1P9YA

Ribosome binding of e. coli trigger factor mutant f44l.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGLRKGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chaperone binding at the ribosomal exit tunnel.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Trigger factor
total genus 32
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1050 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Trigger factor ribosome-binding domain 1p9yA00
1OMSA 1T11A 2MLYA 2MLZA 3GU0A 1P9YA 3GTYX 2MLXA 1W26A 2D3O1
chains in the Genus database with same CATH superfamily
4N7TA 2BX6A 4OX7A 3W61A 1S9GA 1VJQA 2RF2B 3ENQA 2M88A 3KFWX 3QT6A 3BYPA 3CCJS 2Y1IA 2HBYB 1JLFB 3X3UA 1ZAWA 2RB7A 2ZH7A 1U1PA 3R2DJ 3PDNA 2E1AA 3MR7A 1TFWA 1WELA 5J2QB 3ZZTA 1I6JA 4NLGA 4K4VA 4LUBA 2DRAA 1UWBB 1RAAB 3VAKA 2C42A 1FWKA 2ABYA 5LSLA 3THTA 1WOSA 1WTFA 3AQOA 3FSXA 1SC1B 2R2RA 4C11B 4C3MA 2CQCA 5KG7A 1SQEA 2ZHAA 4ELTA 2F4VJ 1LK5A 2CPIA 1NJWA 1J5EF 4NLRA 3VGVA 5I4MA 3I9V9 2AU0A 2M52A 4LQ9A 5CYJA 3FVYA 3M6VA 1IR1A 4LSLB 5E41A 2NZCA 4HDGA 2DGOA 3AT1B 1RE1B 4F0MA 2H1YA 4OYXA 3BS9A 3W3SA 4B3MJ 1U6FA 2C28A 4RW7A 2VOOA 1RT1A 4CLWA 1IQTA 4DL5A 1N36J 3QWPA 3H59A 2PN6A 3DI6B 3LP0A 1HNZJ 4H4MB 5HSPA 4Q8FA 3DXBA 1IWGA 2PFFB 1R0BG 3JTNA 5B0AA 1YRXA 2HEKA 3HD2A 3OXFA 4P9SA 1BLUA 3W2WB 2VQEF 3D6MB 4UOCA 2DNZA 1IN0A 2Y0SD 2WVBA 1X4GA 2CKWA 3EXYA 4FS1A 1YZ7A 4CDIA 2MQLA 4ZVHA 3LP2B 2ZJQQ 1U7LA 5I3UB 2BXJA 2QFJA 3D0HE 1VQ7S 3FBBA 3G82A 4X65J 3I0SB 4A8QA 3MMJA 5B0GA 4CLKA 2NYIA 2XMKA 3CJRA 2AW0A 4NI2B 4OX6A 2RT3A 3AB4B 2O5DA 1RHUB 3H8YA 1WJ9A 4PAAA 2NLWA 5LXRA 5DQGA 5HVHA 3EYZA 4DL2A 1L3VA 2JX2A 2Y0BB 1RQ0A 2F65A 3I82A 5CYMB 4C2MA 2UUCJ 2RQ4A 2JL9A 3KG1A 4G1PA 4DR1F 3KNAA 2BMBA 3IBCB 3MCSA 1B99A 1OO0B 4CI0B 1S0VA 4RNMA 1RBLA 3SCKE 3N9UC 4I67A 4HACA 2VL1A 2MY8A 1QTMA 4B3SJ 3PYFA 3JAMY 1JNRB 1Q78A 4WFXA 3M05A 1CQMA 2PA8D 3GQCA 4G1QB 1MROB 3EVOA 3F0NA 1SKUB 5E2QA 1XR7A 4UTGA 1NB7A 3OFHA 1KDNA 2FD2A 3C15A 3MM7B 4MKVA 5EHHA 2ZJRQ 3QRQA 4IFYB 3D7SB 3CJTA 1IM4A 3W5YA 4ECYA 2ZD1B 2XWYA 3FGVA 4OHXA 4XDCA 4ILLA 3HF5A 2JJ4D 4XK8C 2ZH1A 2ATLA 3KLHA 2DO0A 1N34F 4MIWA 2OIHA 3DDKA 3GJQB 1NZ8A 1FE4A 2BV3A 1WC3A 2BYCA 4DN0A 2MGZA 3G6YA 2AGOA 1NJZA 3EUNA 2E5LJ 3P6YC 4NXMF 2HKEA 4FP9A 2HRTA 4DL6A 2W2MP 2VBYA 5A0YB 1P1LA 3MPYA 2JSXA 1O51A 1VS3A 4CTAA 6FDRA 3PR4A 2W4DA 4URQU 1VFJA 1ZTTA 2RILA 4OYBA 2C3YA 4C0HA 2JHEA 4LBPA 3R5AA 2AX0A 3B8HA 4LT6A 5J2MA 1U49A 4LIWA 2BQUA 4NXMJ 5H9FK 4ED1A 2KZMA 2O66A 2RKIB 1HKAA 4M5GA 4JBCA 3V81B 4ELUA 2QMXA 1UMJA 3N5BA 2M70A 2KHDA 1OQ3A 4JI4J 4NLXA 1VC6A 1XNQJ 3NNCA 3CDUA 4FYVB 4WIQA 1H7WA 1EARA 3BQ2A 5LJ3Y 2ZEJA 9ATCB 5DM7Q 2EFNA 4F3MA 1X4DA 3MMAA 1H6KX 1GTHA 2HWHA 1YBUA 2C3MA 2YNIA 1HNZF 4NLPA 4L72B 4CT8A 2IVYA 4NX9A 5HROA 1NK5A 2YWHA 2EFGA 2R7QA 4AD6A 3DGPB 3R5JB 5E3CA 3BYRA 2KT5A 5H9EK 2FHOB 5THWA 5F8GA 2ASDA 4C8YA 2RUGA 2ZITA 3DDIA 5LJ5Y 3MMBB 4YR3A 5K8PA 4CNYA 1HBMB 1PG5B 4C8ZA 2G0CA 1EAYC 3PKMA 3CNQP 3ZZPA 1FX2A 1S1TA 2POKA 1KTQA 2XI2A 2F9JA 3JSYA 4ZP8A 3TUJC 1UAWA 2XNQA 4B02A 1XERA 3PO4A 4YB5A 2YWKA 3BKTA 2UVUA 2GHVC 1OYEA 2BR0A 2F4FA 2HZVA 3KHGA 2HWIA 3CCES 2YXLA 1AZSA 2LQ5A 3K8VA 4B9UA 2DB1A 4H4KC 1QSLA 2ZE2A 2I2YA 1FK9A 2J0XA 2MZJA 3TX8A 3AXKA 3MEDA 1UVKA 3GIRA 3KXDA 5KFRA 4X4QA 1RDRA 5HI7A 1VK8A 3TX0A 5F3ZA 3R1LA 4XPEA 2J7UA 3H90A 3MR5A 5AJ3J 3EX7B 4MK7A 1NDKA 4GO5X 5B09A 3UCUP 3IGVA 2F5GA 3W63A 3JSRA 3NY0A 3W8GA 4QR0A 2P9CA 2H5IB 3B6BA 2ZZMA 2N7CA 4YR0A 2BM0A 1LXNA 2P2CB 2ZVIA 2DNOA 3CW2C 3BQ1A 3OW2R 2YWFA 4DR4J 2HHHF 2MXYA 4KSEB 4OZ3A 4P75A 4PXBA 5EX0A 4QWCA 3CULA 4LFBJ 2HVZA 3T1YF 2BQRA 4ZVQB 1TL3A 1IKYB 1VGYA 1FDNA 1FI4A 2R8KA 4RNHA 4DU7A 5JMNA 4DG1A 5IS2A 2BJ8A 1XNRJ 4OL8A 3MFHA 5IT0A 2XY6A 2ZJPQ 4HTJA 4ILMA 1UZHA 3TP2A 1YJNS 2XM3A 4RW8A 1C1CB 1S79A 1FTRA 2M8HA 5DDRC 3Q8QB 4F4KA 3AD7C 3KDOA 3UDEA 4CT9A 5GMDA 4Y2MA 2IM2A 5F0WA 4JI5J 1WHVA 1IBMJ 3I5AA 4NYPA 1CQNA 1KLMA 3ZO7A 3C46A 2MPUA 3CD7A 4QWBA 3CC7S 1U2FA 2X1GA 3CVKA 3ZNUA 1KFSA 3M6XA 4QZVB 3R5CA 4LIRA 1S9EA 2QL7B 2WZ1A 3VAIA 4JI1F 4UOGA 3K8WA 2MZQA 3MM5B 4WU3A 3KLFA 1NCLA 2ZUGA 3ZTRA 5L46A 2MZRA 3JTPA 5AJ3F 3TAQA 1GMWD 2QLWA 5CYMA 3VQSA 2F1FA 4NLSA 3N28A 2JZ5A 2FJXA 2UXDJ 1NKEA 1S6QB 2J8AA 3CCTA 5DG9A 3Q22A 1NM2A 4KGVB 5KT5A 2GJFA 2ZZTA 4P52A 2VQFJ 2AJFE 3ETMA 1C4AA 4I4BA 1R0AB 2E5LF 3Q2TC 5IT9U 1BMQB 4J7CA 4FDFA 2J5AA 1BWEA 4F67A 1IKWB 2ACMA 2H3EB 3HHKA 4IG3A 4OJ3A 3VVTA 4EZ9A 3CCLS 3PNIA 4KV8A 3W2WA 2Z2MA 3W62A 3LANA 1APSA 2EPIA 5HQ8A 3GIIA 1VRUB 3F44A 4RW9A 4KIAA 1RT5B 5CA5A 8AT1B 3FFIB 4TYBA 3BDEA 5LM7E 2XGQA 3GLJA 1WC0A 4ES1A 2HAIA 3MPVA 4L76A 5F3TA 2RHQB 4CO3A 3BO2A 2AP6A 1HWKA 4OX9F 4Z7CA 4JUZA 5KG6A 1UTAA 2PFDA 4OHWA 5DG8A 5C2GA 4FKXA 1G3OA 3ZZ0A 1N33F 1CULA 4H4OB 2ALYB 3H98A 3I9ZA 4DV2J 2E1RA 5HP1A 1RAGB 1L3TA 4ECWA 2WCXA 1LWFB 2XMWA 2B5JA 3M6UA 4M8LA 1C0UB 1KVKA 1X5TA 4WKYA 3OLBA 1T94A 2R8IA 1IKXA 4OI1A 2QT7A 3HSDA 3PZPA 2C2RA 3SQGB 2BANA 2CPEA 4NCGB 5KFYA 2VFTA 1U0HB 4JI0J 2KG1A 1V3RA 2HFOA 1Q7YT 3KMSA 1R8PA 3DRSA 4JI3J 3MHYA 2OUGA 3NWRA 2GV1A 5GADI 3PIOQ 1S76D 1NO8A 4EZ6A 3AA8A 2FY8A 4J5OA 2HHTA 2B43A 1SI9A 1FDAA 5HBMA 4RWWA 2G2ZA 1HNVB 1WG4A 2EFQA 3DLKA 3POTB 1GQEA 1HQUA 2H4YB 2QJ3A 3DNCA 2CNKB 2ACYA 3M8PA 3MM7A 1Y00A 2C2EA 2V8HA 4BS2A 3S6EA 1CVJA 3CC4S 1Y9OA 2JEFA 1H7XA 1MROA 1BQNB 1NLKL 4B9TA 3HMJG 3ADAC 1NZAA 3QLHB 3DGPA 3HXMA 4DS5A 1XWLA 3IO1A 2AYMA 4ZLNA 4LRBA 4LVNP 4DL3A 2LXIA 1S6OA 3B4MA 2OPPA 3GP9A 3W9IA 2IBOA 1HWIA 4JOUA 4B08A 2HG4A 4EWTA 2KO1A 4WK3A 1VR6A 3UCZP 1TL1B 3EZUA 1NK6A 4YFUA 4BHQA 2OO4A 3IG1B 5D3GB 5D8HB 4DX7A 2ZDOA 3LALA 4J91A 3IRWP 2Y8YA 5DZ7A 4OLPA 4UW2A 5K9FA 3U7JA 2E7WA 3DRXA 4ECTA 4YOEA 3RZAA 1CC7A 2HFVA 5G0RB 1EZZB 4EGLA 1ZA1B 2XHWA 3HZEA 1ROFA 2HBQB 1FXLA 1JLEB 4LSNA 2JLEA 1HR0J 3CD6S 1FK9B 4JI6F 1D1UA 4FN5A 4MMOA 1X4AA 1RTHA 3ILLA 1NK8A 3P96A 4CIOA 2Y8WA 4WXWA 1SKWA 1RB0A 2MKCA 4O4GB 5D77A 2NXEA 4O0IA 3ENWA 3QSYB 3V6HA 2HIQA 1T9TA 2V6AA 1FRIA 1QSSA 5AE1A 2XBPA 3P3DA 4DU8A 4Q43A 1NEEA 1E6VB 1Y5IB 3MEGA 3C6UA 1U09A 1N6QB 3OTDA 2NSBA 4FNIA 1WOOA 4WK1A 1VBYA 2YNGA 1T03B 4YDXA 2M7SA 3A13A 4ZOSA 3RJMB 4DPUA 2XHCA 2CPYA 4OX8A 4DR5J 1JJHA 3MMAB 3OQ2A 3HT3A 4JI4F 3E2EA 4KC5A 1EHWA 3MMBA 3CGIA 3MR3A 1TK0A 1P27B 2AMCB 5L1JA 5C7PA 2WRMA 5H9EJ 2RRNA 4B3SF 1SH0A 3CEDA 3R5BA 1K47A 2HLUA 4IG0B 2YTCA 4EO8A 2R7UA 1YJ9S 3AJ1A 1S1VB 2XYHB 5D4LA 2PC6A 4X4VA 2IM3A 5D0EA 1QY7A 1RWPB 1CJUB 2ZH9A 1TMMA 4OYZA 1PAEX 3QRPA 2IVMA 3LPEA 1N32F 2BZ2A 2EC0A 5D4OA 5E3QA 4X62F 4RZRA 4ZVFA 4O44A 4MK8A 2R8JA 4KBIA 2OPSB 1Q8KA 3IR6B 3W9HA 1RI7A 1FNXH 4ED8A 2GZOA 2KKHA 2CPDA 2JFKA 3RYLA 5EGYA 4FF3A 1PYTA 1H2UX 4CNZA 4ZPAA 1T05A 4P2SA 2NZ4A 2QL5B 4MIAA 4GKKJ 4G6VB 2VPYB 2DGWA 2GO9A 3M8SA 2OELA 1XQIA 4TY9A 5KFEA 3EZ5A 4DV4J 4DFPA 3NXZA 4YUDA 3LP1B 1X4FA 2J6TA 2ILYA 1XR5A 3DYAB 2MZ1A 4QWEA 1HI8A 3NG8A 1K8AT 1AFIA 2XO6A 1B0TA 1WF1A 4E2FB 3PEHA 3MF5A 3KJFB 2BKOA 3OR1A 1UPMB 3LP0B 2BANB 4M5IA 4NCGA 5ETQA 4Z2XA 4Q2MA 2R2SA 3GJRB 4PG5A 1SVDA 1QE1B 1UFLA 2CZVC 4M5DA 2KXFA 1UW9A 3DRSB 3PM9A 2DTJA 4Y3CA 1MNEA 5KFNA 1U1MA 4CLPA 1N6QA 4DJBA 4FYXB 1S10A 2HWTA 2D41A 2KT3A 2QN6B 1J5OA 2AT1B 2OH2A 1VQ4S 1RAHB 3PIPQ 1LK7A 4A48A 2RQMA 5KFPA 1T05B 1DJ0A 2V8VA 3GFXA 2O67A 5M2UA 4BBYA 1S6PA 2LU2A 2X1AA 1HR0F 4JI6J 1M5KC 2MKSA 4BCAA 3G2XA 4ZVOB 4CCHA 3H2VE 1MN9A 3Q8YA 3S01A 3FFIA 3TYTA 3PEJA 1J5EJ 1EQ0A 4LR9A 3LGHA 2BE2A 2M4MA 3DGVA 1JIHA 1LOUA 2IYIA 4RW8B 5GAGI 2OFGX 2F7VA 2CJXB 3AXMA 3CDWA 3D0IE 4EYIB 4RUBA 2CVIA 2D3ZA 4OLOA 4YB1P 2MQQA 3C19A 4CO5A 2HIYA 1CJKB 2YPZA 5F8MA 2K3IA 1TP7A 1JJ2R 5CZVA 1TUVA 4LBHA 1N56A 3S8SA 4DFMA 2KM8C 2UUAJ 3HLUA 2BQ3A 1KVJA 3WHIA 2KZZA 5L1LA 1G6BA 3T5HA 3FKBA 3HSGA 3IRXA 3DU6A 3OBIA 1YJUA 5U47A 3TVYA 3SFGA 3T5KA 1S6QA 2VQFF 4ZA1A 4IDKA 4E98A 1RT2B 5JVHQ 4OYIA 4ICLA 4I2PA 5KFMA 4K5SA 1SJ3P 2HFUA 2IJRA 4L3KA 4Y00A 3GB0A 1WF2A 2MKIA 2VFRA 3UFCX 2VODA 5BXIA 5A2QU 3GFHA 3LW5C 2G1HA 4ANCA 4LFCJ 2M0GB 1S1UB 4U6PA 2E44A 4PG8A 2IA0A 4YHHJ 4USTA 3SEOA 2IYGA 4IQXA 1YX2A 4X62J 2DH8A 3S1TA 2CNOB 2RJZA 3HP6A 2HS0A 4O0NA 2EG2A 2QLFB 3TI0A 2ZM6J 3SQGA 3FRYA 1QLNA 4ZPCA 1BE4A 1XIQA 2LKZA 5GMKa 3OTOJ 3ISZA 4TU7A 1YHQS 1DY3A 2RNEA 1X5SA 3O44A 4K0KF 3DOKB 4JV1A 3UR0A 4MKAA 4BC7A 2QA2A 3J81Y 1SBRA 4QCLA 3SSRA 3UWTA 3LH2S 1UZDA 1AROP 3QJLA 1JJCB 1BXNA 1S59A 4Q2LA 4JI7F 3TARA 4N41A 2HVIA 4F4XA 2AGQA 5EUHA 2IBKA 1RKIA 1UVNA 2NREA 3QLHA 3PYDA 3N6LA 4EYHB 1U1KA 1GEHA 3DHWC 2U1AA 1CJTA 3OR2A 3D68A 5BYQA 3I56S 3HJFA 3M8PB 2XYGB 1IUJA 2BE9B 1NK9A 3CCMS 2WSFC 4JV5J 3FEZA 4YY3F 2GFFA 1HWUA 2DEIA 3AJDA 2E1MC 4A8YA 2WVFA 4DV2F 2H9ZA 1RCXB 1EKSA 2CQ2A 2H54B 2VA3A 3QGHA 2I1RA 2GIFA 2QFIA 3TOQA 3H4BA 3PW4A 2FUG9 1WTBA 4ZKAA 3OXGA 5J1EA 3M1VA 4N5SA 3KHLA 1NHVA 1NJYA 2YX4A 3GU0A 3VTIA 2ATCB 1B4SA 4LRDA 1XR6A 2VG6A 1JKHA 2HFZA 3BGLA 1S1UA 1VBZA 2J0QD 4KE5A 2B5JB 1B70B 5B0DA 2LQ8A 2ZH3A 4OYWA 1FTCA 3SYZA 2VB6A 5KFWA 2D3OR 1SKRA 4ZVSB 1VQ5S 2W8KA 2CQHA 1S1WB 3BEGB 1WHWA 2VUGA 4OI0A 2BRKA 1RAJA 1R0AA 4DR7F 2R4FA 3CCSS 3PJWA 3BSOA 3TO8A 4UT4A 1FRLA 3CIZA 3KJVB 4ED5A 2GAHC 4ZVGA 3PR5B 4DSJA 2YVSA 4X2BA 3W7BA 4WKRA 4IFYA 2W2OP 2H5JB 4RX6A 2R42A 1R8HA 3PFOA 2A6MA 1GNKA 4PQAA 1Z4UA 3K5PA 4CM0A 1M5VC 3P5BP 2V2VA 3PY8A 1RWUA 2FZKB 3F73A 4PPDA 4R25A 3T19A 1VRTB 1GTEA 3U27A 3CE8A 4HHUA 1RADB 3CDBA 1C4CA 4V1Ak 4KFBA 3HX9A 2XLIA 1LWXA 3PJXA 3NAHA 4DV3J 4HVZA 3QGGA 2VKRA 4FYWB 1UP1A 2XTJP 5IC4B 2V67A 5B0CA 4FPRA 2QLXA 1VQOS 1FRKA 1HBNB 2HQFA 3I4PA 2P9GA 1F2HA 1HPZB 3IM8A 3RUBL 3TAMA 4OZ0A 3TA0A 1HMVB 4LJMA 4ZN3A 5B08A 4ES3A 1EKRA 5LXYA 4WCEQ 3KDNA 2V4QA 3K0JA 2KTQA 1UKUA 1ZH5A 4DL0C 3NGUA 2B7BB 3I0SA 3HULA 4XTTA 5GVQA 1UVIA 3ITHA 3X1LB 1RWKB 4IOAQ 3LA0A 2B8QA 2XULA 3CCUS 1HYSB 2L9WA 2R9LA 5CABA 2V34A 5KFLA 4OMFG 1ZAVA 1IR0A 1PSDA 1S9EB 3BH6B 1MWYA 1OPIA 1RTJB 2CWXA 2O1PA 3R5DA 4DXLA 3CXCR 3D28A 3U1LA 3M8WA 4F0KA 2MSTA 1ZBTA 2EI5A 2WTFA 2VDHA 3K5NA 3DM2B 1QVFR 2J0SD 4KO0A 1H0HB 1YGYA 4A8KA 3T1HJ 1ZPVA 5KFHA 3DI6A 3QO9B 1WG1A 4ZHRA 3GFYA 4RW7B 3OT9A 3DLGA 4J9OA 1PJ6A 1HNWJ 1FKPA 1FNMA 1L3KA 4KY3A 4HH0A 3CJ4A 4ZJLA 3CTRA 2DR9A 2DJWA 3DRRA 3UI3A 3UDLA 1B0VA 2OP5A 3BR8A 3J7YU 1OSDA 4YB6A 2NYHA 1B7FA 2RE1A 4Q0BB 1JLCA 1TQLA 2EWHA 4IFVA 4F50A 1HWLA 4JP8A 5KT4A 4TQSA 2GVDA 1TL4A 3M2VB 1IBMF 3BN4A 1GK8A 2LP4A 3DOLA 1FWPA 2A18A 3HHLB 3OTOF 1FJ7A 2B3TB 7FDRA 4B3RJ 4GVBA 3NS5A 1M5PC 2YQ0A 3TQ1A 5KG2A 2R2TA 4DBQA 1U8WA 2EW9A 1FJGF 1S97A 2MHEA 2QTWA 3I32A 5G0RA 1M5OC 3AFGA 1VIOA 2FY1A 1MN7A 3UD3P 2B0GA 2MQMA 3OJSA 1FXDA 3MM8A 4CRJA 1RGVA 1SIWB 3ULHA 2QMUB 4F7VA 2C2DA 5F8IA 1NKBA 2QG9B 3DFEA 3I6PA 3D6FB 4OV1A 2IHR1 4DZ6A 7AT1B 1OY8A 1Q8BA 4UF4A 3DOLB 1KRPA 2HNDA 4RUAA 2GVDB 5HMWA 1GMWA 2FIUA 3V4MA 3K7RA 2OJ3A 3MD3A 4U7UK 1G1XA 2ROEA 2VD3A 2HQCA 4I64A 5B0FA 3GIJA 4DV5J 1XMOJ 1NJXA 3SDEB 2V4JB 4I69A 1KSPA 4ID5A 1U8SA 3G9CA 1N88A 4X66F 1UVMA 2VF3A 1DQ8A 1T9UA 2YNFB 3MMCB 2YH1A 4P73A 1NHUA 1HQUB 1VISA 4UOFA 2ASJA 2MQPA 3TZXA 1OY9A 3D3CJ 1WC5A 3CJKB 1EJ7L 3GG0A 5HJYA 3TJAA 1RTHB 3QZ7A 4WP9A 3MWBA 3V6KA 1GXUA 3VAGA 1U45A 2KXNB 5LT5A 1Q82T 1JLAB 1DQ9A 5HQMA 1UWAA 2YH0A 4J9MA 2HHSA 3BBFA 2HQDA 2R7TA 1XMQF 3QIPB 1UWBA 5G4DA 3W5ZA 4FBUA 3OXLA 5DG7A 1FD2A 5CZXA 2FJWA 3N4WA 2DR6A 2DO4A 4N8OA 2KI2A 1FE0A 1DLOA 3GE9A 1T3OA 5F0UA 4DPTA 4AQYJ 1T9WA 2KYXA 3KK1B 3IG1A 5D3GA 3V81A 2RMLA 1U25A 4Y2KA 4PWDA 1TK8A 2PMZD 4TY8B 1HWJA 2CQ0A 4NLUA 3T3FA 4PUOB 1I3OB 2MLXA 4NZ7A 3TWZA 4EK2A 3KJNB 4A8MP 2CIMA 1HBUB 3I0RB 4ED4A 4KHRA 3MR2A 4NEYA 3M8QB 4ECSA 2EC2A 2GIQA 3T9ZA 1QAYA 4C97A 1OIAA 3Q0AA 4LMZA 1I51B 4MTPA 4F04B 2E9ZA 4KYZA 2UUTA 1IKVA 1WD6A 2J0WA 3SCIE 1VRUA 3A3OB 1S7IA 4IG3B 4PG4A 2V2KA 4RW9B 3UDVA 3K5MA 5B0BA 3OL8A 3RR8A 5ETSA 4MYTA 2OD6A 2ZH4A 2CYYA 2QIFA 2A0FB 4DFJA 5MAOA 1WKKA 2YWEA 1U48A 1Q81T 2IJNA 3AOBA 4C48A 3MUMP 3AJ2A 3KLGA 3R7SB 5DDOC 4GKKF 1S5ZA 2AJQA 4QQBA 1A7GE 4MFBA 1VCTA 1FA0A 1HNIA 5HVGA 1S1WA 2DKOB 3KG4A 2DNRA 4LF4F 3BGOP 2KVQE 3JQJA 4CLUA 5KT7A 3MOZA 3M9NB 2ZHBA 1FFSB 2X3DA 1VQ8S 4XDDA 3PX4A 3RAQA 2MQNA 3BPSP 4H4OA 2VG6B 1RT6A 4I6YA 2J9DA 1BC6A 1V5VA 3PHEA 2Z0GA 4XO0A 5DETA 4I2QB 2ZVSA 1BUXA 1U26A 1YJ7A 4UZBA 2W8LA 2D1CA 3NL0A 4CWBA 1Y11A 4UZCA 1HNWF 4FS2A 2PE8A 3JQMA 4ZJOA 2UVVA 2PI4A 4C0OC 2AJ2A 3M2RA 5BYRA 2D74B 3KHRA 2AJ1A 2W2PP 4C8OA 1K9MT 2L3MA 3G82B 4OI3A 5H9FJ 4DZDA 1SUQB 2Q79A 5ADZA 4AUKA 1D0EA 4EBDA 4PWUA 1TFYA 4WYWA 3DRPA 3UVJA 4DOZA 3W66A 2H4WB 5IWAJ 3HVRA 5E0OA 4F2SA 2X1BA 2QSFA 3AY0A 2Z56B 5CHCB 1D9FA 4B9NA 1VQLS 1HA1A 3UQSA 2OGUA 4TU9A 1YBAA 3D54A 3Q24A 3ET6A 3NGTA 3IS9B 2MJNA 2FC8A 2QO3A 3K17A 3WIUA 2QA4S 4F4YA 1HNXF 2H5EA 3CB4A 2Z57B 4USVA 5HK4A 3RBZA 2WONA 4C98A 1KQSR 2Y9HA 3OVBA 2XCPA 3EVMA 4LRFA 3E51A 3DRYA 2GVZB 4QOTA 4DX6A 2GC8A 1X60A 2M3DA 4DUTA 4PWDB 2FQQB 4N56A 2JFDA 2XO7A 2W2QP 1Y4ZB 2FLPA 1IBKF 4RU9A 1Q5VA 4F0HA 3FEXB 4RUHA 2HGLA 4USWA 1N48A 1DURA 1TVRB 2NPFA 1ULRA 4QIGA 4B3TF 1XMBA 3GR1A 3O1LA 3QGPA 1K0VA 3KKFA 3QAUA 5K14A 1AUDA 1BQMB 1SJFA 2QGFB 1NRKA 4CO0A 2MQ8A 3BBCA 4NLYA 2LECA 2PI5A 3MMCA 3G87A 3UD5A 3D67A 4DV7J 2DBBA 3C6TA 4FVCA 5GAHI 1P8GA 1TK5A 4Y2IA 3CO0P 3NNAA 1NH7A 2NXCA 1HQEB 2YKMB 4ZCIA 2GGPB 2RDJA 1C0TA 2W9CA 1VRQC 3M4XA 2ZKTA 3NRBA 2BEFA 3MEEA 1G2EA 1IKYA 3K58A 2E9TA 2CDRB 2YWWA 4ZCMA 4O23A 1IBCB 1TKXA 1TL5A 2UXCJ 4WYLA 1ZZNA 2VBXA 4JV0A 4W92B 1RK8A 4I2PB 2XS2A 1M1HA 1D3WA 1WSVA 3J7YI 1JQGA 5KG3A 3QJJA 2ROGA 5GMEA 4ED6A 3LWMA 2RHSB 4LREA 4JI2F 4A8SA 2HNYA 5D0GA 5IFMA 1YJVA 1MWQA 3DOMB 3GILA 1NAQA 1VI7A 3QPIA 2XS7A 1R27B 3D3BJ 3D9BA 3WC2A 4PQUA 3M7VA 4USUA 2F3JA 1LFWA 5HANA 2W9BB 2PMWA 3PO5A 4ID8A 2FJEB 4RW4A 1GXTA 2PMHA 3OSPA 2FJAB 4F36A 2IAJB 2RKIA 2HZAA 4LRAA 1H74A 3PFEA 4PXDA 1SPBP 2WOMA 2CPZA 2NXJA 5CYQA 4P10A 2HHHJ 4LFBF 4O3SA 1RAFB 4WTOB 1SC3B 5ETLA 1WDDA 3R2CJ 4L3NA 2O01C 4RW6B 2O3DA 2HVDA 2FDNA 4IH7A 3A12A 2Z4PA 2WW8A 3QT5A 1LXJA 4ZP9A 3GCWP 9RUBA 3IGNA 5M2PA 2DNPA 2D3UA 1UETA 2E29A 1HBMA 2J7KA 2ZWPA 3HD1A 4U8YA 1HI1A 4F26A 3D1HA 5A8KB 5KFOA 3MOJB 2K7JA 3OSNA 1C2PA 1F5AA 1M5HA 3PRVA 1JLGB 4K2XA 3VGUA 3J7Z5 3OL7A 2R7WA 1YSJA 1TUWA 1MMDA 3KLHB 2DCUB 4M5DB 3JQKA 4K4XA 1HD0A 2ADBA 1TL7A 5T7LB 1KNZA 3H25A 2GJIA 1RWXB 4KKOB 4U96A 3MAQA 4WE1B 4AYBD 1EP4A 5LMNJ 4KH1B 1QD1A 1T02A 3DU5A 1CPZA 2C2OB 3UPFA 4BC9A 2BJ7A 3J81j 2I5JB 3T9NA 2FVQA 3AQPA 4RNNA 4IRCA 1L3SA 1RZMA 2OAUA 3PYEA 2P9EA 2CWKA 2JEJA 1GMUA 3LOUA 5EX3A 2OPQB 4J9SA 1D9AA 4HL9A 2LQJA 3RAMA 2HHXA 5ETKA 4I7FA 3TJ8A 1YG0A 1Q0NA 4H54A 3K89A 4P2FA 1F3VA 2HNZB 1CJVA 4USJC 1EP4B 2GQ2A 1M5SA 2IFXA 5CH7B 5F9LA 2CPXA 5C42B 3K57A 4ILRA 3T5LA 5I3UA 4L6V3 2HK3A 2QZ8A 4XPCA 1IM6A 4KPYA 2DNNA 1CS4A 1PJ7A 2B4UA 4KV8B 3I87A 3ZZRA 1KEKA 5CQGA 2DHAA 4J9KA 4K50A 2FGCA 2KRBA 3KUEA 1HW9A 3QGIA 4MJKA 2DXFA 3KG0A 3NGKA 2VZ9A 5ETVA 3CDEA 5ETRA 5DDPC 3HHLC 4LF8F 1FRXA 1P6TA 3CJQA 3R9LA 3NP5A 1U1OA 1E6VA 2HVEA 4X4RA 3KJVA 2YNFA 4KT0C 1Z2ZA 2Y3YA 3BBBA 3Q89A 4USIA 4DR2J 1YJWS 3PHTA 3JAMU 2YNGB 5E3PA 1RT3B 1T03A 4HI2A 1J2VA 1PJ5A 3VV2B 5M2RA 1WI6A 4U7CA 3W2VA 2RUSA 1MW7A 8RUCA 5F8LA 3H5SA 5GADU 4FKYA 4J9LA 4DV6F 3VF0B 2C1EB 1UFWA 1SL2A 2RDDA 4K8RA 4L74A 4YR2A 3R8YA 2YKQA 2J76E 4ZMMA 3THVA 3RAXA 2FB0A 1X9MA 2MDAA 2U2FA 4PXCA 5IT4A 5CD4A 2KM8B 2YBVA 2DRBA 4BDPA 3H2LA 2EFOA 3VAFA 4F2RA 1T9YA 1AW0A 1VLYA 1RT4B 3PYGA 4C3KA 2AIRB 5HAOA 2HNYB 1FT8A 1N5VA 2ZOGA 4TQRA 2XZWA 5J2QA 3CMES 2UXCF 4PG6A 1S9GB 4QYRA 2WK4A 1JLFA 2WONB 1N5YA 5JVGQ 2JNJA 1SJQA 2V50A 1NNDA 3W5XA 3QQCD 3MUVP 3NNHA 1A9NB 3V4IB 3K5OA 1PILA 3RB3A 2MLZA 1JNZB 2RQKA 4HEA9 3D2WA 1UJ4A 1X4HA 4ZPTR 2YKMA 4P2XA 3J81U 2K1RB 4Q5VA 3MTKA 4AL7A 2OTJS 1UVLA 4F25A 2OSRA 2LCWA 2FJVA 5H1SV 2B9WA 4OYMA 2HMIB 2H48B 3SQOP 3UNGC 4PXEA 1RLCL 3LQVA 1BQMA 1JLQA 1RWWB 3BGRA 3ZTOA 2N82B 3OVSA 2Z2LA 2KL8A 2F9DA 1PCAA 4C11A 1IBLJ 4DSEA 4OJHA 2H65B 4OHVA 1H3DA 1QVGR 4QIFA 1WKJA 1LEOA 4DSLA 4DSKA 3M30A 5EWEA 1T9XA 5A8WB 4K0KJ 4TN2A 2DY9A 3NWGA 2GMJA 1XC9A 1NUEA 2DNHA 2K7KA 3HM9A 2V63A 4CH7A 3V2UC 3CF5Q 3Q8SB 2LEBA 2CG8A 2CJKA 1SL1A 2UZAA 1S1TB 2GS8A 2VBWA 2JVOA 2WSEC 4I6WA 1REVA 2DEJA 2M9KA 1HMVA 2ZFHA 3M8YA 5IXUA 3T6JA 5KFDA 4EBCA 2UU9J 1TZ0A 2YNHB 3M32A 1FKAF 1HQ2A 1TELA 4FF2A 1KC8T 1RT5A 2HQGA 2MKKA 2K8GA 2CAJA 1T3NA 2XLKA 4UUXA 2DNYA 3GTYX 3G6ES 5GAGU 2UXBF 2VONA 1FDDA 2FYXA 1G4CA 2AJ0A 3IR7B 1OMSA 3MM9B 2VG7B 3ZZZA 4DCJB 4DWIA 1VRTA 4LF2A 3OVAA 4ATNA 3K2YA 3G96A 2AEFA 2HAFA 2KB2A 1GAOA 1WEXA 3MAHA 4X4NA 3VAHA 2XQCA 8ATCB 3E01A 3EDRB 2PT0A 3BSCA 5A8RB 3AH6A 3QNWB 3O6QA 1ZZFA 2FTRA 4DV1F 4F3QA 2FLLA 3UE2A 1R89A 2DXDA 3TEHB 1XN9A 2QA1A 1AYEA 2YNHA 3D66A 4B9SA 2HHVA 2AQ4A 1K1SA 1TKTB 4LF6F 3MPUB 3HZGA 4KGXB 3KK1A 3IBFB 2HHQA 4DUYF 1YKWA 1R0CB 1QUPA 3HHDA 1OPZA 2V8DA 4X84A 3RRHA 5D78A 3QZ8A 5T7LA 3CIMA 3QFHA 2I9SA 4CQ1A 1Q86T 3GFZA 1FJGJ 1FJEB 3BGRB 3TZZA 2Q6BA 1Q79A 2E1PA 1ITPA 2VPXB 1QJHA 4WU2A 2HZCA 1RP5A 1REGX 5LSRA 1XK8A 2MMYA 2B9EA 3OR1B 4H4KA 1ZM2A 3IMQJ 4JI0F 5DO2A 4CLTA 4QPXA 2J6SA 2VA2A 5AXMA 1JLQB 2A3JA 1SIZA 4K4ZA 2QC3A 1CJTB 3ZZOA 1E6YB 2VICA 3P8BB 3SV3A 1UVJA 4KHPF 2NQPA 1KOOA 1BY9A 3L09A 4GKJF 1D8ZA 5KG0A 2KH9A 3EXCX 1UW4A 1Q8LA 4ZLPA 1PBUA 1TKDA 2CJAA 5KTQA 2V5HG 1RHMB 1N33J 5A2QY 2C3UA 3G4SS 1SV5A 3IN5A 5HLFB 3J7A1 3DHXA 2XY7A 1QSYA 3Q23A 2RAQA 3EVWA 4MAKA 3PV8A 4IRKA 1U1LA 4CO2A 3EGVA 3DOKA 4OIXA 4ZVRB 2OFHX 3MAAA 4CLYA 2KFYA 2FHMA 5SZTA 3FBEA 1WOPA 2A1BA 3DMJB 2VC1A 5IT9Y 5IZHA 4P7TA 3DLLQ 2VASA 4HR2A 3GIMA 2IC3A 3FMBA 2ZBQA 3ONQA 3QYYA 3SCLE 4K4YA 1S9FA 1WNEA 4R5PA 3KUGA 4IQMA 3CCWA 5BR8F 3L4BC 1SH2A 4B17A 1RTIA 3TR5A 2W7AA 1S48A 3E3XA 1RHRB 3CJ2A 1M0SA 5DGBA 4DV6J 4E0DA 1TKXB 5FDLB 4LF9J 1F9EB 3ENVA 3OFFA 3M2UB 1LFPA 2VC0A 4W98A 4QW8A 3ZZUA 3KLVA 3R1HA 2Q66A 4DR6F 2V94A 3JTOA 4QU7A 1U2CA 3RBXA 2LXFA 2IMWP 1GH8A 4NXNJ 4A46A 1BD6A 5HATA 4LVOP 5KFKA 1NU4A 2XSJB 3VAJA 1SB6A 2KJWA 4ZPDA 3OD2A 3GPAA 4ID5B 1RJJA 1RHQB 3QFWA 2W9AA 5E3RA 4LSLA 1WC1A 4YDDB 1TV6B 2B6AA 2Q1LA 1AUSL 3N01A 1RBOB 2AKWB 3QJPA 3NCRA 1S12A 2EXUA 1UL3A 4WTYA 4YN3B 5D6GA 5KFFA 1K44A 3FCWA 4R8UB 2VKZG 1RTIB 4Z37A 3EZOA 2JLGA 1HLWA 1HW8A 1VJWA 4IR9A 1KQFB 1DTQB 4O3PA 3UDCA 5DLGA 1NK0A 1TUGB 1T0TV 2GA7A 1GMVA 1O6XA 2X51A 4LFAJ 3W1YC 1S57A 3IBWA 2XC9A 2D3O1 1SV5B 1S0OA 4DFKA 3ITHB 1KBRA 4FXWA 2RRAA 1OJ4A 2RVJA 5HVFA 1FESA 1RWVB 2DYAA 2RDIA 3OJUA 4DR3J 2CPJA 4F3OA 1TR0A 3Q8PB 4MYUA 4RBTA 1X5PA 1JLBA 4CP5A 3Q8VA 4NPOA 2GCFA 1NPPA 2DITA 1SJ4P 2CZ4A 4QYZK 2HHWA 3TUZC 4KJIA 2MQOA 5HLFA 2DPJA 4TVAB 2N3OA 1Z1ZA 1BGXT 5LMNF 1C0TB 3UCGA 2LA4A 2W9CB 1HFEL 1M1GA 4LF9F 1FKPB 2KT2A 3H40A 2ERRA 4MK9A 3MGJA 2OD4A 2MYFA 4IYQA 5D0HA 1SUQA 3LF0A 2Z2YB 5C25A 4Q44A 4BLGA 4DF8A 2F8MA 4DV0J 3QO9A 1YLXA 2FVCA 4PZVA 2N4DA 2GNKA 3H42A 2A6OA 2DR8A 3DLGB 3THPA 3J7ZT 2HRYA 2MSSA 3NBPA 3MM6B 2JLFA 4UQGA 4YEAA 2QYCA 1KVIA 3OUYA 1D09B 2W01A 4HTIA 4D3GA 5HMYA 5JUMA 4BWMA 1DARA 2B9XA 1NSQA 1U0HA 4X4OA 2OEMA 3MFIA 2W7OA 2ZH5A 4Y6IA 3CCRS 3A3NB 4DSIA 5A8KA 2CDQA 3B54A 1VC0A 3UW1A 1RHJB 2C2ZB 1KR4A 2CJQA 2G2YA 2CJYB 4FNHA 5ITHA 5F8NA 1UEUA 1NSKL 2GVZA 3L7UA 2XZTB 4ENOA 5C42A 1HYSA 3D1QA 1H2TZ 1ZYQA 2IAJA 4OYOA 3VALA 2GX8A 4DR4F 1NXIA 4NZ0A 1VQ6S 2VG5B 3BKFA 3NCPA 4RNFA 5CYQB 1FEHA 3QT8A 2HBRB 2PD1A 4OHYA 2LMIA 1X31C 4X66J 4J9NA 2Y1LB 2HW3A 2HPUA 3M8ZA 1TKZA 3US5A 3D6HB 2LDYA 4BWJA 1D8YA 3HFZB 3SI8A 2HHPA 1S1VA 2BACA 3UO0A 3PX0A 1YK9A 4O3RA 2QMWA 4CZCA 3E01B 2XGPA 2CQ3A 2DNMA 3HK2A 4RUCA 3SMZA 3JSMA 5J2NB 4UUWA 1V3SA 1W7WA 1VQYA 4R8UA 4AXJA 2GMLA 5IWAF 1RWNB 5AXLA 2W25A 3BDPA 4ER8A 5DZ6A 3R6LB 4JI7J 4DQRA 2OKQA 2SXLA 3KMQA 1RT1B 3OV7A 2BW2A 5KT6A 3D4JA 1NDPA 3GMGA 4Y34A 1F1BB 5KFAA 5HL7Q 4EMDA 2PDAA 3FRZA 1PAUB 3GCXP 1NH8A 3HPOA 1PBAA 3ELHA 4J9VA 1RBAA 1RT6B 1UEKA 2QLJB 3H5UA 1J27A 4HT7A 1QDUB 3P49B 1NSAA 3OPKA 3G8SA 5ETOA 2FJBB 2HFNA 3HSZA 2I38A 2IM0A 3R7NB 3JYTB 2E5IA 1WC6A 4KR0B 5KFQA 3ENAA 3RB6A 3M30B 3PTWA 1HBOA 4IO9Q 1KTVA 2XMUA 1FJCA 4KAIA 4JI5F 1QUVA 4KPCA 3TNVA 4K7QA 3SXLA 2UP1A 1TVRA 3FQKA 3OTCA 3UR3C 5KT3A 3RTVA 2DGXA 2NUHA 4NLVA 2EVZA 1KONA 1RAEB 3A3PB 4OZNA 3ZTQA 2HGNA 5K8NA 2LXUA 4Q7AA 1URRA 4PKDB 3KUHA 2RF2A 3HHLD 3PW2A 2XS5A 5JJBA 2R8GA 1TL1A 3HFKA 4OZJA 4YHHF 4Q8EA 3NOGA 1S49A 2XMMA 1KD1T 5DQIA 3O8WA 2WBRA 4ICLB 3RW6A 2V69A 4PWWA 1H73A 2ALZA 3OHAA 1H98A 2WB1D 3EPIA 2CQDA 3ICLA 1N52B 5KT2A 1ICEB 3IRXB 4R0JA 1VMBA 4RNOA 3A1YG 4UY8T 2P6TA 4DQIA 4QPTA 3H4DA 5DM6Q 2WVDA 2XNRA 1LW2A 2GJ2A 2EKNA 1ACMB 1FRHA 2Q3PA 3G86A 2VJUA 3MR6A 1S72S 1MLAA 5FLXY 2JOQA 5LOQA 1KLNA 1TMJA 5E7OB 2W24A 1S0MA 4KGKA 2CNLB 4OI6A 1F2GA 2EK1A 2A2CA 3DLEA 1R3NA 2BM1A 3WX4A 2F8EX 2NXNA 2E66A 1V9OA 3DCAA 1VQMS 1JX4A 3W2VB 2UUWA 1RTDA 4HDHA 4URSA 2OEKA 3VWSA 2YKOA 2L41A 3PRBA 4O3NA 3AOAA 1KQKA 1RA7A 1SL0A 1Q7LB 2J8SA 4IO1A 1IBLF 5LSOA 1IR2A 3PCOB 2N3LA 3JYTA 2HQIA 1ZM4A 2EKYA 2V4JA 1VQNS 2VDIA 4C6AA 4C0BA 1HNIB 2KFNA 3A8KA 1T8EA 2IA6A 4L75A 2G2OA 2BKPA 3FZ2A 3M2UA 1MG7A 1SQGA 3DM2A 5A6PA 3KLGB 3SCJE 4DMZA 5LMUF 1IXKA 1VQKS 1KKHA 1IBKJ 4ZJQA 2VHGA 2NUUG 2B8PA 1CBKA 1NBEB 1CJKA 1TKZB 2DNGA 3CJ3A 3LP1A 2DD8S 4R5PB 3J80Y 1JJ4A 4EFAC 4ZP7A 2IDEA 2BE2B 1RHKB 2K3KA 4KHMA 4LR8A 1X9WA 3H7HB 2VPWB 1OYDA 2ASLA 1HIYA 1LKZA 1YVFA 2B4VA 2HLTA 3B4DA 4RLEA 1PGZA 3C14B 3FSYA 2MHNA 4OI2A 3R97A 5J2MB 3G6XA 3B78A 3MI7X 1QTNB 2XMTA 1UCNA 2YY3A 5K5MA 2VBZA 1MMNA 4LRCA 2G0JA 2FHKA 2I5JA 2LFVA 2MKJA 5I3PA 3ZTPA 3MUTP 4CTAB 3N0VA 4B3MF 2ZC3A 3CSKA 2VOPA 2GIRA 3HT0A 2QYGA 3M2VA 3ZC4A 4M94A 1NPRA 1DHMA 3JS9A 4TNOA 3ILIA 3CO9A 4NL5A 1NMEB 4L73A 2OPQA 3FBCA 3BM7A 4DQSA 5I3QA 1GX5A 1RSCA 1IQZA 1C1BB 1VHFA 1ZOTA 3I55S 3A8IA 3G71S 1W25A 1RXOB 1DBDA 4DR6J 3MCNA 4DL4A 4I1TA 2K06A 2YX1A 4DPYA 5GAEI 2CG4A 2EEYA 2IRYA 3L95X 1DAXA 4GMKA 1IVZA 2R2UA 3QT7A 3DLJA 4AT1B 2RU3A 2KU7A 5E33A 2DH7A 3TZWA 4NMXA 4CLLA 4M5MA 4G1QA 1VIXA 1GFWB 1S4EA 3VR1A 4LF8J 4DPWA 3Q83A 4RJVA 2D7SA 4WF9Q 2FZGB 3QBCA 4HT5A 4D3HA 3CC2S 3PG9A 2JEGA 3C15B 3GJSB 4N77A 3M9OB 1C1BA 5IV4A 1TAUA 2V2ZA 4ZPBA 3RR7A 4LR7A 4J90A 4A4JA 2RU9A 2AWZA 2LQBA 2YWGA 1Y3KA 2J7WA 3H0PA 3CDAA 3RW7A 4LF7J 5FIIA 4RW4B 4Y2CA 3J80U 5KG4A 4LFCF 2BABA 2GAGC 4NI2A 5D4NA 2DIUA 3VAMA 4ED2A 4KQZA 4WIIA 3ZNJ1 1LW0A 5C24B 1Y5LB 4CO4A 3C2PA 1VOMA 1OY6A 2WOMB 2BE7D 3LP2A 3Q86A 3TA2A 3TVKA 2GHPA 3PACA 1U1QA 2HSEB 4RR5A 3MTJA 1AFJA 2ROPA 1WI8A 2JDJA 1LW2B 2P6SA 3GYXB 4RBVA 4AE5A 3GR0A 4IG0A 3EMTA 7FD1A 4A8WA 3T5JA 1QAJA 2IRUA 3CD5A 2D9OA 2MTLA 3R3TA 3WBZA 3CJ8A 5L39A 1VK3A 3KLEB 4U8VA 2AYGA 3CJ5A 3GJTB 2UUBF 2IMOA 1P1TA 4CO1A 4GRSA 3MECA 4K4WA 1YTYA 4F4ZA 2B6AB 4NMLA 1HQEA 4DUZJ 4IOCQ 4EI2A 1WSRA 2NPIA 2OPRB 2B9YA 4TLQA 3QAEA 2HURA 1KFDA 2C2NA 3HHEA 1N8RT 4KGZB 3UNYA 1R8CA 1REVB 4DS4A 4ZPVR 3T1YJ 1YI2S 4DR7J 3N6MA 5HJXA 5KFZA 1Q8IA 3DRRB 3DXSX 2XEXA 1U6BA 4QU6A 2DISA 2DRDA 1KN6A 3L9ZA 2V8PA 1CSJA 2QA4G 1B7YB 3LTOA 2XMJA 1FRJA 1ZM3A 5CAAA 2IVFB 4HYKA 3KK3A 2BRLA 2CZ9A 2DK2A 2OMLA 2CUYA 1N54B 2COLA 3L3CA 2FLOA 1WF0A 4ZLLA 5IM0A 4IRDA 4V19X 3D5MA 4MKYA 4C4WA 1F9HA 4ZVEA 2DGVA 4P7VA 2XMAA 1Q95G 1FXRA 2AZ3A 2HVHA 3CD0A 3GG1A 4QYZJ 1OS5A 4HHJA 4RU2A 1H72C 3FCVA 3KK2A 4M63A 3FSIA 4ED0A 3DLEB 3OL9A 4DV1J 1TKTA 4DPOA 2RIJA 1Y10A 2DIVA 2X7IA 3IS9A 3GIKA 2BJ9A 1DFDA 1WKLA 2OPPB 1X0PA 4NLTA 5C24A 4WFZA 3DMJA 1HNXJ 2Z30B 4C9DA 4ZS6A 4LF6J 1YWXA 2XY5A 1R6VA 3UN5A 5AXKA 3IM9A 1M1KT 3DDNA 3SIPB 4FVMA 1EETA 2ZWOA 3CT9A 1CC8A 1LQ9A 2VH7A 3QSIA 2EFVA 2UVWA 2G0IA 3LGMA 3KLIA 3RBDA 4USKA 1MMLA 2XZDB 2UV8A 4ED7A 3V6JA 1LWCB 4ZVUB 2VG7A 4MIBA 3O3LA 3SSSA 2V0NA 3KHHA 2UU9F 5B0EA 5J1PA 1HHTP 3AA9A 4HHHA 2BOAA 2JVRA 3MCOA 1RACB 3G8TA 1V3ZA 1QAXA 4PCQA 2GMHA 4FF4A 5FJ4A 2AV5A 2L9NA 2XI3A 1YJTA 2OSQA 3WZ0A 4PR6A 2CADA 3G6VA 4MKBA 4ZPWR 5B7WA 1RYRA 2HYIB 2DH9A 2I6WA 2CPFA 2CQ4A 2CVEA 3I5BA 2G13A 1NB2A 4A8XA 1NSPA 3BSAA 1U4BA 1N4LA 3NOCA 2LLZA 4X64F 3D0GE 1OWXA 4DEZA 5KFVA 5GAEU 4LF4J 5GAHU 1F0XA 1QAIA 1H38A 5E3AA 2X3GA 2OLWA 2EBGA 3NAIA 2RD5C 4J9RA 3TANA 1T7PA 1X8DA 1YZ6A 3CJSA 4IDKB 4LF5J 2HQ3A 5EWGA 5KFBA 3G8QA 2X1FA 1RABB 3EE3A 2NSCA 5ETPA 3ET6B 4WXOA 1R8BA 3EWGA 4A8FA 5CD4H 2AYEA 2CRLA 1WEYA 2UVRA 1SJ1A 1K1QA 2WAQD 4C8MA 5J2NA 5J1NA 1PKUA 1F60B 4JI8F 4OJ1A 4JV5F 3FQLA 3JXOA 2XWXA 2WVEA 2RSQA 2ZUAA 3AD8C 1S1XB 5KOWA 4QBUA 2Z8QA 2V68A 1SC4B 5F8HA 1NK4A 2MLYA 4RKUC 2DPIA 2HS4A 3FDSA 4FYDA 2YKPA 4CH0S 4FYYB 4F4AA 2HS3A 4WFYA 2M5YA 1EETB 4K2JA 2MZSA 1W26A 2YQ3A 3W64A 3JSMB 4K4TA 4N47A 4KTQA 1TL3B 4OZ2A 3MEEB 4PG7A 3WIVA 2MEWA 2WVCA 5KFCA 3IWLA 3MDFA 2E5JA 4OHZA 3WDOA 2FJDB 4ETZA 3VHQA 2ASYA 3PRDA 2F63A 2I8EA 1DLOB 5IV3A 3MM5A 3KLFB 1PYOB 4NRTA 4QIWD 4UQTA 5A8WA 1AT1B 3C16A 2VPZB 4RBUA 3IWNC 1KP6A 3VZIA 1U2RA 3HSJA 2UV8G 4N8NA 3R5GA 5C2CA 1KLMB 2E7VA 1NJIT 4ZVPB 1QE1A 3TA1A 3GV7B 3QIPA 4B9VA 3HO1A 1G7CB 3DLBA 4X65F 2MB0B 1S4FA 2KXHA 1CEZA 1XJWB 1FFWB 2IIHA 4NYOA 3C3LA 5HMZA 2ZOMA 4RPFA 3TVZA 1JLAA 1X4BA 1F5BA 1XEZA 2L9DA 1VLOA 3HI9A 3ISNC 3SFUA 3FNNA 5CCLA 4X4SA 3V6DB 3T1AA 1JLGA 1KHWA 3NS7B 5KAKA 3NS6A 1ZS6A 2ZNYA 2DHSA 3TUIC 3V4IA 2M8DB 4NA3A 2DHHA 4LF1A 5EN1A 2IY5B 1WEZA 4M5NA 3K5LA 3D6TB 3W60A 1SJRA 2D69A 2YKNB 1BQXA 4NRUA 1HBUA 2PEHA 1WHYA 3AD9C 1RT7A 4TU8A 4O44B 1VDHA 2YPYA 4ZLJA 3BO4A 4NE9C 1DTTB 2QLBB 4ZIWA 4DV7F 1RWOB 1SH3A 4WFAQ 3U1NA 3M8RA 4CM2A 2VFUA 3QRRA 4DLGA 1F6TA 3FMWA 4X64J 3FC9A 4ED3A 4Y28C 2NCKL 3TW0A 5KFTA 1FCAA 4DUZF 1MU2B 4Y65A 1RT4A 3OTEA 1VBXA 1Y3JA 4HI1A 5HN0A 1N34J 1WG5A 3RU0A 2BJEA 3V5RA 2AHOB 2YQ1A 3LPYA 4M95A 3MZIA 5AE3A 5L9NA 3H5YA 2DNQA 5I42B 1DTTA 1Y0HA 2R7SA 2KJVA 5IQ6A 1HBOB 3BKUA 3O2IA 3MPDA 2KVIA 1VHIA 2R3VA 5FD1A 1RT3A 3HDSA 2V9KA 3IP0A 4DSFA 1ZTWA 1QM9A 4K59A 3MPWA 2AJ4A 2GQCA 4Q0BA 5D0RA 1O8BA 4DV5F 4KRWA 1XMOF 1KS2A 2QRRA 3CJ0A 1U24A 2XLJA 5AE2A 2AD9A 5J2PB 1RAOA 1FDBA 1RUSA 3N79A 2CJBA 4KKOA 5LL6d 1U1RA 5C5JA 1J5OB 2BOPA 3BPDA 3I4HX 2MGZB 2GGPA 3L7OA 5DGAA 4J9UE 5HROB 4PPZA 1DZ5A 1UEVA 3MECB 4ANEA 5KFUA 2BA9A 4DV0F 5L9XA 1S0NA 4AL6A 2R7VA 2P5VA 1U1NA 3NBPB 4YY3J 3KLEA 3GONA 2PEBA 1AA1B 4KB7A 2HNDB 4M5JA 2AEJA 2A10A 3BGFA 1IKVB 4CLSA 4JYAJ 4F8RA 4C8NA 3WX8A 3ZTSA 4WFNQ 4X4PA 3KJQB 5ETTA 2KHCA 3DKDA 4QIEA 4FZVA 4ECRA 3M8QA 2DT9A 2CPHA 3MAAB 4IKAA 4NYZA 3PKYA 4DCOB 4IR1A 3EPGA 4XAKA 1CULB 1DRZA 3R7BB 4EEYA 1UJ6A 4NLDA 3L7PA 1V5IB 5D4PA 5HMXA 4JI1J 1JLBB 2G9OA 2IRXA 3Q8UA 3I96A 4YB7A 5EDWA 2LDIA 2VIHA 1K0TA 2H51B 1CJVB 2QSWA 6AT1B 4ZCKA 2R8HA 3BSNA 3BF4A 2VV5A 4KFBB 4X4UA 1PO6A 4M5KA 4QJVA 4G1IA 2UXDF 4DDFA 1JLCB 4IFVB 4OQJA 3ZFVA 4F4WA 1HHSA 2J9EA 3PX6A 1FO1A 1TL7B 3BH7B 5KFIA 4DF4A 4Y0FA 4KHPJ 3M6WA 2V9WA 3NEKA 3AODA 3ILOA 3TQEA 3Q2SC 4I0WA 4XIUA 3T1HF 2EFPA 2G1DA 1E6YA 3MD1A 4QWDA 1YDLA 1JMTA 2PO4A 2ZD1A 4DX8H 2L48A 2QEXS 1S99A 2OMOA 1NPKA 3RG6A 3HFVA 1NDLA 5IQQA 4KO0B 4DV3F 1YIJS 4UOHA 4WPAA 4B9LA 5BJRA 3ZXWA 4ES2A 5J2PA 1X9SA 4ELVA 2OHDA 3U02A 4YS2A 2CA9A 3SBMA 5C25B 5RUBA 1RTJA 4YP3A 4FBTA 5F8JA 3M9MB 2UUCF 3NMRA 4I2QA 5DJBA 4V19J 3AOCA 1GXLA 5IOLA 4HACB 2BJ3A 4WZQA 1RTZA 3P5TL 1N5TA 4JB8B 1RISA 2B56A 3LO3A 4EO6A 5HQLA 1RKJA 4ERDA 3AB2B 1YBTA 5K8OA 1YITS 1NK7A 1LV5A 4LFAF 2DNKA 2V4RA 2JRSA 3FK4A 1R7IA 1S6UA 3W65A 4DLEA 4W90B 3W9JA 4CYUB 1RTDB 2HGMA 1FVSA 1DQAA 2WBMA 4JI2J 1Y7PA 1L3UA 1Y5NB 3P45B 4OX9J 1MWZA 3SZ2A 4WP8A 2IC3B 5J1EB 2ZH6A 4GVLA 4WJBA 2DGSA 1F5CA 2Q6CA 3DC2A 4C7QA 2FHJA 4NASA 4ECVA 4DQPA 2N4CA 1W2BR 2W4PA 5F9NA 2FHJD 2YX7A 4ZN1A 2AX1A 4ECUA 1IWAA 2C3OA 1MU2A 3NLCA 3OTBA 4IOBA 4ETXA 1VC5A 3F41A 3BO3A 5L1IA 3GV5B 2GW8A 4PQUB 4H4MA 3BZQA 4C8LA 3VGSA 2HK2A 1UFKA 1U6ZA 1WUUA 3TRGA 2RS2A 1A6LA 4AL5A 4TYAA 2NR0A 4ZP6A 3UN3A 4NA1A 5K20B 1HNVA 1X7VA 2W4CA 1VBKA 3C8YA 3POTA 3T6BA 2DR7A 4FXVA 1URNA 2BW7A 3ETOA 4OJGA 1RWMB 2FGOA 1LWEA 1IJFB 2ZHOA 3C6UB 3I5CA 5ETNA 3NGDA 3MURP 2CQ1A 4EBEA 2DVIA 3HCXA 4U95A 1OSCA 1B64A 5HBMB 2PGCA 4NLQA 3N5FA 3AHPA 1HHQA 4GC6A 3M2RB 4N76A 1XNQF 3A4TA 1KQGB 1SQFA 5K14B 4QW9A 3DLHA 4QIVA 4F02A 2ZE2B 5IM0B 2BKNA 3EDQB 1UPPA 2OEJA 3GYGA 1FNOA 4PYDA 1N36F 2FZCB 2OTLS 4IH5A 4OYAA 3AAWB 5CCMA 3C16B 1VQ9S 1IKXB 2LQ9A 3A8EA 1SXLA 2KYZA 1R31A 1X5OA 1D9DA 2M2BA 2KRRA 3QMQA 1MSWD 5L38A 1KHVA 4DPXA 1HPZA 3TAMB 1LWEB 2AF6A 1CLFA 2HMIA 3FEYB 5AXNA 1WACA 1WHXA 3EGNA 3LAKA 4MFBB 4P72A 4ITSA 1RT2A 1Z2LA 5E5NA 4B9MA 3R27A 4OV6A 3W8PA 2K1RA 4UY85 1FF2A 1N5YB 1PC4A 2FPHX 2W2NP 3QIDA 3S7RA 4A8OA 4URGA 3BN7A 1XNRF 3OHBA 2DY1A 4PYAA 4O3QA 2ZOFA 3GZ7A 3QATA 2HBZB 3CMAS 1I94F 1BQNA 4ECQA 1SC6A 5T41A 5A6WA 5CXTA 1FD8A 4Z7YA 2DGQA 2E7XA 4DX5A 3ISND 2UXBJ 2ZM6F 1TAQA 1TTHB 1XMQJ 2WW4A 2QV6A 1FKOA 3NKYA 1KOHA 1RAIB 2KDOA 2Z2ZA 3I0RA 3DRPB 3UVJB 3MEDB 2CQPA 4DCPB 2FVSA 1LW0B 4AQYF 1EB0A 4PUOA 2AEMA 1RU1A 1RA6A 2XYPB 2B4PA 1PIEA 5KFXA 2JWNA 5KFSA 3KYLA 4E8UA 5KFJA 4GKJJ 3HHLA 5K8MA 2VQEJ 2LU1A 1P9QC 2GHWA 1HD1A 2MY7A 2LVWA 4Y2AA 3C66A 3BGUA 4NLOA 4OYPA 3RRKA 3CCQS 3TUPA 2GO8A 2RH3A 3PW5A 3HKWA 5HP1B 4DI6A 1FFGB 5A76A 4JV2A 3A8JA 2KN4A 5L8RC 5KG1A 2MKYA 3VGTA 2ZZNA 1JXVA 2BUNA 1UA0A 1S7HA 2R7XA 2DCLA 4OFZA 3GSIA 4QR1A 1N0UA 2LYVA 2RS8A 2PA3A 3RGIA 3ZZYA 1FHTA 1FKOB 3UD4P 1F9FA 1EIYB 2J6UA 3GWCA 4Q45A 2Q43A 3IAS9 1Q16B 1WDTA 2XMVA 3MM6A 1JXLA 4U7UD 4HKQA 1YRTA 2EG1A 4NOHA 2F40A 2APOA 3EM1A 3HJVA 4DG1B 2Y1RI 1T9VA 1FWLA 5FLXU 3VQTA 3WQPA 3MM9A 4J37A 2HNZA 2UUAF 2LA6A 2HHUA 3HVTA 2GQQA 2IPOB 1FVQA 4I7FB 2WSCC 4TXSA 2MZTA 3UN2A 1X4EA 3MEKA 2ZBRA 4MT1A 2PSZA 1CJUA 3MCMA 1R6YA 4K5RA 2VG5A 2ZBCA 4TY8A 4PRFA 4G3IA 4J9QA 3H20A 4J9PA 2FVPA 2ZNZA 2QE5A 3TJ9A 3K59A 2QL9B 1XTZA 2VFVA 4DR5F 4KH0B 2E1CA 2OPSA 1JB0C 3HHNB 5DQHA 3C14A 3IA0A 3CPWR 4I68A 1M90T 3EGZA 4QWAA 1BHNA 1DTQA 1EQMA 4WWSA 2W1BA 2Z58B 3LUYA 1U0SA 2B51A 2VFSA 1ZA2B 3KK2B 4DR1J 3NGSA 2MKHA 3KK3B 4GVBB 3JSBA 3BREA 4DN9A 4WE1A 3OUYB 1S77D 4M5LA 3QWUA 2ADCA 2HFSA 1Q4RA 3DN9A 2LEPA 3KNGA 1F3FA 5HO4A 3SV4A 3BQ0A 2FLNA 1SKSA 1O5JA 3B82A 4QR2A 5BR8J 1AZSB 2YKAA 3E8OA 1K73T 4B3RF 1ZPWX 4CH1A 2DHGA 3BB5A 4OZ1A 3JB9k 4W4MA 4ECXA 3DYAA 1I94J 2XSJA 4O4RA 4O4GA 4M5HA 1R43A 3BJYA 4KGMA 1PYSB 4DR2F 4X4TA 2B4OA 1NDCA 1SCJB 2OPRA 3C6TB 3CJKA 4ZCLA 4ZIVA 5L1KA 3SDEA 1UA1A 4FXDA 1XBWA 3H5XA 4WZMA 4WBFA 1Q53A 2JEIA 4ZK7M 1ZAXA 2NS1B 4P71A 3OFGA 5DDQC 4DHVA 2FVRA 2B7CB 3LGNA 4IH6A 2C2KB 2DGUA 4MH8A 5IC6B 2ZH8A 1AB8A 4NEZA 4DV4F 4RW6A 5MLCV 5FDLA 4LBIA 2N7YA 3CCZA 3TAPA 3RB0A 1NHKL 4DQQA 4HLBA 3D1OA 4OZ5A 4O3OA 1CS4B 3HVWA 3FBFA 2JC1A 1ZETA 5JXSA 3EGWB 1KWMA 1N5SA 4GO7X 2R7RA 3PVXA 2XG8A 3MXHP 1LNQA 1N5QA 2C2MB 1HARA 2J9DE 2K2PA 2J9CA 2WHOA 2DXEA 4EU0A 3PJ9A 4NA2A 2MJUA 1V6HA 3IFEA 4AFFA 5T14A 1Q1KA 3MM8B 4TLRA 1T95A 2C3PA 2EK6A 4P6QA 2DNLA 2VJVA 4LF5F 2R7OA 1NKCA 3RB4A 5AT1B 4ECZA 1PC5A 1HBNA 4ZDNA 1TV6A 3PXGa 1Q5YA 2A2DA 5EWFA 3OL6A 4DR3F 4JYAF 1U02A 1I5OB 2E5HA 4C3LA 3TZYA 4WFBQ 4I6AA 2CQGA 4RL1A 4RO0A 1RLDA 4G65A 5A0YA 3MEGB 1AXQA 2I0XA 2IDLA 3DLKB 4NLWA 3KTQA 4I56A 4LQ3A 4NCAA 1RCOB 2P8IA 4EUVA 4CLZA 1RYSA 4P74A 3V6DA 1X4CA 4ZHRB 1FRMA 4ANDA 2RQCA 2BJDA 5ETMA 2XSFA 4B3OA 4U9RA 2G4BA 4B3TJ 3T41A 4YMEA 1GT8A 2PIIA 2YNIB 5D15A 3IC1A 4P2MA 3KOAA 2JH3A 2AZ1A 2IJFA 2BJ1A 4PABA 4NCBA 1LWFA 4CYUA 2ZH2A 2AGPA 2E9RX 1JK9B 3SSQA 1JWWA 4K4UA 2CNNB 5KFGA 2ZC4A 4CLFA 1O0PA 3HVAA 3IWXA 4C8KA 2KFZA 1WWHA 3TEGA 5DLFA 3NGRA 1GX6A 5F41A 1U47A 1YQHA 3EICA 1R8AA 2WB4A 2BDPA 2HRUA 4DUYJ 2ZDPA 2DHXA 4R0EA 3GSDA 2OI2A 2AYBA 3IXQA 4FF1A 2CJ9A 2ZBPA 3CWJA 3FUYA 5A8RA 1X0FA 2UUBJ 3GV8B 1H2VZ 1B0PA 2LEAA 3BR9A 3J7AN 1B3TA 3BV8A 3HVTB 4OZLA 2QX0A 3LAMA 2E5GA 6FD1A 4ZITA 1L5UA 2V2QA 2CQBA 3KWMA 2Y1JA 1UJ5A 1YJRA 3FZBA 4NWBA 3LWLA 3DOMA 4JI8J 3OR2B 1S1XA 3IR5B 4DL7A 1HL6A 3VCDA 3OFEA 4A47A 3CCVS 2VU5A 3Q8RB 3O5TB 1IJEB 2ZBIA 1P9YA 3I31A 5BYSA 4NZ6A 3CMQA 3NCQA 4GC7A 3ILJA 4ALZA 1VQSA 2FC9A 3M32B 2DGTA 5SUHA 3PW7A 1WC4A 4JI3F 1C0UA 4LF7F 1VQPS 1BWVA 1OQ6A 1EX8A 1S6PB 3RBEA 4M1KA 3WC0A 4IUFA 2D9PA 3VZHA 1HI0P 1TU0B 3M1VB 2JC0A 4FPIA 5DRKA 3RRGA 4K4SA 3F56A 1N32J 2ZKUA 2F4VF 3U1MA 3H2UB 5I42A 3OLAA 4AXIA 1A0OB 1JLEA 4LSNB 4B3OB 3VVUA 4U67Q 2IM1A 4S0MA 1JKHB 2CFXA 1FERA 1YRUA 1N0VC 4RWXA 3N6NA 2CQIA 4OI4A 4ZVTB 1VYAA 2EBEA 3FJ2A 3IAM9 5KOXA 1ZM9A 2BVZA 3R6GB 4HH1A 5KG5A 2W9BA 2NXUA 2F8HA 1C1CA 1RU2A 1I1GA 2RRBA 3CUNA 3PW0A 2XB2D 4YQWA 2CXEA 2XCAA 3GYNA 3HKZD 4WP3A 1IKWA 3P4UB 1LWCA 1JXEA 4TKTA 1CG2A 2BBEA 1FX4A 4USMA 2KG0A 3NMAA 4LSZB 1W2IA 1RT7B 2V8GA 4USHA 5LMUJ 2DR5A 2ILZA 4PEOA 1ELOA 1T11A 1WORA 2L08A 3KLIB 2W7PA 2YKNA 4NXNF 1FEEA 3FCHA 2C22A 5DS7A 3EJMA
chains in the Genus database with same CATH topology
1OMSA 1T11A 2MLYA 2MLZA 3GU0A 1P9YA 3GTYX 2MLXA 1W26A 2D3O1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMS A;  1T11 A;  2MLY A;  2MLZ A;  3GU0 A;  1P9Y A;  3GTY X;  2MLX A;  1W26 A;  2D3O 1; 
#chains in the Genus database with same CATH topology
 4N7T A;  2BX6 A;  4OX7 A;  3W61 A;  1S9G A;  1VJQ A;  2RF2 B;  3ENQ A;  2M88 A;  3KFW X;  3QT6 A;  3BYP A;  3CCJ S;  2Y1I A;  2HBY B;  1JLF B;  3X3U A;  1ZAW A;  2RB7 A;  2ZH7 A;  1U1P A;  3R2D J;  3PDN A;  2E1A A;  3MR7 A;  1TFW A;  1WEL A;  5J2Q B;  3ZZT A;  1I6J A;  4NLG A;  4K4V A;  4LUB A;  2DRA A;  1UWB B;  1RAA B;  3VAK A;  2C42 A;  1FWK A;  2ABY A;  5LSL A;  3THT A;  1WOS A;  1WTF A;  3AQO A;  3FSX A;  1SC1 B;  2R2R A;  4C11 B;  4C3M A;  2CQC A;  5KG7 A;  1SQE A;  2ZHA A;  4ELT A;  2F4V J;  1LK5 A;  2CPI A;  1NJW A;  1J5E F;  4NLR A;  3VGV A;  5I4M A;  3I9V 9;  2AU0 A;  2M52 A;  4LQ9 A;  5CYJ A;  3FVY A;  3M6V A;  1IR1 A;  4LSL B;  5E41 A;  2NZC A;  4HDG A;  2DGO A;  3AT1 B;  1RE1 B;  4F0M A;  2H1Y A;  4OYX A;  3BS9 A;  3W3S A;  4B3M J;  1U6F A;  2C28 A;  4RW7 A;  2VOO A;  1RT1 A;  4CLW A;  1IQT A;  4DL5 A;  1N36 J;  3QWP A;  3H59 A;  2PN6 A;  3DI6 B;  3LP0 A;  1HNZ J;  4H4M B;  5HSP A;  4Q8F A;  3DXB A;  1IWG A;  2PFF B;  1R0B G;  3JTN A;  5B0A A;  1YRX A;  2HEK A;  3HD2 A;  3OXF A;  4P9S A;  1BLU A;  3W2W B;  2VQE F;  3D6M B;  4UOC A;  2DNZ A;  1IN0 A;  2Y0S D;  2WVB A;  1X4G A;  2CKW A;  3EXY A;  4FS1 A;  1YZ7 A;  4CDI A;  2MQL A;  4ZVH A;  3LP2 B;  2ZJQ Q;  1U7L A;  5I3U B;  2BXJ A;  2QFJ A;  3D0H E;  1VQ7 S;  3FBB A;  3G82 A;  4X65 J;  3I0S B;  4A8Q A;  3MMJ A;  5B0G A;  4CLK A;  2NYI A;  2XMK A;  3CJR A;  2AW0 A;  4NI2 B;  4OX6 A;  2RT3 A;  3AB4 B;  2O5D A;  1RHU B;  3H8Y A;  1WJ9 A;  4PAA A;  2NLW A;  5LXR A;  5DQG A;  5HVH A;  3EYZ A;  4DL2 A;  1L3V A;  2JX2 A;  2Y0B B;  1RQ0 A;  2F65 A;  3I82 A;  5CYM B;  4C2M A;  2UUC J;  2RQ4 A;  2JL9 A;  3KG1 A;  4G1P A;  4DR1 F;  3KNA A;  2BMB A;  3IBC B;  3MCS A;  1B99 A;  1OO0 B;  4CI0 B;  1S0V A;  4RNM A;  1RBL A;  3SCK E;  3N9U C;  4I67 A;  4HAC A;  2VL1 A;  2MY8 A;  1QTM A;  4B3S J;  3PYF A;  3JAM Y;  1JNR B;  1Q78 A;  4WFX A;  3M05 A;  1CQM A;  2PA8 D;  3GQC A;  4G1Q B;  1MRO B;  3EVO A;  3F0N A;  1SKU B;  5E2Q A;  1XR7 A;  4UTG A;  1NB7 A;  3OFH A;  1KDN A;  2FD2 A;  3C15 A;  3MM7 B;  4MKV A;  5EHH A;  2ZJR Q;  3QRQ A;  4IFY B;  3D7S B;  3CJT A;  1IM4 A;  3W5Y A;  4ECY A;  2ZD1 B;  2XWY A;  3FGV A;  4OHX A;  4XDC A;  4ILL A;  3HF5 A;  2JJ4 D;  4XK8 C;  2ZH1 A;  2ATL A;  3KLH A;  2DO0 A;  1N34 F;  4MIW A;  2OIH A;  3DDK A;  3GJQ B;  1NZ8 A;  1FE4 A;  2BV3 A;  1WC3 A;  2BYC A;  4DN0 A;  2MGZ A;  3G6Y A;  2AGO A;  1NJZ A;  3EUN A;  2E5L J;  3P6Y C;  4NXM F;  2HKE A;  4FP9 A;  2HRT A;  4DL6 A;  2W2M P;  2VBY A;  5A0Y B;  1P1L A;  3MPY A;  2JSX A;  1O51 A;  1VS3 A;  4CTA A;  6FDR A;  3PR4 A;  2W4D A;  4URQ U;  1VFJ A;  1ZTT A;  2RIL A;  4OYB A;  2C3Y A;  4C0H A;  2JHE A;  4LBP A;  3R5A A;  2AX0 A;  3B8H A;  4LT6 A;  5J2M A;  1U49 A;  4LIW A;  2BQU A;  4NXM J;  5H9F K;  4ED1 A;  2KZM A;  2O66 A;  2RKI B;  1HKA A;  4M5G A;  4JBC A;  3V81 B;  4ELU A;  2QMX A;  1UMJ A;  3N5B A;  2M70 A;  2KHD A;  1OQ3 A;  4JI4 J;  4NLX A;  1VC6 A;  1XNQ J;  3NNC A;  3CDU A;  4FYV B;  4WIQ A;  1H7W A;  1EAR A;  3BQ2 A;  5LJ3 Y;  2ZEJ A;  9ATC B;  5DM7 Q;  2EFN A;  4F3M A;  1X4D A;  3MMA A;  1H6K X;  1GTH A;  2HWH A;  1YBU A;  2C3M A;  2YNI A;  1HNZ F;  4NLP A;  4L72 B;  4CT8 A;  2IVY A;  4NX9 A;  5HRO A;  1NK5 A;  2YWH A;  2EFG A;  2R7Q A;  4AD6 A;  3DGP B;  3R5J B;  5E3C A;  3BYR A;  2KT5 A;  5H9E K;  2FHO B;  5THW A;  5F8G A;  2ASD A;  4C8Y A;  2RUG A;  2ZIT A;  3DDI A;  5LJ5 Y;  3MMB B;  4YR3 A;  5K8P A;  4CNY A;  1HBM B;  1PG5 B;  4C8Z A;  2G0C A;  1EAY C;  3PKM A;  3CNQ P;  3ZZP A;  1FX2 A;  1S1T A;  2POK A;  1KTQ A;  2XI2 A;  2F9J A;  3JSY A;  4ZP8 A;  3TUJ C;  1UAW A;  2XNQ A;  4B02 A;  1XER A;  3PO4 A;  4YB5 A;  2YWK A;  3BKT A;  2UVU A;  2GHV C;  1OYE A;  2BR0 A;  2F4F A;  2HZV A;  3KHG A;  2HWI A;  3CCE S;  2YXL A;  1AZS A;  2LQ5 A;  3K8V A;  4B9U A;  2DB1 A;  4H4K C;  1QSL A;  2ZE2 A;  2I2Y A;  1FK9 A;  2J0X A;  2MZJ A;  3TX8 A;  3AXK A;  3MED A;  1UVK A;  3GIR A;  3KXD A;  5KFR A;  4X4Q A;  1RDR A;  5HI7 A;  1VK8 A;  3TX0 A;  5F3Z A;  3R1L A;  4XPE A;  2J7U A;  3H90 A;  3MR5 A;  5AJ3 J;  3EX7 B;  4MK7 A;  1NDK A;  4GO5 X;  5B09 A;  3UCU P;  3IGV A;  2F5G A;  3W63 A;  3JSR A;  3NY0 A;  3W8G A;  4QR0 A;  2P9C A;  2H5I B;  3B6B A;  2ZZM A;  2N7C A;  4YR0 A;  2BM0 A;  1LXN A;  2P2C B;  2ZVI A;  2DNO A;  3CW2 C;  3BQ1 A;  3OW2 R;  2YWF A;  4DR4 J;  2HHH F;  2MXY A;  4KSE B;  4OZ3 A;  4P75 A;  4PXB A;  5EX0 A;  4QWC A;  3CUL A;  4LFB J;  2HVZ A;  3T1Y F;  2BQR A;  4ZVQ B;  1TL3 A;  1IKY B;  1VGY A;  1FDN A;  1FI4 A;  2R8K A;  4RNH A;  4DU7 A;  5JMN A;  4DG1 A;  5IS2 A;  2BJ8 A;  1XNR J;  4OL8 A;  3MFH A;  5IT0 A;  2XY6 A;  2ZJP Q;  4HTJ A;  4ILM A;  1UZH A;  3TP2 A;  1YJN S;  2XM3 A;  4RW8 A;  1C1C B;  1S79 A;  1FTR A;  2M8H A;  5DDR C;  3Q8Q B;  4F4K A;  3AD7 C;  3KDO A;  3UDE A;  4CT9 A;  5GMD A;  4Y2M A;  2IM2 A;  5F0W A;  4JI5 J;  1WHV A;  1IBM J;  3I5A A;  4NYP A;  1CQN A;  1KLM A;  3ZO7 A;  3C46 A;  2MPU A;  3CD7 A;  4QWB A;  3CC7 S;  1U2F A;  2X1G A;  3CVK A;  3ZNU A;  1KFS A;  3M6X A;  4QZV B;  3R5C A;  4LIR A;  1S9E A;  2QL7 B;  2WZ1 A;  3VAI A;  4JI1 F;  4UOG A;  3K8W A;  2MZQ A;  3MM5 B;  4WU3 A;  3KLF A;  1NCL A;  2ZUG A;  3ZTR A;  5L46 A;  2MZR A;  3JTP A;  5AJ3 F;  3TAQ A;  1GMW D;  2QLW A;  5CYM A;  3VQS A;  2F1F A;  4NLS A;  3N28 A;  2JZ5 A;  2FJX A;  2UXD J;  1NKE A;  1S6Q B;  2J8A A;  3CCT A;  5DG9 A;  3Q22 A;  1NM2 A;  4KGV B;  5KT5 A;  2GJF A;  2ZZT A;  4P52 A;  2VQF J;  2AJF E;  3ETM A;  1C4A A;  4I4B A;  1R0A B;  2E5L F;  3Q2T C;  5IT9 U;  1BMQ B;  4J7C A;  4FDF A;  2J5A A;  1BWE A;  4F67 A;  1IKW B;  2ACM A;  2H3E B;  3HHK A;  4IG3 A;  4OJ3 A;  3VVT A;  4EZ9 A;  3CCL S;  3PNI A;  4KV8 A;  3W2W A;  2Z2M A;  3W62 A;  3LAN A;  1APS A;  2EPI A;  5HQ8 A;  3GII A;  1VRU B;  3F44 A;  4RW9 A;  4KIA A;  1RT5 B;  5CA5 A;  8AT1 B;  3FFI B;  4TYB A;  3BDE A;  5LM7 E;  2XGQ A;  3GLJ A;  1WC0 A;  4ES1 A;  2HAI A;  3MPV A;  4L76 A;  5F3T A;  2RHQ B;  4CO3 A;  3BO2 A;  2AP6 A;  1HWK A;  4OX9 F;  4Z7C A;  4JUZ A;  5KG6 A;  1UTA A;  2PFD A;  4OHW A;  5DG8 A;  5C2G A;  4FKX A;  1G3O A;  3ZZ0 A;  1N33 F;  1CUL A;  4H4O B;  2ALY B;  3H98 A;  3I9Z A;  4DV2 J;  2E1R A;  5HP1 A;  1RAG B;  1L3T A;  4ECW A;  2WCX A;  1LWF B;  2XMW A;  2B5J A;  3M6U A;  4M8L A;  1C0U B;  1KVK A;  1X5T A;  4WKY A;  3OLB A;  1T94 A;  2R8I A;  1IKX A;  4OI1 A;  2QT7 A;  3HSD A;  3PZP A;  2C2R A;  3SQG B;  2BAN A;  2CPE A;  4NCG B;  5KFY A;  2VFT A;  1U0H B;  4JI0 J;  2KG1 A;  1V3R A;  2HFO A;  1Q7Y T;  3KMS A;  1R8P A;  3DRS A;  4JI3 J;  3MHY A;  2OUG A;  3NWR A;  2GV1 A;  5GAD I;  3PIO Q;  1S76 D;  1NO8 A;  4EZ6 A;  3AA8 A;  2FY8 A;  4J5O A;  2HHT A;  2B43 A;  1SI9 A;  1FDA A;  5HBM A;  4RWW A;  2G2Z A;  1HNV B;  1WG4 A;  2EFQ A;  3DLK A;  3POT B;  1GQE A;  1HQU A;  2H4Y B;  2QJ3 A;  3DNC A;  2CNK B;  2ACY A;  3M8P A;  3MM7 A;  1Y00 A;  2C2E A;  2V8H A;  4BS2 A;  3S6E A;  1CVJ A;  3CC4 S;  1Y9O A;  2JEF A;  1H7X A;  1MRO A;  1BQN B;  1NLK L;  4B9T A;  3HMJ G;  3ADA C;  1NZA A;  3QLH B;  3DGP A;  3HXM A;  4DS5 A;  1XWL A;  3IO1 A;  2AYM A;  4ZLN A;  4LRB A;  4LVN P;  4DL3 A;  2LXI A;  1S6O A;  3B4M A;  2OPP A;  3GP9 A;  3W9I A;  2IBO A;  1HWI A;  4JOU A;  4B08 A;  2HG4 A;  4EWT A;  2KO1 A;  4WK3 A;  1VR6 A;  3UCZ P;  1TL1 B;  3EZU A;  1NK6 A;  4YFU A;  4BHQ A;  2OO4 A;  3IG1 B;  5D3G B;  5D8H B;  4DX7 A;  2ZDO A;  3LAL A;  4J91 A;  3IRW P;  2Y8Y A;  5DZ7 A;  4OLP A;  4UW2 A;  5K9F A;  3U7J A;  2E7W A;  3DRX A;  4ECT A;  4YOE A;  3RZA A;  1CC7 A;  2HFV A;  5G0R B;  1EZZ B;  4EGL A;  1ZA1 B;  2XHW A;  3HZE A;  1ROF A;  2HBQ B;  1FXL A;  1JLE B;  4LSN A;  2JLE A;  1HR0 J;  3CD6 S;  1FK9 B;  4JI6 F;  1D1U A;  4FN5 A;  4MMO A;  1X4A A;  1RTH A;  3ILL A;  1NK8 A;  3P96 A;  4CIO A;  2Y8W A;  4WXW A;  1SKW A;  1RB0 A;  2MKC A;  4O4G B;  5D77 A;  2NXE A;  4O0I A;  3ENW A;  3QSY B;  3V6H A;  2HIQ A;  1T9T A;  2V6A A;  1FRI A;  1QSS A;  5AE1 A;  2XBP A;  3P3D A;  4DU8 A;  4Q43 A;  1NEE A;  1E6V B;  1Y5I B;  3MEG A;  3C6U A;  1U09 A;  1N6Q B;  3OTD A;  2NSB A;  4FNI A;  1WOO A;  4WK1 A;  1VBY A;  2YNG A;  1T03 B;  4YDX A;  2M7S A;  3A13 A;  4ZOS A;  3RJM B;  4DPU A;  2XHC A;  2CPY A;  4OX8 A;  4DR5 J;  1JJH A;  3MMA B;  3OQ2 A;  3HT3 A;  4JI4 F;  3E2E A;  4KC5 A;  1EHW A;  3MMB A;  3CGI A;  3MR3 A;  1TK0 A;  1P27 B;  2AMC B;  5L1J A;  5C7P A;  2WRM A;  5H9E J;  2RRN A;  4B3S F;  1SH0 A;  3CED A;  3R5B A;  1K47 A;  2HLU A;  4IG0 B;  2YTC A;  4EO8 A;  2R7U A;  1YJ9 S;  3AJ1 A;  1S1V B;  2XYH B;  5D4L A;  2PC6 A;  4X4V A;  2IM3 A;  5D0E A;  1QY7 A;  1RWP B;  1CJU B;  2ZH9 A;  1TMM A;  4OYZ A;  1PAE X;  3QRP A;  2IVM A;  3LPE A;  1N32 F;  2BZ2 A;  2EC0 A;  5D4O A;  5E3Q A;  4X62 F;  4RZR A;  4ZVF A;  4O44 A;  4MK8 A;  2R8J A;  4KBI A;  2OPS B;  1Q8K A;  3IR6 B;  3W9H A;  1RI7 A;  1FNX H;  4ED8 A;  2GZO A;  2KKH A;  2CPD A;  2JFK A;  3RYL A;  5EGY A;  4FF3 A;  1PYT A;  1H2U X;  4CNZ A;  4ZPA A;  1T05 A;  4P2S A;  2NZ4 A;  2QL5 B;  4MIA A;  4GKK J;  4G6V B;  2VPY B;  2DGW A;  2GO9 A;  3M8S A;  2OEL A;  1XQI A;  4TY9 A;  5KFE A;  3EZ5 A;  4DV4 J;  4DFP A;  3NXZ A;  4YUD A;  3LP1 B;  1X4F A;  2J6T A;  2ILY A;  1XR5 A;  3DYA B;  2MZ1 A;  4QWE A;  1HI8 A;  3NG8 A;  1K8A T;  1AFI A;  2XO6 A;  1B0T A;  1WF1 A;  4E2F B;  3PEH A;  3MF5 A;  3KJF B;  2BKO A;  3OR1 A;  1UPM B;  3LP0 B;  2BAN B;  4M5I A;  4NCG A;  5ETQ A;  4Z2X A;  4Q2M A;  2R2S A;  3GJR B;  4PG5 A;  1SVD A;  1QE1 B;  1UFL A;  2CZV C;  4M5D A;  2KXF A;  1UW9 A;  3DRS B;  3PM9 A;  2DTJ A;  4Y3C A;  1MNE A;  5KFN A;  1U1M A;  4CLP A;  1N6Q A;  4DJB A;  4FYX B;  1S10 A;  2HWT A;  2D41 A;  2KT3 A;  2QN6 B;  1J5O A;  2AT1 B;  2OH2 A;  1VQ4 S;  1RAH B;  3PIP Q;  1LK7 A;  4A48 A;  2RQM A;  5KFP A;  1T05 B;  1DJ0 A;  2V8V A;  3GFX A;  2O67 A;  5M2U A;  4BBY A;  1S6P A;  2LU2 A;  2X1A A;  1HR0 F;  4JI6 J;  1M5K C;  2MKS A;  4BCA A;  3G2X A;  4ZVO B;  4CCH A;  3H2V E;  1MN9 A;  3Q8Y A;  3S01 A;  3FFI A;  3TYT A;  3PEJ A;  1J5E J;  1EQ0 A;  4LR9 A;  3LGH A;  2BE2 A;  2M4M A;  3DGV A;  1JIH A;  1LOU A;  2IYI A;  4RW8 B;  5GAG I;  2OFG X;  2F7V A;  2CJX B;  3AXM A;  3CDW A;  3D0I E;  4EYI B;  4RUB A;  2CVI A;  2D3Z A;  4OLO A;  4YB1 P;  2MQQ A;  3C19 A;  4CO5 A;  2HIY A;  1CJK B;  2YPZ A;  5F8M A;  2K3I A;  1TP7 A;  1JJ2 R;  5CZV A;  1TUV A;  4LBH A;  1N56 A;  3S8S A;  4DFM A;  2KM8 C;  2UUA J;  3HLU A;  2BQ3 A;  1KVJ A;  3WHI A;  2KZZ A;  5L1L A;  1G6B A;  3T5H A;  3FKB A;  3HSG A;  3IRX A;  3DU6 A;  3OBI A;  1YJU A;  5U47 A;  3TVY A;  3SFG A;  3T5K A;  1S6Q A;  2VQF F;  4ZA1 A;  4IDK A;  4E98 A;  1RT2 B;  5JVH Q;  4OYI A;  4ICL A;  4I2P A;  5KFM A;  4K5S A;  1SJ3 P;  2HFU A;  2IJR A;  4L3K A;  4Y00 A;  3GB0 A;  1WF2 A;  2MKI A;  2VFR A;  3UFC X;  2VOD A;  5BXI A;  5A2Q U;  3GFH A;  3LW5 C;  2G1H A;  4ANC A;  4LFC J;  2M0G B;  1S1U B;  4U6P A;  2E44 A;  4PG8 A;  2IA0 A;  4YHH J;  4UST A;  3SEO A;  2IYG A;  4IQX A;  1YX2 A;  4X62 J;  2DH8 A;  3S1T A;  2CNO B;  2RJZ A;  3HP6 A;  2HS0 A;  4O0N A;  2EG2 A;  2QLF B;  3TI0 A;  2ZM6 J;  3SQG A;  3FRY A;  1QLN A;  4ZPC A;  1BE4 A;  1XIQ A;  2LKZ A;  5GMK a;  3OTO J;  3ISZ A;  4TU7 A;  1YHQ S;  1DY3 A;  2RNE A;  1X5S A;  3O44 A;  4K0K F;  3DOK B;  4JV1 A;  3UR0 A;  4MKA A;  4BC7 A;  2QA2 A;  3J81 Y;  1SBR A;  4QCL A;  3SSR A;  3UWT A;  3LH2 S;  1UZD A;  1ARO P;  3QJL A;  1JJC B;  1BXN A;  1S59 A;  4Q2L A;  4JI7 F;  3TAR A;  4N41 A;  2HVI A;  4F4X A;  2AGQ A;  5EUH A;  2IBK A;  1RKI A;  1UVN A;  2NRE A;  3QLH A;  3PYD A;  3N6L A;  4EYH B;  1U1K A;  1GEH A;  3DHW C;  2U1A A;  1CJT A;  3OR2 A;  3D68 A;  5BYQ A;  3I56 S;  3HJF A;  3M8P B;  2XYG B;  1IUJ A;  2BE9 B;  1NK9 A;  3CCM S;  2WSF C;  4JV5 J;  3FEZ A;  4YY3 F;  2GFF A;  1HWU A;  2DEI A;  3AJD A;  2E1M C;  4A8Y A;  2WVF A;  4DV2 F;  2H9Z A;  1RCX B;  1EKS A;  2CQ2 A;  2H54 B;  2VA3 A;  3QGH A;  2I1R A;  2GIF A;  2QFI A;  3TOQ A;  3H4B A;  3PW4 A;  2FUG 9;  1WTB A;  4ZKA A;  3OXG A;  5J1E A;  3M1V A;  4N5S A;  3KHL A;  1NHV A;  1NJY A;  2YX4 A;  3GU0 A;  3VTI A;  2ATC B;  1B4S A;  4LRD A;  1XR6 A;  2VG6 A;  1JKH A;  2HFZ A;  3BGL A;  1S1U A;  1VBZ A;  2J0Q D;  4KE5 A;  2B5J B;  1B70 B;  5B0D A;  2LQ8 A;  2ZH3 A;  4OYW A;  1FTC A;  3SYZ A;  2VB6 A;  5KFW A;  2D3O R;  1SKR A;  4ZVS B;  1VQ5 S;  2W8K A;  2CQH A;  1S1W B;  3BEG B;  1WHW A;  2VUG A;  4OI0 A;  2BRK A;  1RAJ A;  1R0A A;  4DR7 F;  2R4F A;  3CCS S;  3PJW A;  3BSO A;  3TO8 A;  4UT4 A;  1FRL A;  3CIZ A;  3KJV B;  4ED5 A;  2GAH C;  4ZVG A;  3PR5 B;  4DSJ A;  2YVS A;  4X2B A;  3W7B A;  4WKR A;  4IFY A;  2W2O P;  2H5J B;  4RX6 A;  2R42 A;  1R8H A;  3PFO A;  2A6M A;  1GNK A;  4PQA A;  1Z4U A;  3K5P A;  4CM0 A;  1M5V C;  3P5B P;  2V2V A;  3PY8 A;  1RWU A;  2FZK B;  3F73 A;  4PPD A;  4R25 A;  3T19 A;  1VRT B;  1GTE A;  3U27 A;  3CE8 A;  4HHU A;  1RAD B;  3CDB A;  1C4C A;  4V1A k;  4KFB A;  3HX9 A;  2XLI A;  1LWX A;  3PJX A;  3NAH A;  4DV3 J;  4HVZ A;  3QGG A;  2VKR A;  4FYW B;  1UP1 A;  2XTJ P;  5IC4 B;  2V67 A;  5B0C A;  4FPR A;  2QLX A;  1VQO S;  1FRK A;  1HBN B;  2HQF A;  3I4P A;  2P9G A;  1F2H A;  1HPZ B;  3IM8 A;  3RUB L;  3TAM A;  4OZ0 A;  3TA0 A;  1HMV B;  4LJM A;  4ZN3 A;  5B08 A;  4ES3 A;  1EKR A;  5LXY A;  4WCE Q;  3KDN A;  2V4Q A;  3K0J A;  2KTQ A;  1UKU A;  1ZH5 A;  4DL0 C;  3NGU A;  2B7B B;  3I0S A;  3HUL A;  4XTT A;  5GVQ A;  1UVI A;  3ITH A;  3X1L B;  1RWK B;  4IOA Q;  3LA0 A;  2B8Q A;  2XUL A;  3CCU S;  1HYS B;  2L9W A;  2R9L A;  5CAB A;  2V34 A;  5KFL A;  4OMF G;  1ZAV A;  1IR0 A;  1PSD A;  1S9E B;  3BH6 B;  1MWY A;  1OPI A;  1RTJ B;  2CWX A;  2O1P A;  3R5D A;  4DXL A;  3CXC R;  3D28 A;  3U1L A;  3M8W A;  4F0K A;  2MST A;  1ZBT A;  2EI5 A;  2WTF A;  2VDH A;  3K5N A;  3DM2 B;  1QVF R;  2J0S D;  4KO0 A;  1H0H B;  1YGY A;  4A8K A;  3T1H J;  1ZPV A;  5KFH A;  3DI6 A;  3QO9 B;  1WG1 A;  4ZHR A;  3GFY A;  4RW7 B;  3OT9 A;  3DLG A;  4J9O A;  1PJ6 A;  1HNW J;  1FKP A;  1FNM A;  1L3K A;  4KY3 A;  4HH0 A;  3CJ4 A;  4ZJL A;  3CTR A;  2DR9 A;  2DJW A;  3DRR A;  3UI3 A;  3UDL A;  1B0V A;  2OP5 A;  3BR8 A;  3J7Y U;  1OSD A;  4YB6 A;  2NYH A;  1B7F A;  2RE1 A;  4Q0B B;  1JLC A;  1TQL A;  2EWH A;  4IFV A;  4F50 A;  1HWL A;  4JP8 A;  5KT4 A;  4TQS A;  2GVD A;  1TL4 A;  3M2V B;  1IBM F;  3BN4 A;  1GK8 A;  2LP4 A;  3DOL A;  1FWP A;  2A18 A;  3HHL B;  3OTO F;  1FJ7 A;  2B3T B;  7FDR A;  4B3R J;  4GVB A;  3NS5 A;  1M5P C;  2YQ0 A;  3TQ1 A;  5KG2 A;  2R2T A;  4DBQ A;  1U8W A;  2EW9 A;  1FJG F;  1S97 A;  2MHE A;  2QTW A;  3I32 A;  5G0R A;  1M5O C;  3AFG A;  1VIO A;  2FY1 A;  1MN7 A;  3UD3 P;  2B0G A;  2MQM A;  3OJS A;  1FXD A;  3MM8 A;  4CRJ A;  1RGV A;  1SIW B;  3ULH A;  2QMU B;  4F7V A;  2C2D A;  5F8I A;  1NKB A;  2QG9 B;  3DFE A;  3I6P A;  3D6F B;  4OV1 A;  2IHR 1;  4DZ6 A;  7AT1 B;  1OY8 A;  1Q8B A;  4UF4 A;  3DOL B;  1KRP A;  2HND A;  4RUA A;  2GVD B;  5HMW A;  1GMW A;  2FIU A;  3V4M A;  3K7R A;  2OJ3 A;  3MD3 A;  4U7U K;  1G1X A;  2ROE A;  2VD3 A;  2HQC A;  4I64 A;  5B0F A;  3GIJ A;  4DV5 J;  1XMO J;  1NJX A;  3SDE B;  2V4J B;  4I69 A;  1KSP A;  4ID5 A;  1U8S A;  3G9C A;  1N88 A;  4X66 F;  1UVM A;  2VF3 A;  1DQ8 A;  1T9U A;  2YNF B;  3MMC B;  2YH1 A;  4P73 A;  1NHU A;  1HQU B;  1VIS A;  4UOF A;  2ASJ A;  2MQP A;  3TZX A;  1OY9 A;  3D3C J;  1WC5 A;  3CJK B;  1EJ7 L;  3GG0 A;  5HJY A;  3TJA A;  1RTH B;  3QZ7 A;  4WP9 A;  3MWB A;  3V6K A;  1GXU A;  3VAG A;  1U45 A;  2KXN B;  5LT5 A;  1Q82 T;  1JLA B;  1DQ9 A;  5HQM A;  1UWA A;  2YH0 A;  4J9M A;  2HHS A;  3BBF A;  2HQD A;  2R7T A;  1XMQ F;  3QIP B;  1UWB A;  5G4D A;  3W5Z A;  4FBU A;  3OXL A;  5DG7 A;  1FD2 A;  5CZX A;  2FJW A;  3N4W A;  2DR6 A;  2DO4 A;  4N8O A;  2KI2 A;  1FE0 A;  1DLO A;  3GE9 A;  1T3O A;  5F0U A;  4DPT A;  4AQY J;  1T9W A;  2KYX A;  3KK1 B;  3IG1 A;  5D3G A;  3V81 A;  2RML A;  1U25 A;  4Y2K A;  4PWD A;  1TK8 A;  2PMZ D;  4TY8 B;  1HWJ A;  2CQ0 A;  4NLU A;  3T3F A;  4PUO B;  1I3O B;  2MLX A;  4NZ7 A;  3TWZ A;  4EK2 A;  3KJN B;  4A8M P;  2CIM A;  1HBU B;  3I0R B;  4ED4 A;  4KHR A;  3MR2 A;  4NEY A;  3M8Q B;  4ECS A;  2EC2 A;  2GIQ A;  3T9Z A;  1QAY A;  4C97 A;  1OIA A;  3Q0A A;  4LMZ A;  1I51 B;  4MTP A;  4F04 B;  2E9Z A;  4KYZ A;  2UUT A;  1IKV A;  1WD6 A;  2J0W A;  3SCI E;  1VRU A;  3A3O B;  1S7I A;  4IG3 B;  4PG4 A;  2V2K A;  4RW9 B;  3UDV A;  3K5M A;  5B0B A;  3OL8 A;  3RR8 A;  5ETS A;  4MYT A;  2OD6 A;  2ZH4 A;  2CYY A;  2QIF A;  2A0F B;  4DFJ A;  5MAO A;  1WKK A;  2YWE A;  1U48 A;  1Q81 T;  2IJN A;  3AOB A;  4C48 A;  3MUM P;  3AJ2 A;  3KLG A;  3R7S B;  5DDO C;  4GKK F;  1S5Z A;  2AJQ A;  4QQB A;  1A7G E;  4MFB A;  1VCT A;  1FA0 A;  1HNI A;  5HVG A;  1S1W A;  2DKO B;  3KG4 A;  2DNR A;  4LF4 F;  3BGO P;  2KVQ E;  3JQJ A;  4CLU A;  5KT7 A;  3MOZ A;  3M9N B;  2ZHB A;  1FFS B;  2X3D A;  1VQ8 S;  4XDD A;  3PX4 A;  3RAQ A;  2MQN A;  3BPS P;  4H4O A;  2VG6 B;  1RT6 A;  4I6Y A;  2J9D A;  1BC6 A;  1V5V A;  3PHE A;  2Z0G A;  4XO0 A;  5DET A;  4I2Q B;  2ZVS A;  1BUX A;  1U26 A;  1YJ7 A;  4UZB A;  2W8L A;  2D1C A;  3NL0 A;  4CWB A;  1Y11 A;  4UZC A;  1HNW F;  4FS2 A;  2PE8 A;  3JQM A;  4ZJO A;  2UVV A;  2PI4 A;  4C0O C;  2AJ2 A;  3M2R A;  5BYR A;  2D74 B;  3KHR A;  2AJ1 A;  2W2P P;  4C8O A;  1K9M T;  2L3M A;  3G82 B;  4OI3 A;  5H9F J;  4DZD A;  1SUQ B;  2Q79 A;  5ADZ A;  4AUK A;  1D0E A;  4EBD A;  4PWU A;  1TFY A;  4WYW A;  3DRP A;  3UVJ A;  4DOZ A;  3W66 A;  2H4W B;  5IWA J;  3HVR A;  5E0O A;  4F2S A;  2X1B A;  2QSF A;  3AY0 A;  2Z56 B;  5CHC B;  1D9F A;  4B9N A;  1VQL S;  1HA1 A;  3UQS A;  2OGU A;  4TU9 A;  1YBA A;  3D54 A;  3Q24 A;  3ET6 A;  3NGT A;  3IS9 B;  2MJN A;  2FC8 A;  2QO3 A;  3K17 A;  3WIU A;  2QA4 S;  4F4Y A;  1HNX F;  2H5E A;  3CB4 A;  2Z57 B;  4USV A;  5HK4 A;  3RBZ A;  2WON A;  4C98 A;  1KQS R;  2Y9H A;  3OVB A;  2XCP A;  3EVM A;  4LRF A;  3E51 A;  3DRY A;  2GVZ B;  4QOT A;  4DX6 A;  2GC8 A;  1X60 A;  2M3D A;  4DUT A;  4PWD B;  2FQQ B;  4N56 A;  2JFD A;  2XO7 A;  2W2Q P;  1Y4Z B;  2FLP A;  1IBK F;  4RU9 A;  1Q5V A;  4F0H A;  3FEX B;  4RUH A;  2HGL A;  4USW A;  1N48 A;  1DUR A;  1TVR B;  2NPF A;  1ULR A;  4QIG A;  4B3T F;  1XMB A;  3GR1 A;  3O1L A;  3QGP A;  1K0V A;  3KKF A;  3QAU A;  5K14 A;  1AUD A;  1BQM B;  1SJF A;  2QGF B;  1NRK A;  4CO0 A;  2MQ8 A;  3BBC A;  4NLY A;  2LEC A;  2PI5 A;  3MMC A;  3G87 A;  3UD5 A;  3D67 A;  4DV7 J;  2DBB A;  3C6T A;  4FVC A;  5GAH I;  1P8G A;  1TK5 A;  4Y2I A;  3CO0 P;  3NNA A;  1NH7 A;  2NXC A;  1HQE B;  2YKM B;  4ZCI A;  2GGP B;  2RDJ A;  1C0T A;  2W9C A;  1VRQ C;  3M4X A;  2ZKT A;  3NRB A;  2BEF A;  3MEE A;  1G2E A;  1IKY A;  3K58 A;  2E9T A;  2CDR B;  2YWW A;  4ZCM A;  4O23 A;  1IBC B;  1TKX A;  1TL5 A;  2UXC J;  4WYL A;  1ZZN A;  2VBX A;  4JV0 A;  4W92 B;  1RK8 A;  4I2P B;  2XS2 A;  1M1H A;  1D3W A;  1WSV A;  3J7Y I;  1JQG A;  5KG3 A;  3QJJ A;  2ROG A;  5GME A;  4ED6 A;  3LWM A;  2RHS B;  4LRE A;  4JI2 F;  4A8S A;  2HNY A;  5D0G A;  5IFM A;  1YJV A;  1MWQ A;  3DOM B;  3GIL A;  1NAQ A;  1VI7 A;  3QPI A;  2XS7 A;  1R27 B;  3D3B J;  3D9B A;  3WC2 A;  4PQU A;  3M7V A;  4USU A;  2F3J A;  1LFW A;  5HAN A;  2W9B B;  2PMW A;  3PO5 A;  4ID8 A;  2FJE B;  4RW4 A;  1GXT A;  2PMH A;  3OSP A;  2FJA B;  4F36 A;  2IAJ B;  2RKI A;  2HZA A;  4LRA A;  1H74 A;  3PFE A;  4PXD A;  1SPB P;  2WOM A;  2CPZ A;  2NXJ A;  5CYQ A;  4P10 A;  2HHH J;  4LFB F;  4O3S A;  1RAF B;  4WTO B;  1SC3 B;  5ETL A;  1WDD A;  3R2C J;  4L3N A;  2O01 C;  4RW6 B;  2O3D A;  2HVD A;  2FDN A;  4IH7 A;  3A12 A;  2Z4P A;  2WW8 A;  3QT5 A;  1LXJ A;  4ZP9 A;  3GCW P;  9RUB A;  3IGN A;  5M2P A;  2DNP A;  2D3U A;  1UET A;  2E29 A;  1HBM A;  2J7K A;  2ZWP A;  3HD1 A;  4U8Y A;  1HI1 A;  4F26 A;  3D1H A;  5A8K B;  5KFO A;  3MOJ B;  2K7J A;  3OSN A;  1C2P A;  1F5A A;  1M5H A;  3PRV A;  1JLG B;  4K2X A;  3VGU A;  3J7Z 5;  3OL7 A;  2R7W A;  1YSJ A;  1TUW A;  1MMD A;  3KLH B;  2DCU B;  4M5D B;  3JQK A;  4K4X A;  1HD0 A;  2ADB A;  1TL7 A;  5T7L B;  1KNZ A;  3H25 A;  2GJI A;  1RWX B;  4KKO B;  4U96 A;  3MAQ A;  4WE1 B;  4AYB D;  1EP4 A;  5LMN J;  4KH1 B;  1QD1 A;  1T02 A;  3DU5 A;  1CPZ A;  2C2O B;  3UPF A;  4BC9 A;  2BJ7 A;  3J81 j;  2I5J B;  3T9N A;  2FVQ A;  3AQP A;  4RNN A;  4IRC A;  1L3S A;  1RZM A;  2OAU A;  3PYE A;  2P9E A;  2CWK A;  2JEJ A;  1GMU A;  3LOU A;  5EX3 A;  2OPQ B;  4J9S A;  1D9A A;  4HL9 A;  2LQJ A;  3RAM A;  2HHX A;  5ETK A;  4I7F A;  3TJ8 A;  1YG0 A;  1Q0N A;  4H54 A;  3K89 A;  4P2F A;  1F3V A;  2HNZ B;  1CJV A;  4USJ C;  1EP4 B;  2GQ2 A;  1M5S A;  2IFX A;  5CH7 B;  5F9L A;  2CPX A;  5C42 B;  3K57 A;  4ILR A;  3T5L A;  5I3U A;  4L6V 3;  2HK3 A;  2QZ8 A;  4XPC A;  1IM6 A;  4KPY A;  2DNN A;  1CS4 A;  1PJ7 A;  2B4U A;  4KV8 B;  3I87 A;  3ZZR A;  1KEK A;  5CQG A;  2DHA A;  4J9K A;  4K50 A;  2FGC A;  2KRB A;  3KUE A;  1HW9 A;  3QGI A;  4MJK A;  2DXF A;  3KG0 A;  3NGK A;  2VZ9 A;  5ETV A;  3CDE A;  5ETR A;  5DDP C;  3HHL C;  4LF8 F;  1FRX A;  1P6T A;  3CJQ A;  3R9L A;  3NP5 A;  1U1O A;  1E6V A;  2HVE A;  4X4R A;  3KJV A;  2YNF A;  4KT0 C;  1Z2Z A;  2Y3Y A;  3BBB A;  3Q89 A;  4USI A;  4DR2 J;  1YJW S;  3PHT A;  3JAM U;  2YNG B;  5E3P A;  1RT3 B;  1T03 A;  4HI2 A;  1J2V A;  1PJ5 A;  3VV2 B;  5M2R A;  1WI6 A;  4U7C A;  3W2V A;  2RUS A;  1MW7 A;  8RUC A;  5F8L A;  3H5S A;  5GAD U;  4FKY A;  4J9L A;  4DV6 F;  3VF0 B;  2C1E B;  1UFW A;  1SL2 A;  2RDD A;  4K8R A;  4L74 A;  4YR2 A;  3R8Y A;  2YKQ A;  2J76 E;  4ZMM A;  3THV A;  3RAX A;  2FB0 A;  1X9M A;  2MDA A;  2U2F A;  4PXC A;  5IT4 A;  5CD4 A;  2KM8 B;  2YBV A;  2DRB A;  4BDP A;  3H2L A;  2EFO A;  3VAF A;  4F2R A;  1T9Y A;  1AW0 A;  1VLY A;  1RT4 B;  3PYG A;  4C3K A;  2AIR B;  5HAO A;  2HNY B;  1FT8 A;  1N5V A;  2ZOG A;  4TQR A;  2XZW A;  5J2Q A;  3CME S;  2UXC F;  4PG6 A;  1S9G B;  4QYR A;  2WK4 A;  1JLF A;  2WON B;  1N5Y A;  5JVG Q;  2JNJ A;  1SJQ A;  2V50 A;  1NND A;  3W5X A;  3QQC D;  3MUV P;  3NNH A;  1A9N B;  3V4I B;  3K5O A;  1PIL A;  3RB3 A;  2MLZ A;  1JNZ B;  2RQK A;  4HEA 9;  3D2W A;  1UJ4 A;  1X4H A;  4ZPT R;  2YKM A;  4P2X A;  3J81 U;  2K1R B;  4Q5V A;  3MTK A;  4AL7 A;  2OTJ S;  1UVL A;  4F25 A;  2OSR A;  2LCW A;  2FJV A;  5H1S V;  2B9W A;  4OYM A;  2HMI B;  2H48 B;  3SQO P;  3UNG C;  4PXE A;  1RLC L;  3LQV A;  1BQM A;  1JLQ A;  1RWW B;  3BGR A;  3ZTO A;  2N82 B;  3OVS A;  2Z2L A;  2KL8 A;  2F9D A;  1PCA A;  4C11 A;  1IBL J;  4DSE A;  4OJH A;  2H65 B;  4OHV A;  1H3D A;  1QVG R;  4QIF A;  1WKJ A;  1LEO A;  4DSL A;  4DSK A;  3M30 A;  5EWE A;  1T9X A;  5A8W B;  4K0K J;  4TN2 A;  2DY9 A;  3NWG A;  2GMJ A;  1XC9 A;  1NUE A;  2DNH A;  2K7K A;  3HM9 A;  2V63 A;  4CH7 A;  3V2U C;  3CF5 Q;  3Q8S B;  2LEB A;  2CG8 A;  2CJK A;  1SL1 A;  2UZA A;  1S1T B;  2GS8 A;  2VBW A;  2JVO A;  2WSE C;  4I6W A;  1REV A;  2DEJ A;  2M9K A;  1HMV A;  2ZFH A;  3M8Y A;  5IXU A;  3T6J A;  5KFD A;  4EBC A;  2UU9 J;  1TZ0 A;  2YNH B;  3M32 A;  1FKA F;  1HQ2 A;  1TEL A;  4FF2 A;  1KC8 T;  1RT5 A;  2HQG A;  2MKK A;  2K8G A;  2CAJ A;  1T3N A;  2XLK A;  4UUX A;  2DNY A;  3GTY X;  3G6E S;  5GAG U;  2UXB F;  2VON A;  1FDD A;  2FYX A;  1G4C A;  2AJ0 A;  3IR7 B;  1OMS A;  3MM9 B;  2VG7 B;  3ZZZ A;  4DCJ B;  4DWI A;  1VRT A;  4LF2 A;  3OVA A;  4ATN A;  3K2Y A;  3G96 A;  2AEF A;  2HAF A;  2KB2 A;  1GAO A;  1WEX A;  3MAH A;  4X4N A;  3VAH A;  2XQC A;  8ATC B;  3E01 A;  3EDR B;  2PT0 A;  3BSC A;  5A8R B;  3AH6 A;  3QNW B;  3O6Q A;  1ZZF A;  2FTR A;  4DV1 F;  4F3Q A;  2FLL A;  3UE2 A;  1R89 A;  2DXD A;  3TEH B;  1XN9 A;  2QA1 A;  1AYE A;  2YNH A;  3D66 A;  4B9S A;  2HHV A;  2AQ4 A;  1K1S A;  1TKT B;  4LF6 F;  3MPU B;  3HZG A;  4KGX B;  3KK1 A;  3IBF B;  2HHQ A;  4DUY F;  1YKW A;  1R0C B;  1QUP A;  3HHD A;  1OPZ A;  2V8D A;  4X84 A;  3RRH A;  5D78 A;  3QZ8 A;  5T7L A;  3CIM A;  3QFH A;  2I9S A;  4CQ1 A;  1Q86 T;  3GFZ A;  1FJG J;  1FJE B;  3BGR B;  3TZZ A;  2Q6B A;  1Q79 A;  2E1P A;  1ITP A;  2VPX B;  1QJH A;  4WU2 A;  2HZC A;  1RP5 A;  1REG X;  5LSR A;  1XK8 A;  2MMY A;  2B9E A;  3OR1 B;  4H4K A;  1ZM2 A;  3IMQ J;  4JI0 F;  5DO2 A;  4CLT A;  4QPX A;  2J6S A;  2VA2 A;  5AXM A;  1JLQ B;  2A3J A;  1SIZ A;  4K4Z A;  2QC3 A;  1CJT B;  3ZZO A;  1E6Y B;  2VIC A;  3P8B B;  3SV3 A;  1UVJ A;  4KHP F;  2NQP A;  1KOO A;  1BY9 A;  3L09 A;  4GKJ F;  1D8Z A;  5KG0 A;  2KH9 A;  3EXC X;  1UW4 A;  1Q8L A;  4ZLP A;  1PBU A;  1TKD A;  2CJA A;  5KTQ A;  2V5H G;  1RHM B;  1N33 J;  5A2Q Y;  2C3U A;  3G4S S;  1SV5 A;  3IN5 A;  5HLF B;  3J7A 1;  3DHX A;  2XY7 A;  1QSY A;  3Q23 A;  2RAQ A;  3EVW A;  4MAK A;  3PV8 A;  4IRK A;  1U1L A;  4CO2 A;  3EGV A;  3DOK A;  4OIX A;  4ZVR B;  2OFH X;  3MAA A;  4CLY A;  2KFY A;  2FHM A;  5SZT A;  3FBE A;  1WOP A;  2A1B A;  3DMJ B;  2VC1 A;  5IT9 Y;  5IZH A;  4P7T A;  3DLL Q;  2VAS A;  4HR2 A;  3GIM A;  2IC3 A;  3FMB A;  2ZBQ A;  3ONQ A;  3QYY A;  3SCL E;  4K4Y A;  1S9F A;  1WNE A;  4R5P A;  3KUG A;  4IQM A;  3CCW A;  5BR8 F;  3L4B C;  1SH2 A;  4B17 A;  1RTI A;  3TR5 A;  2W7A A;  1S48 A;  3E3X A;  1RHR B;  3CJ2 A;  1M0S A;  5DGB A;  4DV6 J;  4E0D A;  1TKX B;  5FDL B;  4LF9 J;  1F9E B;  3ENV A;  3OFF A;  3M2U B;  1LFP A;  2VC0 A;  4W98 A;  4QW8 A;  3ZZU A;  3KLV A;  3R1H A;  2Q66 A;  4DR6 F;  2V94 A;  3JTO A;  4QU7 A;  1U2C A;  3RBX A;  2LXF A;  2IMW P;  1GH8 A;  4NXN J;  4A46 A;  1BD6 A;  5HAT A;  4LVO P;  5KFK A;  1NU4 A;  2XSJ B;  3VAJ A;  1SB6 A;  2KJW A;  4ZPD A;  3OD2 A;  3GPA A;  4ID5 B;  1RJJ A;  1RHQ B;  3QFW A;  2W9A A;  5E3R A;  4LSL A;  1WC1 A;  4YDD B;  1TV6 B;  2B6A A;  2Q1L A;  1AUS L;  3N01 A;  1RBO B;  2AKW B;  3QJP A;  3NCR A;  1S12 A;  2EXU A;  1UL3 A;  4WTY A;  4YN3 B;  5D6G A;  5KFF A;  1K44 A;  3FCW A;  4R8U B;  2VKZ G;  1RTI B;  4Z37 A;  3EZO A;  2JLG A;  1HLW A;  1HW8 A;  1VJW A;  4IR9 A;  1KQF B;  1DTQ B;  4O3P A;  3UDC A;  5DLG A;  1NK0 A;  1TUG B;  1T0T V;  2GA7 A;  1GMV A;  1O6X A;  2X51 A;  4LFA J;  3W1Y C;  1S57 A;  3IBW A;  2XC9 A;  2D3O 1;  1SV5 B;  1S0O A;  4DFK A;  3ITH B;  1KBR A;  4FXW A;  2RRA A;  1OJ4 A;  2RVJ A;  5HVF A;  1FES A;  1RWV B;  2DYA A;  2RDI A;  3OJU A;  4DR3 J;  2CPJ A;  4F3O A;  1TR0 A;  3Q8P B;  4MYU A;  4RBT A;  1X5P A;  1JLB A;  4CP5 A;  3Q8V A;  4NPO A;  2GCF A;  1NPP A;  2DIT A;  1SJ4 P;  2CZ4 A;  4QYZ K;  2HHW A;  3TUZ C;  4KJI A;  2MQO A;  5HLF A;  2DPJ A;  4TVA B;  2N3O A;  1Z1Z A;  1BGX T;  5LMN F;  1C0T B;  3UCG A;  2LA4 A;  2W9C B;  1HFE L;  1M1G A;  4LF9 F;  1FKP B;  2KT2 A;  3H40 A;  2ERR A;  4MK9 A;  3MGJ A;  2OD4 A;  2MYF A;  4IYQ A;  5D0H A;  1SUQ A;  3LF0 A;  2Z2Y B;  5C25 A;  4Q44 A;  4BLG A;  4DF8 A;  2F8M A;  4DV0 J;  3QO9 A;  1YLX A;  2FVC A;  4PZV A;  2N4D A;  2GNK A;  3H42 A;  2A6O A;  2DR8 A;  3DLG B;  3THP A;  3J7Z T;  2HRY A;  2MSS A;  3NBP A;  3MM6 B;  2JLF A;  4UQG A;  4YEA A;  2QYC A;  1KVI A;  3OUY A;  1D09 B;  2W01 A;  4HTI A;  4D3G A;  5HMY A;  5JUM A;  4BWM A;  1DAR A;  2B9X A;  1NSQ A;  1U0H A;  4X4O A;  2OEM A;  3MFI A;  2W7O A;  2ZH5 A;  4Y6I A;  3CCR S;  3A3N B;  4DSI A;  5A8K A;  2CDQ A;  3B54 A;  1VC0 A;  3UW1 A;  1RHJ B;  2C2Z B;  1KR4 A;  2CJQ A;  2G2Y A;  2CJY B;  4FNH A;  5ITH A;  5F8N A;  1UEU A;  1NSK L;  2GVZ A;  3L7U A;  2XZT B;  4ENO A;  5C42 A;  1HYS A;  3D1Q A;  1H2T Z;  1ZYQ A;  2IAJ A;  4OYO A;  3VAL A;  2GX8 A;  4DR4 F;  1NXI A;  4NZ0 A;  1VQ6 S;  2VG5 B;  3BKF A;  3NCP A;  4RNF A;  5CYQ B;  1FEH A;  3QT8 A;  2HBR B;  2PD1 A;  4OHY A;  2LMI A;  1X31 C;  4X66 J;  4J9N A;  2Y1L B;  2HW3 A;  2HPU A;  3M8Z A;  1TKZ A;  3US5 A;  3D6H B;  2LDY A;  4BWJ A;  1D8Y A;  3HFZ B;  3SI8 A;  2HHP A;  1S1V A;  2BAC A;  3UO0 A;  3PX0 A;  1YK9 A;  4O3R A;  2QMW A;  4CZC A;  3E01 B;  2XGP A;  2CQ3 A;  2DNM A;  3HK2 A;  4RUC A;  3SMZ A;  3JSM A;  5J2N B;  4UUW A;  1V3S A;  1W7W A;  1VQY A;  4R8U A;  4AXJ A;  2GML A;  5IWA F;  1RWN B;  5AXL A;  2W25 A;  3BDP A;  4ER8 A;  5DZ6 A;  3R6L B;  4JI7 J;  4DQR A;  2OKQ A;  2SXL A;  3KMQ A;  1RT1 B;  3OV7 A;  2BW2 A;  5KT6 A;  3D4J A;  1NDP A;  3GMG A;  4Y34 A;  1F1B B;  5KFA A;  5HL7 Q;  4EMD A;  2PDA A;  3FRZ A;  1PAU B;  3GCX P;  1NH8 A;  3HPO A;  1PBA A;  3ELH A;  4J9V A;  1RBA A;  1RT6 B;  1UEK A;  2QLJ B;  3H5U A;  1J27 A;  4HT7 A;  1QDU B;  3P49 B;  1NSA A;  3OPK A;  3G8S A;  5ETO A;  2FJB B;  2HFN A;  3HSZ A;  2I38 A;  2IM0 A;  3R7N B;  3JYT B;  2E5I A;  1WC6 A;  4KR0 B;  5KFQ A;  3ENA A;  3RB6 A;  3M30 B;  3PTW A;  1HBO A;  4IO9 Q;  1KTV A;  2XMU A;  1FJC A;  4KAI A;  4JI5 F;  1QUV A;  4KPC A;  3TNV A;  4K7Q A;  3SXL A;  2UP1 A;  1TVR A;  3FQK A;  3OTC A;  3UR3 C;  5KT3 A;  3RTV A;  2DGX A;  2NUH A;  4NLV A;  2EVZ A;  1KON A;  1RAE B;  3A3P B;  4OZN A;  3ZTQ A;  2HGN A;  5K8N A;  2LXU A;  4Q7A A;  1URR A;  4PKD B;  3KUH A;  2RF2 A;  3HHL D;  3PW2 A;  2XS5 A;  5JJB A;  2R8G A;  1TL1 A;  3HFK A;  4OZJ A;  4YHH F;  4Q8E A;  3NOG A;  1S49 A;  2XMM A;  1KD1 T;  5DQI A;  3O8W A;  2WBR A;  4ICL B;  3RW6 A;  2V69 A;  4PWW A;  1H73 A;  2ALZ A;  3OHA A;  1H98 A;  2WB1 D;  3EPI A;  2CQD A;  3ICL A;  1N52 B;  5KT2 A;  1ICE B;  3IRX B;  4R0J A;  1VMB A;  4RNO A;  3A1Y G;  4UY8 T;  2P6T A;  4DQI A;  4QPT A;  3H4D A;  5DM6 Q;  2WVD A;  2XNR A;  1LW2 A;  2GJ2 A;  2EKN A;  1ACM B;  1FRH A;  2Q3P A;  3G86 A;  2VJU A;  3MR6 A;  1S72 S;  1MLA A;  5FLX Y;  2JOQ A;  5LOQ A;  1KLN A;  1TMJ A;  5E7O B;  2W24 A;  1S0M A;  4KGK A;  2CNL B;  4OI6 A;  1F2G A;  2EK1 A;  2A2C A;  3DLE A;  1R3N A;  2BM1 A;  3WX4 A;  2F8E X;  2NXN A;  2E66 A;  1V9O A;  3DCA A;  1VQM S;  1JX4 A;  3W2V B;  2UUW A;  1RTD A;  4HDH A;  4URS A;  2OEK A;  3VWS A;  2YKO A;  2L41 A;  3PRB A;  4O3N A;  3AOA A;  1KQK A;  1RA7 A;  1SL0 A;  1Q7L B;  2J8S A;  4IO1 A;  1IBL F;  5LSO A;  1IR2 A;  3PCO B;  2N3L A;  3JYT A;  2HQI A;  1ZM4 A;  2EKY A;  2V4J A;  1VQN S;  2VDI A;  4C6A A;  4C0B A;  1HNI B;  2KFN A;  3A8K A;  1T8E A;  2IA6 A;  4L75 A;  2G2O A;  2BKP A;  3FZ2 A;  3M2U A;  1MG7 A;  1SQG A;  3DM2 A;  5A6P A;  3KLG B;  3SCJ E;  4DMZ A;  5LMU F;  1IXK A;  1VQK S;  1KKH A;  1IBK J;  4ZJQ A;  2VHG A;  2NUU G;  2B8P A;  1CBK A;  1NBE B;  1CJK A;  1TKZ B;  2DNG A;  3CJ3 A;  3LP1 A;  2DD8 S;  4R5P B;  3J80 Y;  1JJ4 A;  4EFA C;  4ZP7 A;  2IDE A;  2BE2 B;  1RHK B;  2K3K A;  4KHM A;  4LR8 A;  1X9W A;  3H7H B;  2VPW B;  1OYD A;  2ASL A;  1HIY A;  1LKZ A;  1YVF A;  2B4V A;  2HLT A;  3B4D A;  4RLE A;  1PGZ A;  3C14 B;  3FSY A;  2MHN A;  4OI2 A;  3R97 A;  5J2M B;  3G6X A;  3B78 A;  3MI7 X;  1QTN B;  2XMT A;  1UCN A;  2YY3 A;  5K5M A;  2VBZ A;  1MMN A;  4LRC A;  2G0J A;  2FHK A;  2I5J A;  2LFV A;  2MKJ A;  5I3P A;  3ZTP A;  3MUT P;  4CTA B;  3N0V A;  4B3M F;  2ZC3 A;  3CSK A;  2VOP A;  2GIR A;  3HT0 A;  2QYG A;  3M2V A;  3ZC4 A;  4M94 A;  1NPR A;  1DHM A;  3JS9 A;  4TNO A;  3ILI A;  3CO9 A;  4NL5 A;  1NME B;  4L73 A;  2OPQ A;  3FBC A;  3BM7 A;  4DQS A;  5I3Q A;  1GX5 A;  1RSC A;  1IQZ A;  1C1B B;  1VHF A;  1ZOT A;  3I55 S;  3A8I A;  3G71 S;  1W25 A;  1RXO B;  1DBD A;  4DR6 J;  3MCN A;  4DL4 A;  4I1T A;  2K06 A;  2YX1 A;  4DPY A;  5GAE I;  2CG4 A;  2EEY A;  2IRY A;  3L95 X;  1DAX A;  4GMK A;  1IVZ A;  2R2U A;  3QT7 A;  3DLJ A;  4AT1 B;  2RU3 A;  2KU7 A;  5E33 A;  2DH7 A;  3TZW A;  4NMX A;  4CLL A;  4M5M A;  4G1Q A;  1VIX A;  1GFW B;  1S4E A;  3VR1 A;  4LF8 J;  4DPW A;  3Q83 A;  4RJV A;  2D7S A;  4WF9 Q;  2FZG B;  3QBC A;  4HT5 A;  4D3H A;  3CC2 S;  3PG9 A;  2JEG A;  3C15 B;  3GJS B;  4N77 A;  3M9O B;  1C1B A;  5IV4 A;  1TAU A;  2V2Z A;  4ZPB A;  3RR7 A;  4LR7 A;  4J90 A;  4A4J A;  2RU9 A;  2AWZ A;  2LQB A;  2YWG A;  1Y3K A;  2J7W A;  3H0P A;  3CDA A;  3RW7 A;  4LF7 J;  5FII A;  4RW4 B;  4Y2C A;  3J80 U;  5KG4 A;  4LFC F;  2BAB A;  2GAG C;  4NI2 A;  5D4N A;  2DIU A;  3VAM A;  4ED2 A;  4KQZ A;  4WII A;  3ZNJ 1;  1LW0 A;  5C24 B;  1Y5L B;  4CO4 A;  3C2P A;  1VOM A;  1OY6 A;  2WOM B;  2BE7 D;  3LP2 A;  3Q86 A;  3TA2 A;  3TVK A;  2GHP A;  3PAC A;  1U1Q A;  2HSE B;  4RR5 A;  3MTJ A;  1AFJ A;  2ROP A;  1WI8 A;  2JDJ A;  1LW2 B;  2P6S A;  3GYX B;  4RBV A;  4AE5 A;  3GR0 A;  4IG0 A;  3EMT A;  7FD1 A;  4A8W A;  3T5J A;  1QAJ A;  2IRU A;  3CD5 A;  2D9O A;  2MTL A;  3R3T A;  3WBZ A;  3CJ8 A;  5L39 A;  1VK3 A;  3KLE B;  4U8V A;  2AYG A;  3CJ5 A;  3GJT B;  2UUB F;  2IMO A;  1P1T A;  4CO1 A;  4GRS A;  3MEC A;  4K4W A;  1YTY A;  4F4Z A;  2B6A B;  4NML A;  1HQE A;  4DUZ J;  4IOC Q;  4EI2 A;  1WSR A;  2NPI A;  2OPR B;  2B9Y A;  4TLQ A;  3QAE A;  2HUR A;  1KFD A;  2C2N A;  3HHE A;  1N8R T;  4KGZ B;  3UNY A;  1R8C A;  1REV B;  4DS4 A;  4ZPV R;  3T1Y J;  1YI2 S;  4DR7 J;  3N6M A;  5HJX A;  5KFZ A;  1Q8I A;  3DRR B;  3DXS X;  2XEX A;  1U6B A;  4QU6 A;  2DIS A;  2DRD A;  1KN6 A;  3L9Z A;  2V8P A;  1CSJ A;  2QA4 G;  1B7Y B;  3LTO A;  2XMJ A;  1FRJ A;  1ZM3 A;  5CAA A;  2IVF B;  4HYK A;  3KK3 A;  2BRL A;  2CZ9 A;  2DK2 A;  2OML A;  2CUY A;  1N54 B;  2COL A;  3L3C A;  2FLO A;  1WF0 A;  4ZLL A;  5IM0 A;  4IRD A;  4V19 X;  3D5M A;  4MKY A;  4C4W A;  1F9H A;  4ZVE A;  2DGV A;  4P7V A;  2XMA A;  1Q95 G;  1FXR A;  2AZ3 A;  2HVH A;  3CD0 A;  3GG1 A;  4QYZ J;  1OS5 A;  4HHJ A;  4RU2 A;  1H72 C;  3FCV A;  3KK2 A;  4M63 A;  3FSI A;  4ED0 A;  3DLE B;  3OL9 A;  4DV1 J;  1TKT A;  4DPO A;  2RIJ A;  1Y10 A;  2DIV A;  2X7I A;  3IS9 A;  3GIK A;  2BJ9 A;  1DFD A;  1WKL A;  2OPP B;  1X0P A;  4NLT A;  5C24 A;  4WFZ A;  3DMJ A;  1HNX J;  2Z30 B;  4C9D A;  4ZS6 A;  4LF6 J;  1YWX A;  2XY5 A;  1R6V A;  3UN5 A;  5AXK A;  3IM9 A;  1M1K T;  3DDN A;  3SIP B;  4FVM A;  1EET A;  2ZWO A;  3CT9 A;  1CC8 A;  1LQ9 A;  2VH7 A;  3QSI A;  2EFV A;  2UVW A;  2G0I A;  3LGM A;  3KLI A;  3RBD A;  4USK A;  1MML A;  2XZD B;  2UV8 A;  4ED7 A;  3V6J A;  1LWC B;  4ZVU B;  2VG7 A;  4MIB A;  3O3L A;  3SSS A;  2V0N A;  3KHH A;  2UU9 F;  5B0E A;  5J1P A;  1HHT P;  3AA9 A;  4HHH A;  2BOA A;  2JVR A;  3MCO A;  1RAC B;  3G8T A;  1V3Z A;  1QAX A;  4PCQ A;  2GMH A;  4FF4 A;  5FJ4 A;  2AV5 A;  2L9N A;  2XI3 A;  1YJT A;  2OSQ A;  3WZ0 A;  4PR6 A;  2CAD A;  3G6V A;  4MKB A;  4ZPW R;  5B7W A;  1RYR A;  2HYI B;  2DH9 A;  2I6W A;  2CPF A;  2CQ4 A;  2CVE A;  3I5B A;  2G13 A;  1NB2 A;  4A8X A;  1NSP A;  3BSA A;  1U4B A;  1N4L A;  3NOC A;  2LLZ A;  4X64 F;  3D0G E;  1OWX A;  4DEZ A;  5KFV A;  5GAE U;  4LF4 J;  5GAH U;  1F0X A;  1QAI A;  1H38 A;  5E3A A;  2X3G A;  2OLW A;  2EBG A;  3NAI A;  2RD5 C;  4J9R A;  3TAN A;  1T7P A;  1X8D A;  1YZ6 A;  3CJS A;  4IDK B;  4LF5 J;  2HQ3 A;  5EWG A;  5KFB A;  3G8Q A;  2X1F A;  1RAB B;  3EE3 A;  2NSC A;  5ETP A;  3ET6 B;  4WXO A;  1R8B A;  3EWG A;  4A8F A;  5CD4 H;  2AYE A;  2CRL A;  1WEY A;  2UVR A;  1SJ1 A;  1K1Q A;  2WAQ D;  4C8M A;  5J2N A;  5J1N A;  1PKU A;  1F60 B;  4JI8 F;  4OJ1 A;  4JV5 F;  3FQL A;  3JXO A;  2XWX A;  2WVE A;  2RSQ A;  2ZUA A;  3AD8 C;  1S1X B;  5KOW A;  4QBU A;  2Z8Q A;  2V68 A;  1SC4 B;  5F8H A;  1NK4 A;  2MLY A;  4RKU C;  2DPI A;  2HS4 A;  3FDS A;  4FYD A;  2YKP A;  4CH0 S;  4FYY B;  4F4A A;  2HS3 A;  4WFY A;  2M5Y A;  1EET B;  4K2J A;  2MZS A;  1W26 A;  2YQ3 A;  3W64 A;  3JSM B;  4K4T A;  4N47 A;  4KTQ A;  1TL3 B;  4OZ2 A;  3MEE B;  4PG7 A;  3WIV A;  2MEW A;  2WVC A;  5KFC A;  3IWL A;  3MDF A;  2E5J A;  4OHZ A;  3WDO A;  2FJD B;  4ETZ A;  3VHQ A;  2ASY A;  3PRD A;  2F63 A;  2I8E A;  1DLO B;  5IV3 A;  3MM5 A;  3KLF B;  1PYO B;  4NRT A;  4QIW D;  4UQT A;  5A8W A;  1AT1 B;  3C16 A;  2VPZ B;  4RBU A;  3IWN C;  1KP6 A;  3VZI A;  1U2R A;  3HSJ A;  2UV8 G;  4N8N A;  3R5G A;  5C2C A;  1KLM B;  2E7V A;  1NJI T;  4ZVP B;  1QE1 A;  3TA1 A;  3GV7 B;  3QIP A;  4B9V A;  3HO1 A;  1G7C B;  3DLB A;  4X65 F;  2MB0 B;  1S4F A;  2KXH A;  1CEZ A;  1XJW B;  1FFW B;  2IIH A;  4NYO A;  3C3L A;  5HMZ A;  2ZOM A;  4RPF A;  3TVZ A;  1JLA A;  1X4B A;  1F5B A;  1XEZ A;  2L9D A;  1VLO A;  3HI9 A;  3ISN C;  3SFU A;  3FNN A;  5CCL A;  4X4S A;  3V6D B;  3T1A A;  1JLG A;  1KHW A;  3NS7 B;  5KAK A;  3NS6 A;  1ZS6 A;  2ZNY A;  2DHS A;  3TUI C;  3V4I A;  2M8D B;  4NA3 A;  2DHH A;  4LF1 A;  5EN1 A;  2IY5 B;  1WEZ A;  4M5N A;  3K5L A;  3D6T B;  3W60 A;  1SJR A;  2D69 A;  2YKN B;  1BQX A;  4NRU A;  1HBU A;  2PEH A;  1WHY A;  3AD9 C;  1RT7 A;  4TU8 A;  4O44 B;  1VDH A;  2YPY A;  4ZLJ A;  3BO4 A;  4NE9 C;  1DTT B;  2QLB B;  4ZIW A;  4DV7 F;  1RWO B;  1SH3 A;  4WFA Q;  3U1N A;  3M8R A;  4CM2 A;  2VFU A;  3QRR A;  4DLG A;  1F6T A;  3FMW A;  4X64 J;  3FC9 A;  4ED3 A;  4Y28 C;  2NCK L;  3TW0 A;  5KFT A;  1FCA A;  4DUZ F;  1MU2 B;  4Y65 A;  1RT4 A;  3OTE A;  1VBX A;  1Y3J A;  4HI1 A;  5HN0 A;  1N34 J;  1WG5 A;  3RU0 A;  2BJE A;  3V5R A;  2AHO B;  2YQ1 A;  3LPY A;  4M95 A;  3MZI A;  5AE3 A;  5L9N A;  3H5Y A;  2DNQ A;  5I42 B;  1DTT A;  1Y0H A;  2R7S A;  2KJV A;  5IQ6 A;  1HBO B;  3BKU A;  3O2I A;  3MPD A;  2KVI A;  1VHI A;  2R3V A;  5FD1 A;  1RT3 A;  3HDS A;  2V9K A;  3IP0 A;  4DSF A;  1ZTW A;  1QM9 A;  4K59 A;  3MPW A;  2AJ4 A;  2GQC A;  4Q0B A;  5D0R A;  1O8B A;  4DV5 F;  4KRW A;  1XMO F;  1KS2 A;  2QRR A;  3CJ0 A;  1U24 A;  2XLJ A;  5AE2 A;  2AD9 A;  5J2P B;  1RAO A;  1FDB A;  1RUS A;  3N79 A;  2CJB A;  4KKO A;  5LL6 d;  1U1R A;  5C5J A;  1J5O B;  2BOP A;  3BPD A;  3I4H X;  2MGZ B;  2GGP A;  3L7O A;  5DGA A;  4J9U E;  5HRO B;  4PPZ A;  1DZ5 A;  1UEV A;  3MEC B;  4ANE A;  5KFU A;  2BA9 A;  4DV0 F;  5L9X A;  1S0N A;  4AL6 A;  2R7V A;  2P5V A;  1U1N A;  3NBP B;  4YY3 J;  3KLE A;  3GON A;  2PEB A;  1AA1 B;  4KB7 A;  2HND B;  4M5J A;  2AEJ A;  2A10 A;  3BGF A;  1IKV B;  4CLS A;  4JYA J;  4F8R A;  4C8N A;  3WX8 A;  3ZTS A;  4WFN Q;  4X4P A;  3KJQ B;  5ETT A;  2KHC A;  3DKD A;  4QIE A;  4FZV A;  4ECR A;  3M8Q A;  2DT9 A;  2CPH A;  3MAA B;  4IKA A;  4NYZ A;  3PKY A;  4DCO B;  4IR1 A;  3EPG A;  4XAK A;  1CUL B;  1DRZ A;  3R7B B;  4EEY A;  1UJ6 A;  4NLD A;  3L7P A;  1V5I B;  5D4P A;  5HMX A;  4JI1 J;  1JLB B;  2G9O A;  2IRX A;  3Q8U A;  3I96 A;  4YB7 A;  5EDW A;  2LDI A;  2VIH A;  1K0T A;  2H51 B;  1CJV B;  2QSW A;  6AT1 B;  4ZCK A;  2R8H A;  3BSN A;  3BF4 A;  2VV5 A;  4KFB B;  4X4U A;  1PO6 A;  4M5K A;  4QJV A;  4G1I A;  2UXD F;  4DDF A;  1JLC B;  4IFV B;  4OQJ A;  3ZFV A;  4F4W A;  1HHS A;  2J9E A;  3PX6 A;  1FO1 A;  1TL7 B;  3BH7 B;  5KFI A;  4DF4 A;  4Y0F A;  4KHP J;  3M6W A;  2V9W A;  3NEK A;  3AOD A;  3ILO A;  3TQE A;  3Q2S C;  4I0W A;  4XIU A;  3T1H F;  2EFP A;  2G1D A;  1E6Y A;  3MD1 A;  4QWD A;  1YDL A;  1JMT A;  2PO4 A;  2ZD1 A;  4DX8 H;  2L48 A;  2QEX S;  1S99 A;  2OMO A;  1NPK A;  3RG6 A;  3HFV A;  1NDL A;  5IQQ A;  4KO0 B;  4DV3 F;  1YIJ S;  4UOH A;  4WPA A;  4B9L A;  5BJR A;  3ZXW A;  4ES2 A;  5J2P A;  1X9S A;  4ELV A;  2OHD A;  3U02 A;  4YS2 A;  2CA9 A;  3SBM A;  5C25 B;  5RUB A;  1RTJ A;  4YP3 A;  4FBT A;  5F8J A;  3M9M B;  2UUC F;  3NMR A;  4I2Q A;  5DJB A;  4V19 J;  3AOC A;  1GXL A;  5IOL A;  4HAC B;  2BJ3 A;  4WZQ A;  1RTZ A;  3P5T L;  1N5T A;  4JB8 B;  1RIS A;  2B56 A;  3LO3 A;  4EO6 A;  5HQL A;  1RKJ A;  4ERD A;  3AB2 B;  1YBT A;  5K8O A;  1YIT S;  1NK7 A;  1LV5 A;  4LFA F;  2DNK A;  2V4R A;  2JRS A;  3FK4 A;  1R7I A;  1S6U A;  3W65 A;  4DLE A;  4W90 B;  3W9J A;  4CYU B;  1RTD B;  2HGM A;  1FVS A;  1DQA A;  2WBM A;  4JI2 J;  1Y7P A;  1L3U A;  1Y5N B;  3P45 B;  4OX9 J;  1MWZ A;  3SZ2 A;  4WP8 A;  2IC3 B;  5J1E B;  2ZH6 A;  4GVL A;  4WJB A;  2DGS A;  1F5C A;  2Q6C A;  3DC2 A;  4C7Q A;  2FHJ A;  4NAS A;  4ECV A;  4DQP A;  2N4C A;  1W2B R;  2W4P A;  5F9N A;  2FHJ D;  2YX7 A;  4ZN1 A;  2AX1 A;  4ECU A;  1IWA A;  2C3O A;  1MU2 A;  3NLC A;  3OTB A;  4IOB A;  4ETX A;  1VC5 A;  3F41 A;  3BO3 A;  5L1I A;  3GV5 B;  2GW8 A;  4PQU B;  4H4M A;  3BZQ A;  4C8L A;  3VGS A;  2HK2 A;  1UFK A;  1U6Z A;  1WUU A;  3TRG A;  2RS2 A;  1A6L A;  4AL5 A;  4TYA A;  2NR0 A;  4ZP6 A;  3UN3 A;  4NA1 A;  5K20 B;  1HNV A;  1X7V A;  2W4C A;  1VBK A;  3C8Y A;  3POT A;  3T6B A;  2DR7 A;  4FXV A;  1URN A;  2BW7 A;  3ETO A;  4OJG A;  1RWM B;  2FGO A;  1LWE A;  1IJF B;  2ZHO A;  3C6U B;  3I5C A;  5ETN A;  3NGD A;  3MUR P;  2CQ1 A;  4EBE A;  2DVI A;  3HCX A;  4U95 A;  1OSC A;  1B64 A;  5HBM B;  2PGC A;  4NLQ A;  3N5F A;  3AHP A;  1HHQ A;  4GC6 A;  3M2R B;  4N76 A;  1XNQ F;  3A4T A;  1KQG B;  1SQF A;  5K14 B;  4QW9 A;  3DLH A;  4QIV A;  4F02 A;  2ZE2 B;  5IM0 B;  2BKN A;  3EDQ B;  1UPP A;  2OEJ A;  3GYG A;  1FNO A;  4PYD A;  1N36 F;  2FZC B;  2OTL S;  4IH5 A;  4OYA A;  3AAW B;  5CCM A;  3C16 B;  1VQ9 S;  1IKX B;  2LQ9 A;  3A8E A;  1SXL A;  2KYZ A;  1R31 A;  1X5O A;  1D9D A;  2M2B A;  2KRR A;  3QMQ A;  1MSW D;  5L38 A;  1KHV A;  4DPX A;  1HPZ A;  3TAM B;  1LWE B;  2AF6 A;  1CLF A;  2HMI A;  3FEY B;  5AXN A;  1WAC A;  1WHX A;  3EGN A;  3LAK A;  4MFB B;  4P72 A;  4ITS A;  1RT2 A;  1Z2L A;  5E5N A;  4B9M A;  3R27 A;  4OV6 A;  3W8P A;  2K1R A;  4UY8 5;  1FF2 A;  1N5Y B;  1PC4 A;  2FPH X;  2W2N P;  3QID A;  3S7R A;  4A8O A;  4URG A;  3BN7 A;  1XNR F;  3OHB A;  2DY1 A;  4PYA A;  4O3Q A;  2ZOF A;  3GZ7 A;  3QAT A;  2HBZ B;  3CMA S;  1I94 F;  1BQN A;  4ECQ A;  1SC6 A;  5T41 A;  5A6W A;  5CXT A;  1FD8 A;  4Z7Y A;  2DGQ A;  2E7X A;  4DX5 A;  3ISN D;  2UXB J;  2ZM6 F;  1TAQ A;  1TTH B;  1XMQ J;  2WW4 A;  2QV6 A;  1FKO A;  3NKY A;  1KOH A;  1RAI B;  2KDO A;  2Z2Z A;  3I0R A;  3DRP B;  3UVJ B;  3MED B;  2CQP A;  4DCP B;  2FVS A;  1LW0 B;  4AQY F;  1EB0 A;  4PUO A;  2AEM A;  1RU1 A;  1RA6 A;  2XYP B;  2B4P A;  1PIE A;  5KFX A;  2JWN A;  5KFS A;  3KYL A;  4E8U A;  5KFJ A;  4GKJ J;  3HHL A;  5K8M A;  2VQE J;  2LU1 A;  1P9Q C;  2GHW A;  1HD1 A;  2MY7 A;  2LVW A;  4Y2A A;  3C66 A;  3BGU A;  4NLO A;  4OYP A;  3RRK A;  3CCQ S;  3TUP A;  2GO8 A;  2RH3 A;  3PW5 A;  3HKW A;  5HP1 B;  4DI6 A;  1FFG B;  5A76 A;  4JV2 A;  3A8J A;  2KN4 A;  5L8R C;  5KG1 A;  2MKY A;  3VGT A;  2ZZN A;  1JXV A;  2BUN A;  1UA0 A;  1S7H A;  2R7X A;  2DCL A;  4OFZ A;  3GSI A;  4QR1 A;  1N0U A;  2LYV A;  2RS8 A;  2PA3 A;  3RGI A;  3ZZY A;  1FHT A;  1FKO B;  3UD4 P;  1F9F A;  1EIY B;  2J6U A;  3GWC A;  4Q45 A;  2Q43 A;  3IAS 9;  1Q16 B;  1WDT A;  2XMV A;  3MM6 A;  1JXL A;  4U7U D;  4HKQ A;  1YRT A;  2EG1 A;  4NOH A;  2F40 A;  2APO A;  3EM1 A;  3HJV A;  4DG1 B;  2Y1R I;  1T9V A;  1FWL A;  5FLX U;  3VQT A;  3WQP A;  3MM9 A;  4J37 A;  2HNZ A;  2UUA F;  2LA6 A;  2HHU A;  3HVT A;  2GQQ A;  2IPO B;  1FVQ A;  4I7F B;  2WSC C;  4TXS A;  2MZT A;  3UN2 A;  1X4E A;  3MEK A;  2ZBR A;  4MT1 A;  2PSZ A;  1CJU A;  3MCM A;  1R6Y A;  4K5R A;  2VG5 A;  2ZBC A;  4TY8 A;  4PRF A;  4G3I A;  4J9Q A;  3H20 A;  4J9P A;  2FVP A;  2ZNZ A;  2QE5 A;  3TJ9 A;  3K59 A;  2QL9 B;  1XTZ A;  2VFV A;  4DR5 F;  4KH0 B;  2E1C A;  2OPS A;  1JB0 C;  3HHN B;  5DQH A;  3C14 A;  3IA0 A;  3CPW R;  4I68 A;  1M90 T;  3EGZ A;  4QWA A;  1BHN A;  1DTQ A;  1EQM A;  4WWS A;  2W1B A;  2Z58 B;  3LUY A;  1U0S A;  2B51 A;  2VFS A;  1ZA2 B;  3KK2 B;  4DR1 J;  3NGS A;  2MKH A;  3KK3 B;  4GVB B;  3JSB A;  3BRE A;  4DN9 A;  4WE1 A;  3OUY B;  1S77 D;  4M5L A;  3QWU A;  2ADC A;  2HFS A;  1Q4R A;  3DN9 A;  2LEP A;  3KNG A;  1F3F A;  5HO4 A;  3SV4 A;  3BQ0 A;  2FLN A;  1SKS A;  1O5J A;  3B82 A;  4QR2 A;  5BR8 J;  1AZS B;  2YKA A;  3E8O A;  1K73 T;  4B3R F;  1ZPW X;  4CH1 A;  2DHG A;  3BB5 A;  4OZ1 A;  3JB9 k;  4W4M A;  4ECX A;  3DYA A;  1I94 J;  2XSJ A;  4O4R A;  4O4G A;  4M5H A;  1R43 A;  3BJY A;  4KGM A;  1PYS B;  4DR2 F;  4X4T A;  2B4O A;  1NDC A;  1SCJ B;  2OPR A;  3C6T B;  3CJK A;  4ZCL A;  4ZIV A;  5L1K A;  3SDE A;  1UA1 A;  4FXD A;  1XBW A;  3H5X A;  4WZM A;  4WBF A;  1Q53 A;  2JEI A;  4ZK7 M;  1ZAX A;  2NS1 B;  4P71 A;  3OFG A;  5DDQ C;  4DHV A;  2FVR A;  2B7C B;  3LGN A;  4IH6 A;  2C2K B;  2DGU A;  4MH8 A;  5IC6 B;  2ZH8 A;  1AB8 A;  4NEZ A;  4DV4 F;  4RW6 A;  5MLC V;  5FDL A;  4LBI A;  2N7Y A;  3CCZ A;  3TAP A;  3RB0 A;  1NHK L;  4DQQ A;  4HLB A;  3D1O A;  4OZ5 A;  4O3O A;  1CS4 B;  3HVW A;  3FBF A;  2JC1 A;  1ZET A;  5JXS A;  3EGW B;  1KWM A;  1N5S A;  4GO7 X;  2R7R A;  3PVX A;  2XG8 A;  3MXH P;  1LNQ A;  1N5Q A;  2C2M B;  1HAR A;  2J9D E;  2K2P A;  2J9C A;  2WHO A;  2DXE A;  4EU0 A;  3PJ9 A;  4NA2 A;  2MJU A;  1V6H A;  3IFE A;  4AFF A;  5T14 A;  1Q1K A;  3MM8 B;  4TLR A;  1T95 A;  2C3P A;  2EK6 A;  4P6Q A;  2DNL A;  2VJV A;  4LF5 F;  2R7O A;  1NKC A;  3RB4 A;  5AT1 B;  4ECZ A;  1PC5 A;  1HBN A;  4ZDN A;  1TV6 A;  3PXG a;  1Q5Y A;  2A2D A;  5EWF A;  3OL6 A;  4DR3 F;  4JYA F;  1U02 A;  1I5O B;  2E5H A;  4C3L A;  3TZY A;  4WFB Q;  4I6A A;  2CQG A;  4RL1 A;  4RO0 A;  1RLD A;  4G65 A;  5A0Y A;  3MEG B;  1AXQ A;  2I0X A;  2IDL A;  3DLK B;  4NLW A;  3KTQ A;  4I56 A;  4LQ3 A;  4NCA A;  1RCO B;  2P8I A;  4EUV A;  4CLZ A;  1RYS A;  4P74 A;  3V6D A;  1X4C A;  4ZHR B;  1FRM A;  4AND A;  2RQC A;  2BJD A;  5ETM A;  2XSF A;  4B3O A;  4U9R A;  2G4B A;  4B3T J;  3T41 A;  4YME A;  1GT8 A;  2PII A;  2YNI B;  5D15 A;  3IC1 A;  4P2M A;  3KOA A;  2JH3 A;  2AZ1 A;  2IJF A;  2BJ1 A;  4PAB A;  4NCB A;  1LWF A;  4CYU A;  2ZH2 A;  2AGP A;  2E9R X;  1JK9 B;  3SSQ A;  1JWW A;  4K4U A;  2CNN B;  5KFG A;  2ZC4 A;  4CLF A;  1O0P A;  3HVA A;  3IWX A;  4C8K A;  2KFZ A;  1WWH A;  3TEG A;  5DLF A;  3NGR A;  1GX6 A;  5F41 A;  1U47 A;  1YQH A;  3EIC A;  1R8A A;  2WB4 A;  2BDP A;  2HRU A;  4DUY J;  2ZDP A;  2DHX A;  4R0E A;  3GSD A;  2OI2 A;  2AYB A;  3IXQ A;  4FF1 A;  2CJ9 A;  2ZBP A;  3CWJ A;  3FUY A;  5A8R A;  1X0F A;  2UUB J;  3GV8 B;  1H2V Z;  1B0P A;  2LEA A;  3BR9 A;  3J7A N;  1B3T A;  3BV8 A;  3HVT B;  4OZL A;  2QX0 A;  3LAM A;  2E5G A;  6FD1 A;  4ZIT A;  1L5U A;  2V2Q A;  2CQB A;  3KWM A;  2Y1J A;  1UJ5 A;  1YJR A;  3FZB A;  4NWB A;  3LWL A;  3DOM A;  4JI8 J;  3OR2 B;  1S1X A;  3IR5 B;  4DL7 A;  1HL6 A;  3VCD A;  3OFE A;  4A47 A;  3CCV S;  2VU5 A;  3Q8R B;  3O5T B;  1IJE B;  2ZBI A;  1P9Y A;  3I31 A;  5BYS A;  4NZ6 A;  3CMQ A;  3NCQ A;  4GC7 A;  3ILJ A;  4ALZ A;  1VQS A;  2FC9 A;  3M32 B;  2DGT A;  5SUH A;  3PW7 A;  1WC4 A;  4JI3 F;  1C0U A;  4LF7 F;  1VQP S;  1BWV A;  1OQ6 A;  1EX8 A;  1S6P B;  3RBE A;  4M1K A;  3WC0 A;  4IUF A;  2D9P A;  3VZH A;  1HI0 P;  1TU0 B;  3M1V B;  2JC0 A;  4FPI A;  5DRK A;  3RRG A;  4K4S A;  3F56 A;  1N32 J;  2ZKU A;  2F4V F;  3U1M A;  3H2U B;  5I42 A;  3OLA A;  4AXI A;  1A0O B;  1JLE A;  4LSN B;  4B3O B;  3VVU A;  4U67 Q;  2IM1 A;  4S0M A;  1JKH B;  2CFX A;  1FER A;  1YRU A;  1N0V C;  4RWX A;  3N6N A;  2CQI A;  4OI4 A;  4ZVT B;  1VYA A;  2EBE A;  3FJ2 A;  3IAM 9;  5KOX A;  1ZM9 A;  2BVZ A;  3R6G B;  4HH1 A;  5KG5 A;  2W9B A;  2NXU A;  2F8H A;  1C1C A;  1RU2 A;  1I1G A;  2RRB A;  3CUN A;  3PW0 A;  2XB2 D;  4YQW A;  2CXE A;  2XCA A;  3GYN A;  3HKZ D;  4WP3 A;  1IKW A;  3P4U B;  1LWC A;  1JXE A;  4TKT A;  1CG2 A;  2BBE A;  1FX4 A;  4USM A;  2KG0 A;  3NMA A;  4LSZ B;  1W2I A;  1RT7 B;  2V8G A;  4USH A;  5LMU J;  2DR5 A;  2ILZ A;  4PEO A;  1ELO A;  1T11 A;  1WOR A;  2L08 A;  3KLI B;  2W7P A;  2YKN A;  4NXN F;  1FEE A;  3FCH A;  2C22 A;  5DS7 A;  3EJM A; 
#chains in the Genus database with same CATH homology
 1OMS A;  1T11 A;  2MLY A;  2MLZ A;  3GU0 A;  1P9Y A;  3GTY X;  2MLX A;  1W26 A;  2D3O 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...