1P9YA

Ribosome binding of e. coli trigger factor mutant f44l.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGLRKGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chaperone binding at the ribosomal exit tunnel.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Trigger factor
total genus 32
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1050 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Trigger factor ribosome-binding domain 1p9yA00
2MLYA 2D3O1 1P9YA 2MLXA 2MLZA 3GTYX 3GU0A 1W26A 1OMSA 1T11A
chains in the Genus database with same CATH superfamily
1KVIA 2MLYA 2JLFA 1SQGA 2K3KA 5DO2A 1Y5LB 2IRXA 4QYZK 4Z2XA 4O3QA 2VDIA 4ZVRB 3PRDA 4LT6A 4DCPB 2A6MA 4ZVFA 3SFGA 4YMEA 2MHNA 3LPYA 3T5JA 2PE8A 3MZIA 2IVMA 3PX4A 3PW7A 3MAAB 4NI2A 3RTVA 4M5MA 4TYAA 4C8YA 2OPSA 2PA3A 2J5AA 3NOGA 4DI6A 1LWCB 3O3LA 4QWAA 1YBTA 4USIA 2BUNA 2BQ3A 1KN6A 4LF9F 4ED3A 2XYGB 2N7CA 1YSJA 1TUGB 3VAMA 3CDUA 2R8JA 5EGYA 3CJ3A 4ZVHA 4Y2IA 3LGNA 1XERA 1XNQJ 4CM0A 2YH1A 4UOHA 4C6AA 4PABA 2AMCB 3N6LA 2JVRA 4QU7A 3EVWA 1CJVB 5CZVA 4RUAA 2P5VA 3IR6B 4HEA9 5J2QA 3L7OA 1S9EB 2ZVSA 1SQFA 1TL5A 2X1GA 2C42A 2XMWA 3TWZA 1N6QB 3MMCA 3M1VB 3HHLA 4MJKA 4WFBQ 1VOMA 3U1NA 4NASA 1ACMB 1ZM3A 3PR5B 4E98A 4OMFG 1NK6A 1YRXA 1ZTWA 3DDKA 2E1AA 3M4XA 4RL1A 3PYFA 1PIEA 2HQFA 1HFEL 2OEJA 2U2FA 2V6AA 4WFYA 4I69A 1MU2A 1VR6A 3OXLA 4RWXA 4RWWA 1EP4B 4NYOA 1HA1A 4DN9A 2DRAA 2VHGA 2HHVA 4NA1A 5A6WA 4K4WA 4ZHRA 1IVZA 4RNHA 1W26A 3TJAA 3X1LB 1BC6A 2DHAA 4FS1A 5CD4H 1B7YB 3D5MA 2D9OA 3M05A 3QGHA 3UFCX 1SJ3P 3VGTA 1FWKA 5LMUF 5EWFA 1NDLA 3FEYB 1OQ3A 2HNZB 4KY3A 3RAQA 4KHPJ 4ERDA 2JOQA 2OPQA 1RB0A 4WKRA 3FNNA 3PFEA 3CCZA 2M88A 3DC2A 2BR0A 1EKRA 1G6BA 4FPRA 4AXIA 4DV5J 2D3OR 2DNNA 3H98A 1R43A 1TL4A 2FY8A 3FSIA 2KXFA 4ED6A 1UEVA 3PRBA 5D0HA 1CVJA 2CZ4A 3HK2A 1QAJA 2AW0A 1T7PA 2GJIA 1RHKB 1FXRA 2YWWA 2M0GB 3CDAA 1S97A 2UXBJ 1JX4A 3D1HA 1X4CA 2W2PP 4KPYA 3DXSX 4YQWA 6AT1B 4ZP7A 4IQXA 4F04B 4L3NA 4LR7A 2VKZG 4NLYA 4KJIA 4AL7A 3B54A 2DK2A 1UCNA 1F3VA 1IM4A 2J6UA 4M95A 1Q4RA 5GAHI 5IT9U 1B64A 1RA7A 4ZDNA 4ZKAA 3KLIB 2ZH6A 2FZKB 2VV5A 3TX8A 2DY1A 5KFIA 1Q8KA 4DV7J 2EEYA 2RT3A 3CJ8A 5ETTA 5A8WA 1MWQA 4X65J 2BRLA 3I5BA 3G86A 1U2RA 4EBDA 3C6TA 3AQPA 4QOTA 2DGOA 1D1UA 2XG8A 3ET6A 4GC6A 4V1Ak 3J7AN 3WHIA 4L75A 4ZIWA 5ADZA 1VS3A 4JYAF 4O4GB 4C11B 4KKOB 1KQGB 1JLAA 4D3HA 5LJ3Y 2Y8YA 2CDQA 2P9GA 2L48A 4PR6A 3UN2A 3MR5A 2MY8A 3CDWA 1IBKF 3VVUA 2AEMA 3AA9A 4LF5J 1WDTA 3H42A 2IYGA 1VBKA 2MSTA 3FVYA 1QSLA 3W7BA 3D0GE 3PX0A 3JSMA 2WVEA 3AD7C 4EK2A 2WK4A 4AXJA 4DV4F 1K44A 1PYOB 2ZM6J 4F8RA 2XZTB 1C4AA 4LFAJ 2B51A 2VF3A 4ZCMA 2J0XA 2BZ2A 1FD2A 2NZ4A 2VG5B 2HBZB 1TV6A 1X8DA 2G1HA 2VFTA 2XSJB 3CNQP 5J1PA 1VJQA 5KG7A 4KGVB 4LF4F 2F8EX 4Q2MA 5J1EA 3PX6A 1DQ9A 4ZJLA 2GO8A 1HKAA 2I0XA 1DTQB 5DM6Q 4JI5J 4JI7J 4ID8A 3R9LA 1M5KC 2NYHA 2GJ2A 3AXKA 3K2YA 4J9LA 2GZOA 1TR0A 4DR2F 3FFIB 3KK2A 2H5IB 2BJ3A 1YBUA 4Q45A 3KHHA 3GJSB 5K20B 2W8KA 1R6YA 3E01A 1W2BR 2AWZA 4CO2A 3TOQA 3DRPB 4CLKA 1S59A 2G0CA 4KTQA 5KT5A 1N54B 1P8GA 2OUGA 3DOMB 2ASDA 2ZD1B 2O66A 3MHYA 3MCSA 1R0AA 3CCUS 1TKXB 4LIWA 2NSBA 4Q8EA 1N36F 4F4ZA 4JI4J 2IM2A 2CNLB 4ECVA 2XWXA 1CBKA 1TP7A 4HT5A 3OR2B 5CYQB 2MLXA 3CCMS 1FX4A 1B0VA 4PG6A 4ED5A 2L9WA 1AFJA 5KFPA 2LXFA 1NSQA 2DGXA 3GIKA 2DB1A 2IAJB 1RAEB 1T95A 4R5PB 3CTRA 1W25A 1HW9A 4KBIA 3RUBL 1PO6A 2UUBJ 2FDNA 3MAAA 4NI2B 5E3PA 4LRAA 4AQYF 3CDEA 2UUWA 2YVSA 3F0NA 3WIVA 2B5JB 5LOQA 3TANA 1R8BA 4HI1A 5JJBA 4DR2J 2HNYA 1CJKA 2YWHA 4Q0BA 2QIFA 1XIQA 1FVQA 2MKYA 1REGX 4KHPF 1WEXA 4I67A 1FFSB 5C2GA 3VAHA 4X4UA 1XJWB 5E3AA 2QE5A 4TU8A 2I38A 2RD5C 1T3OA 5DLGA 2EFOA 4ES2A 1UA0A 3MMAA 1JXVA 4WFXA 4PQUB 4WZQA 2R2RA 4P2MA 4M63A 3RBZA 1QD1A 2KKHA 2CXEA 1U0HA 4ED2A 3OL7A 3EZUA 4TY8A 1N34J 2XMKA 2HHTA 1BQXA 2MMYA 5HVGA 4YY3J 5I42B 1YRUA 2AEFA 5D0GA 4KYZA 3O5TB 2E44A 1PKUA 2XSFA 4ZPWR 5B0EA 2PC6A 2ZKTA 1QJHA 2DO4A 1REVB 3P8BB 2DISA 4DPXA 1H38A 1SH3A 1S1XB 1J5EJ 2MQQA 2CZ9A 2DNZA 1M1HA 3EM1A 2FPHX 2JFDA 1RTJA 1SJFA 2WHOA 2IHR1 3OR1B 1DBDA 1VJWA 4KR0B 3TUJC 5AXNA 3TX0A 1XC9A 2CKWA 4LBPA 4XDDA 4OX7A 1QDUB 2B4OA 2CQ3A 3PACA 3DLEB 2MZQA 1CS4B 2YH0A 4QW8A 3GIIA 3D68A 3DYAB 2OIHA 2UVUA 4F3OA 1RTDB 2Y1RI 1S79A 2C2ZB 2D74B 2D3O1 5FJ4A 1N5TA 5J2NB 1Q8BA 2RS2A 4FNHA 2D3UA 3IM8A 1Y10A 1EIYB 3D6MB 2YPZA 4USTA 2Z57B 5KFDA 3H20A 4L73A 4XTTA 3QJJA 4CH7A 1MLAA 1N5YA 2HHUA 4R25A 2BQUA 4N76A 1F2GA 2CA9A 1LV5A 4P74A 1ZPWX 2VFVA 3DDIA 4FXWA 5AE1A 1NH8A 4LF6F 3OHBA 2DGWA 5LSLA 4G1PA 2MJUA 4C3MA 4DCJB 2BE2A 2OO4A 1IR0A 2ZITA 1EKSA 2E29A 3M2VB 2NXJA 5F8LA 2FD2A 1NPKA 3A1YG 5KFCA 4XPCA 4ZVSB 2NUUG 1AUSL 5FIIA 4CT9A 4HYKA 4K2XA 4CIOA 4ECSA 1TKZB 4NXNF 3FCVA 2XNQA 3LGMA 3T5LA 2DR9A 4HKQA 1S10A 4ZVTB 3J80Y 3A3NB 1DLOA 4ZCKA 5HLFA 4X66J 4YUDA 5I3UB 1QAIA 2XMAA 3GTYX 4CLWA 2AKWB 4JI8J 1IBMJ 5KFNA 3CD0A 3UN3A 1VQ5S 1QVFR 3H4DA 2ZJRQ 5AXMA 2RRBA 4KAIA 2KRBA 5K8MA 1KR4A 3G6VA 1CLFA 4RW9A 2OPRB 5T41A 3HVTB 5EWGA 3UCZP 4PUOB 4DWIA 5IFMA 2V8GA 2I6WA 3ELHA 4ZITA 2I5JA 3I9V9 3DRYA 2V4RA 4Q43A 1HBNA 5HJYA 3POTA 1FDNA 1FT8A 1FDDA 2ZEJA 4G65A 4NLWA 3MUVP 3LWLA 1U09A 1RT2B 5DJBA 1LWFA 2CQ4A 2Q79A 1WEYA 3BQ2A 3G9CA 1BGXT 1WHVA 1APSA 1TMMA 3C6UA 1FJ7A 2QFJA 2RRAA 3DM2A 4Q0BB 1N8RT 1RBAA 1S99A 1QSSA 3FCWA 5D4OA 2MDAA 1OYDA 1RXOB 1U24A 1V5VA 3RAMA 2DRDA 4LF7F 1WOSA 2HWIA 2I1RA 5HN0A 1X5OA 2VZ9A 5BJRA 2ZH9A 1VQMS 4JI5F 3H5UA 1Q78A 3I4PA 1CC7A 4IG0A 4DQPA 2HVEA 3DOMA 5ETLA 2R7SA 3W62A 3A3PB 3IO1A 4USVA 2Q6BA 2BBEA 3T9ZA 3E01B 4GO5X 5HATA 2LVWA 1IJEB 3BBCA 4DFJA 4RW7B 4K5RA 5IOLA 2IAJA 1N32J 4ZVQB 2QFIA 1CJUA 3MUTP 3UDEA 4P2XA 3J81j 1IBLJ 1PSDA 2YKAA 3FC9A 3LP2A 5CYQA 3ZTRA 5BXIA 4DUYF 2XEXA 2B0GA 4UQGA 2EK6A 4ZVPB 5CCMA 4IRKA 3G4SS 2CPZA 2DIUA 3OFHA 3Q23A 2VICA 1HPZB 2D1CA 3H90A 1JIHA 4CH1A 2EFNA 2ABYA 2DTJA 2E5IA 2XY7A 5KFQA 2ZH4A 1WUUA 1Y3JA 2BJ7A 5E5NA 3SIPB 3MR7A 1F2HA 3E2EA 2QA1A 1SQEA 3H5SA 1C1BB 3KNGA 1P1TA 5KFEA 5IQ6A 1VRUB 3HP6A 3FFIA 2DNHA 4NX9A 1K1SA 1KS2A 3PY8A 1UVLA 1NB2A 4NRTA 4DR6J 1BUXA 1ZM9A 3JQJA 1NU4A 1RWWB 4DPOA 3BS9A 1U0SA 5KT6A 2OTJS 3IFEA 4HHJA 3N4WA 1VQKS 1S1TA 5CHCB 2F63A 4L6V3 4P71A 4PAAA 3DHWC 3HX9A 3KK3B 1XMQF 4G3IA 1G3OA 2VG5A 3V6DB 1P9QC 5KG6A 5DQIA 4B9NA 2VJVA 1RT2A 1RP5A 3DOKB 3R8YA 2N82B 2YWFA 1RUSA 2A3JA 1VQ4S 1FDBA 4WP8A 3GIRA 3JB9k 4OI2A 3THTA 5ETVA 3TJ9A 1JQGA 2ACYA 3C6TB 2L08A 2G2YA 2DNPA 2GIRA 3ZZUA 1VC6A 4ETXA 4F4KA 1RKIA 2WONB 3VAKA 5CD4A 1I51B 1NBEB 1S7HA 4F4WA 1HNIA 1E6YA 4KIAA 4DZ6A 1VQ8S 3QQCD 3Q0AA 1Q95G 2ILZA 3PCOB 1NSPA 5ETOA 1TL3A 4KPCA 5IT4A 4LRDA 2R2SA 1NKBA 1PJ6A 3PEJA 2R8HA 3NGRA 1WACA 5GAEU 2MZTA 2JLGA 2FB0A 1NZ8A 3DLJA 5DZ6A 1VGYA 4O3NA 3HD1A 2BM0A 2ROPA 4I64A 3A8KA 3O44A 3W65A 4ECWA 1X4EA 4C97A 1PYSB 4GVLA 4L72B 1HQUB 4DSFA 4DPWA 4USMA 5ITHA 3OL9A 3NS7B 2FJDB 4QR0A 3KLIA 1SC3B 1JLFB 4CT8A 3PZPA 4J9MA 2YNIB 4N8OA 3HSDA 5B08A 2ZE2A 1VFJA 1KNZA 2VASA 1G4CA 4OJGA 3DI6A 2ZNZA 2E5LF 4CCHA 4NCGA 2W01A 4LFBF 4DV3F 1FKOA 3DOLB 1HWKA 5A0YB 2DNYA 3K5NA 3M6UA 2HHHJ 2LEPA 2CQCA 4UW2A 4ECRA 3KTQA 1KWMA 1AROP 5L46A 2PA8D 2KI2A 2E1RA 2YNHB 3HULA 4RU2A 2YQ0A 4LBHA 2RSQA 1V6HA 1HARA 3GB0A 3CD7A 3GONA 3IR5B 1KQFB 1AZSB 5KFKA 4EZ9A 2VU5A 2AJ4A 2E7WA 4M1KA 4TVAB 3UD5A 2V67A 3ULHA 4AE5A 4CI0B 1N4LA 1V5IB 2LDYA 3HSGA 1T05A 2JEGA 3CJTA 2LLZA 2PI4A 2XGQA 3Q8QB 1O6XA 4L74A 4URQU 3P6YC 3GIMA 4FPIA 1UP1A 2VBXA 1Y11A 1YJUA 1QTMA 2R3VA 3KUHA 1UVJA 4WZMA 1RT5B 1KONA 3OTCA 3R7NB 2BJ9A 4NCAA 2HQIA 4F4YA 3IAS9 4LR9A 5KOXA 5DG8A 3Q89A 2WOMB 3D7SB 3GYNA 2GCFA 2PIIA 3K17A 4A8QA 2UUCJ 2EXUA 4C8LA 2VL1A 2L9DA 4M5IA 5D3GB 2W9BB 1N6QA 4KV8B 4A8WA 2IY5B 2JEJA 2FHJA 1F9HA 2Z2MA 3C66A 5J2QB 3WQPA 5GAEI 3BREA 2V68A 2EFPA 4URSA 5KFHA 4R0JA 1LFPA 2OLWA 4EU0A 2CQBA 3H5XA 1UPMB 4N8NA 2DRBA 1OIAA 2NQPA 2F3JA 2Q66A 1RTHA 2G2OA 2F1FA 1XTZA 1BY9A 4DU7A 3W9IA 4K4XA 3NGKA 2GMLA 1CJKB 3RB3A 4NLDA 3Q8PB 1M0SA 1BMQB 4I4BA 3E51A 3MM9A 2GMHA 4BC7A 3CCWA 2UUTA 1U26A 3RJMB 3KHLA 2LECA 1KLNA 1QE1A 3HSJA 3VAJA 2IJRA 3UD4P 4OLPA 3QJLA 3NCRA 5CXTA 3GPAA 1GMUA 1SJ1A 4IOCQ 3ISZA 2XS5A 2F8MA 5GVQA 5AJ3J 1TMJA 2CG8A 3CMQA 3ILLA 2G2ZA 4GVBA 4DQQA 2G13A 4FP9A 5HI7A 3TZWA 4U7CA 3O8WA 1T03B 3DI6B 2UU9F 4PG4A 5KFYA 1TFWA 2HBYB 3DKDA 3I96A 4ICLB 1RHQB 2DXFA 4DFPA 3V81B 2OJ3A 2UXCJ 2C22A 3OUYB 4QBUA 1AXQA 3TAMA 3PKYA 5CQGA 3LGHA 4AFFA 3PRVA 2PFDA 1HMVA 3VAGA 4WK3A 3W9JA 2VQFJ 2RDJA 2DHGA 2K1RA 1YKWA 3IMQJ 5RUBA 2QA4G 2COLA 4DUZF 2DNLA 1VC0A 2XZDB 4OZ1A 2J7UA 4I2QB 5BYQA 1IXKA 1FRLA 4ZPVR 2HNDA 4Y2AA 4MK9A 1N0VC 1HQ2A 2ZE2B 1H2VZ 3QGGA 3VQSA 4PG7A 4WFZA 3LW5C 2KFYA 1T9XA 3AJ1A 4K4TA 2VG6A 3C15A 3ISND 2YNIA 2JX2A 1RADB 4OJHA 4F67A 3EJMA 3HJFA 3NXZA 2VFSA 4X64F 2R7XA 4TN2A 3MR6A 4TU9A 2LQ5A 4BC9A 3G6XA 4DR5J 5DGAA 2DR7A 3UDCA 3RRHA 1N33F 1UETA 3D6TB 4ZCLA 4EGLA 2DPIA 2W7OA 2MSSA 2QSFA 3LUYA 2IJNA 3N5BA 3D66A 1V3ZA 2J8SA 3M8QA 3NLCA 3LP0B 1RDRA 1VQSA 4J9VA 5L38A 3DLBA 2DY9A 5KT3A 3HM9A 1NK5A 5DETA 1UJ6A 1WKKA 3JQKA 1N56A 1Q8LA 1UJ4A 3WDOA 3G87A 1MWZA 4YR0A 2MKCA 2HIYA 4Y3CA 4JI6F 2YX7A 4C0OC 3UR3C 2DT9A 1NXIA 4X4NA 2KT3A 4U95A 1RWXB 3MPVA 3KLEB 4FYDA 2QLBB 3MXHP 2W24A 5E7OB 2OSQA 1KDNA 3JAMU 1FESA 2V94A 2ZWPA 2HWTA 1XNRF 4MAKA 4X4QA 1TL1B 3MUMP 2ZKUA 1RT1B 1WC0A 2QYCA 2PMHA 1MW7A 4O4RA 5C25A 3PW4A 1TKTB 1IKVB 5IM0B 1ZAXA 2XHWA 4LMZA 2V4JA 2AJFE 2BMBA 2Y1LB 3MD1A 3AQOA 3MEGA 3ZXWA 5BR8F 2QLWA 4JBCA 1WHYA 4N56A 5LXYA 3DLKA 4CTAB 5B0CA 4PWDB 2J7WA 3M2RB 1HIYA 1XR5A 5C5JA 2EK1A 1RWVB 3M8PB 2RQMA 5KFMA 1D9FA 4AT1B 1SIZA 4QWEA 2VD3A 3B6BA 1S1TB 3W2VA 3L3CA 2FVCA 1PAEX 3IWLA 4DV2J 5G4DA 3VGUA 3LH2S 3LP2B 3FSXA 1T8EA 1BQNB 2IIHA 4A4JA 4CLLA 1S57A 3EX7B 4KRWA 2CPDA 1X0PA 2E66A 2H4WB 3OTBA 2M70A 4RKUC 3RRKA 4ED7A 3V4IB 3ITHA 2KM8B 1FNMA 5F8JA 4TU7A 4DX5A 2XMJA 4HDGA 2IM3A 1KTQA 1LOUA 1FCAA 3T1YJ 5GAGU 2F4VJ 5CH7B 1LWEA 3PO5A 5HQMA 1OSDA 5BYSA 1GQEA 2WTFA 2MZSA 2HHQA 2EFQA 3L95X 2RMLA 3CWJA 2FIUA 5KFOA 3CCSS 3EDQB 3MMBB 1YVFA 3SCIE 2CRLA 3HHLC 4RNOA 5HVFA 4ZMMA 3DGVA 2JEFA 5HP1A 4YDDB 3OXGA 4C2MA 4PQUA 2RE1A 1N52B 4ZHRB 4EYHB 2DH7A 2W8LA 2EG2A 1RA6A 2APOA 3SCLE 3H5YA 5IWAJ 4PXBA 2XLJA 3SYZA 1F0XA 4FYXB 2GC8A 3P45B 2LP4A 2E9ZA 5JXSA 2Q1LA 1IJFB 2RKIB 1FRIA 4Q7AA 3HDSA 3ZZZA 1XK8A 2V0NA 2ADCA 1YWXA 2XO7A 5AJ3F 4Y2KA 1T3NA 2DNGA 1NUEA 2CWKA 4YB5A 2WBRA 4I1TA 3VWSA 3TZXA 4IR1A 4KO0A 1EQMA 3NNHA 3MMBA 3KLGB 1S1VB 3ICLA 2UVRA 1KFSA 3CC7S 2YNFA 4DBQA 4ZLLA 4R0EA 2ZOFA 1ZAWA 5I3UA 1L3SA 1TU0B 4LBIA 1CEZA 3BGOP 3TR5A 1U1LA 4JI2F 2MYFA 4B3OB 3M2RA 4A8KA 5IXUA 1UEKA 1XR6A 2XCAA 4WU3A 1SIWB 1UL3A 4RZRA 2H5JB 4U96A 4UT4A 1WG5A 2XTJP 3CF5Q 5HVHA 4NLUA 4DL4A 1FO1A 2NPIA 2ZNYA 3DLHA 4PEOA 4FXDA 4OV6A 3L7UA 8RUCA 5IT0A 4QR1A 5LL6d 4HL9A 4CM2A 4OX9J 3NL0A 3PO4A 3MURP 1BD6A 2HS3A 3GYGA 1FX2A 1QSYA 2GQQA 1X7VA 3H2LA 4IKAA 1GXTA 4HI2A 3KJQB 5K8PA 2ZH1A 2IMWP 1UFLA 1X4AA 2JC0A 1GAOA 4WBFA 2CQDA 3PJXA 4J9OA 4N5SA 2GVZB 2QGFB 3AH6A 4C4WA 4MYTA 4OYXA 4PXCA 1TQLA 5KFUA 1VBYA 1EB0A 2MZJA 1K73T 1GXUA 2E1MC 4P9SA 2RUGA 4PYAA 4DXLA 1YITS 1HLWA 2R2TA 2HVHA 2ZZNA 4EZ6A 4PZVA 1JXEA 2F65A 1XMQJ 2VBZA 3KXDA 1PC4A 3I0SA 4WP3A 5LSOA 3WC2A 4EO6A 1FI4A 4Y0FA 1KLMA 2OELA 5SZTA 3GP9A 5GMKa 4WYWA 1WOPA 1JNRB 2JWNA 1UVMA 1HI1A 3VGSA 9ATCB 3JXOA 4DCOB 2X3GA 3K7RA 3P5TL 3TVKA 3VF0B 4QZVB 2L41A 4DSIA 3UN5A 3EGVA 3BSCA 2FJWA 4RPFA 5CABA 4WCEQ 3ZNUA 4A8SA 2KB2A 2K2PA 3UI3A 1YHQS 2HFNA 5B0DA 2CPXA 2QN6B 1N5YB 2C2RA 2DNKA 2LDIA 3OW2R 2AIRB 3G8SA 1MROB 1U47A 2CYYA 4PG5A 1U4BA 1RYSA 5J2MA 3M6WA 4C8ZA 2CQ1A 5E33A 3KUEA 3RGIA 5IZHA 1HR0F 1YTYA 2ZOGA 3BO2A 3LP0A 4JI1J 3OBIA 3M8QB 2QLFB 1RWMB 1TUVA 4RO0A 1TKZA 2DGSA 1U2CA 2P6TA 5DS7A 4K50A 1MWYA 2VFUA 3MM6A 4AUKA 1GNKA 2WSFC 4F26A 2F7VA 2NYIA 3MFHA 4AL6A 3T1AA 5HJXA 3KUGA 4IFVB 1J5OB 4QYZJ 3HHLD 5LMNF 2IMOA 1HBMB 4DS4A 5LXRA 1NRKA 1YDLA 2F9DA 4R8UA 1S76D 2OMLA 1YLXA 1NJWA 1REVA 3Q24A 2W4DA 3H0PA 4ECTA 1MG7A 1X9SA 2AV5A 4WXWA 2R4FA 4KFBA 5A6PA 4LFCF 2QC3A 4S0MA 3G8TA 1RWKB 2E5JA 1EAYC 1S49A 2V8VA 3N28A 4P52A 4A8MP 2KXNB 4E2FB 1W7WA 2DH8A 2Q6CA 4A47A 2FLLA 3QT5A 2QL7B 3O1LA 4ZLPA 2YKMA 2C3PA 5E0OA 2C28A 1RTDA 4ELVA 3GFHA 1S6QA 4C98A 3NWGA 3EVMA 3NNCA 5ETKA 4JI3F 4N77A 1H0HB 4RBVA 5HANA 3HCXA 3NBPB 4Q44A 3KJFB 3C46A 4WF9Q 3CCLS 3LOUA 2NUHA 3U27A 1VBXA 4QIWD 3SCJE 3U7JA 2OKQA 3VAIA 2VONA 2HNYB 1HWLA 3U02A 2A6OA 4YN3B 1HHSA 4X4TA 3LAMA 2MXYA 5D6GA 1RLDA 2MQLA 2W2NP 4LSLA 4X84A 5KT7A 3G8QA 2DJWA 2DYAA 3CEDA 2P8IA 2DXDA 3LA0A 3NAHA 2V8DA 1PGZA 3BKUA 4JOUA 3AODA 1YK9A 4NLRA 1NB7A 4BLGA 4Y28C 4J9RA 2IBOA 1FEHA 1RU1A 1PG5B 3KK2B 2MJNA 2QO3A 4L3KA 4OZ3A 4O3OA 4YB1P 5JVHQ 2ZH5A 3U1MA 4C3LA 1S9GA 2HS4A 2P6SA 3HSZA 3Q83A 5C42B 2VB6A 3M32A 5D77A 4F0HA 5GMDA 2A2CA 3R6LB 3P4UB 1DTQA 3GLJA 3W61A 1FKAF 1IQZA 3MEEB 3AOAA 4DLEA 3MPDA 1TKXA 5F0WA 1IKWB 2KDOA 2VC1A 2FQQB 2YWGA 4RBTA 2R7QA 1L5UA 4ZPBA 2JL9A 3RW7A 2DHXA 3C14A 3R3TA 4WIQA 4KV8A 3B8HA 1QUVA 1JLCA 2XLIA 3DRPA 5T14A 1T05B 4M5DA 4ANDA 2D3ZA 1NZAA 2DD8S 5F8MA 4WWSA 4DG1A 3VV2B 5E3RA 1C0UA 2N7YA 4RW8B 1YI2S 5H9FK 2YBVA 4JI6J 1GK8A 2VUGA 3QFWA 2IPOB 5A8KB 3KFWX 5KFRA 5J2PB 1EETA 4ZPCA 1B70B 1Q5VA 1R89A 2VC0A 5I3QA 3FDSA 1HNZF 1RLCL 2R2UA 2XGPA 1WC4A 4EMDA 5HP1B 1FKOB 3DOLA 5D8HB 3MCMA 4X62J 2IDEA 3G82B 3P3DA 2HLTA 4NLGA 3MM5B 1Z2ZA 4KHMA 2HFVA 4TLQA 5ETPA 3ZTOA 2MZ1A 1JLGA 4F2RA 1H3DA 3JQMA 4RUBA 1I94F 3R5AA 3T9NA 1R0AB 2H4YB 2KTQA 1HHQA 1VMBA 3D0IE 3QIPB 1IR2A 3DMJB 5CYMB 4NLPA 4X65F 4LF7J 2UXDJ 4FKXA 2NXNA 1HBUB 5EX0A 5DG7A 5DG9A 1Y3KA 2VA2A 2DBBA 4OYBA 4LF8F 1UJ5A 2BJ8A 3A3OB 1NJZA 4DMZA 1VK3A 4U7UD 1RTIA 1U02A 1ULRA 1RHJB 2JNJA 3BSNA 4YB6A 2HQDA 2CQPA 2MQNA 5LT5A 2DPJA 2HGMA 1F5CA 1C4CA 1TELA 2RJZA 4CO5A 4CYUB 2R7WA 3FGVA 2ZDPA 6FD1A 2KJWA 5KFFA 3J7A1 1M1GA 1IM6A 4OI6A 2I8EA 1Y4ZB 3OL8A 1BQMA 4OIXA 4DV0F 1HW8A 4XAKA 3EYZA 2FYXA 2GS8A 3SQGB 1R8HA 3D6HB 4CDIA 2BE9B 3UE2A 1E6YB 5BR8J 1AUDA 2MKSA 1MSWD 1IKYA 2U1AA 5F8GA 4OJ3A 4MKAA 3MPYA 2WONA 4TQRA 3MEGB 5DDQC 2Y3YA 2JC1A 1M1KT 3NMAA 3V4IA 5DQGA 3W5ZA 4B17A 4ATNA 4PRFA 2FLNA 2AJ2A 5C25B 3ZZRA 2IC3A 2KHDA 3A4TA 3PYDA 4X66F 3THVA 4YR2A 2FHOB 2JEIA 4X2BA 4GKKF 3M30A 3R2CJ 2MKHA 3KYLA 2HPUA 4URGA 2QMWA 1X4GA 3BR8A 3DRRB 4ZIVA 2IA6A 4BBYA 1V9OA 2UXCF 1G2EA 4USWA 3QJPA 4J91A 4J9NA 2IA0A 1LEOA 1OY9A 3BYPA 3VHQA 2LEAA 4ENOA 3CMES 4HVZA 2GV1A 5D15A 1K0VA 2IC3B 2KT5A 1IKVA 3JTNA 5IM0A 2Q3PA 1JLQB 2BKPA 3ILIA 4FZVA 2HAIA 1FRXA 2RHQB 4MIAA 4NEZA 4MTPA 3J81U 1F5AA 2HK2A 2Z8QA 3MPUB 4NE9C 3SBMA 1SH2A 3M9OB 1TL7B 4LQ9A 3THPA 1JLGB 3CJ0A 4AD6A 3J7Z5 5GMEA 4DR7J 4LF8J 2DNQA 1D09B 2GMJA 3GJRB 3LANA 3VAFA 3P5BP 3MOZA 4MK8A 4U8VA 2KN4A 3A8IA 3CJ4A 3PTWA 4P2SA 2H48B 1VQOS 1GMVA 4K5SA 4OYIA 1GMWA 1U1RA 2Q43A 2FTRA 1NLKL 5EDWA 5M2UA 2H5EA 1PJ7A 1WKLA 2Z2YB 4Q5VA 4OYZA 1Y9OA 2A18A 1UAWA 3K5OA 1LWCA 1OPZA 3MMCB 2KH9A 1HI8A 2H9ZA 4PPDA 5FLXY 2BJ1A 4WTYA 4N47A 1JNZB 5HMYA 5KOWA 1IQTA 3QMQA 4NA3A 1OYEA 2XLKA 2VQEJ 4FN5A 3QRRA 3SQGA 1X0FA 1KSPA 2BJEA 3RR7A 2YY3A 1Q81T 3CMAS 1BQMB 1IKWA 1LK7A 2B43A 1CQNA 2IDLA 1KTVA 3TJ8A 4EWTA 5C2CA 1YJ7A 3BO3A 2KT2A 4XK8C 2D41A 5K5MA 2XHCA 2HZCA 3BF4A 3IAM9 1X5PA 4MKBA 4O0IA 3B4DA 4CZCA 3FBEA 4B9SA 4JV5J 2RUSA 2VIHA 3PHEA 3KDNA 2CQGA 4Q2LA 1ZZFA 5EUHA 3NWRA 3FJ2A 1SJ4P 1D8ZA 1PJ5A 2ADBA 3I5CA 1N33J 1MU2B 3MOJB 4DSJA 2R7VA 1JMTA 2C3UA 1G7CB 1QE1B 2IVFB 1VIOA 4ZA1A 3HKZD 2J9CA 1FDAA 2WVFA 4QYRA 5CYMA 2RQ4A 3EXCX 3CGIA 3FBCA 4DR7F 2ZHOA 2HMIA 2NLWA 2NPFA 2OPRA 4M8LA 2GQCA 2QRRA 3H7HB 1URNA 4J9UE 4ES1A 4OI0A 1NKEA 1L3KA 4PKDB 3BGFA 3QAEA 5IQQA 1TK5A 1T03A 3NBPA 3P96A 1F6TA 1VQ7S 1B3TA 2KL8A 1SUQB 2QJ3A 4WJBA 1KHVA 2GO9A 3WIUA 3GCXP 5A8KA 4DV3J 4DL7A 3S01A 2AGOA 4LF6J 1N0UA 2C3YA 4BCAA 1O51A 2Z4PA 1C0UB 2OHDA 3DRSA 3BGUA 4NLQA 3HLUA 1E6VA 2A10A 3AJ2A 4ALZA 4DG1B 2YKNB 2W9BA 4Q8FA 4TY9A 3TYTA 4B02A 2DNOA 3WZ0A 7AT1B 1OPIA 1YJRA 2HFSA 3MEDA 3OSPA 2CNKB 2EKNA 1AFIA 1SVDA 3GG1A 4NLXA 4UUXA 4JB8B 1XMOJ 2AHOB 3GFYA 3RW6A 3PHTA 1HD0A 2OMOA 3AXMA 2NR0A 1GXLA 5JMNA 4EYIB 3TQEA 1RT5A 4HR2A 3SCKE 4IDKB 2E1PA 4KB7A 3KLHA 1N88A 3PW2A 4UZBA 1XMBA 2RIJA 4IFVA 1KVKA 2WW4A 3S6EA 2ZHBA 2QMXA 3ONQA 4JI8F 4Y65A 4YP3A 3TP2A 4NXNJ 2H1YA 1T9YA 1UTAA 2CIMA 1HNWJ 3US5A 3H25A 2DEJA 3KG1A 3IRXA 1DZ5A 1FKPB 2FVPA 2ROGA 4ZVOB 2PEHA 1X5SA 2BW2A 5D78A 2AZ3A 2FHKA 3M2VA 2ZJPQ 3AT1B 1YQHA 2AEJA 5H9FJ 2F9JA 4MH8A 4P75A 3LP1B 4PCQA 4FXVA 3JYTB 3T41A 4ECYA 3I55S 1SCJB 1UKUA 3FRZA 4U67Q 1VQPS 1U1PA 4LFBJ 3CD5A 3I4HX 3SZ2A 4G1QA 3L7PA 1RTJB 3QSIA 4MIWA 4CO4A 4Z7YA 3D3CJ 3AB2B 3I82A 4OYOA 1X4BA 4K7QA 3LP1A 3N5FA 2KRRA 4C8NA 3SSRA 2W9CB 4LIRA 4IG3A 5IV3A 2BACA 4J90A 3D2WA 4Y2CA 4JP8A 5DZ7A 2M8DB 4HACA 3IBFB 3BKTA 2XO6A 3UO0A 3QLHA 2F4FA 2DR6A 2YNHA 2MB0B 5CA5A 3MM6B 3N6MA 1D3WA 1UFWA 1I5OB 1IBKJ 5F3TA 5I42A 3UW1A 3NGUA 1S6UA 4I6YA 2M2BA 4JV1A 1FRMA 3I87A 4BWJA 3LPEA 1UA1A 3OVBA 2QTWA 2JRSA 3IC1A 4DL5A 1LNQA 2CG4A 4FYVB 1U8WA 4B9LA 3DU5A 3SDEA 2AJ0A 3TEGA 2LXIA 4QWCA 3H40A 5AXLA 5ETMA 3BGLA 1HQUA 5F8NA 2CNOB 2EVZA 3BPDA 5E3QA 3BDEA 4K0KF 4KGXB 2YKNA 1DHMA 3JSRA 4KGZB 2R8IA 1E6VB 1U0HB 1RU2A 4WK1A 2HGNA 2WVBA 5C24A 2E9TA 4B3RJ 2HHSA 5K8NA 1ITPA 2HK3A 3I0RB 3PVXA 1FNXH 3BYRA 4P2FA 3NS6A 4P73A 2Y1IA 1YZ7A 3ISNC 3PYEA 3X3UA 5J2MB 2OH2A 3DOKA 3EUNA 3KLFA 1VQ6S 5U47A 2ACMA 2IM0A 4P7TA 4ZN1A 3MTKA 2AGQA 2GAGC 3SSQA 3TA2A 4RNFA 2C2NA 4NZ0A 3TNVA 1V3SA 1N5VA 2BW7A 2LXUA 2XMVA 1B0PA 3BGRB 1S4EA 1RSCA 3BKFA 3CB4A 3R7SB 4JI2J 5B0AA 3BO4A 4B3TF 4TYBA 2EW9A 2BABA 4YHHF 2C1EB 2F5GA 2B5JA 3DGPB 4OHVA 1NHKL 3Q8RB 2JHEA 4O44A 1GTHA 2P9CA 4OHZA 5HL7Q 3DRXA 5FDLA 3DU6A 5A2QU 3KK1A 4CLPA 1C1BA 4ZLNA 2HURA 5T7LB 1VQLS 1WHWA 1NO8A 2CNNB 4UZCA 1KOOA 2HHPA 2YNGB 3NY0A 4F0KA 1U7LA 1WF0A 2NXCA 2J6TA 4B9MA 1PYTA 3RB0A 5EN1A 3EDRB 4ZVEA 3HZEA 4TLRA 1ZM2A 4V19J 1S1VA 1U25A 1S6PB 3N79A 4ZP8A 2YNGA 1XEZA 1IR1A 2AYEA 3TVZA 1D0EA 3C3LA 2X1FA 3CO9A 1TK8A 4ILRA 2FLPA 2AX0A 3NCQA 2GGPB 1RACB 3QFHA 4RBUA 2DVIA 3RB6A 2M3DA 4UOGA 2YQ1A 1IWAA 3D4JA 3SXLA 1VRQC 1NK7A 2OSRA 4I56A 3M6VA 4DR1J 4K4YA 5D0EA 3KWMA 3I5AA 4B3OA 5DRKA 4OFZA 3ZFVA 1SKWA 2V2QA 4B3SJ 3FUYA 1G1XA 1BWEA 3FEXB 2XI2A 4ED4A 1HD1A 3Q8UA 1R31A 4ZVUB 2UVVA 4WFNQ 3C6UB 3VCDA 3W63A 2SXLA 4ANCA 4C0BA 2MLZA 2FJBB 4TXSA 1N34F 4PWDA 1VI7A 3OVSA 1YJ9S 5EWEA 2RVJA 4C11A 3FKBA 1WTFA 3GR1A 4J9PA 2RKIA 3FZBA 2ZUAA 4WE1B 2PD1A 4L76A 2W4CA 4ECQA 3GYXB 1LWEB 3MAHA 2X3DA 4EUVA 3OTEA 3JSMB 3HD2A 1H72C 2B4UA 3HI9A 1R7IA 2AYBA 4LUBA 4GC7A 1KC8T 1IWGA 1JB0C 4DUTA 2B56A 4U7UK 2O3DA 4O3PA 2DEIA 4IOAQ 1QUPA 2QL9B 3BGRA 3MECB 4DOZA 3NCPA 2UV8A 3HF5A 3W8PA 4F36A 3TAPA 2WVDA 3ZZYA 1N32F 2UP1A 2HS0A 1RISA 1S48A 1YZ6A 1LWFB 1VK8A 2B9XA 2YKPA 3AFGA 3W2VB 3I32A 3M30B 3K5MA 2J9DA 2ROEA 3OPKA 5HLFB 3TO8A 5IS2A 4Z37A 2J76E 5KT2A 1U45A 5KFSA 4NXMF 2PEBA 3POTB 2FUG9 1FK9B 5C24B 8ATCB 4I7FA 3IS9B 1A7GE 1NMEB 2B7CB 1ROFA 4I6WA 3R27A 4P6QA 3EZOA 4W92B 3NG8A 4NYPA 2GW8A 2QZ8A 5A8WB 3K0JA 2WZ1A 2XYPB 4CLUA 4JUZA 1WC6A 4OYMA 4RW9B 2JDJA 2V34A 2B7BB 2LMIA 5B0GA 4M5NA 1S0VA 1WOOA 2J9DE 1FJGF 4MMOA 1Q86T 3HVAA 4HACB 1S1WA 3BH6B 1W2IA 3FRYA 3CVKA 1K8AT 2VFRA 2XNRA 3NOCA 3QGIA 1H2TZ 2UXBF 3W5XA 3DHXA 2HNDB 3M8PA 4ZP9A 1U1KA 1RWOB 2JZ5A 3KLEA 9RUBA 5KG5A 4FYYB 4XPEA 3CC4S 4P72A 1WSVA 4CNZA 1LFWA 5AE2A 1NPPA 2KVQE 2E7XA 4OQJA 2G1DA 1VLOA 2PSZA 4B3RF 3G71S 3W2WA 2HAFA 1OSCA 3EVOA 1K1QA 3FMWA 3N9UC 3HHDA 1RT3A 2BE2B 2B9WA 2E1CA 2MHEA 3PV8A 3T5KA 2NCKL 3HFVA 2FZCB 1C2PA 1MMDA 3KG4A 3V2UC 1WKJA 1M5HA 2W2QP 3ZTSA 5DM7Q 1T0TV 3R1HA 3G82A 2EC0A 4B3MJ 2YTCA 1X5TA 2NS1B 1NNDA 1X31C 2J0WA 4OZ2A 3IXQA 4OYWA 5KFVA 5F8HA 1QAXA 3R5JB 4RNMA 1UMJA 4NOHA 3K5PA 4QPTA 2ZZMA 2AX1A 4JI3J 1X4DA 3CDBA 4DEZA 3RAXA 3ENAA 3QT8A 4DV1F 4W90B 2P9EA 4X4RA 4KC5A 5IV4A 1T9UA 2B8PA 1CG2A 3WX4A 4ZCIA 1WC1A 2N4CA 2OFHX 4I2PA 3T3FA 1HI0P 4WKYA 1Y5NB 1U6ZA 5HROA 2VA3A 5F41A 4YS2A 1KBRA 2LQJA 4DQIA 1ZA1B 1FD8A 4USHA 2OPSB 4F3MA 2N3OA 4DSEA 2G0JA 2LQ8A 1F3FA 2DITA 4ANEA 1Q8IA 1SC1B 2HBRB 4OHXA 2W9AA 3TUPA 4DS5A 1FRKA 3W1YC 1SKRA 3OUYA 4CLZA 1NM2A 2W7AA 2W1BA 2XI3A 2A2DA 3I56S 3DDNA 1S1XA 1IBCB 4USKA 3ZC4A 1F9FA 1DJ0A 2V2ZA 1IKXB 5I4MA 3GILA 5LMNJ 4LF9J 2CQ2A 2AZ1A 2BA9A 2O01C 2OEKA 5A2QY 4DL2A 1AYEA 3E3XA 4KH1B 3OL6A 2WSCC 1JJ2R 3BDPA 2HHXA 1XNQF 3T6JA 4B3MF 3RR8A 4DV5F 1FFWB 1U1MA 1SC4B 2CAJA 3UQSA 1CJTB 3HT3A 5L1LA 1JJ4A 1AW0A 1NJXA 2K3IA 2BEFA 5GADU 1NKCA 1M90T 2NZCA 1NK4A 4IYQA 4ZP6A 2PMZD 3HMJG 3SV4A 1VISA 2YX1A 3MMAB 3J80U 1K9MT 5KFXA 4DV1J 1U1NA 3M6XA 2V5HG 4G1IA 4UOFA 5KFWA 1FJCA 1RAJA 2F8HA 2GHPA 2LYVA 5IWAF 1NK9A 4IQMA 1UZHA 4DX6A 1J2VA 2CPIA 3GFXA 1RTHB 2EI5A 3D54A 3T1YF 1TK0A 4IRDA 3PIPQ 1IKXA 1LXNA 2VBWA 5KAKA 3TUZC 4DQSA 1S77D 2E9RX 1RYRA 4PXDA 4Y6IA 4JI0F 3GU0A 3ILOA 4LF2A 4DV6F 2HMIB 2JVOA 2V2KA 5KG3A 3QBCA 3T5HA 5KT4A 4RW6A 3R5GA 1DFDA 3TI0A 3PXGa 4DX7A 3UDVA 5I3PA 3UPFA 2IM1A 3AB4B 3J7YU 4ILLA 3OFFA 4DZDA 4ES3A 3TEHB 2XMMA 4FYWB 4E0DA 2WBMA 3UVJB 1WF2A 1YX2A 2FC8A 3JTOA 3MGJA 4J5OA 2VH7A 3PW0A 3HHKA 4PXEA 5C7PA 1IN0A 3R6GB 1MMNA 1EZZB 3S8SA 4R8UB 4ZOSA 4DPUA 3TAQA 1UVIA 4C8KA 4A8FA 1R0CB 4F02A 1NPRA 2CJQA 3AJDA 2HQCA 4AQYJ 1YJWS 3G2XA 3IWNC 2MGZA 2OP5A 3OFEA 1SC6A 5E2QA 1VQYA 2QLXA 1S6OA 2UVWA 2HBQB 3IG1B 3KJNB 1FJEB 1RWUA 2FJEB 5HROB 4DV0J 3A13A 1HNVB 3RYLA 2DR5A 3NNAA 3HVRA 3CJKB 3IBCB 4LRBA 2BRKA 3JTPA 1O5JA 2RF2A 4QW9A 3CUNA 2JJ4D 4Y2MA 2CJYB 2XY5A 2FVQA 4CO1A 4PG8A 1FJGJ 3CD6S 5IC4B 5J1NA 1QY7A 1UW9A 1QM9A 4A46A 4X4PA 3RBXA 3G6ES 1OJ4A 3K57A 3HXMA 4LSNB 1KFDA 3QYYA 2ZH7A 3ZO7A 4DUZJ 3JSBA 4MFBB 1RWPB 2BXJA 2ZDOA 3OQ2A 3S7RA 1SKSA 1RT3B 1VC5A 1PILA 1VYAA 2FHMA 3OT9A 3UCUP 1H7XA 3D3BJ 4F7VA 1VHIA 2HGLA 3HPOA 2BX6A 3V6KA 2CUYA 1SJRA 3ENVA 2I2YA 4F4XA 1B7FA 1MN9A 1NH7A 4EBCA 5AE3A 2HYIB 2GHVC 2Z2LA 3MM7A 6FDRA 2KXHA 4CLTA 3EPGA 2ZHAA 1RKJA 4NWBA 4UF4A 4DF8A 1FXLA 1P6TA 2LKZA 3H59A 4ED1A 5HQ8A 3DRRA 1WDDA 4KKOA 3TA1A 1Y0HA 1TL3B 3UDLA 4H4MA 4U6PA 3BSOA 1YIJS 1HNXF 5MAOA 2V2VA 1OWXA 3IP0A 3RRGA 4CYUA 3P49B 1WNEA 1S1WB 1JLFA 2Y0SD 3LF0A 4HHUA 4RUHA 2G9OA 4OZJA 1KEKA 4J9SA 3TVYA 2LQBA 3RZAA 1SL1A 2DXEA 1Z1ZA 2BDPA 1DY3A 1VRUA 3S1TA 4DR1F 4WYLA 2HHWA 1NCLA 5E3CA 4DHVA 3AY0A 1P1LA 3NGTA 3QAUA 1IKYB 1FWLA 2QMUB 8AT1B 4C3KA 3D1QA 1URRA 2I9SA 1QVGR 1FEEA 1NHUA 4P10A 3DMJA 2DCUB 4LR8A 1WEZA 2IRYA 1VHFA 2MZRA 3C19A 3OD2A 1LXJA 4ETZA 1WJ9A 3FBBA 5A76A 2ILYA 1RGVA 3MM5A 3TRGA 3U1LA 3MTJA 4OZLA 4FF2A 1NDKA 2DGUA 2JFKA 5HAOA 4GRSA 1HNIB 4M5LA 2EWHA 2WB4A 3SQOP 1SKUB 2DCLA 2AYGA 1RTIB 1XWLA 4C9DA 2VKRA 3PW5A 4H4OB 1RAAB 4OZNA 5KFLA 5KTQA 3IM9A 4ELTA 1EHWA 3WC0A 2GAHC 4ECXA 1FNOA 4NRUA 2EPIA 4MIBA 2NXEA 4QR2A 3OTOJ 4KE5A 1U8SA 4WE1A 1LW2A 3FZ2A 4FNIA 4EEYA 1RAIB 2HRYA 3PDNA 2MQOA 4LQ3A 4HLBA 3QGPA 2GGPA 2Z56B 5AT1B 4UQTA 3J7ZT 2O5DA 2NREA 4LF1A 5KFBA 4DLGA 1Q53A 4DL6A 2M5YA 3KNAA 3EWGA 3CCJS 2KYXA 5A8RB 1F5BA 3M32B 3RU0A 3M9MB 1HBNB 3B82A 4CO3A 1YRTA 2EKYA 2PN6A 2E7VA 2PGCA 5LJ5Y 2VQFF 2NSCA 1S72S 1QAYA 4QIFA 3OXFA 3QATA 2H3EB 4FVMA 2W7PA 5L8RC 4IR9A 5ETNA 1RT6A 4A8YA 1LWXA 2YQ3A 2XULA 4RR5A 3VGVA 2XM3A 4DF4A 1U48A 2F4VF 4DR4F 5F9LA 2ALZA 2XS2A 3N01A 1ZA2B 2M9KA 3SI8A 2W2OP 4LSLB 4QIEA 4RX6A 4XDCA 5KFGA 4K2JA 2RILA 4ECZA 1CJVA 2QA2A 3ZZTA 2MY7A 4NLVA 4K59A 2HVZA 2FC9A 1SBRA 1LK5A 3IWXA 5L1JA 5B0FA 2XMUA 5H9EK 2HKEA 3K8VA 4C8MA 3BB5A 4QCLA 1XBWA 2HWHA 3DLGB 1JLBB 1XQIA 3EMTA 2AYMA 2QX0A 2GA7A 5L9NA 1FE0A 2RH3A 2R7OA 4RW7A 1HYSB 3QZ7A 5THWA 5KFTA 4OJ1A 3ZNJ1 4CH0S 1UWAA 1WC5A 3CPWR 1D9DA 1TAUA 1R8CA 3AHPA 3R5CA 2M8HA 2K06A 3JSYA 2VG7A 3GE9A 4HH1A 5HK4A 1K47A 2RAQA 1CULA 2YX4A 3DNCA 4J7CA 4D3GA 1R6VA 1ZTTA 2FVRA 2RDIA 3CJSA 2ZH8A 3GFZA 4F25A 4TKTA 2YPYA 5G0RA 2B9EA 3BPSP 3LALA 1GMWD 2N4DA 2B8QA 1R0BG 1X60A 3BV8A 3M8YA 3PM9A 2ZWOA 4ZJQA 5CYJA 1ZPVA 3EZ5A 3RBDA 1A9NB 1IBMF 3EICA 1S9FA 3KDOA 1RHMB 2V8PA 4C0HA 1HBMA 4F3QA 4CRJA 3LO3A 3KLFB 1X9MA 2ASJA 3W60A 3NEKA 1S6QB 2C2OB 2EFGA 3IR7B 3Q2TC 3MR2A 1T11A 3CCRS 2YKMB 1DTTB 2Z30B 1JKHA 3A8EA 3SV3A 1VIXA 2KHCA 2LCWA 1ZH5A 4ID5B 4CLYA 2WVCA 4FKYA 3OV7A 1QLNA 4NEYA 2IFXA 1VLYA 5B0BA 2CJAA 4USUA 4I2PB 1JKHB 3TUIC 3M8SA 4HTIA 4DX8H 1F60B 3CJ2A 3F73A 3QSYB 2AU0A 1N36J 4JI4F 2E5HA 4FF4A 1SV5A 1TZ0A 5GADI 5HBMB 5GAHU 2ERRA 1H6KX 4HH0A 1MNEA 4NCBA 4MK7A 3FMBA 2ZC3A 1KHWA 2IYIA 4QWBA 2BOAA 2ASLA 4KGKA 1A0OB 2DNMA 1ZOTA 1UPPA 3D67A 2GVDB 4NMXA 3VTIA 4QWDA 5K8OA 3NRBA 1FWPA 1CQMA 2XMTA 2D9PA 4NA2A 2EBGA 5D0RA 2BANB 3NKYA 3AA8A 1Q16B 2KZMA 1KLMB 2ZBPA 4OV1A 2QV6A 2XBPA 3WBZA 4A8OA 1X4FA 3KJVA 3I0SB 1FA0A 2OGUA 2UZAA 1OY6A 3TAMB 3BJYA 4F50A 2VOOA 1OMSA 4PWWA 2BANA 3PJWA 3PG9A 1AB8A 3MWBA 1EX8A 1CS4A 3LTOA 4GO7X 4CLFA 4NYZA 3DCAA 1HWJA 4IFYA 1R3NA 1WD6A 2LQ9A 1XR7A 3HFKA 2C3MA 4IOBA 5CZXA 2PT0A 3FSYA 2HLUA 4WP9A 4YY3F 1L3VA 3OR1A 4B9UA 5K14A 3MAQA 4LRFA 1T02A 1WELA 2GIFA 4CQ1A 3F56A 5HBMA 2L9NA 3A12A 2WB1D 1CULB 1UW4A 1ZAVA 4PQAA 2KVIA 2W25A 5E41A 2HRTA 3QZ8A 2PO4A 2HVDA 4DR3J 5J2NA 4OL8A 5ETQA 1O8BA 1JJCB 4NPOA 3H2UB 3MEDB 4IO9Q 4DR6F 1YJTA 3CCTA 4OZ0A 3IRXB 4JI1F 2HEKA 7FD1A 3HZGA 4KQZA 3DRSB 3ETOA 1DTTA 1UEUA 1JLBA 2RRNA 1VRTB 4FVCA 4H4KC 1SJQA 4CNYA 3MPWA 1S12A 3CXCR 1I94J 2B4VA 5EX3A 1AA1B 3CJQA 5A8RA 2UU9J 2CPJA 2HSEB 3HT0A 3KLHB 3B4MA 4IDKA 3M7VA 3NGDA 2K8GA 2PI5A 2D69A 2B4PA 2HW3A 2BYCA 4OI1A 2ATLA 1FE4A 3CCVS 1WTBA 2MKKA 4HT7A 3UD3P 1VQ9S 2AF6A 2OAUA 5D3GA 4X4VA 4I0WA 1OQ6A 3AD9C 3BM7A 4CWBA 4Z7CA 3AOBA 3TQ1A 1LW2B 3H8YA 1KQSR 3HKWA 4NZ6A 1EARA 3DXBA 2V4QA 3G6YA 3HHNB 2OFGX 1NJIT 2RU9A 3GJTB 3PYGA 1FTCA 3BH7B 2PDAA 5SUHA 3MFIA 1WHXA 1EJ7L 3MI7X 3QO9B 2EFVA 2YKOA 2V69A 3Q8VA 4H4OA 2C2DA 4DFMA 1H98A 1SUQA 3MD3A 3W3SA 3FEZA 3KLGA 1WWHA 4RJVA 5KG0A 3CIZA 5CAAA 4DN0A 2ZBRA 2RQCA 5AXKA 1BE4A 4ZK7M 3TZZA 2R8GA 2EBEA 2ASYA 4HDHA 4NXMJ 4OX8A 2QG9B 5FLXU 2ATCB 3R7BB 1RT4B 3CT9A 4BS2A 3SEOA 1RABB 1BHNA 2HQ3A 1AZSA 2QLJB 2ZOMA 3L9ZA 2BE7D 3NS5A 4OX9F 4A48A 3HJVA 4IH6A 3BQ1A 1Q7YT 4B3TJ 2W2MP 3K89A 4GKKJ 3RG6A 3GJQB 1RT6B 4PWUA 1VDHA 1KOHA 1KP6A 4R5PA 4G6VB 3LAKA 4V19X 3OHAA 1GX5A 3OJSA 4OX6A 2UUBF 2E5GA 2WRMA 3ENQA 2XYHB 1NK0A 4NCGB 1J27A 3OR2A 4IO1A 4W4MA 3UNGC 3T19A 3W5YA 5J1EB 1L3UA 3CJ5A 4ELUA 2CDRB 2KZZA 2RNEA 2QT7A 1T94A 1WG4A 3R5BA 2OD4A 4ZS6A 1S0MA 1BLUA 4JI7F 3EE3A 1TL7A 1LW0A 2C2KB 3FQLA 3EGNA 4DV4J 4DPYA 3QPIA 1HWUA 3K59A 5F0UA 1SH0A 1JLQA 1BQNA 3GV5B 2CJKA 1RBLA 2DIVA 1RT1A 2F40A 3DGPA 2YKQA 3JS9A 1TL1A 3GQCA 4MFBA 4KSEB 1GTEA 4K4UA 1F1BB 4BDPA 4YB7A 2KFNA 2FJVA 3PEHA 2KJVA 3V4MA 1FRJA 3ENWA 2VJUA 4YEAA 3LQVA 2ZUGA 4DL0C 4JI0J 1S1UA 3DLKB 4CTAA 1S0OA 1ZS6A 1JLAB 3MM7B 3CIMA 4KGMA 2HRUA 1J5EF 4UTGA 4K8RA 5KFAA 4X62F 2DGQA 3BQ0A 5KG4A 1KD1T 5DDPC 3ET6B 2X1AA 2XWYA 3H4BA 2R7UA 5EHHA 2DKOB 2OPQB 3GV7B 3ZZOA 2ZH2A 4MKYA 2RHSB 4LSNA 4JV0A 3MCOA 4PPZA 5K9FA 1RCOB 1FHTA 1S1UB 4GMKA 3SFUA 2MGZB 2D7SA 2RQKA 4KH0B 2OPPA 1OO0B 2FLOA 2XQCA 4ZJOA 3W66A 2KO1A 4YR3A 2OTLS 2VODA 3DN9A 4ZPTR 1NHVA 3FBFA 3F44A 1IUJA 4M5JA 2B9YA 2LU1A 4O4GA 2J9EA 2X51A 4QQBA 3UWTA 5KG2A 3GSDA 1SL0A 3CJKA 2Y9HA 1YG0A 4RU9A 3NGSA 2XC9A 3PR4A 1Q82T 1FF2A 2WSEC 1HNVA 4ZPDA 3IGNA 3CW2C 4NLSA 1ICEB 2M52A 2LEBA 4X4OA 2BM1A 1Q1KA 3KG0A 3HHLB 1KVJA 3TW0A 5ETRA 1RT7A 1HBUA 1H74A 3QLHB 1TTHB 3VR1A 4F2SA 1P27B 4ZN3A 4RW4A 4BWMA 1RT4A 2FZGB 2VG6B 2BVZA 3B78A 3C15B 5DQHA 2Y1JA 2KYZA 4WU2A 1RAOA 1RBOB 3V81A 2CADA 4C7QA 3UNYA 5LMUJ 1Y5IB 3C16B 3BBFA 4FF3A 4DV6J 2RS8A 3H2VE 4ZLJA 5FD1A 2VPZB 4KT0C 3JYTA 2IRUA 4U8YA 2K1RB 3QO9A 4LJMA 4C48A 2PFFB 1NSKL 3BZQA 3HVWA 1P9YA 4Y34A 5LSRA 3PNIA 4RW8A 1RHRB 5DDOC 5H9EJ 4LF4J 4IH5A 3R1LA 3V6DA 3SSSA 3MEKA 2H51B 2MPUA 1RK8A 1SPBP 3IG1A 1RJJA 3M1VA 4M5DB 2VOPA 2HFOA 4I68A 2CQIA 3KKFA 1JLCB 5KG1A 5HMWA 1PAUB 3TZYA 4AL5A 3MR3A 1ZZNA 1KQKA 1K0TA 3I31A 1TAQA 3AAWB 3UR0A 1I6JA 1L3TA 1BXNA 3KOAA 3GZ7A 5J2PA 5L1KA 4F4AA 3K5LA 1EP4A 1JLEA 2AQ4A 1R8AA 1Q0NA 3OJUA 1YJNS 4LF5F 1M5SA 1OY8A 1Y00A 1S9GB 2LA4A 2POKA 3R5DA 1B0TA 5C42A 1HBOA 2MTLA 1Y7PA 2Y0BB 4IH7A 2I5JB 5F8IA 1C0TB 3CSKA 4MKVA 1XN9A 4TQSA 2QA4S 1C0TA 4N41A 3CJRA 1H2UX 1HBOB 2WOMA 4NL5A 2C2EA 3C14B 1X9WA 4LFCJ 3JAMY 4U9RA 4JYAJ 2HVIA 2IVYA 2FHJD 2BQRA 3G96A 4LFAF 4KHRA 2ZC4A 5JVGQ 1WC3A 4WPAA 2CQ0A 1RQ0A 2CQHA 2GX8A 4WXOA 3ADAC 2VQEF 4X64J 1HR0J 4UY85 4RLEA 2MQPA 4OI3A 4USJC 1HWIA 4B3SF 2V50A 2J7KA 1RAFB 4TNOA 3ILJA 5CCLA 1HQEB 2H54B 3QWUA 4K4VA 1U6BA 4GKJJ 4M5HA 1HHTP 4JV2A 4HTJA 4E8UA 4OYAA 5F3ZA 1CJTA 3BEGB 1DRZA 3QT7A 1EQ0A 5IT9Y 3Q2SC 3MF5A 2CJBA 4QIVA 5LM7E 3Q8SB 1GEHA 4WIIA 2CPFA 3EPIA 3EGZA 3IA0A 2LA6A 2V63A 4IRCA 2BKOA 3E8OA 5ETSA 1N48A 2Z0GA 1FVSA 3C16A 2PMWA 2ZVIA 3DLLQ 1RCXB 3A8JA 1RI7A 2N3LA 4EFAC 1J5OA 1GH8A 2UV8G 4RW4B 4QU6A 1XMOF 2J6SA 4CP5A 3M2UA 4K0KJ 3KJVB 3M9NB 3KK3A 2LU2A 1RAHB 2BKNA 2R9LA 3VQTA 1N5SA 4YOEA 2H65B 3D6FB 1AT1B 2BV3A 3HO1A 2VDHA 2FVSA 3DLEA 4LREA 4KFBB 2MKIA 3MMJA 4I7FB 4N7TA 4DU8A 4EO8A 5HQLA 5A0YA 2AD9A 3I6PA 5M2PA 1HNWF 1NAQA 2V9KA 3GR0A 2DHHA 2KG0A 2A0FB 2WCXA 1WI8A 1TVRB 3DFEA 1NSAA 4EI2A 4X4SA 4ILMA 2AJQA 1FERA 2BJDA 5B7WA 4YHHJ 3F41A 2W4PA 3AOCA 3KMSA 2ZM6F 1RT7B 3IBWA 3M8RA 4HHHA 3IGVA 2GQ2A 4DQRA 3OFGA 3I9ZA 1NK8A 1PCAA 2KU7A 4TY8B 2AT1B 2ZBIA 1TKDA 3IS9A 1YBAA 3D1OA 4M5GA 2HZAA 1B4SA 3W2WB 4UY8T 4XIUA 3MM8B 3QIDA 4OYPA 3Q8YA 2XCPA 1DAXA 1FTRA 2HHHF 4NMLA 4GKJF 1MROA 2XY6A 2ZFHA 4LVOP 2R7RA 3CCQS 4H4KA 1Q79A 3VZIA 2ALYB 2QYGA 4M5KA 4B9VA 2RDDA 2OPPB 3DLGA 3FQKA 4OHYA 3VZHA 2ZH3A 5JUMA 1ELOA 4MT1A 3GV8B 1T9WA 3V5RA 3W8GA 2J8AA 1R8PA 5KFJA 1U49A 1QTNB 4DR5F 1RAGB 2DGVA 2VPXB 3T1HF 4WFAQ 1R27B 3BN7A 2VG7B 2OEMA 1H7WA 3CE8A 3TARA 3VALA 4DR4J 2B6AA 5D4LA 2AGPA 4AYBD 1HYSA 1LW0B 2YXLA 4MYUA 2L3MA 5BYRA 3LWMA 2JH3A 2CPEA 4ER8A 2QL5B 1FK9A 3FK4A 2DNRA 2GVZA 2KG1A 1S6PA 3O2IA 1HPZA 3CCES 3UCGA 1UVNA 5MLCV 3HHEA 1I3OB 4UOCA 4DJBA 3RB4A 4LRCA 4DSLA 3BBBA 3TA0A 3N0VA 2YNFB 3PFOA 5KFZA 4B9TA 1DURA 2R8KA 2FGOA 1U6FA 3EXYA 3FCHA 3V6JA 2ZD1A 3SMZA 3R97A 3MECA 1UWBA 2UUAJ 4O0NA 3OSNA 1S0NA 1DQAA 1I1GA 2FGCA 4OLOA 2VPWB 5T7LA 2CZVC 3ZZPA 3KK1B 3J7YI 1WG1A 4NLOA 4UUWA 3OLBA 4FS2A 1TFYA 2CPHA 4DV7F 1UWBB 1MMLA 1XNRJ 1Q7LB 3CC2S 3QIPA 1KRPA 3IN5A 1C1CB 4FDFA 5L39A 4K4SA 2KFZA 1CPZA 1S7IA 1U1OA 4KO0B 5GAGI 2VPYB 1TV6B 2XSJA 4OI4A 1UZDA 2K7KA 2Y8WA 4K4ZA 3W64A 1CJUB 4WTOB 2C3OA 1V3RA 3K58A 4QIGA 1S4FA 1EETB 1LQ9A 1RHUB 2WAQD 4O23A 5HSPA 1GX6A 1O0PA 2FJAB 3N6NA 4DPTA 1ZYQA 3M8WA 4LVNP 1T9TA 4ED0A 4IG0B 4DV2F 4DUYJ 4O44B 1TUWA 3ETMA 2EC2A 4NLTA 1U1QA 2YWKA 2UUCF 5L1IA 2J0SD 3CO0P 3ITHB 2V8HA 2UUAF 2JSXA 4YDXA 3DM2B 4JV5F 1RWNB 2OD6A 1VBZA 1GFWB 1RZMA 3MCNA 3SDEB 1SB6A 4H54A 2XB2D 5DLFA 1YJVA 2OI2A 2ZBCA 3EGWB 1VQNS 1S5ZA 2JLEA 5F9NA 1M5VC 4H4MB 3MEEA 3ZTQA 4ZVGA 1Z4UA 3OLAA 2HG4A 1ZETA 1C1CA 4ZPAA 4FBUA 1DLOB 1WORA 3I0RA 1HL6A 2WW8A 3D0HE 2ZZTA 3Q86A 4QJVA 1NDCA 5IC6B 4Y00A 3W9HA 1Z2LA 2HFUA 4ECUA 3KHRA 1JXLA 4DR3F 2DGTA 4OZ5A 5M2RA 4DDFA 3T6BA 1HNZJ 4PUOA 3HVTA 2XZWA 4ED8A 2B6AB 5FDLB 4YFUA 4NZ7A 4J37A 5B09A 1VCTA 4J9QA 1TKTA 2GJFA 3BR9A 4ITSA 4QPXA 1D8YA 3J81Y 1CC8A 3L4BC 2QEXS 3QRQA 2RU3A 1MN7A 2P2CB 2E5LJ 2AP6A 1Q5YA 2O67A 3K8WA 5K14B 1JK9B 2B3TB 4CO0A 1B99A 3R2DJ 2GHWA 1VRTA 1X4HA 1ZM4A 2AJ1A 2MEWA 7FDRA 4LSZB 2G0IA 2HZVA 2HIQA 2MKJA 4IFYB 5D4PA 4W98A 1U2FA 1PC5A 3PKMA 2GNKA 1LKZA 2V4JB 3AD8C 1M5PC 4DFKA 3MM8A 2ZBQA 3ZZ0A 1FFGB 3WX8A 1NEEA 3ZTPA 3PIOQ 1DARA 2M7SA 4RNNA 3IRWP 4OHWA 1M5OC 1NJYA 3NMRA 4C8OA 1PBAA 4BHQA 2LFVA 2W9CA 2IBKA 4O3RA 4FF1A 2GIQA 2HNZA 3T1HJ 1UFKA 2NXUA 1SL2A 2FJXA 2DR8A 3KLVA 2HFZA 3O6QA 1FRHA 1UVKA 4G1QB 4XO0A 1TVRA 1YGYA 3GCWP 2KM8C 1CSJA 5HMZA 4J9KA 4F0MA 2CWXA 4O3SA 2X7IA 5HMXA 2RF2B 2YWEA 4DSKA 2M4MA 4DL3A 1T9VA 2CJXB 2EG1A 3D28A 1GT8A 1WF1A 2CFXA 3GWCA 1RTZA 3BN4A 4I2QA 5D4NA 3OTOF 3Q22A 2V9WA 3QNWB 1N5QA 3PJ9A 3D9BA 1SI9A 3DYAA 3L09A 3KMQA 5H1SV 1RE1B 4I6AA 1FXDA 2CVEA 4B08A 4RUCA 1JWWA 1HMVB 2FY1A 1PBUA 3C8YA 1F9EB 1S9EA 1WSRA 2Z58B 2GVDA 3C2PA 4M94A 1D9AA 4RW6B 3QT6A 4IG3B 3GSIA 2MQ8A 5L9XA 1IBLF 3QRPA 1JJHA 2R7TA 2CVIA 3M8ZA 3V6HA 2DH9A 3MDFA 3CULA 3GG0A 2DHSA 1SV5B 2QSWA 4IUFA 2CJ9A 2R42A 4PYDA 3OTDA 2J0QD 1A6LA 2O1PA 4GVBB 5DGBA 2BOPA 1SXLA 2VBYA 2RB7A 2IJFA 3NAIA 5G0RB 2Z2ZA 3OVAA 3UVJA 5HO4A 3KHGA 4EBEA 2UXDF 3HFZB 3RBEA 4P7VA 2GFFA 1HNXJ 1BWVA 4ID5A 1NDPA 3NP5A 3M2UB 2K7JA 1OS5A 1WI6A 3BSAA 4CLSA 2ZJQQ 3GIJA 2DO0A 2A1BA 3MM9B 2HQGA 1JLEB 1KKHA 2X1BA 5DDRC 1FKPA 1H73A 1HQEA 1DQ8A 3GMGA 2MQMA 2CPYA 4ICLA 3QWPA 2C2MB 1ZBTA 3VVTA 4FBTA 2XS7A 4A8XA 2G4BA
chains in the Genus database with same CATH topology
2MLYA 2D3O1 1P9YA 2MLXA 2MLZA 3GTYX 3GU0A 1W26A 1OMSA 1T11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLY A;  2D3O 1;  1P9Y A;  2MLX A;  2MLZ A;  3GTY X;  3GU0 A;  1W26 A;  1OMS A;  1T11 A; 
#chains in the Genus database with same CATH topology
 1KVI A;  2MLY A;  2JLF A;  1SQG A;  2K3K A;  5DO2 A;  1Y5L B;  2IRX A;  4QYZ K;  4Z2X A;  4O3Q A;  2VDI A;  4ZVR B;  3PRD A;  4LT6 A;  4DCP B;  2A6M A;  4ZVF A;  3SFG A;  4YME A;  2MHN A;  3LPY A;  3T5J A;  2PE8 A;  3MZI A;  2IVM A;  3PX4 A;  3PW7 A;  3MAA B;  4NI2 A;  3RTV A;  4M5M A;  4TYA A;  4C8Y A;  2OPS A;  2PA3 A;  2J5A A;  3NOG A;  4DI6 A;  1LWC B;  3O3L A;  4QWA A;  1YBT A;  4USI A;  2BUN A;  2BQ3 A;  1KN6 A;  4LF9 F;  4ED3 A;  2XYG B;  2N7C A;  1YSJ A;  1TUG B;  3VAM A;  3CDU A;  2R8J A;  5EGY A;  3CJ3 A;  4ZVH A;  4Y2I A;  3LGN A;  1XER A;  1XNQ J;  4CM0 A;  2YH1 A;  4UOH A;  4C6A A;  4PAB A;  2AMC B;  3N6L A;  2JVR A;  4QU7 A;  3EVW A;  1CJV B;  5CZV A;  4RUA A;  2P5V A;  3IR6 B;  4HEA 9;  5J2Q A;  3L7O A;  1S9E B;  2ZVS A;  1SQF A;  1TL5 A;  2X1G A;  2C42 A;  2XMW A;  3TWZ A;  1N6Q B;  3MMC A;  3M1V B;  3HHL A;  4MJK A;  4WFB Q;  1VOM A;  3U1N A;  4NAS A;  1ACM B;  1ZM3 A;  3PR5 B;  4E98 A;  4OMF G;  1NK6 A;  1YRX A;  1ZTW A;  3DDK A;  2E1A A;  3M4X A;  4RL1 A;  3PYF A;  1PIE A;  2HQF A;  1HFE L;  2OEJ A;  2U2F A;  2V6A A;  4WFY A;  4I69 A;  1MU2 A;  1VR6 A;  3OXL A;  4RWX A;  4RWW A;  1EP4 B;  4NYO A;  1HA1 A;  4DN9 A;  2DRA A;  2VHG A;  2HHV A;  4NA1 A;  5A6W A;  4K4W A;  4ZHR A;  1IVZ A;  4RNH A;  1W26 A;  3TJA A;  3X1L B;  1BC6 A;  2DHA A;  4FS1 A;  5CD4 H;  1B7Y B;  3D5M A;  2D9O A;  3M05 A;  3QGH A;  3UFC X;  1SJ3 P;  3VGT A;  1FWK A;  5LMU F;  5EWF A;  1NDL A;  3FEY B;  1OQ3 A;  2HNZ B;  4KY3 A;  3RAQ A;  4KHP J;  4ERD A;  2JOQ A;  2OPQ A;  1RB0 A;  4WKR A;  3FNN A;  3PFE A;  3CCZ A;  2M88 A;  3DC2 A;  2BR0 A;  1EKR A;  1G6B A;  4FPR A;  4AXI A;  4DV5 J;  2D3O R;  2DNN A;  3H98 A;  1R43 A;  1TL4 A;  2FY8 A;  3FSI A;  2KXF A;  4ED6 A;  1UEV A;  3PRB A;  5D0H A;  1CVJ A;  2CZ4 A;  3HK2 A;  1QAJ A;  2AW0 A;  1T7P A;  2GJI A;  1RHK B;  1FXR A;  2YWW A;  2M0G B;  3CDA A;  1S97 A;  2UXB J;  1JX4 A;  3D1H A;  1X4C A;  2W2P P;  4KPY A;  3DXS X;  4YQW A;  6AT1 B;  4ZP7 A;  4IQX A;  4F04 B;  4L3N A;  4LR7 A;  2VKZ G;  4NLY A;  4KJI A;  4AL7 A;  3B54 A;  2DK2 A;  1UCN A;  1F3V A;  1IM4 A;  2J6U A;  4M95 A;  1Q4R A;  5GAH I;  5IT9 U;  1B64 A;  1RA7 A;  4ZDN A;  4ZKA A;  3KLI B;  2ZH6 A;  2FZK B;  2VV5 A;  3TX8 A;  2DY1 A;  5KFI A;  1Q8K A;  4DV7 J;  2EEY A;  2RT3 A;  3CJ8 A;  5ETT A;  5A8W A;  1MWQ A;  4X65 J;  2BRL A;  3I5B A;  3G86 A;  1U2R A;  4EBD A;  3C6T A;  3AQP A;  4QOT A;  2DGO A;  1D1U A;  2XG8 A;  3ET6 A;  4GC6 A;  4V1A k;  3J7A N;  3WHI A;  4L75 A;  4ZIW A;  5ADZ A;  1VS3 A;  4JYA F;  4O4G B;  4C11 B;  4KKO B;  1KQG B;  1JLA A;  4D3H A;  5LJ3 Y;  2Y8Y A;  2CDQ A;  2P9G A;  2L48 A;  4PR6 A;  3UN2 A;  3MR5 A;  2MY8 A;  3CDW A;  1IBK F;  3VVU A;  2AEM A;  3AA9 A;  4LF5 J;  1WDT A;  3H42 A;  2IYG A;  1VBK A;  2MST A;  3FVY A;  1QSL A;  3W7B A;  3D0G E;  3PX0 A;  3JSM A;  2WVE A;  3AD7 C;  4EK2 A;  2WK4 A;  4AXJ A;  4DV4 F;  1K44 A;  1PYO B;  2ZM6 J;  4F8R A;  2XZT B;  1C4A A;  4LFA J;  2B51 A;  2VF3 A;  4ZCM A;  2J0X A;  2BZ2 A;  1FD2 A;  2NZ4 A;  2VG5 B;  2HBZ B;  1TV6 A;  1X8D A;  2G1H A;  2VFT A;  2XSJ B;  3CNQ P;  5J1P A;  1VJQ A;  5KG7 A;  4KGV B;  4LF4 F;  2F8E X;  4Q2M A;  5J1E A;  3PX6 A;  1DQ9 A;  4ZJL A;  2GO8 A;  1HKA A;  2I0X A;  1DTQ B;  5DM6 Q;  4JI5 J;  4JI7 J;  4ID8 A;  3R9L A;  1M5K C;  2NYH A;  2GJ2 A;  3AXK A;  3K2Y A;  4J9L A;  2GZO A;  1TR0 A;  4DR2 F;  3FFI B;  3KK2 A;  2H5I B;  2BJ3 A;  1YBU A;  4Q45 A;  3KHH A;  3GJS B;  5K20 B;  2W8K A;  1R6Y A;  3E01 A;  1W2B R;  2AWZ A;  4CO2 A;  3TOQ A;  3DRP B;  4CLK A;  1S59 A;  2G0C A;  4KTQ A;  5KT5 A;  1N54 B;  1P8G A;  2OUG A;  3DOM B;  2ASD A;  2ZD1 B;  2O66 A;  3MHY A;  3MCS A;  1R0A A;  3CCU S;  1TKX B;  4LIW A;  2NSB A;  4Q8E A;  1N36 F;  4F4Z A;  4JI4 J;  2IM2 A;  2CNL B;  4ECV A;  2XWX A;  1CBK A;  1TP7 A;  4HT5 A;  3OR2 B;  5CYQ B;  2MLX A;  3CCM S;  1FX4 A;  1B0V A;  4PG6 A;  4ED5 A;  2L9W A;  1AFJ A;  5KFP A;  2LXF A;  1NSQ A;  2DGX A;  3GIK A;  2DB1 A;  2IAJ B;  1RAE B;  1T95 A;  4R5P B;  3CTR A;  1W25 A;  1HW9 A;  4KBI A;  3RUB L;  1PO6 A;  2UUB J;  2FDN A;  3MAA A;  4NI2 B;  5E3P A;  4LRA A;  4AQY F;  3CDE A;  2UUW A;  2YVS A;  3F0N A;  3WIV A;  2B5J B;  5LOQ A;  3TAN A;  1R8B A;  4HI1 A;  5JJB A;  4DR2 J;  2HNY A;  1CJK A;  2YWH A;  4Q0B A;  2QIF A;  1XIQ A;  1FVQ A;  2MKY A;  1REG X;  4KHP F;  1WEX A;  4I67 A;  1FFS B;  5C2G A;  3VAH A;  4X4U A;  1XJW B;  5E3A A;  2QE5 A;  4TU8 A;  2I38 A;  2RD5 C;  1T3O A;  5DLG A;  2EFO A;  4ES2 A;  1UA0 A;  3MMA A;  1JXV A;  4WFX A;  4PQU B;  4WZQ A;  2R2R A;  4P2M A;  4M63 A;  3RBZ A;  1QD1 A;  2KKH A;  2CXE A;  1U0H A;  4ED2 A;  3OL7 A;  3EZU A;  4TY8 A;  1N34 J;  2XMK A;  2HHT A;  1BQX A;  2MMY A;  5HVG A;  4YY3 J;  5I42 B;  1YRU A;  2AEF A;  5D0G A;  4KYZ A;  3O5T B;  2E44 A;  1PKU A;  2XSF A;  4ZPW R;  5B0E A;  2PC6 A;  2ZKT A;  1QJH A;  2DO4 A;  1REV B;  3P8B B;  2DIS A;  4DPX A;  1H38 A;  1SH3 A;  1S1X B;  1J5E J;  2MQQ A;  2CZ9 A;  2DNZ A;  1M1H A;  3EM1 A;  2FPH X;  2JFD A;  1RTJ A;  1SJF A;  2WHO A;  2IHR 1;  3OR1 B;  1DBD A;  1VJW A;  4KR0 B;  3TUJ C;  5AXN A;  3TX0 A;  1XC9 A;  2CKW A;  4LBP A;  4XDD A;  4OX7 A;  1QDU B;  2B4O A;  2CQ3 A;  3PAC A;  3DLE B;  2MZQ A;  1CS4 B;  2YH0 A;  4QW8 A;  3GII A;  3D68 A;  3DYA B;  2OIH A;  2UVU A;  4F3O A;  1RTD B;  2Y1R I;  1S79 A;  2C2Z B;  2D74 B;  2D3O 1;  5FJ4 A;  1N5T A;  5J2N B;  1Q8B A;  2RS2 A;  4FNH A;  2D3U A;  3IM8 A;  1Y10 A;  1EIY B;  3D6M B;  2YPZ A;  4UST A;  2Z57 B;  5KFD A;  3H20 A;  4L73 A;  4XTT A;  3QJJ A;  4CH7 A;  1MLA A;  1N5Y A;  2HHU A;  4R25 A;  2BQU A;  4N76 A;  1F2G A;  2CA9 A;  1LV5 A;  4P74 A;  1ZPW X;  2VFV A;  3DDI A;  4FXW A;  5AE1 A;  1NH8 A;  4LF6 F;  3OHB A;  2DGW A;  5LSL A;  4G1P A;  2MJU A;  4C3M A;  4DCJ B;  2BE2 A;  2OO4 A;  1IR0 A;  2ZIT A;  1EKS A;  2E29 A;  3M2V B;  2NXJ A;  5F8L A;  2FD2 A;  1NPK A;  3A1Y G;  5KFC A;  4XPC A;  4ZVS B;  2NUU G;  1AUS L;  5FII A;  4CT9 A;  4HYK A;  4K2X A;  4CIO A;  4ECS A;  1TKZ B;  4NXN F;  3FCV A;  2XNQ A;  3LGM A;  3T5L A;  2DR9 A;  4HKQ A;  1S10 A;  4ZVT B;  3J80 Y;  3A3N B;  1DLO A;  4ZCK A;  5HLF A;  4X66 J;  4YUD A;  5I3U B;  1QAI A;  2XMA A;  3GTY X;  4CLW A;  2AKW B;  4JI8 J;  1IBM J;  5KFN A;  3CD0 A;  3UN3 A;  1VQ5 S;  1QVF R;  3H4D A;  2ZJR Q;  5AXM A;  2RRB A;  4KAI A;  2KRB A;  5K8M A;  1KR4 A;  3G6V A;  1CLF A;  4RW9 A;  2OPR B;  5T41 A;  3HVT B;  5EWG A;  3UCZ P;  4PUO B;  4DWI A;  5IFM A;  2V8G A;  2I6W A;  3ELH A;  4ZIT A;  2I5J A;  3I9V 9;  3DRY A;  2V4R A;  4Q43 A;  1HBN A;  5HJY A;  3POT A;  1FDN A;  1FT8 A;  1FDD A;  2ZEJ A;  4G65 A;  4NLW A;  3MUV P;  3LWL A;  1U09 A;  1RT2 B;  5DJB A;  1LWF A;  2CQ4 A;  2Q79 A;  1WEY A;  3BQ2 A;  3G9C A;  1BGX T;  1WHV A;  1APS A;  1TMM A;  3C6U A;  1FJ7 A;  2QFJ A;  2RRA A;  3DM2 A;  4Q0B B;  1N8R T;  1RBA A;  1S99 A;  1QSS A;  3FCW A;  5D4O A;  2MDA A;  1OYD A;  1RXO B;  1U24 A;  1V5V A;  3RAM A;  2DRD A;  4LF7 F;  1WOS A;  2HWI A;  2I1R A;  5HN0 A;  1X5O A;  2VZ9 A;  5BJR A;  2ZH9 A;  1VQM S;  4JI5 F;  3H5U A;  1Q78 A;  3I4P A;  1CC7 A;  4IG0 A;  4DQP A;  2HVE A;  3DOM A;  5ETL A;  2R7S A;  3W62 A;  3A3P B;  3IO1 A;  4USV A;  2Q6B A;  2BBE A;  3T9Z A;  3E01 B;  4GO5 X;  5HAT A;  2LVW A;  1IJE B;  3BBC A;  4DFJ A;  4RW7 B;  4K5R A;  5IOL A;  2IAJ A;  1N32 J;  4ZVQ B;  2QFI A;  1CJU A;  3MUT P;  3UDE A;  4P2X A;  3J81 j;  1IBL J;  1PSD A;  2YKA A;  3FC9 A;  3LP2 A;  5CYQ A;  3ZTR A;  5BXI A;  4DUY F;  2XEX A;  2B0G A;  4UQG A;  2EK6 A;  4ZVP B;  5CCM A;  4IRK A;  3G4S S;  2CPZ A;  2DIU A;  3OFH A;  3Q23 A;  2VIC A;  1HPZ B;  2D1C A;  3H90 A;  1JIH A;  4CH1 A;  2EFN A;  2ABY A;  2DTJ A;  2E5I A;  2XY7 A;  5KFQ A;  2ZH4 A;  1WUU A;  1Y3J A;  2BJ7 A;  5E5N A;  3SIP B;  3MR7 A;  1F2H A;  3E2E A;  2QA1 A;  1SQE A;  3H5S A;  1C1B B;  3KNG A;  1P1T A;  5KFE A;  5IQ6 A;  1VRU B;  3HP6 A;  3FFI A;  2DNH A;  4NX9 A;  1K1S A;  1KS2 A;  3PY8 A;  1UVL A;  1NB2 A;  4NRT A;  4DR6 J;  1BUX A;  1ZM9 A;  3JQJ A;  1NU4 A;  1RWW B;  4DPO A;  3BS9 A;  1U0S A;  5KT6 A;  2OTJ S;  3IFE A;  4HHJ A;  3N4W A;  1VQK S;  1S1T A;  5CHC B;  2F63 A;  4L6V 3;  4P71 A;  4PAA A;  3DHW C;  3HX9 A;  3KK3 B;  1XMQ F;  4G3I A;  1G3O A;  2VG5 A;  3V6D B;  1P9Q C;  5KG6 A;  5DQI A;  4B9N A;  2VJV A;  1RT2 A;  1RP5 A;  3DOK B;  3R8Y A;  2N82 B;  2YWF A;  1RUS A;  2A3J A;  1VQ4 S;  1FDB A;  4WP8 A;  3GIR A;  3JB9 k;  4OI2 A;  3THT A;  5ETV A;  3TJ9 A;  1JQG A;  2ACY A;  3C6T B;  2L08 A;  2G2Y A;  2DNP A;  2GIR A;  3ZZU A;  1VC6 A;  4ETX A;  4F4K A;  1RKI A;  2WON B;  3VAK A;  5CD4 A;  1I51 B;  1NBE B;  1S7H A;  4F4W A;  1HNI A;  1E6Y A;  4KIA A;  4DZ6 A;  1VQ8 S;  3QQC D;  3Q0A A;  1Q95 G;  2ILZ A;  3PCO B;  1NSP A;  5ETO A;  1TL3 A;  4KPC A;  5IT4 A;  4LRD A;  2R2S A;  1NKB A;  1PJ6 A;  3PEJ A;  2R8H A;  3NGR A;  1WAC A;  5GAE U;  2MZT A;  2JLG A;  2FB0 A;  1NZ8 A;  3DLJ A;  5DZ6 A;  1VGY A;  4O3N A;  3HD1 A;  2BM0 A;  2ROP A;  4I64 A;  3A8K A;  3O44 A;  3W65 A;  4ECW A;  1X4E A;  4C97 A;  1PYS B;  4GVL A;  4L72 B;  1HQU B;  4DSF A;  4DPW A;  4USM A;  5ITH A;  3OL9 A;  3NS7 B;  2FJD B;  4QR0 A;  3KLI A;  1SC3 B;  1JLF B;  4CT8 A;  3PZP A;  4J9M A;  2YNI B;  4N8O A;  3HSD A;  5B08 A;  2ZE2 A;  1VFJ A;  1KNZ A;  2VAS A;  1G4C A;  4OJG A;  3DI6 A;  2ZNZ A;  2E5L F;  4CCH A;  4NCG A;  2W01 A;  4LFB F;  4DV3 F;  1FKO A;  3DOL B;  1HWK A;  5A0Y B;  2DNY A;  3K5N A;  3M6U A;  2HHH J;  2LEP A;  2CQC A;  4UW2 A;  4ECR A;  3KTQ A;  1KWM A;  1ARO P;  5L46 A;  2PA8 D;  2KI2 A;  2E1R A;  2YNH B;  3HUL A;  4RU2 A;  2YQ0 A;  4LBH A;  2RSQ A;  1V6H A;  1HAR A;  3GB0 A;  3CD7 A;  3GON A;  3IR5 B;  1KQF B;  1AZS B;  5KFK A;  4EZ9 A;  2VU5 A;  2AJ4 A;  2E7W A;  4M1K A;  4TVA B;  3UD5 A;  2V67 A;  3ULH A;  4AE5 A;  4CI0 B;  1N4L A;  1V5I B;  2LDY A;  3HSG A;  1T05 A;  2JEG A;  3CJT A;  2LLZ A;  2PI4 A;  2XGQ A;  3Q8Q B;  1O6X A;  4L74 A;  4URQ U;  3P6Y C;  3GIM A;  4FPI A;  1UP1 A;  2VBX A;  1Y11 A;  1YJU A;  1QTM A;  2R3V A;  3KUH A;  1UVJ A;  4WZM A;  1RT5 B;  1KON A;  3OTC A;  3R7N B;  2BJ9 A;  4NCA A;  2HQI A;  4F4Y A;  3IAS 9;  4LR9 A;  5KOX A;  5DG8 A;  3Q89 A;  2WOM B;  3D7S B;  3GYN A;  2GCF A;  2PII A;  3K17 A;  4A8Q A;  2UUC J;  2EXU A;  4C8L A;  2VL1 A;  2L9D A;  4M5I A;  5D3G B;  2W9B B;  1N6Q A;  4KV8 B;  4A8W A;  2IY5 B;  2JEJ A;  2FHJ A;  1F9H A;  2Z2M A;  3C66 A;  5J2Q B;  3WQP A;  5GAE I;  3BRE A;  2V68 A;  2EFP A;  4URS A;  5KFH A;  4R0J A;  1LFP A;  2OLW A;  4EU0 A;  2CQB A;  3H5X A;  1UPM B;  4N8N A;  2DRB A;  1OIA A;  2NQP A;  2F3J A;  2Q66 A;  1RTH A;  2G2O A;  2F1F A;  1XTZ A;  1BY9 A;  4DU7 A;  3W9I A;  4K4X A;  3NGK A;  2GML A;  1CJK B;  3RB3 A;  4NLD A;  3Q8P B;  1M0S A;  1BMQ B;  4I4B A;  3E51 A;  3MM9 A;  2GMH A;  4BC7 A;  3CCW A;  2UUT A;  1U26 A;  3RJM B;  3KHL A;  2LEC A;  1KLN A;  1QE1 A;  3HSJ A;  3VAJ A;  2IJR A;  3UD4 P;  4OLP A;  3QJL A;  3NCR A;  5CXT A;  3GPA A;  1GMU A;  1SJ1 A;  4IOC Q;  3ISZ A;  2XS5 A;  2F8M A;  5GVQ A;  5AJ3 J;  1TMJ A;  2CG8 A;  3CMQ A;  3ILL A;  2G2Z A;  4GVB A;  4DQQ A;  2G13 A;  4FP9 A;  5HI7 A;  3TZW A;  4U7C A;  3O8W A;  1T03 B;  3DI6 B;  2UU9 F;  4PG4 A;  5KFY A;  1TFW A;  2HBY B;  3DKD A;  3I96 A;  4ICL B;  1RHQ B;  2DXF A;  4DFP A;  3V81 B;  2OJ3 A;  2UXC J;  2C22 A;  3OUY B;  4QBU A;  1AXQ A;  3TAM A;  3PKY A;  5CQG A;  3LGH A;  4AFF A;  3PRV A;  2PFD A;  1HMV A;  3VAG A;  4WK3 A;  3W9J A;  2VQF J;  2RDJ A;  2DHG A;  2K1R A;  1YKW A;  3IMQ J;  5RUB A;  2QA4 G;  2COL A;  4DUZ F;  2DNL A;  1VC0 A;  2XZD B;  4OZ1 A;  2J7U A;  4I2Q B;  5BYQ A;  1IXK A;  1FRL A;  4ZPV R;  2HND A;  4Y2A A;  4MK9 A;  1N0V C;  1HQ2 A;  2ZE2 B;  1H2V Z;  3QGG A;  3VQS A;  4PG7 A;  4WFZ A;  3LW5 C;  2KFY A;  1T9X A;  3AJ1 A;  4K4T A;  2VG6 A;  3C15 A;  3ISN D;  2YNI A;  2JX2 A;  1RAD B;  4OJH A;  4F67 A;  3EJM A;  3HJF A;  3NXZ A;  2VFS A;  4X64 F;  2R7X A;  4TN2 A;  3MR6 A;  4TU9 A;  2LQ5 A;  4BC9 A;  3G6X A;  4DR5 J;  5DGA A;  2DR7 A;  3UDC A;  3RRH A;  1N33 F;  1UET A;  3D6T B;  4ZCL A;  4EGL A;  2DPI A;  2W7O A;  2MSS A;  2QSF A;  3LUY A;  2IJN A;  3N5B A;  3D66 A;  1V3Z A;  2J8S A;  3M8Q A;  3NLC A;  3LP0 B;  1RDR A;  1VQS A;  4J9V A;  5L38 A;  3DLB A;  2DY9 A;  5KT3 A;  3HM9 A;  1NK5 A;  5DET A;  1UJ6 A;  1WKK A;  3JQK A;  1N56 A;  1Q8L A;  1UJ4 A;  3WDO A;  3G87 A;  1MWZ A;  4YR0 A;  2MKC A;  2HIY A;  4Y3C A;  4JI6 F;  2YX7 A;  4C0O C;  3UR3 C;  2DT9 A;  1NXI A;  4X4N A;  2KT3 A;  4U95 A;  1RWX B;  3MPV A;  3KLE B;  4FYD A;  2QLB B;  3MXH P;  2W24 A;  5E7O B;  2OSQ A;  1KDN A;  3JAM U;  1FES A;  2V94 A;  2ZWP A;  2HWT A;  1XNR F;  4MAK A;  4X4Q A;  1TL1 B;  3MUM P;  2ZKU A;  1RT1 B;  1WC0 A;  2QYC A;  2PMH A;  1MW7 A;  4O4R A;  5C25 A;  3PW4 A;  1TKT B;  1IKV B;  5IM0 B;  1ZAX A;  2XHW A;  4LMZ A;  2V4J A;  2AJF E;  2BMB A;  2Y1L B;  3MD1 A;  3AQO A;  3MEG A;  3ZXW A;  5BR8 F;  2QLW A;  4JBC A;  1WHY A;  4N56 A;  5LXY A;  3DLK A;  4CTA B;  5B0C A;  4PWD B;  2J7W A;  3M2R B;  1HIY A;  1XR5 A;  5C5J A;  2EK1 A;  1RWV B;  3M8P B;  2RQM A;  5KFM A;  1D9F A;  4AT1 B;  1SIZ A;  4QWE A;  2VD3 A;  3B6B A;  1S1T B;  3W2V A;  3L3C A;  2FVC A;  1PAE X;  3IWL A;  4DV2 J;  5G4D A;  3VGU A;  3LH2 S;  3LP2 B;  3FSX A;  1T8E A;  1BQN B;  2IIH A;  4A4J A;  4CLL A;  1S57 A;  3EX7 B;  4KRW A;  2CPD A;  1X0P A;  2E66 A;  2H4W B;  3OTB A;  2M70 A;  4RKU C;  3RRK A;  4ED7 A;  3V4I B;  3ITH A;  2KM8 B;  1FNM A;  5F8J A;  4TU7 A;  4DX5 A;  2XMJ A;  4HDG A;  2IM3 A;  1KTQ A;  1LOU A;  1FCA A;  3T1Y J;  5GAG U;  2F4V J;  5CH7 B;  1LWE A;  3PO5 A;  5HQM A;  1OSD A;  5BYS A;  1GQE A;  2WTF A;  2MZS A;  2HHQ A;  2EFQ A;  3L95 X;  2RML A;  3CWJ A;  2FIU A;  5KFO A;  3CCS S;  3EDQ B;  3MMB B;  1YVF A;  3SCI E;  2CRL A;  3HHL C;  4RNO A;  5HVF A;  4ZMM A;  3DGV A;  2JEF A;  5HP1 A;  4YDD B;  3OXG A;  4C2M A;  4PQU A;  2RE1 A;  1N52 B;  4ZHR B;  4EYH B;  2DH7 A;  2W8L A;  2EG2 A;  1RA6 A;  2APO A;  3SCL E;  3H5Y A;  5IWA J;  4PXB A;  2XLJ A;  3SYZ A;  1F0X A;  4FYX B;  2GC8 A;  3P45 B;  2LP4 A;  2E9Z A;  5JXS A;  2Q1L A;  1IJF B;  2RKI B;  1FRI A;  4Q7A A;  3HDS A;  3ZZZ A;  1XK8 A;  2V0N A;  2ADC A;  1YWX A;  2XO7 A;  5AJ3 F;  4Y2K A;  1T3N A;  2DNG A;  1NUE A;  2CWK A;  4YB5 A;  2WBR A;  4I1T A;  3VWS A;  3TZX A;  4IR1 A;  4KO0 A;  1EQM A;  3NNH A;  3MMB A;  3KLG B;  1S1V B;  3ICL A;  2UVR A;  1KFS A;  3CC7 S;  2YNF A;  4DBQ A;  4ZLL A;  4R0E A;  2ZOF A;  1ZAW A;  5I3U A;  1L3S A;  1TU0 B;  4LBI A;  1CEZ A;  3BGO P;  3TR5 A;  1U1L A;  4JI2 F;  2MYF A;  4B3O B;  3M2R A;  4A8K A;  5IXU A;  1UEK A;  1XR6 A;  2XCA A;  4WU3 A;  1SIW B;  1UL3 A;  4RZR A;  2H5J B;  4U96 A;  4UT4 A;  1WG5 A;  2XTJ P;  3CF5 Q;  5HVH A;  4NLU A;  4DL4 A;  1FO1 A;  2NPI A;  2ZNY A;  3DLH A;  4PEO A;  4FXD A;  4OV6 A;  3L7U A;  8RUC A;  5IT0 A;  4QR1 A;  5LL6 d;  4HL9 A;  4CM2 A;  4OX9 J;  3NL0 A;  3PO4 A;  3MUR P;  1BD6 A;  2HS3 A;  3GYG A;  1FX2 A;  1QSY A;  2GQQ A;  1X7V A;  3H2L A;  4IKA A;  1GXT A;  4HI2 A;  3KJQ B;  5K8P A;  2ZH1 A;  2IMW P;  1UFL A;  1X4A A;  2JC0 A;  1GAO A;  4WBF A;  2CQD A;  3PJX A;  4J9O A;  4N5S A;  2GVZ B;  2QGF B;  3AH6 A;  4C4W A;  4MYT A;  4OYX A;  4PXC A;  1TQL A;  5KFU A;  1VBY A;  1EB0 A;  2MZJ A;  1K73 T;  1GXU A;  2E1M C;  4P9S A;  2RUG A;  4PYA A;  4DXL A;  1YIT S;  1HLW A;  2R2T A;  2HVH A;  2ZZN A;  4EZ6 A;  4PZV A;  1JXE A;  2F65 A;  1XMQ J;  2VBZ A;  3KXD A;  1PC4 A;  3I0S A;  4WP3 A;  5LSO A;  3WC2 A;  4EO6 A;  1FI4 A;  4Y0F A;  1KLM A;  2OEL A;  5SZT A;  3GP9 A;  5GMK a;  4WYW A;  1WOP A;  1JNR B;  2JWN A;  1UVM A;  1HI1 A;  3VGS A;  9ATC B;  3JXO A;  4DCO B;  2X3G A;  3K7R A;  3P5T L;  3TVK A;  3VF0 B;  4QZV B;  2L41 A;  4DSI A;  3UN5 A;  3EGV A;  3BSC A;  2FJW A;  4RPF A;  5CAB A;  4WCE Q;  3ZNU A;  4A8S A;  2KB2 A;  2K2P A;  3UI3 A;  1YHQ S;  2HFN A;  5B0D A;  2CPX A;  2QN6 B;  1N5Y B;  2C2R A;  2DNK A;  2LDI A;  3OW2 R;  2AIR B;  3G8S A;  1MRO B;  1U47 A;  2CYY A;  4PG5 A;  1U4B A;  1RYS A;  5J2M A;  3M6W A;  4C8Z A;  2CQ1 A;  5E33 A;  3KUE A;  3RGI A;  5IZH A;  1HR0 F;  1YTY A;  2ZOG A;  3BO2 A;  3LP0 A;  4JI1 J;  3OBI A;  3M8Q B;  2QLF B;  1RWM B;  1TUV A;  4RO0 A;  1TKZ A;  2DGS A;  1U2C A;  2P6T A;  5DS7 A;  4K50 A;  1MWY A;  2VFU A;  3MM6 A;  4AUK A;  1GNK A;  2WSF C;  4F26 A;  2F7V A;  2NYI A;  3MFH A;  4AL6 A;  3T1A A;  5HJX A;  3KUG A;  4IFV B;  1J5O B;  4QYZ J;  3HHL D;  5LMN F;  2IMO A;  1HBM B;  4DS4 A;  5LXR A;  1NRK A;  1YDL A;  2F9D A;  4R8U A;  1S76 D;  2OML A;  1YLX A;  1NJW A;  1REV A;  3Q24 A;  2W4D A;  3H0P A;  4ECT A;  1MG7 A;  1X9S A;  2AV5 A;  4WXW A;  2R4F A;  4KFB A;  5A6P A;  4LFC F;  2QC3 A;  4S0M A;  3G8T A;  1RWK B;  2E5J A;  1EAY C;  1S49 A;  2V8V A;  3N28 A;  4P52 A;  4A8M P;  2KXN B;  4E2F B;  1W7W A;  2DH8 A;  2Q6C A;  4A47 A;  2FLL A;  3QT5 A;  2QL7 B;  3O1L A;  4ZLP A;  2YKM A;  2C3P A;  5E0O A;  2C28 A;  1RTD A;  4ELV A;  3GFH A;  1S6Q A;  4C98 A;  3NWG A;  3EVM A;  3NNC A;  5ETK A;  4JI3 F;  4N77 A;  1H0H B;  4RBV A;  5HAN A;  3HCX A;  3NBP B;  4Q44 A;  3KJF B;  3C46 A;  4WF9 Q;  3CCL S;  3LOU A;  2NUH A;  3U27 A;  1VBX A;  4QIW D;  3SCJ E;  3U7J A;  2OKQ A;  3VAI A;  2VON A;  2HNY B;  1HWL A;  3U02 A;  2A6O A;  4YN3 B;  1HHS A;  4X4T A;  3LAM A;  2MXY A;  5D6G A;  1RLD A;  2MQL A;  2W2N P;  4LSL A;  4X84 A;  5KT7 A;  3G8Q A;  2DJW A;  2DYA A;  3CED A;  2P8I A;  2DXD A;  3LA0 A;  3NAH A;  2V8D A;  1PGZ A;  3BKU A;  4JOU A;  3AOD A;  1YK9 A;  4NLR A;  1NB7 A;  4BLG A;  4Y28 C;  4J9R A;  2IBO A;  1FEH A;  1RU1 A;  1PG5 B;  3KK2 B;  2MJN A;  2QO3 A;  4L3K A;  4OZ3 A;  4O3O A;  4YB1 P;  5JVH Q;  2ZH5 A;  3U1M A;  4C3L A;  1S9G A;  2HS4 A;  2P6S A;  3HSZ A;  3Q83 A;  5C42 B;  2VB6 A;  3M32 A;  5D77 A;  4F0H A;  5GMD A;  2A2C A;  3R6L B;  3P4U B;  1DTQ A;  3GLJ A;  3W61 A;  1FKA F;  1IQZ A;  3MEE B;  3AOA A;  4DLE A;  3MPD A;  1TKX A;  5F0W A;  1IKW B;  2KDO A;  2VC1 A;  2FQQ B;  2YWG A;  4RBT A;  2R7Q A;  1L5U A;  4ZPB A;  2JL9 A;  3RW7 A;  2DHX A;  3C14 A;  3R3T A;  4WIQ A;  4KV8 A;  3B8H A;  1QUV A;  1JLC A;  2XLI A;  3DRP A;  5T14 A;  1T05 B;  4M5D A;  4AND A;  2D3Z A;  1NZA A;  2DD8 S;  5F8M A;  4WWS A;  4DG1 A;  3VV2 B;  5E3R A;  1C0U A;  2N7Y A;  4RW8 B;  1YI2 S;  5H9F K;  2YBV A;  4JI6 J;  1GK8 A;  2VUG A;  3QFW A;  2IPO B;  5A8K B;  3KFW X;  5KFR A;  5J2P B;  1EET A;  4ZPC A;  1B70 B;  1Q5V A;  1R89 A;  2VC0 A;  5I3Q A;  3FDS A;  1HNZ F;  1RLC L;  2R2U A;  2XGP A;  1WC4 A;  4EMD A;  5HP1 B;  1FKO B;  3DOL A;  5D8H B;  3MCM A;  4X62 J;  2IDE A;  3G82 B;  3P3D A;  2HLT A;  4NLG A;  3MM5 B;  1Z2Z A;  4KHM A;  2HFV A;  4TLQ A;  5ETP A;  3ZTO A;  2MZ1 A;  1JLG A;  4F2R A;  1H3D A;  3JQM A;  4RUB A;  1I94 F;  3R5A A;  3T9N A;  1R0A B;  2H4Y B;  2KTQ A;  1HHQ A;  1VMB A;  3D0I E;  3QIP B;  1IR2 A;  3DMJ B;  5CYM B;  4NLP A;  4X65 F;  4LF7 J;  2UXD J;  4FKX A;  2NXN A;  1HBU B;  5EX0 A;  5DG7 A;  5DG9 A;  1Y3K A;  2VA2 A;  2DBB A;  4OYB A;  4LF8 F;  1UJ5 A;  2BJ8 A;  3A3O B;  1NJZ A;  4DMZ A;  1VK3 A;  4U7U D;  1RTI A;  1U02 A;  1ULR A;  1RHJ B;  2JNJ A;  3BSN A;  4YB6 A;  2HQD A;  2CQP A;  2MQN A;  5LT5 A;  2DPJ A;  2HGM A;  1F5C A;  1C4C A;  1TEL A;  2RJZ A;  4CO5 A;  4CYU B;  2R7W A;  3FGV A;  2ZDP A;  6FD1 A;  2KJW A;  5KFF A;  3J7A 1;  1M1G A;  1IM6 A;  4OI6 A;  2I8E A;  1Y4Z B;  3OL8 A;  1BQM A;  4OIX A;  4DV0 F;  1HW8 A;  4XAK A;  3EYZ A;  2FYX A;  2GS8 A;  3SQG B;  1R8H A;  3D6H B;  4CDI A;  2BE9 B;  3UE2 A;  1E6Y B;  5BR8 J;  1AUD A;  2MKS A;  1MSW D;  1IKY A;  2U1A A;  5F8G A;  4OJ3 A;  4MKA A;  3MPY A;  2WON A;  4TQR A;  3MEG B;  5DDQ C;  2Y3Y A;  2JC1 A;  1M1K T;  3NMA A;  3V4I A;  5DQG A;  3W5Z A;  4B17 A;  4ATN A;  4PRF A;  2FLN A;  2AJ2 A;  5C25 B;  3ZZR A;  2IC3 A;  2KHD A;  3A4T A;  3PYD A;  4X66 F;  3THV A;  4YR2 A;  2FHO B;  2JEI A;  4X2B A;  4GKK F;  3M30 A;  3R2C J;  2MKH A;  3KYL A;  2HPU A;  4URG A;  2QMW A;  1X4G A;  3BR8 A;  3DRR B;  4ZIV A;  2IA6 A;  4BBY A;  1V9O A;  2UXC F;  1G2E A;  4USW A;  3QJP A;  4J91 A;  4J9N A;  2IA0 A;  1LEO A;  1OY9 A;  3BYP A;  3VHQ A;  2LEA A;  4ENO A;  3CME S;  4HVZ A;  2GV1 A;  5D15 A;  1K0V A;  2IC3 B;  2KT5 A;  1IKV A;  3JTN A;  5IM0 A;  2Q3P A;  1JLQ B;  2BKP A;  3ILI A;  4FZV A;  2HAI A;  1FRX A;  2RHQ B;  4MIA A;  4NEZ A;  4MTP A;  3J81 U;  1F5A A;  2HK2 A;  2Z8Q A;  3MPU B;  4NE9 C;  3SBM A;  1SH2 A;  3M9O B;  1TL7 B;  4LQ9 A;  3THP A;  1JLG B;  3CJ0 A;  4AD6 A;  3J7Z 5;  5GME A;  4DR7 J;  4LF8 J;  2DNQ A;  1D09 B;  2GMJ A;  3GJR B;  3LAN A;  3VAF A;  3P5B P;  3MOZ A;  4MK8 A;  4U8V A;  2KN4 A;  3A8I A;  3CJ4 A;  3PTW A;  4P2S A;  2H48 B;  1VQO S;  1GMV A;  4K5S A;  4OYI A;  1GMW A;  1U1R A;  2Q43 A;  2FTR A;  1NLK L;  5EDW A;  5M2U A;  2H5E A;  1PJ7 A;  1WKL A;  2Z2Y B;  4Q5V A;  4OYZ A;  1Y9O A;  2A18 A;  1UAW A;  3K5O A;  1LWC A;  1OPZ A;  3MMC B;  2KH9 A;  1HI8 A;  2H9Z A;  4PPD A;  5FLX Y;  2BJ1 A;  4WTY A;  4N47 A;  1JNZ B;  5HMY A;  5KOW A;  1IQT A;  3QMQ A;  4NA3 A;  1OYE A;  2XLK A;  2VQE J;  4FN5 A;  3QRR A;  3SQG A;  1X0F A;  1KSP A;  2BJE A;  3RR7 A;  2YY3 A;  1Q81 T;  3CMA S;  1BQM B;  1IKW A;  1LK7 A;  2B43 A;  1CQN A;  2IDL A;  1KTV A;  3TJ8 A;  4EWT A;  5C2C A;  1YJ7 A;  3BO3 A;  2KT2 A;  4XK8 C;  2D41 A;  5K5M A;  2XHC A;  2HZC A;  3BF4 A;  3IAM 9;  1X5P A;  4MKB A;  4O0I A;  3B4D A;  4CZC A;  3FBE A;  4B9S A;  4JV5 J;  2RUS A;  2VIH A;  3PHE A;  3KDN A;  2CQG A;  4Q2L A;  1ZZF A;  5EUH A;  3NWR A;  3FJ2 A;  1SJ4 P;  1D8Z A;  1PJ5 A;  2ADB A;  3I5C A;  1N33 J;  1MU2 B;  3MOJ B;  4DSJ A;  2R7V A;  1JMT A;  2C3U A;  1G7C B;  1QE1 B;  2IVF B;  1VIO A;  4ZA1 A;  3HKZ D;  2J9C A;  1FDA A;  2WVF A;  4QYR A;  5CYM A;  2RQ4 A;  3EXC X;  3CGI A;  3FBC A;  4DR7 F;  2ZHO A;  2HMI A;  2NLW A;  2NPF A;  2OPR A;  4M8L A;  2GQC A;  2QRR A;  3H7H B;  1URN A;  4J9U E;  4ES1 A;  4OI0 A;  1NKE A;  1L3K A;  4PKD B;  3BGF A;  3QAE A;  5IQQ A;  1TK5 A;  1T03 A;  3NBP A;  3P96 A;  1F6T A;  1VQ7 S;  1B3T A;  2KL8 A;  1SUQ B;  2QJ3 A;  4WJB A;  1KHV A;  2GO9 A;  3WIU A;  3GCX P;  5A8K A;  4DV3 J;  4DL7 A;  3S01 A;  2AGO A;  4LF6 J;  1N0U A;  2C3Y A;  4BCA A;  1O51 A;  2Z4P A;  1C0U B;  2OHD A;  3DRS A;  3BGU A;  4NLQ A;  3HLU A;  1E6V A;  2A10 A;  3AJ2 A;  4ALZ A;  4DG1 B;  2YKN B;  2W9B A;  4Q8F A;  4TY9 A;  3TYT A;  4B02 A;  2DNO A;  3WZ0 A;  7AT1 B;  1OPI A;  1YJR A;  2HFS A;  3MED A;  3OSP A;  2CNK B;  2EKN A;  1AFI A;  1SVD A;  3GG1 A;  4NLX A;  4UUX A;  4JB8 B;  1XMO J;  2AHO B;  3GFY A;  3RW6 A;  3PHT A;  1HD0 A;  2OMO A;  3AXM A;  2NR0 A;  1GXL A;  5JMN A;  4EYI B;  3TQE A;  1RT5 A;  4HR2 A;  3SCK E;  4IDK B;  2E1P A;  4KB7 A;  3KLH A;  1N88 A;  3PW2 A;  4UZB A;  1XMB A;  2RIJ A;  4IFV A;  1KVK A;  2WW4 A;  3S6E A;  2ZHB A;  2QMX A;  3ONQ A;  4JI8 F;  4Y65 A;  4YP3 A;  3TP2 A;  4NXN J;  2H1Y A;  1T9Y A;  1UTA A;  2CIM A;  1HNW J;  3US5 A;  3H25 A;  2DEJ A;  3KG1 A;  3IRX A;  1DZ5 A;  1FKP B;  2FVP A;  2ROG A;  4ZVO B;  2PEH A;  1X5S A;  2BW2 A;  5D78 A;  2AZ3 A;  2FHK A;  3M2V A;  2ZJP Q;  3AT1 B;  1YQH A;  2AEJ A;  5H9F J;  2F9J A;  4MH8 A;  4P75 A;  3LP1 B;  4PCQ A;  4FXV A;  3JYT B;  3T41 A;  4ECY A;  3I55 S;  1SCJ B;  1UKU A;  3FRZ A;  4U67 Q;  1VQP S;  1U1P A;  4LFB J;  3CD5 A;  3I4H X;  3SZ2 A;  4G1Q A;  3L7P A;  1RTJ B;  3QSI A;  4MIW A;  4CO4 A;  4Z7Y A;  3D3C J;  3AB2 B;  3I82 A;  4OYO A;  1X4B A;  4K7Q A;  3LP1 A;  3N5F A;  2KRR A;  4C8N A;  3SSR A;  2W9C B;  4LIR A;  4IG3 A;  5IV3 A;  2BAC A;  4J90 A;  3D2W A;  4Y2C A;  4JP8 A;  5DZ7 A;  2M8D B;  4HAC A;  3IBF B;  3BKT A;  2XO6 A;  3UO0 A;  3QLH A;  2F4F A;  2DR6 A;  2YNH A;  2MB0 B;  5CA5 A;  3MM6 B;  3N6M A;  1D3W A;  1UFW A;  1I5O B;  1IBK J;  5F3T A;  5I42 A;  3UW1 A;  3NGU A;  1S6U A;  4I6Y A;  2M2B A;  4JV1 A;  1FRM A;  3I87 A;  4BWJ A;  3LPE A;  1UA1 A;  3OVB A;  2QTW A;  2JRS A;  3IC1 A;  4DL5 A;  1LNQ A;  2CG4 A;  4FYV B;  1U8W A;  4B9L A;  3DU5 A;  3SDE A;  2AJ0 A;  3TEG A;  2LXI A;  4QWC A;  3H40 A;  5AXL A;  5ETM A;  3BGL A;  1HQU A;  5F8N A;  2CNO B;  2EVZ A;  3BPD A;  5E3Q A;  3BDE A;  4K0K F;  4KGX B;  2YKN A;  1DHM A;  3JSR A;  4KGZ B;  2R8I A;  1E6V B;  1U0H B;  1RU2 A;  4WK1 A;  2HGN A;  2WVB A;  5C24 A;  2E9T A;  4B3R J;  2HHS A;  5K8N A;  1ITP A;  2HK3 A;  3I0R B;  3PVX A;  1FNX H;  3BYR A;  4P2F A;  3NS6 A;  4P73 A;  2Y1I A;  1YZ7 A;  3ISN C;  3PYE A;  3X3U A;  5J2M B;  2OH2 A;  3DOK A;  3EUN A;  3KLF A;  1VQ6 S;  5U47 A;  2ACM A;  2IM0 A;  4P7T A;  4ZN1 A;  3MTK A;  2AGQ A;  2GAG C;  3SSQ A;  3TA2 A;  4RNF A;  2C2N A;  4NZ0 A;  3TNV A;  1V3S A;  1N5V A;  2BW7 A;  2LXU A;  2XMV A;  1B0P A;  3BGR B;  1S4E A;  1RSC A;  3BKF A;  3CB4 A;  3R7S B;  4JI2 J;  5B0A A;  3BO4 A;  4B3T F;  4TYB A;  2EW9 A;  2BAB A;  4YHH F;  2C1E B;  2F5G A;  2B5J A;  3DGP B;  4OHV A;  1NHK L;  3Q8R B;  2JHE A;  4O44 A;  1GTH A;  2P9C A;  4OHZ A;  5HL7 Q;  3DRX A;  5FDL A;  3DU6 A;  5A2Q U;  3KK1 A;  4CLP A;  1C1B A;  4ZLN A;  2HUR A;  5T7L B;  1VQL S;  1WHW A;  1NO8 A;  2CNN B;  4UZC A;  1KOO A;  2HHP A;  2YNG B;  3NY0 A;  4F0K A;  1U7L A;  1WF0 A;  2NXC A;  2J6T A;  4B9M A;  1PYT A;  3RB0 A;  5EN1 A;  3EDR B;  4ZVE A;  3HZE A;  4TLR A;  1ZM2 A;  4V19 J;  1S1V A;  1U25 A;  1S6P B;  3N79 A;  4ZP8 A;  2YNG A;  1XEZ A;  1IR1 A;  2AYE A;  3TVZ A;  1D0E A;  3C3L A;  2X1F A;  3CO9 A;  1TK8 A;  4ILR A;  2FLP A;  2AX0 A;  3NCQ A;  2GGP B;  1RAC B;  3QFH A;  4RBU A;  2DVI A;  3RB6 A;  2M3D A;  4UOG A;  2YQ1 A;  1IWA A;  3D4J A;  3SXL A;  1VRQ C;  1NK7 A;  2OSR A;  4I56 A;  3M6V A;  4DR1 J;  4K4Y A;  5D0E A;  3KWM A;  3I5A A;  4B3O A;  5DRK A;  4OFZ A;  3ZFV A;  1SKW A;  2V2Q A;  4B3S J;  3FUY A;  1G1X A;  1BWE A;  3FEX B;  2XI2 A;  4ED4 A;  1HD1 A;  3Q8U A;  1R31 A;  4ZVU B;  2UVV A;  4WFN Q;  3C6U B;  3VCD A;  3W63 A;  2SXL A;  4ANC A;  4C0B A;  2MLZ A;  2FJB B;  4TXS A;  1N34 F;  4PWD A;  1VI7 A;  3OVS A;  1YJ9 S;  5EWE A;  2RVJ A;  4C11 A;  3FKB A;  1WTF A;  3GR1 A;  4J9P A;  2RKI A;  3FZB A;  2ZUA A;  4WE1 B;  2PD1 A;  4L76 A;  2W4C A;  4ECQ A;  3GYX B;  1LWE B;  3MAH A;  2X3D A;  4EUV A;  3OTE A;  3JSM B;  3HD2 A;  1H72 C;  2B4U A;  3HI9 A;  1R7I A;  2AYB A;  4LUB A;  4GC7 A;  1KC8 T;  1IWG A;  1JB0 C;  4DUT A;  2B56 A;  4U7U K;  2O3D A;  4O3P A;  2DEI A;  4IOA Q;  1QUP A;  2QL9 B;  3BGR A;  3MEC B;  4DOZ A;  3NCP A;  2UV8 A;  3HF5 A;  3W8P A;  4F36 A;  3TAP A;  2WVD A;  3ZZY A;  1N32 F;  2UP1 A;  2HS0 A;  1RIS A;  1S48 A;  1YZ6 A;  1LWF B;  1VK8 A;  2B9X A;  2YKP A;  3AFG A;  3W2V B;  3I32 A;  3M30 B;  3K5M A;  2J9D A;  2ROE A;  3OPK A;  5HLF B;  3TO8 A;  5IS2 A;  4Z37 A;  2J76 E;  5KT2 A;  1U45 A;  5KFS A;  4NXM F;  2PEB A;  3POT B;  2FUG 9;  1FK9 B;  5C24 B;  8ATC B;  4I7F A;  3IS9 B;  1A7G E;  1NME B;  2B7C B;  1ROF A;  4I6W A;  3R27 A;  4P6Q A;  3EZO A;  4W92 B;  3NG8 A;  4NYP A;  2GW8 A;  2QZ8 A;  5A8W B;  3K0J A;  2WZ1 A;  2XYP B;  4CLU A;  4JUZ A;  1WC6 A;  4OYM A;  4RW9 B;  2JDJ A;  2V34 A;  2B7B B;  2LMI A;  5B0G A;  4M5N A;  1S0V A;  1WOO A;  2J9D E;  1FJG F;  4MMO A;  1Q86 T;  3HVA A;  4HAC B;  1S1W A;  3BH6 B;  1W2I A;  3FRY A;  3CVK A;  1K8A T;  2VFR A;  2XNR A;  3NOC A;  3QGI A;  1H2T Z;  2UXB F;  3W5X A;  3DHX A;  2HND B;  3M8P A;  4ZP9 A;  1U1K A;  1RWO B;  2JZ5 A;  3KLE A;  9RUB A;  5KG5 A;  4FYY B;  4XPE A;  3CC4 S;  4P72 A;  1WSV A;  4CNZ A;  1LFW A;  5AE2 A;  1NPP A;  2KVQ E;  2E7X A;  4OQJ A;  2G1D A;  1VLO A;  2PSZ A;  4B3R F;  3G71 S;  3W2W A;  2HAF A;  1OSC A;  3EVO A;  1K1Q A;  3FMW A;  3N9U C;  3HHD A;  1RT3 A;  2BE2 B;  2B9W A;  2E1C A;  2MHE A;  3PV8 A;  3T5K A;  2NCK L;  3HFV A;  2FZC B;  1C2P A;  1MMD A;  3KG4 A;  3V2U C;  1WKJ A;  1M5H A;  2W2Q P;  3ZTS A;  5DM7 Q;  1T0T V;  3R1H A;  3G82 A;  2EC0 A;  4B3M J;  2YTC A;  1X5T A;  2NS1 B;  1NND A;  1X31 C;  2J0W A;  4OZ2 A;  3IXQ A;  4OYW A;  5KFV A;  5F8H A;  1QAX A;  3R5J B;  4RNM A;  1UMJ A;  4NOH A;  3K5P A;  4QPT A;  2ZZM A;  2AX1 A;  4JI3 J;  1X4D A;  3CDB A;  4DEZ A;  3RAX A;  3ENA A;  3QT8 A;  4DV1 F;  4W90 B;  2P9E A;  4X4R A;  4KC5 A;  5IV4 A;  1T9U A;  2B8P A;  1CG2 A;  3WX4 A;  4ZCI A;  1WC1 A;  2N4C A;  2OFH X;  4I2P A;  3T3F A;  1HI0 P;  4WKY A;  1Y5N B;  1U6Z A;  5HRO A;  2VA3 A;  5F41 A;  4YS2 A;  1KBR A;  2LQJ A;  4DQI A;  1ZA1 B;  1FD8 A;  4USH A;  2OPS B;  4F3M A;  2N3O A;  4DSE A;  2G0J A;  2LQ8 A;  1F3F A;  2DIT A;  4ANE A;  1Q8I A;  1SC1 B;  2HBR B;  4OHX A;  2W9A A;  3TUP A;  4DS5 A;  1FRK A;  3W1Y C;  1SKR A;  3OUY A;  4CLZ A;  1NM2 A;  2W7A A;  2W1B A;  2XI3 A;  2A2D A;  3I56 S;  3DDN A;  1S1X A;  1IBC B;  4USK A;  3ZC4 A;  1F9F A;  1DJ0 A;  2V2Z A;  1IKX B;  5I4M A;  3GIL A;  5LMN J;  4LF9 J;  2CQ2 A;  2AZ1 A;  2BA9 A;  2O01 C;  2OEK A;  5A2Q Y;  4DL2 A;  1AYE A;  3E3X A;  4KH1 B;  3OL6 A;  2WSC C;  1JJ2 R;  3BDP A;  2HHX A;  1XNQ F;  3T6J A;  4B3M F;  3RR8 A;  4DV5 F;  1FFW B;  1U1M A;  1SC4 B;  2CAJ A;  3UQS A;  1CJT B;  3HT3 A;  5L1L A;  1JJ4 A;  1AW0 A;  1NJX A;  2K3I A;  2BEF A;  5GAD U;  1NKC A;  1M90 T;  2NZC A;  1NK4 A;  4IYQ A;  4ZP6 A;  2PMZ D;  3HMJ G;  3SV4 A;  1VIS A;  2YX1 A;  3MMA B;  3J80 U;  1K9M T;  5KFX A;  4DV1 J;  1U1N A;  3M6X A;  2V5H G;  4G1I A;  4UOF A;  5KFW A;  1FJC A;  1RAJ A;  2F8H A;  2GHP A;  2LYV A;  5IWA F;  1NK9 A;  4IQM A;  1UZH A;  4DX6 A;  1J2V A;  2CPI A;  3GFX A;  1RTH B;  2EI5 A;  3D54 A;  3T1Y F;  1TK0 A;  4IRD A;  3PIP Q;  1IKX A;  1LXN A;  2VBW A;  5KAK A;  3TUZ C;  4DQS A;  1S77 D;  2E9R X;  1RYR A;  4PXD A;  4Y6I A;  4JI0 F;  3GU0 A;  3ILO A;  4LF2 A;  4DV6 F;  2HMI B;  2JVO A;  2V2K A;  5KG3 A;  3QBC A;  3T5H A;  5KT4 A;  4RW6 A;  3R5G A;  1DFD A;  3TI0 A;  3PXG a;  4DX7 A;  3UDV A;  5I3P A;  3UPF A;  2IM1 A;  3AB4 B;  3J7Y U;  4ILL A;  3OFF A;  4DZD A;  4ES3 A;  3TEH B;  2XMM A;  4FYW B;  4E0D A;  2WBM A;  3UVJ B;  1WF2 A;  1YX2 A;  2FC8 A;  3JTO A;  3MGJ A;  4J5O A;  2VH7 A;  3PW0 A;  3HHK A;  4PXE A;  5C7P A;  1IN0 A;  3R6G B;  1MMN A;  1EZZ B;  3S8S A;  4R8U B;  4ZOS A;  4DPU A;  3TAQ A;  1UVI A;  4C8K A;  4A8F A;  1R0C B;  4F02 A;  1NPR A;  2CJQ A;  3AJD A;  2HQC A;  4AQY J;  1YJW S;  3G2X A;  3IWN C;  2MGZ A;  2OP5 A;  3OFE A;  1SC6 A;  5E2Q A;  1VQY A;  2QLX A;  1S6O A;  2UVW A;  2HBQ B;  3IG1 B;  3KJN B;  1FJE B;  1RWU A;  2FJE B;  5HRO B;  4DV0 J;  3A13 A;  1HNV B;  3RYL A;  2DR5 A;  3NNA A;  3HVR A;  3CJK B;  3IBC B;  4LRB A;  2BRK A;  3JTP A;  1O5J A;  2RF2 A;  4QW9 A;  3CUN A;  2JJ4 D;  4Y2M A;  2CJY B;  2XY5 A;  2FVQ A;  4CO1 A;  4PG8 A;  1FJG J;  3CD6 S;  5IC4 B;  5J1N A;  1QY7 A;  1UW9 A;  1QM9 A;  4A46 A;  4X4P A;  3RBX A;  3G6E S;  1OJ4 A;  3K57 A;  3HXM A;  4LSN B;  1KFD A;  3QYY A;  2ZH7 A;  3ZO7 A;  4DUZ J;  3JSB A;  4MFB B;  1RWP B;  2BXJ A;  2ZDO A;  3OQ2 A;  3S7R A;  1SKS A;  1RT3 B;  1VC5 A;  1PIL A;  1VYA A;  2FHM A;  3OT9 A;  3UCU P;  1H7X A;  3D3B J;  4F7V A;  1VHI A;  2HGL A;  3HPO A;  2BX6 A;  3V6K A;  2CUY A;  1SJR A;  3ENV A;  2I2Y A;  4F4X A;  1B7F A;  1MN9 A;  1NH7 A;  4EBC A;  5AE3 A;  2HYI B;  2GHV C;  2Z2L A;  3MM7 A;  6FDR A;  2KXH A;  4CLT A;  3EPG A;  2ZHA A;  1RKJ A;  4NWB A;  4UF4 A;  4DF8 A;  1FXL A;  1P6T A;  2LKZ A;  3H59 A;  4ED1 A;  5HQ8 A;  3DRR A;  1WDD A;  4KKO A;  3TA1 A;  1Y0H A;  1TL3 B;  3UDL A;  4H4M A;  4U6P A;  3BSO A;  1YIJ S;  1HNX F;  5MAO A;  2V2V A;  1OWX A;  3IP0 A;  3RRG A;  4CYU A;  3P49 B;  1WNE A;  1S1W B;  1JLF A;  2Y0S D;  3LF0 A;  4HHU A;  4RUH A;  2G9O A;  4OZJ A;  1KEK A;  4J9S A;  3TVY A;  2LQB A;  3RZA A;  1SL1 A;  2DXE A;  1Z1Z A;  2BDP A;  1DY3 A;  1VRU A;  3S1T A;  4DR1 F;  4WYL A;  2HHW A;  1NCL A;  5E3C A;  4DHV A;  3AY0 A;  1P1L A;  3NGT A;  3QAU A;  1IKY B;  1FWL A;  2QMU B;  8AT1 B;  4C3K A;  3D1Q A;  1URR A;  2I9S A;  1QVG R;  1FEE A;  1NHU A;  4P10 A;  3DMJ A;  2DCU B;  4LR8 A;  1WEZ A;  2IRY A;  1VHF A;  2MZR A;  3C19 A;  3OD2 A;  1LXJ A;  4ETZ A;  1WJ9 A;  3FBB A;  5A76 A;  2ILY A;  1RGV A;  3MM5 A;  3TRG A;  3U1L A;  3MTJ A;  4OZL A;  4FF2 A;  1NDK A;  2DGU A;  2JFK A;  5HAO A;  4GRS A;  1HNI B;  4M5L A;  2EWH A;  2WB4 A;  3SQO P;  1SKU B;  2DCL A;  2AYG A;  1RTI B;  1XWL A;  4C9D A;  2VKR A;  3PW5 A;  4H4O B;  1RAA B;  4OZN A;  5KFL A;  5KTQ A;  3IM9 A;  4ELT A;  1EHW A;  3WC0 A;  2GAH C;  4ECX A;  1FNO A;  4NRU A;  2EPI A;  4MIB A;  2NXE A;  4QR2 A;  3OTO J;  4KE5 A;  1U8S A;  4WE1 A;  1LW2 A;  3FZ2 A;  4FNI A;  4EEY A;  1RAI B;  2HRY A;  3PDN A;  2MQO A;  4LQ3 A;  4HLB A;  3QGP A;  2GGP A;  2Z56 B;  5AT1 B;  4UQT A;  3J7Z T;  2O5D A;  2NRE A;  4LF1 A;  5KFB A;  4DLG A;  1Q53 A;  4DL6 A;  2M5Y A;  3KNA A;  3EWG A;  3CCJ S;  2KYX A;  5A8R B;  1F5B A;  3M32 B;  3RU0 A;  3M9M B;  1HBN B;  3B82 A;  4CO3 A;  1YRT A;  2EKY A;  2PN6 A;  2E7V A;  2PGC A;  5LJ5 Y;  2VQF F;  2NSC A;  1S72 S;  1QAY A;  4QIF A;  3OXF A;  3QAT A;  2H3E B;  4FVM A;  2W7P A;  5L8R C;  4IR9 A;  5ETN A;  1RT6 A;  4A8Y A;  1LWX A;  2YQ3 A;  2XUL A;  4RR5 A;  3VGV A;  2XM3 A;  4DF4 A;  1U48 A;  2F4V F;  4DR4 F;  5F9L A;  2ALZ A;  2XS2 A;  3N01 A;  1ZA2 B;  2M9K A;  3SI8 A;  2W2O P;  4LSL B;  4QIE A;  4RX6 A;  4XDC A;  5KFG A;  4K2J A;  2RIL A;  4ECZ A;  1CJV A;  2QA2 A;  3ZZT A;  2MY7 A;  4NLV A;  4K59 A;  2HVZ A;  2FC9 A;  1SBR A;  1LK5 A;  3IWX A;  5L1J A;  5B0F A;  2XMU A;  5H9E K;  2HKE A;  3K8V A;  4C8M A;  3BB5 A;  4QCL A;  1XBW A;  2HWH A;  3DLG B;  1JLB B;  1XQI A;  3EMT A;  2AYM A;  2QX0 A;  2GA7 A;  5L9N A;  1FE0 A;  2RH3 A;  2R7O A;  4RW7 A;  1HYS B;  3QZ7 A;  5THW A;  5KFT A;  4OJ1 A;  3ZNJ 1;  4CH0 S;  1UWA A;  1WC5 A;  3CPW R;  1D9D A;  1TAU A;  1R8C A;  3AHP A;  3R5C A;  2M8H A;  2K06 A;  3JSY A;  2VG7 A;  3GE9 A;  4HH1 A;  5HK4 A;  1K47 A;  2RAQ A;  1CUL A;  2YX4 A;  3DNC A;  4J7C A;  4D3G A;  1R6V A;  1ZTT A;  2FVR A;  2RDI A;  3CJS A;  2ZH8 A;  3GFZ A;  4F25 A;  4TKT A;  2YPY A;  5G0R A;  2B9E A;  3BPS P;  3LAL A;  1GMW D;  2N4D A;  2B8Q A;  1R0B G;  1X60 A;  3BV8 A;  3M8Y A;  3PM9 A;  2ZWO A;  4ZJQ A;  5CYJ A;  1ZPV A;  3EZ5 A;  3RBD A;  1A9N B;  1IBM F;  3EIC A;  1S9F A;  3KDO A;  1RHM B;  2V8P A;  4C0H A;  1HBM A;  4F3Q A;  4CRJ A;  3LO3 A;  3KLF B;  1X9M A;  2ASJ A;  3W60 A;  3NEK A;  1S6Q B;  2C2O B;  2EFG A;  3IR7 B;  3Q2T C;  3MR2 A;  1T11 A;  3CCR S;  2YKM B;  1DTT B;  2Z30 B;  1JKH A;  3A8E A;  3SV3 A;  1VIX A;  2KHC A;  2LCW A;  1ZH5 A;  4ID5 B;  4CLY A;  2WVC A;  4FKY A;  3OV7 A;  1QLN A;  4NEY A;  2IFX A;  1VLY A;  5B0B A;  2CJA A;  4USU A;  4I2P B;  1JKH B;  3TUI C;  3M8S A;  4HTI A;  4DX8 H;  1F60 B;  3CJ2 A;  3F73 A;  3QSY B;  2AU0 A;  1N36 J;  4JI4 F;  2E5H A;  4FF4 A;  1SV5 A;  1TZ0 A;  5GAD I;  5HBM B;  5GAH U;  2ERR A;  1H6K X;  4HH0 A;  1MNE A;  4NCB A;  4MK7 A;  3FMB A;  2ZC3 A;  1KHW A;  2IYI A;  4QWB A;  2BOA A;  2ASL A;  4KGK A;  1A0O B;  2DNM A;  1ZOT A;  1UPP A;  3D67 A;  2GVD B;  4NMX A;  3VTI A;  4QWD A;  5K8O A;  3NRB A;  1FWP A;  1CQM A;  2XMT A;  2D9P A;  4NA2 A;  2EBG A;  5D0R A;  2BAN B;  3NKY A;  3AA8 A;  1Q16 B;  2KZM A;  1KLM B;  2ZBP A;  4OV1 A;  2QV6 A;  2XBP A;  3WBZ A;  4A8O A;  1X4F A;  3KJV A;  3I0S B;  1FA0 A;  2OGU A;  2UZA A;  1OY6 A;  3TAM B;  3BJY A;  4F50 A;  2VOO A;  1OMS A;  4PWW A;  2BAN A;  3PJW A;  3PG9 A;  1AB8 A;  3MWB A;  1EX8 A;  1CS4 A;  3LTO A;  4GO7 X;  4CLF A;  4NYZ A;  3DCA A;  1HWJ A;  4IFY A;  1R3N A;  1WD6 A;  2LQ9 A;  1XR7 A;  3HFK A;  2C3M A;  4IOB A;  5CZX A;  2PT0 A;  3FSY A;  2HLU A;  4WP9 A;  4YY3 F;  1L3V A;  3OR1 A;  4B9U A;  5K14 A;  3MAQ A;  4LRF A;  1T02 A;  1WEL A;  2GIF A;  4CQ1 A;  3F56 A;  5HBM A;  2L9N A;  3A12 A;  2WB1 D;  1CUL B;  1UW4 A;  1ZAV A;  4PQA A;  2KVI A;  2W25 A;  5E41 A;  2HRT A;  3QZ8 A;  2PO4 A;  2HVD A;  4DR3 J;  5J2N A;  4OL8 A;  5ETQ A;  1O8B A;  1JJC B;  4NPO A;  3H2U B;  3MED B;  4IO9 Q;  4DR6 F;  1YJT A;  3CCT A;  4OZ0 A;  3IRX B;  4JI1 F;  2HEK A;  7FD1 A;  3HZG A;  4KQZ A;  3DRS B;  3ETO A;  1DTT A;  1UEU A;  1JLB A;  2RRN A;  1VRT B;  4FVC A;  4H4K C;  1SJQ A;  4CNY A;  3MPW A;  1S12 A;  3CXC R;  1I94 J;  2B4V A;  5EX3 A;  1AA1 B;  3CJQ A;  5A8R A;  2UU9 J;  2CPJ A;  2HSE B;  3HT0 A;  3KLH B;  3B4M A;  4IDK A;  3M7V A;  3NGD A;  2K8G A;  2PI5 A;  2D69 A;  2B4P A;  2HW3 A;  2BYC A;  4OI1 A;  2ATL A;  1FE4 A;  3CCV S;  1WTB A;  2MKK A;  4HT7 A;  3UD3 P;  1VQ9 S;  2AF6 A;  2OAU A;  5D3G A;  4X4V A;  4I0W A;  1OQ6 A;  3AD9 C;  3BM7 A;  4CWB A;  4Z7C A;  3AOB A;  3TQ1 A;  1LW2 B;  3H8Y A;  1KQS R;  3HKW A;  4NZ6 A;  1EAR A;  3DXB A;  2V4Q A;  3G6Y A;  3HHN B;  2OFG X;  1NJI T;  2RU9 A;  3GJT B;  3PYG A;  1FTC A;  3BH7 B;  2PDA A;  5SUH A;  3MFI A;  1WHX A;  1EJ7 L;  3MI7 X;  3QO9 B;  2EFV A;  2YKO A;  2V69 A;  3Q8V A;  4H4O A;  2C2D A;  4DFM A;  1H98 A;  1SUQ A;  3MD3 A;  3W3S A;  3FEZ A;  3KLG A;  1WWH A;  4RJV A;  5KG0 A;  3CIZ A;  5CAA A;  4DN0 A;  2ZBR A;  2RQC A;  5AXK A;  1BE4 A;  4ZK7 M;  3TZZ A;  2R8G A;  2EBE A;  2ASY A;  4HDH A;  4NXM J;  4OX8 A;  2QG9 B;  5FLX U;  2ATC B;  3R7B B;  1RT4 B;  3CT9 A;  4BS2 A;  3SEO A;  1RAB B;  1BHN A;  2HQ3 A;  1AZS A;  2QLJ B;  2ZOM A;  3L9Z A;  2BE7 D;  3NS5 A;  4OX9 F;  4A48 A;  3HJV A;  4IH6 A;  3BQ1 A;  1Q7Y T;  4B3T J;  2W2M P;  3K89 A;  4GKK J;  3RG6 A;  3GJQ B;  1RT6 B;  4PWU A;  1VDH A;  1KOH A;  1KP6 A;  4R5P A;  4G6V B;  3LAK A;  4V19 X;  3OHA A;  1GX5 A;  3OJS A;  4OX6 A;  2UUB F;  2E5G A;  2WRM A;  3ENQ A;  2XYH B;  1NK0 A;  4NCG B;  1J27 A;  3OR2 A;  4IO1 A;  4W4M A;  3UNG C;  3T19 A;  3W5Y A;  5J1E B;  1L3U A;  3CJ5 A;  4ELU A;  2CDR B;  2KZZ A;  2RNE A;  2QT7 A;  1T94 A;  1WG4 A;  3R5B A;  2OD4 A;  4ZS6 A;  1S0M A;  1BLU A;  4JI7 F;  3EE3 A;  1TL7 A;  1LW0 A;  2C2K B;  3FQL A;  3EGN A;  4DV4 J;  4DPY A;  3QPI A;  1HWU A;  3K59 A;  5F0U A;  1SH0 A;  1JLQ A;  1BQN A;  3GV5 B;  2CJK A;  1RBL A;  2DIV A;  1RT1 A;  2F40 A;  3DGP A;  2YKQ A;  3JS9 A;  1TL1 A;  3GQC A;  4MFB A;  4KSE B;  1GTE A;  4K4U A;  1F1B B;  4BDP A;  4YB7 A;  2KFN A;  2FJV A;  3PEH A;  2KJV A;  3V4M A;  1FRJ A;  3ENW A;  2VJU A;  4YEA A;  3LQV A;  2ZUG A;  4DL0 C;  4JI0 J;  1S1U A;  3DLK B;  4CTA A;  1S0O A;  1ZS6 A;  1JLA B;  3MM7 B;  3CIM A;  4KGM A;  2HRU A;  1J5E F;  4UTG A;  4K8R A;  5KFA A;  4X62 F;  2DGQ A;  3BQ0 A;  5KG4 A;  1KD1 T;  5DDP C;  3ET6 B;  2X1A A;  2XWY A;  3H4B A;  2R7U A;  5EHH A;  2DKO B;  2OPQ B;  3GV7 B;  3ZZO A;  2ZH2 A;  4MKY A;  2RHS B;  4LSN A;  4JV0 A;  3MCO A;  4PPZ A;  5K9F A;  1RCO B;  1FHT A;  1S1U B;  4GMK A;  3SFU A;  2MGZ B;  2D7S A;  2RQK A;  4KH0 B;  2OPP A;  1OO0 B;  2FLO A;  2XQC A;  4ZJO A;  3W66 A;  2KO1 A;  4YR3 A;  2OTL S;  2VOD A;  3DN9 A;  4ZPT R;  1NHV A;  3FBF A;  3F44 A;  1IUJ A;  4M5J A;  2B9Y A;  2LU1 A;  4O4G A;  2J9E A;  2X51 A;  4QQB A;  3UWT A;  5KG2 A;  3GSD A;  1SL0 A;  3CJK A;  2Y9H A;  1YG0 A;  4RU9 A;  3NGS A;  2XC9 A;  3PR4 A;  1Q82 T;  1FF2 A;  2WSE C;  1HNV A;  4ZPD A;  3IGN A;  3CW2 C;  4NLS A;  1ICE B;  2M52 A;  2LEB A;  4X4O A;  2BM1 A;  1Q1K A;  3KG0 A;  3HHL B;  1KVJ A;  3TW0 A;  5ETR A;  1RT7 A;  1HBU A;  1H74 A;  3QLH B;  1TTH B;  3VR1 A;  4F2S A;  1P27 B;  4ZN3 A;  4RW4 A;  4BWM A;  1RT4 A;  2FZG B;  2VG6 B;  2BVZ A;  3B78 A;  3C15 B;  5DQH A;  2Y1J A;  2KYZ A;  4WU2 A;  1RAO A;  1RBO B;  3V81 A;  2CAD A;  4C7Q A;  3UNY A;  5LMU J;  1Y5I B;  3C16 B;  3BBF A;  4FF3 A;  4DV6 J;  2RS8 A;  3H2V E;  4ZLJ A;  5FD1 A;  2VPZ B;  4KT0 C;  3JYT A;  2IRU A;  4U8Y A;  2K1R B;  3QO9 A;  4LJM A;  4C48 A;  2PFF B;  1NSK L;  3BZQ A;  3HVW A;  1P9Y A;  4Y34 A;  5LSR A;  3PNI A;  4RW8 A;  1RHR B;  5DDO C;  5H9E J;  4LF4 J;  4IH5 A;  3R1L A;  3V6D A;  3SSS A;  3MEK A;  2H51 B;  2MPU A;  1RK8 A;  1SPB P;  3IG1 A;  1RJJ A;  3M1V A;  4M5D B;  2VOP A;  2HFO A;  4I68 A;  2CQI A;  3KKF A;  1JLC B;  5KG1 A;  5HMW A;  1PAU B;  3TZY A;  4AL5 A;  3MR3 A;  1ZZN A;  1KQK A;  1K0T A;  3I31 A;  1TAQ A;  3AAW B;  3UR0 A;  1I6J A;  1L3T A;  1BXN A;  3KOA A;  3GZ7 A;  5J2P A;  5L1K A;  4F4A A;  3K5L A;  1EP4 A;  1JLE A;  2AQ4 A;  1R8A A;  1Q0N A;  3OJU A;  1YJN S;  4LF5 F;  1M5S A;  1OY8 A;  1Y00 A;  1S9G B;  2LA4 A;  2POK A;  3R5D A;  1B0T A;  5C42 A;  1HBO A;  2MTL A;  1Y7P A;  2Y0B B;  4IH7 A;  2I5J B;  5F8I A;  1C0T B;  3CSK A;  4MKV A;  1XN9 A;  4TQS A;  2QA4 S;  1C0T A;  4N41 A;  3CJR A;  1H2U X;  1HBO B;  2WOM A;  4NL5 A;  2C2E A;  3C14 B;  1X9W A;  4LFC J;  3JAM Y;  4U9R A;  4JYA J;  2HVI A;  2IVY A;  2FHJ D;  2BQR A;  3G96 A;  4LFA F;  4KHR A;  2ZC4 A;  5JVG Q;  1WC3 A;  4WPA A;  2CQ0 A;  1RQ0 A;  2CQH A;  2GX8 A;  4WXO A;  3ADA C;  2VQE F;  4X64 J;  1HR0 J;  4UY8 5;  4RLE A;  2MQP A;  4OI3 A;  4USJ C;  1HWI A;  4B3S F;  2V50 A;  2J7K A;  1RAF B;  4TNO A;  3ILJ A;  5CCL A;  1HQE B;  2H54 B;  3QWU A;  4K4V A;  1U6B A;  4GKJ J;  4M5H A;  1HHT P;  4JV2 A;  4HTJ A;  4E8U A;  4OYA A;  5F3Z A;  1CJT A;  3BEG B;  1DRZ A;  3QT7 A;  1EQ0 A;  5IT9 Y;  3Q2S C;  3MF5 A;  2CJB A;  4QIV A;  5LM7 E;  3Q8S B;  1GEH A;  4WII A;  2CPF A;  3EPI A;  3EGZ A;  3IA0 A;  2LA6 A;  2V63 A;  4IRC A;  2BKO A;  3E8O A;  5ETS A;  1N48 A;  2Z0G A;  1FVS A;  3C16 A;  2PMW A;  2ZVI A;  3DLL Q;  1RCX B;  3A8J A;  1RI7 A;  2N3L A;  4EFA C;  1J5O A;  1GH8 A;  2UV8 G;  4RW4 B;  4QU6 A;  1XMO F;  2J6S A;  4CP5 A;  3M2U A;  4K0K J;  3KJV B;  3M9N B;  3KK3 A;  2LU2 A;  1RAH B;  2BKN A;  2R9L A;  3VQT A;  1N5S A;  4YOE A;  2H65 B;  3D6F B;  1AT1 B;  2BV3 A;  3HO1 A;  2VDH A;  2FVS A;  3DLE A;  4LRE A;  4KFB B;  2MKI A;  3MMJ A;  4I7F B;  4N7T A;  4DU8 A;  4EO8 A;  5HQL A;  5A0Y A;  2AD9 A;  3I6P A;  5M2P A;  1HNW F;  1NAQ A;  2V9K A;  3GR0 A;  2DHH A;  2KG0 A;  2A0F B;  2WCX A;  1WI8 A;  1TVR B;  3DFE A;  1NSA A;  4EI2 A;  4X4S A;  4ILM A;  2AJQ A;  1FER A;  2BJD A;  5B7W A;  4YHH J;  3F41 A;  2W4P A;  3AOC A;  3KMS A;  2ZM6 F;  1RT7 B;  3IBW A;  3M8R A;  4HHH A;  3IGV A;  2GQ2 A;  4DQR A;  3OFG A;  3I9Z A;  1NK8 A;  1PCA A;  2KU7 A;  4TY8 B;  2AT1 B;  2ZBI A;  1TKD A;  3IS9 A;  1YBA A;  3D1O A;  4M5G A;  2HZA A;  1B4S A;  3W2W B;  4UY8 T;  4XIU A;  3MM8 B;  3QID A;  4OYP A;  3Q8Y A;  2XCP A;  1DAX A;  1FTR A;  2HHH F;  4NML A;  4GKJ F;  1MRO A;  2XY6 A;  2ZFH A;  4LVO P;  2R7R A;  3CCQ S;  4H4K A;  1Q79 A;  3VZI A;  2ALY B;  2QYG A;  4M5K A;  4B9V A;  2RDD A;  2OPP B;  3DLG A;  3FQK A;  4OHY A;  3VZH A;  2ZH3 A;  5JUM A;  1ELO A;  4MT1 A;  3GV8 B;  1T9W A;  3V5R A;  3W8G A;  2J8A A;  1R8P A;  5KFJ A;  1U49 A;  1QTN B;  4DR5 F;  1RAG B;  2DGV A;  2VPX B;  3T1H F;  4WFA Q;  1R27 B;  3BN7 A;  2VG7 B;  2OEM A;  1H7W A;  3CE8 A;  3TAR A;  3VAL A;  4DR4 J;  2B6A A;  5D4L A;  2AGP A;  4AYB D;  1HYS A;  1LW0 B;  2YXL A;  4MYU A;  2L3M A;  5BYR A;  3LWM A;  2JH3 A;  2CPE A;  4ER8 A;  2QL5 B;  1FK9 A;  3FK4 A;  2DNR A;  2GVZ A;  2KG1 A;  1S6P A;  3O2I A;  1HPZ A;  3CCE S;  3UCG A;  1UVN A;  5MLC V;  3HHE A;  1I3O B;  4UOC A;  4DJB A;  3RB4 A;  4LRC A;  4DSL A;  3BBB A;  3TA0 A;  3N0V A;  2YNF B;  3PFO A;  5KFZ A;  4B9T A;  1DUR A;  2R8K A;  2FGO A;  1U6F A;  3EXY A;  3FCH A;  3V6J A;  2ZD1 A;  3SMZ A;  3R97 A;  3MEC A;  1UWB A;  2UUA J;  4O0N A;  3OSN A;  1S0N A;  1DQA A;  1I1G A;  2FGC A;  4OLO A;  2VPW B;  5T7L A;  2CZV C;  3ZZP A;  3KK1 B;  3J7Y I;  1WG1 A;  4NLO A;  4UUW A;  3OLB A;  4FS2 A;  1TFY A;  2CPH A;  4DV7 F;  1UWB B;  1MML A;  1XNR J;  1Q7L B;  3CC2 S;  3QIP A;  1KRP A;  3IN5 A;  1C1C B;  4FDF A;  5L39 A;  4K4S A;  2KFZ A;  1CPZ A;  1S7I A;  1U1O A;  4KO0 B;  5GAG I;  2VPY B;  1TV6 B;  2XSJ A;  4OI4 A;  1UZD A;  2K7K A;  2Y8W A;  4K4Z A;  3W64 A;  1CJU B;  4WTO B;  2C3O A;  1V3R A;  3K58 A;  4QIG A;  1S4F A;  1EET B;  1LQ9 A;  1RHU B;  2WAQ D;  4O23 A;  5HSP A;  1GX6 A;  1O0P A;  2FJA B;  3N6N A;  4DPT A;  1ZYQ A;  3M8W A;  4LVN P;  1T9T A;  4ED0 A;  4IG0 B;  4DV2 F;  4DUY J;  4O44 B;  1TUW A;  3ETM A;  2EC2 A;  4NLT A;  1U1Q A;  2YWK A;  2UUC F;  5L1I A;  2J0S D;  3CO0 P;  3ITH B;  2V8H A;  2UUA F;  2JSX A;  4YDX A;  3DM2 B;  4JV5 F;  1RWN B;  2OD6 A;  1VBZ A;  1GFW B;  1RZM A;  3MCN A;  3SDE B;  1SB6 A;  4H54 A;  2XB2 D;  5DLF A;  1YJV A;  2OI2 A;  2ZBC A;  3EGW B;  1VQN S;  1S5Z A;  2JLE A;  5F9N A;  1M5V C;  4H4M B;  3MEE A;  3ZTQ A;  4ZVG A;  1Z4U A;  3OLA A;  2HG4 A;  1ZET A;  1C1C A;  4ZPA A;  4FBU A;  1DLO B;  1WOR A;  3I0R A;  1HL6 A;  2WW8 A;  3D0H E;  2ZZT A;  3Q86 A;  4QJV A;  1NDC A;  5IC6 B;  4Y00 A;  3W9H A;  1Z2L A;  2HFU A;  4ECU A;  3KHR A;  1JXL A;  4DR3 F;  2DGT A;  4OZ5 A;  5M2R A;  4DDF A;  3T6B A;  1HNZ J;  4PUO A;  3HVT A;  2XZW A;  4ED8 A;  2B6A B;  5FDL B;  4YFU A;  4NZ7 A;  4J37 A;  5B09 A;  1VCT A;  4J9Q A;  1TKT A;  2GJF A;  3BR9 A;  4ITS A;  4QPX A;  1D8Y A;  3J81 Y;  1CC8 A;  3L4B C;  2QEX S;  3QRQ A;  2RU3 A;  1MN7 A;  2P2C B;  2E5L J;  2AP6 A;  1Q5Y A;  2O67 A;  3K8W A;  5K14 B;  1JK9 B;  2B3T B;  4CO0 A;  1B99 A;  3R2D J;  2GHW A;  1VRT A;  1X4H A;  1ZM4 A;  2AJ1 A;  2MEW A;  7FDR A;  4LSZ B;  2G0I A;  2HZV A;  2HIQ A;  2MKJ A;  4IFY B;  5D4P A;  4W98 A;  1U2F A;  1PC5 A;  3PKM A;  2GNK A;  1LKZ A;  2V4J B;  3AD8 C;  1M5P C;  4DFK A;  3MM8 A;  2ZBQ A;  3ZZ0 A;  1FFG B;  3WX8 A;  1NEE A;  3ZTP A;  3PIO Q;  1DAR A;  2M7S A;  4RNN A;  3IRW P;  4OHW A;  1M5O C;  1NJY A;  3NMR A;  4C8O A;  1PBA A;  4BHQ A;  2LFV A;  2W9C A;  2IBK A;  4O3R A;  4FF1 A;  2GIQ A;  2HNZ A;  3T1H J;  1UFK A;  2NXU A;  1SL2 A;  2FJX A;  2DR8 A;  3KLV A;  2HFZ A;  3O6Q A;  1FRH A;  1UVK A;  4G1Q B;  4XO0 A;  1TVR A;  1YGY A;  3GCW P;  2KM8 C;  1CSJ A;  5HMZ A;  4J9K A;  4F0M A;  2CWX A;  4O3S A;  2X7I A;  5HMX A;  2RF2 B;  2YWE A;  4DSK A;  2M4M A;  4DL3 A;  1T9V A;  2CJX B;  2EG1 A;  3D28 A;  1GT8 A;  1WF1 A;  2CFX A;  3GWC A;  1RTZ A;  3BN4 A;  4I2Q A;  5D4N A;  3OTO F;  3Q22 A;  2V9W A;  3QNW B;  1N5Q A;  3PJ9 A;  3D9B A;  1SI9 A;  3DYA A;  3L09 A;  3KMQ A;  5H1S V;  1RE1 B;  4I6A A;  1FXD A;  2CVE A;  4B08 A;  4RUC A;  1JWW A;  1HMV B;  2FY1 A;  1PBU A;  3C8Y A;  1F9E B;  1S9E A;  1WSR A;  2Z58 B;  2GVD A;  3C2P A;  4M94 A;  1D9A A;  4RW6 B;  3QT6 A;  4IG3 B;  3GSI A;  2MQ8 A;  5L9X A;  1IBL F;  3QRP A;  1JJH A;  2R7T A;  2CVI A;  3M8Z A;  3V6H A;  2DH9 A;  3MDF A;  3CUL A;  3GG0 A;  2DHS A;  1SV5 B;  2QSW A;  4IUF A;  2CJ9 A;  2R42 A;  4PYD A;  3OTD A;  2J0Q D;  1A6L A;  2O1P A;  4GVB B;  5DGB A;  2BOP A;  1SXL A;  2VBY A;  2RB7 A;  2IJF A;  3NAI A;  5G0R B;  2Z2Z A;  3OVA A;  3UVJ A;  5HO4 A;  3KHG A;  4EBE A;  2UXD F;  3HFZ B;  3RBE A;  4P7V A;  2GFF A;  1HNX J;  1BWV A;  4ID5 A;  1NDP A;  3NP5 A;  3M2U B;  2K7J A;  1OS5 A;  1WI6 A;  3BSA A;  4CLS A;  2ZJQ Q;  3GIJ A;  2DO0 A;  2A1B A;  3MM9 B;  2HQG A;  1JLE B;  1KKH A;  2X1B A;  5DDR C;  1FKP A;  1H73 A;  1HQE A;  1DQ8 A;  3GMG A;  2MQM A;  2CPY A;  4ICL A;  3QWP A;  2C2M B;  1ZBT A;  3VVT A;  4FBT A;  2XS7 A;  4A8X A;  2G4B A; 
#chains in the Genus database with same CATH homology
 2MLY A;  2D3O 1;  1P9Y A;  2MLX A;  2MLZ A;  3GTY X;  3GU0 A;  1W26 A;  1OMS A;  1T11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...