1P9YA

Ribosome binding of e. coli trigger factor mutant f44l.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
b'MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGLRKGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trigger factor
molecule tags Isomerase
source organism Escherichia coli
publication title Chaperone binding at the ribosomal exit tunnel.
pubmed doi rcsb
total genus 32
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1050 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Trigger factor ribosome-binding domain 1p9yA00
3GTYX 1T11A 1W26A 2MLZA 2MLYA 2D3O1 3GU0A 2MLXA 1P9YA 1OMSA
chains in the Genus database with same CATH superfamily
4B02A 6FD1A 1AZSA 1H2TZ 1S1WB 2GVDA 2DR5A 3KLVA 4KHPF 2BA9A 1OYDA 4OJHA 3SBMA 3QGGA 2FTRA 2BRKA 3UDLA 1N36F 1HNIB 1RT2A 2XSJA 1ZS6A 4E98A 4A8MP 4PABA 2FZCB 2CFXA 4JI4F 2XNRA 3P6YC 4QJVA 1S1TA 1EB0A 1HBNB 2CRLA 4YR2A 4B9VA 3QQCD 2ROEA 2QGFB 2C1EB 3K8WA 3ZTSA 4IKAA 3OSPA 3KDOA 4CO4A 4W98A 3KJVA 2N4DA 2FY8A 1FXDA 4PPZA 4R8UB 1WNEA 2NZ4A 2F3JA 2OSRA 3JTPA 1N33J 1DLOB 2ASDA 2B56A 1C0UA 1DTTB 2LDIA 3ZC4A 4PR6A 1YSJA 3H4BA 1T3NA 1S6QA 4DL4A 3LP2A 1JLAB 1Q4RA 2DXDA 4CYUB 2W4DA 4XPCA 3MR5A 1LWCA 1TK8A 1RWKB 1FRXA 2HS4A 1RWNB 3BR9A 1GTEA 4AD6A 3FEXB 1QAIA 2AEFA 2LCWA 4MIBA 1RAHB 4HT5A 2QA4S 2M52A 1S6PA 4MK7A 3MDFA 3J81j 1CS4A 3N79A 2J9EA 2B5JA 2PIIA 2EFQA 2HIYA 4LBPA 5H9EK 1AZSB 1LK7A 1NMEB 2CZVC 2PT0A 4RNOA 4OHWA 1YVFA 2CQ0A 4DR3F 3AJDA 2F8MA 3Q8PB 2D3ZA 2W1BA 1T11A 3KMSA 2ILZA 3MEDA 2ZNYA 3J80Y 2XLIA 1IWGA 4ITSA 1KVJA 1LXJA 3KJFB 3BV8A 5CZVA 2XWXA 1ZM3A 4AT1B 3H7HB 3MHYA 5KAKA 1MMDA 4QIWD 5LSLA 2AJFE 4FF1A 2JVOA 3NL0A 4N76A 2AEJA 4B3RJ 3T3FA 3KOAA 3QZ8A 4LVOP 1TL1A 4U96A 1WUUA 3EWGA 4OZLA 3PFEA 2JLGA 3VGSA 2OGUA 4OYAA 4ZN1A 2JEFA 1SC4B 2CG4A 4M5GA 1PKUA 1QSYA 1U0SA 4J9VA 3ZZOA 4DDFA 2ZH6A 1QAXA 2H48B 4DV6J 5D3GB 4MKYA 3W60A 3UW1A 2DTJA 3EICA 2B43A 4C6AA 3MM9B 1HHSA 1R0AA 5DJBA 3R8YA 2BXJA 1FJEB 1TKTA 4Y34A 2A10A 3M1VB 3H59A 4PUOA 3CDAA 1AA1B 3KK2B 3CD0A 3C46A 5SZTA 4KGXB 2KHDA 2EI5A 2LMIA 3C14B 3SCKE 2MKJA 1IBMJ 3M6UA 3CNQP 4IFVA 1VQOS 4FDFA 4QPTA 4BCAA 2VFUA 4WJBA 2CJQA 1U47A 2V4JB 2D9OA 3LANA 4TYBA 5AXNA 3LWMA 2QIFA 3I32A 4ZVFA 1GXTA 4MAKA 2DCUB 5I42B 2ZH3A 1RE1B 2MTLA 1VBYA 9RUBA 2K06A 3FSYA 2G2ZA 4OYWA 4PZVA 4N56A 3AD7C 2MY8A 3QGHA 4NLVA 2QC3A 3T1HJ 2DNYA 4JI8J 2OTLS 4OHYA 1X0FA 4DR7J 3DKDA 2PSZA 1JNRB 1Q8LA 2B6AA 3DOMB 2NYHA 3EM1A 2FUG9 3FCVA 4X4SA 4ELUA 3CC2S 3JAMY 2SXLA 2YVSA 2Z30B 3MAAB 1V5VA 2EC2A 1OJ4A 5BR8F 4I0WA 4DR2J 4B9NA 2HFUA 1FRIA 2JFDA 1IR2A 3WIVA 2V0NA 4CYUA 4ZVEA 1R7IA 1HNIA 1B4SA 1RT2B 2HVDA 2KXHA 2DNMA 4LRFA 2C3PA 4ZPBA 3TUIC 4KPCA 3FZBA 3L7OA 4ZVUB 3TWZA 1HQEB 2IVMA 3GIRA 3VVTA 2C3MA 2HSEB 1KOOA 3BYPA 2MHEA 4ZPVR 1FWKA 2ALYB 2HQIA 4B3SJ 3G8QA 1BXNA 4O4GA 1IBKF 3CJ4A 3I0SB 1RAAB 1TKZA 1T9WA 2A2CA 3RYLA 1GAOA 3MEDB 4PG4A 2UU9F 1WG1A 1OPZA 4WBFA 3NCPA 8ATCB 2ADCA 4C8KA 1G7CB 1X0PA 2CDRB 3GMGA 3W61A 1S0OA 3TANA 1JIHA 2LEPA 2B4OA 5B7WA 3QBCA 1MG7A 2MGZA 3MR6A 2CPHA 1FD2A 3JSYA 4OFZA 4CQ1A 4NA3A 3QNWB 2IAJB 2WBMA 3W2VB 1CJVA 4ZMMA 2OPQA 2PD1A 3VAMA 4ECZA 2XS2A 1RT1B 1SKSA 1JLAA 1FVSA 4ZA1A 1AXQA 4DOZA 4RJVA 5GAEU 1ZBTA 1SB6A 5B0GA 4YB7A 3MMJA 4WE1A 4K8RA 4ZLNA 2JZ5A 4NLXA 2R7SA 4EFAC 4ES1A 1XNRF 3PIPQ 2ZJQQ 4RBUA 4FS1A 4TY9A 2H3EB 3FCHA 5HROA 4J9MA 4OYXA 4O4GB 1JLGB 3HSZA 4DV5J 2J9DA 1Q53A 4PWWA 1BMQB 3KNAA 4OYIA 3FCWA 5BYSA 4LT6A 1KWMA 3UQSA 5A76A 4Y00A 5L46A 1SJ3P 2R4FA 1B0PA 3TAMB 1S49A 3QFHA 3U1LA 4QBUA 1B0TA 3GIKA 2YNGA 3H8YA 1NKEA 1B7YB 3CMAS 2BJ1A 2W9BB 3FBBA 1UFKA 2V2QA 2QFJA 2EW9A 2QEXS 4A8FA 5KG4A 1G2EA 3NGRA 1DTQA 2DEIA 2B9XA 4NLPA 4QIGA 4KHMA 5BYRA 4A46A 1RWOB 2F65A 2BQ3A 2DGUA 5G0RA 1K0VA 1FFSB 3D3BJ 4UTGA 5HN0A 5IT0A 4KO0A 1S77D 3BPDA 1GMWD 3MR7A 4UOFA 1C1BA 3Q0AA 2VQEF 5I42A 1YRUA 3HFZB 3RW6A 1RT6B 1X5OA 4O3SA 2JEIA 1WC1A 1YZ6A 1VI7A 1HD1A 1OO0B 1WC6A 3MMBB 3NKYA 2ZEJA 3AY0A 3IR7B 3PJ9A 1I3OB 3R5DA 2N82B 4OLOA 4NZ7A 4U8VA 1F60B 2KDOA 4X66J 4K4WA 4JI7J 1P1LA 1FRJA 4JI2F 1Y11A 3OTOJ 2R2SA 1IKVB 4QR2A 3O3LA 4JI3J 2R7UA 3ZNJ1 3GU0A 3OTBA 2LXUA 3TQEA 3OHAA 2AYBA 1X5TA 2U2FA 3W5ZA 5F8LA 1RT7B 3CO0P 3CJKA 2KFYA 2AWZA 2CDQA 5F8NA 5FLXY 2X3GA 3DM2A 2C2RA 2Z57B 3Q89A 3THVA 2ASYA 1B3TA 4DV2F 4OHVA 4YDXA 4OYPA 5T41A 1Q8BA 4ZKAA 4DFKA 3CXCR 2DGSA 4XTTA 4F3OA 4IDKA 1MWZA 2N7CA 1YJRA 1SQGA 4LMZA 4WYWA 1IVZA 3KJNB 5AXLA 1WG4A 1RQ0A 3UR3C 1CBKA 1ZPWX 3FFIB 1MU2A 5LMNJ 1PC5A 1JX4A 2M7SA 2IC3B 1E6VB 3Q8SB 1P6TA 1IR1A 2QRRA 1H98A 1HBMB 2DHAA 2LKZA 3I0SA 4RO0A 2F1FA 3JQKA 1VGYA 1JXEA 1QSLA 4DQPA 3TX0A 3HJFA 2CWXA 1YI2S 1GMWA 1RU1A 2NS1B 1DLOA 1NM2A 2BM0A 2OI2A 2QMXA 3IWXA 4OX8A 3VZIA 4P71A 2HG4A 1UVKA 2BOPA 4MKBA 3ILJA 1FRLA 2UUWA 2XLJA 2EG1A 2GX8A 4OZ0A 2DNGA 1RAEB 4RNMA 2F63A 4IG0B 3G6YA 1T05B 4DV4J 1U2RA 3LQVA 2WZ1A 3E01A 5DDRC 1T8EA 4P10A 2IA6A 5KFXA 3DXSX 2HKEA 4NLGA 3SFGA 1T02A 2L08A 1RTDA 1CG2A 3MAHA 1M5KC 5AJ3F 2G2YA 2HBZB 1KDNA 5ETMA 5IC4B 4X62J 4UY85 4DS4A 4HH1A 2HLUA 2RQ4A 2HHHF 3ENAA 2JC0A 3BN4A 2HNYA 3M8ZA 5ETNA 3PX4A 1O5JA 5CHCB 4JI7F 2XMKA 3SV3A 2WVFA 5M2UA 3AODA 1NK0A 1UVIA 3LH2S 5KFVA 2HFOA 5D0EA 4TQSA 1N5YB 2K1RB 4C3MA 3BGRA 4USHA 1ZAWA 3QIPA 3V6KA 3IS9A 3PX0A 2ZH7A 1K1SA 4OX7A 2DT9A 2FLOA 1X4HA 4NLUA 3CCSS 1DTQB 1ELOA 1GXLA 1I51B 3IAS9 3N0VA 3OR1A 4WIQA 5E3QA 3UWTA 5C7PA 3TVKA 2W9CA 4KH1B 4ELVA 3AAWB 3ENQA 3CTRA 1U26A 3MM9A 1I1GA 2N7YA 4M5HA 4OJ1A 5CH7B 1SPBP 1I6JA 2FVRA 1S59A 3CIMA 3R3TA 1XR5A 1WC4A 3TJ8A 1TMJA 4OYOA 3GJRB 1E6YB 2BJ7A 2XMMA 4QWBA 4BWMA 4A8XA 1U6BA 2JOQA 1RHQB 2LLZA 4FYWB 1TVRA 2BANA 2ZD1A 1QUVA 1BQMA 3ITHB 3VAHA 3ZZPA 3HM9A 2C2ZB 3IGVA 4ANEA 3NS6A 4I2PA 2PMHA 2VBWA 4I7FB 4ID5A 3TZXA 2KXNB 4GVLA 1WELA 1R31A 3BZQA 2OAUA 4UOGA 4Q0BA 2R7QA 3P8BB 4Q7AA 4JP8A 4P9SA 3AXKA 3LP1A 2BRLA 3MD1A 1NZAA 1TL1B 3W65A 2O01C 2ZH8A 3TEGA 1BQNB 1YBUA 4D3HA 1Y00A 2OUGA 2RD5C 3HKWA 5J2PB 2XTJP 1M1GA 3E2EA 2WBRA 4K7QA 3AHPA 3M8QA 3Q8VA 2B4PA 1FEHA 2XMVA 3X3UA 1IXKA 3P3DA 1ZA1B 2B0GA 1NJYA 2H4WB 1VQ5S 4HVZA 5J1NA 3SIPB 3U27A 4FYVB 5KG5A 3C16A 3OW2R 5E33A 2KYXA 2MJUA 5CABA 2E1PA 5E3RA 1P27B 4MYUA 4FF2A 1MU2B 3LP2B 1X5SA 1SKUB 3D6MB 4DN0A 4DBQA 1AT1B 3PO5A 2NQPA 1S99A 1VCTA 3W2WB 4MFBA 5IWAJ 2AGQA 5AE3A 1RTIA 3DMJA 2G2OA 3N4WA 4UUXA 4R8UA 2LECA 2OD6A 4V19J 2K3IA 1VFJA 2CWKA 3GLJA 3GILA 4RW6B 1VQNS 2HGLA 4OHZA 2OJ3A 1KTQA 4C98A 2OEMA 3GV5B 4G1IA 5KFWA 4RW4A 4B3SF 3ZTOA 2RT3A 2GZOA 1F9FA 2QJ3A 3AT1B 3DLBA 4C97A 5I3PA 4K4ZA 3D68A 3GYNA 2FC8A 3IXQA 3MMAA 4YQWA 4EBDA 4X4VA 2UU9J 4JYAJ 4HHJA 3AB2B 2LVWA 4K5RA 5LXRA 1VQPS 3L7UA 4HI1A 2FGOA 3NXZA 5LMNF 5KG6A 3DRYA 4DLEA 1VJWA 1HBOA 3BN7A 2J0SD 1WEZA 1N88A 2E29A 2R3VA 5RUBA 3G6VA 1MSWD 5L1LA 4HYKA 3RRGA 2KH9A 1SC6A 4Y6IA 3V6DA 4ZIWA 1KLMA 5BYQA 2CNKB 2DHGA 4RUHA 2BX6A 1OY9A 4AL6A 1LEOA 4PEOA 4WP3A 4CLFA 1SUQB 1TKXB 2HFZA 4HR2A 1IM6A 4DLGA 1HR0J 3CCLS 2MKYA 1TAUA 1REVA 1O8BA 3QWUA 4X84A 4NOHA 5K5MA 1H38A 3W66A 2AU0A 2F7VA 4XAKA 3ISZA 2A3JA 3N6MA 3ZNUA 3HHNB 1NH8A 3QT6A 2AYGA 5KOWA 1FNOA 1VIOA 1TVRB 1JLCB 5D4OA 3QYYA 3KHLA 4LR8A 1YITS 1IBLJ 3P49B 4EK2A 4OJGA 1AFJA 3W1YC 4PPDA 2OKQA 2ZKUA 1IN0A 3BREA 3B82A 3JSRA 2BKOA 3KK2A 1YJNS 2CPYA 3LGNA 4OI6A 1PAUB 4OMFG 4CT9A 4U95A 4UUWA 4QIFA 3DLKB 2CNLB 1PC4A 2Y0BB 2QN6B 1WHXA 2YX4A 3H90A 3QPIA 2KO1A 4WYLA 1SJ1A 1LK5A 4UOCA 4CM2A 1CSJA 2A6MA 3FNNA 5LJ5Y 4X65J 2B9YA 2ZD1B 2CQPA 4OI2A 4ZHRB 4ED2A 4A48A 3QRQA 4PXCA 2Z2YB 4DSJA 2BQUA 2DPIA 1HQ2A 1FWPA 1WKLA 3IM9A 3VWSA 3GIJA 1WOPA 2UXCJ 2NUUG 2R8JA 4I6AA 1PJ7A 3M4XA 2AYMA 1FRHA 1VJQA 2KVIA 3DGPB 1R8BA 5J1PA 3EPIA 4F2RA 1V3RA 1FDBA 2YQ1A 4EEYA 1S9GA 4I2QB 5I4MA 4OQJA 4WU3A 7AT1B 3MFIA 1TL7A 3CJ8A 3DRSB 5L9XA 4OHXA 4QU7A 5D77A 4DXLA 1U2FA 4LREA 3GB0A 3MF5A 3K5LA 2GVZA 2EFOA 2OPSA 4OZNA 5E3AA 4B3RF 3KG4A 4RWWA 4PQUA 5HVHA 3DFEA 1IWAA 3HVTB 3IRWP 1SKRA 4GRSA 1FRMA 3HF5A 2UXBJ 3LAKA 2CQGA 2KG0A 1EQ0A 3IMQJ 1XJWB 4OYBA 4P2SA 2JEJA 3QRRA 5T7LA 4QW8A 1SCJB 5HMXA 2V2VA 1YJUA 4JI0F 1WOOA 1RAJA 3HPOA 2DR8A 4K4TA 4JI0J 1NKBA 2E1CA 4NX9A 1VQMS 1WOSA 3ITHA 2XY6A 3AFGA 1N36J 4IRDA 4USJC 1JJCB 1OSDA 1RCOB 1VYAA 3EGNA 2DIUA 2CQCA 1Q0NA 4N47A 4RUCA 1FE0A 4U67Q 4N7TA 1S79A 2R7WA 3GSDA 2EKYA 4CO2A 5K14A 3TA1A 2VUGA 2BJ8A 2UP1A 4HKQA 2KZMA 4QWCA 1UWBB 2YQ3A 2AKWB 1TL5A 4FPRA 2V4QA 3R1LA 4NXNJ 1WTFA 5A2QU 1MROB 5K8OA 1I94F 1Y7PA 1D9FA 3PW2A 4B3TF 1JLFA 3TR5A 1XN9A 3NP5A 3M6XA 2MGZB 1XR7A 5LSRA 2GVZB 2HPUA 4IO9Q 4PQUB 3Q83A 1NDCA 4A8QA 2IBKA 4TU9A 3PX6A 1NSKL 3IWLA 3HX9A 3LPEA 5ADZA 3OVSA 2ZBRA 1K9MT 2KN4A 1VQLS 1HD0A 2GQ2A 4LRAA 4YR3A 1X4EA 2D41A 4L3NA 4CLYA 3FSIA 4IRCA 2QZ8A 5MAOA 3TZWA 1UEVA 1FX4A 1J27A 1KBRA 2R42A 4DX6A 2MZJA 3UNGC 1DFDA 4NMLA 2E66A 3KXDA 4LRCA 3PKYA 4ECWA 2NREA 2ZH4A 4IDKB 5GMDA 2M3DA 4YEAA 3R97A 4AE5A 1FNXH 4BBYA 3KG0A 5JUMA 2C2KB 3QLHA 2E1MC 2NYIA 3V81A 3HZGA 2XO6A 2AJ0A 3AQPA 2WVCA 4DEZA 1NHUA 2FVSA 1W7WA 1UZDA 1XK8A 2GIFA 3HHLD 4HL9A 4B9MA 3D6FB 3PW7A 3ILIA 4FZVA 4P73A 1S4EA 3D54A 4P6QA 2QG9B 1RTHB 2B9EA 4ZJOA 4FP9A 3KLFB 4ZVHA 5A8WA 1CJTA 3GFZA 2OHDA 1EAYC 3WC2A 2AMCB 1Y10A 2ZZTA 3C15A 5C5JA 2Z2MA 4A8KA 4C8NA 2QLXA 3KJVB 1PO6A 1FJGJ 4ED1A 1WTBA 5D0RA 2HHVA 3US5A 5CYQA 5EN1A 3SZ2A 4AQYJ 3DRSA 5J2MA 3IO1A 4IG0A 3V5RA 5KFSA 1FXLA 3SCLE 2KI2A 3M6VA 3N5BA 2Q6CA 2YKNA 2MQMA 3AH6A 3ETMA 1C4CA 2FB0A 1EX8A 2ZBPA 3NWGA 1BUXA 4DX5A 4LFCF 1G1XA 3FKBA 3CJ3A 2PN6A 1RA7A 5DQHA 1HL6A 2VA2A 4IR1A 1V3SA 1HWIA 1KHVA 1N54B 4RW7B 4J9PA 1U45A 2B5JB 3T5HA 5H9FK 4ZPAA 2VG7B 4I67A 1I94J 2JFKA 2ZH2A 2HYIB 3BQ2A 1NSAA 2IC3A 4ETZA 1JJ4A 4R0JA 4TY8B 3S6EA 5FDLA 3D1OA 1SV5B 2LQ8A 1C4AA 2ZH5A 3FFIA 4YDDB 3S8SA 4WZMA 1RLDA 3Q8UA 1F9EB 2ZC4A 3MECA 1S1XB 1X4GA 1UWAA 1EJ7L 4FXWA 2UUBF 2RRAA 2R7VA 1BQXA 1V3ZA 1WG5A 4O23A 5HP1A 3O2IA 2IY5B 2C2DA 4ED5A 4LIWA 3BO2A 8AT1B 2JDJA 2BKNA 1NDPA 3FQLA 1YQHA 1XIQA 2BZ2A 4TLQA 2PMZD 3HHLC 4ZHRA 4NXMF 1DRZA 3D66A 1T05A 4RPFA 4NA1A 2FC9A 1RKIA 2FVCA 4Y2AA 4GC7A 4HT7A 4PKDB 2CZ4A 2DB1A 1R0BG 2RUSA 5KT2A 1RISA 1GMUA 5GAHU 1SC3B 4HTIA 4TLRA 3BO3A 3SQGB 4KC5A 2HVEA 5A8RB 2VDHA 4KV8B 2AGOA 1NJZA 1H2VZ 1CS4B 1HNVA 1XNQF 2OFGX 1PG5B 2RE1A 2BYCA 2VONA 2KJVA 3POTA 3CIZA 5F3ZA 1MMNA 2VC1A 3D3CJ 2WB4A 3QAEA 2RRNA 1QY7A 2L3MA 2VFTA 1FRKA 3GFHA 2QX0A 1G4CA 5J2NA 2MLZA 5H9EJ 1S9EA 4LF9F 2J0WA 1D09B 1YJVA 3HI9A 3L4BC 3TYTA 1VBXA 3MUVP 3PXGa 1V6HA 1R89A 1KONA 5D6GA 2C2NA 3UCGA 3VTIA 1IKYB 2VPZB 3DN9A 4IRKA 1TV6B 3K5MA 2UUCJ 2L9DA 2R2TA 1H73A 2K1RA 2BVZA 1HARA 2VFRA 3BBFA 4ILMA 2XWYA 3MCMA 1T0TV 3P96A 5D8HB 1PJ6A 5HBMA 4DPWA 2R8GA 2CZ9A 1QTNB 2A1BA 2XYGB 3A8JA 3BR8A 3QIDA 4PG6A 2KG1A 1N32F 5KFAA 1SC1B 1WI6A 2ZJRQ 2V69A 3SQGA 4P74A 2XS7A 3G71S 2BJ9A 3CF5Q 1RTHA 2FIUA 4DS5A 5HMZA 4DU8A 5K20B 1RBOB 4TU8A 2R8KA 2PDAA 3KYLA 2KFZA 2HQ3A 2O66A 3SEOA 4BWJA 3TEHB 3WC0A 5GAEI 5I3UB 2MQOA 2Y0SD 4RZRA 2VHGA 5HJYA 4ZP7A 4ED3A 2EG2A 2YKOA 4RNFA 2OPPA 5HLFA 1JXLA 4X4NA 2IM3A 2PE8A 4IH6A 4F4XA 2AGPA 5IQQA 3HKZD 1NBEB 1CC8A 3M2UA 3BDEA 3K89A 4AYBD 2DO4A 1S4FA 2UV8G 3MECB 2XO7A 5KFGA 4WFYA 3H5YA 5CXTA 2OIHA 3CCUS 4IYQA 2MQPA 1SV5A 3I56S 1BGXT 3T1HF 4Y3CA 4IOBA 4M5DB 4PXDA 2K7JA 2Z56B 1NEEA 3ISNC 3QJJA 2OPQB 4UOHA 1DJ0A 2FHMA 4AUKA 4DU7A 1N33F 3OT9A 4X4UA 1FERA 4ZCKA 1DAXA 3OXLA 3AB4B 4KE5A 2HQFA 3JAMU 2XY5A 4RW9A 1UJ5A 3UDVA 3MM7B 3UCUP 2YWFA 5IM0A 3BYRA 2ZWOA 3DRPB 3SXLA 2DY9A 2DXEA 2MYFA 1UEKA 3LP0B 3PHEA 2BABA 4ZPTR 5KFDA 2BBEA 1RA6A 5E3PA 3JSMB 1AW0A 2HNDA 4C0HA 3RR8A 1HIYA 2M9KA 2AJ1A 2MZQA 2VPYB 4USWA 1G6BA 3FK4A 4AXJA 1S7IA 1M5HA 1ROFA 4K4SA 3ZZRA 1OIAA 3H20A 2HVIA 2O3DA 2XC9A 1S1VA 2ILYA 3A8KA 5D4LA 1AB8A 3U7JA 3VVUA 4EU0A 1PYTA 1KD1T 1R6YA 1JLQB 4M63A 3E3XA 4K4XA 2PEHA 4DL6A 1BWVA 2Z4PA 4ZPCA 4BHQA 2HAIA 1T9YA 2FQQB 3D0GE 4FXDA 3AOCA 1D8ZA 1FO1A 3W2VA 1HI1A 2EK6A 2C2MB 1W2IA 4J9QA 5AXKA 2RF2B 3VQTA 5KFEA 1C0UB 2CJAA 3CMQA 2VG5A 2Y1LB 4TKTA 3BSOA 3DGVA 4Q44A 2BV3A 4LBIA 4DJBA 2IMWP 1AFIA 1FJCA 1JQGA 4RNNA 2D3O1 3QO9B 2HRTA 2H1YA 1R6VA 4CNYA 1RYSA 2QV6A 4IG3B 3W64A 2CPIA 2FHKA 3QT5A 3NBPB 4MK9A 4MYTA 1YKWA 4NYOA 3T41A 1GQEA 5B0DA 4DG1A 2RMLA 4LSLB 4LBHA 1PJ5A 4M5IA 2CG8A 3J7A1 3A3NB 4CO1A 2H51B 3HFKA 3EZOA 2G9OA 3S7RA 1LWEA 1N5SA 3HDSA 3CMES 4LFAF 3R2CJ 2RDIA 3MEGB 3D0IE 3I9ZA 4KSEB 3MAQA 3H4DA 1CULA 5F41A 2JVRA 3VHQA 2ALZA 3JQMA 2AJ2A 2HURA 2M2BA 1X4BA 2IDLA 3DI6A 2CPJA 1N5TA 3ZXWA 1VBZA 2Z2ZA 4WU2A 1Y5NB 4ZIVA 4QW9A 3M8SA 1WORA 5KFZA 3RAXA 1X9WA 2G4BA 2OFHX 5B0FA 2XYHB 2H5EA 2GVDB 2YWWA 2LEBA 4CTAA 4URQU 3QJPA 1UFWA 4IFYA 2VG5B 3PDNA 4DQSA 1UEUA 5HLFB 1NAQA 1KRPA 1TL3B 1SJFA 3MURP 2HGNA 2FJDB 2EBGA 3MUMP 3AJ1A 2GJ2A 3UN2A 1D1UA 3GV7B 4KJIA 1FEEA 3IC1A 5LOQA 4WWSA 2E5JA 4NLTA 4RU9A 2NSBA 1U1LA 4H54A 3ZTQA 1NHKL 4IFVB 2BW7A 1S6QB 1TQLA 2FLLA 1XWLA 2MEWA 3BGUA 3MPDA 4O3QA 5D0HA 2IJNA 3MFHA 1ZM9A 3EVOA 3O1LA 4WFBQ 1F3VA 1JKHB 2ZE2A 2DITA 5IFMA 1HWKA 4DL3A 5D3GA 3GYXB 1SBRA 4ANCA 1JLEB 1M5SA 3N6LA 2W2QP 3NEKA 1NHVA 5D78A 1HNXJ 3MTJA 2VBXA 4S0MA 3UN3A 3DRPA 4JOUA 2WTFA 2BE7D 2BANB 3GCWP 4DV1F 2R7OA 4WZQA 2UUTA 5FLXU 4DI6A 2ZOFA 4OV1A 1HHQA 3MOJB 5F9NA 5KT5A 1E6YA 3L7PA 1TUWA 5GAGU 4JI6J 1JB0C 3JS9A 4IQXA 5KFYA 4WK3A 4Z37A 4JB8B 4IH7A 3M9MB 1HBNA 2MQ8A 1B0VA 1TZ0A 1WD6A 4NCGB 4ZOSA 4MJKA 5IT4A 3DDNA 1V9OA 3SMZA 1E6VA 1YDLA 4KGVB 3CJRA 2GIQA 3IP0A 4MH8A 5IS2A 4X4RA 4DCOB 3KHHA 3LALA 2F4FA 1UPPA 3W9IA 5KFCA 1QD1A 1S9FA 5DGAA 3G82B 2GW8A 5F8JA 2CVEA 2IFXA 3HZEA 2HK2A 4RUAA 1JJ2R 4WCEQ 4A8YA 1U1PA 3I4PA 4LRDA 4HI2A 3PNIA 2WW4A 5B0BA 4FF4A 2VASA 2WSEC 2JWNA 5LM7E 2ZHAA 3PY8A 1KN6A 4DR3J 3NOCA 3KK1A 3RAQA 4IH5A 2P6TA 3BKUA 2XNQA 1R8PA 2E1RA 1QM9A 4KFBA 2HWIA 5KFTA 4USIA 4DV3F 3DYAA 2ZBIA 1ZAXA 2RDDA 1W26A 3DC2A 3DDKA 5GAHI 1X60A 4WP8A 1UP1A 2ACMA 2VF3A 2PEBA 4CIOA 4O44A 4J9SA 2L9WA 2HK3A 4FVCA 5KT7A 4M5JA 1TR0A 3KLGA 2LQ9A 4LR7A 3HVRA 1JLGA 2UXDF 1PSDA 3FEYB 1J5EF 2EFNA 2VG6A 2LP4A 1CQNA 1F9HA 5C42B 4LF5J 2UXBF 1KKHA 3ZO7A 4W90B 2K7KA 2CNOB 3EGVA 3IWNC 5K8NA 4QYZK 4LSLA 1TUGB 2CPDA 3Q8YA 4J90A 1G3OA 4GKJF 2GC8A 1RB0A 4ZLLA 2D1CA 3H2VE 4KRWA 3PYDA 2VOPA 2KVQE 5DM6Q 4DCJB 3BEGB 2AV5A 3NMAA 1N0VC 2HVHA 1T95A 1Q95G 4OZ3A 1RADB 1VC6A 2XHCA 1RT1A 4E2FB 2FJXA 3G8TA 1RBAA 2GGPA 4JI6F 3OLAA 5CYQB 2KRRA 2HZVA 2DNZA 1SUQA 1TKXA 1TTHB 3T1YF 4M5NA 3HXMA 1Q86T 4DN9A 1EP4B 5F8GA 1HQEA 2EXUA 3D2WA 1PYOB 2ZVSA 3TVYA 3DDIA 2BR0A 1CJTB 2CQIA 3PRVA 3VAJA 2XEXA 5J1EA 4PRFA 4F4YA 4DPTA 2BJ3A 2Q3PA 3EDQB 5JMNA 1XNRJ 3TJ9A 2HQCA 1MN9A 2XZWA 1ZH5A 3HVAA 4OL8A 1WDDA 3FBCA 1T9VA 2F8EX 2V2ZA 3DLGA 3A12A 3F0NA 1V5IB 3MEGA 3WX8A 2UVUA 3BH7B 2RILA 3CB4A 1U4BA 2DBBA 1IJEB 1DURA 2J7KA 1HPZB 1K1QA 2MJNA 1NB2A 1U25A 2VH7A 3G87A 4HHUA 2HQDA 2Y1RI 3QT7A 3C15B 2BJDA 3CCZA 4Y2IA 2I9SA 1JLCA 3J7ZT 1KQSR 3Q8QB 5CYMB 4AFFA 1XMQJ 4E8UA 5DDPC 3UD5A 2DNRA 2LU1A 1HWUA 1NNDA 3MOZA 2RHQB 4USMA 1S72S 2ZZNA 3QJLA 4K4UA 3CGIA 3HLUA 1ZTWA 1JWWA 4QWEA 1OQ3A 3RZAA 1RT6A 5GMEA 1KQGB 3PRDA 2E5GA 3CC7S 1D9AA 3BSNA 4DR1F 2HHHJ 5A6PA 4HDHA 1KLMB 1JK9B 3OJUA 3KTQA 5A8KB 2ZKTA 3MUTP 4P2XA 4A8SA 4NMXA 3C66A 3GWCA 3T19A 3ENVA 4LF8F 3MM6A 3OSNA 1Q16B 4A8WA 4LF4F 3A1YG 2FHJA 1QJHA 1RXOB 2UZAA 5MLCV 3GONA 1UPMB 2VKZG 1RLCL 4GVBB 1EQMA 2EEYA 3P5BP 4MK8A 2D3OR 2FLNA 4ILLA 2V8GA 4ZP6A 1RK8A 3GE9A 1HPZA 2BMBA 2XM3A 3G8SA 3AJ2A 3I4HX 3OFGA 1U7LA 3OL7A 3Q24A 1JLBA 4LIRA 2O67A 3A13A 4YB5A 5GAGI 2MZ1A 2GHPA 5D0GA 1LW0A 2L9NA 2NLWA 1Q81T 2CQ3A 4DX7A 5BXIA 4EBEA 3R2DJ 1ZYQA 3PKMA 2J9DE 2BE2A 2HRYA 1WI8A 2BACA 3VGTA 1QUPA 3GG0A 4F26A 4F4ZA 1H2UX 5DM7Q 1YJWS 4ZVGA 2M0GB 3VQSA 3OTCA 4URGA 4X64J 4CP5A 2UVRA 4PWDA 2B4VA 1X8DA 1Q5YA 4WF9Q 1VIXA 1Z2ZA 1H3DA 3MWBA 4W4MA 2OEKA 1XTZA 3IG1A 1B70B 3TARA 3JB9k 1ZAVA 2JH3A 2GA7A 2F8HA 4LSZB 5ITHA 3NGDA 1VQSA 1EIYB 2FVPA 5KFKA 4G65A 3IFEA 2D69A 1UTAA 2ZUAA 4IOCQ 2MHNA 4LUBA 4ZPDA 2HZAA 3WZ0A 3CJ2A 7FDRA 1XMQF 3TUZC 2V4JA 5LMUF 1WKJA 2UUAJ 1SH0A 4DQQA 2CADA 3QIPB 2AF6A 3M2UB 1DHMA 1WSVA 1ULRA 3CT9A 3EMTA 3R6LB 2ZM6J 4KPYA 1F1BB 2XYPB 4C0OC 2OPSB 3MXHP 4P7VA 2RU9A 3I0RA 4M94A 4H4KA 4ED4A 5JVGQ 4M5LA 5L38A 2IA0A 1N52B 2I5JB 1R8AA 3OTEA 4R5PB 4DQRA 4QYRA 2APOA 1KEKA 4Y2MA 1LW0B 3OXFA 3PYGA 2XG8A 2YX1A 2Z8QA 4YMEA 1PBUA 4CTAB 3N5FA 4I69A 4NLSA 1XMOJ 3SSSA 3ONQA 3VAKA 2YKQA 3B54A 4QCLA 2XMTA 5ETRA 4ES2A 2DRDA 4USVA 5M2RA 4ID5B 1KVKA 4RBTA 4YB6A 4KQZA 3M05A 3TW0A 5A2QY 3OTDA 3NCQA 5K9FA 3BGOP 2DHSA 3SYZA 3DOKB 4ES3A 3M8RA 3TNVA 4ECTA 3IS9B 2V50A 1RBLA 2QLJB 1UVNA 1M1HA 3RGIA 2PO4A 1F3FA 1J2VA 1GEHA 2BKPA 2P9GA 3R5CA 4DZ6A 4F3QA 3GIIA 2OEJA 1H7XA 2GMLA 2KTQA 4CH0S 5KOXA 4M5DA 4ECQA 2K8GA 1AUSL 2MY7A 2MZSA 4NLRA 4F67A 2W7OA 1UA0A 1QLNA 2CIMA 3OD2A 2KB2A 3QFWA 2NZCA 5LXYA 2I6WA 2IM1A 2ZZMA 3DU6A 4RNHA 3DRXA 4A8OA 3CCES 2B8PA 5L1KA 1H7WA 4ECYA 3O44A 1TFYA 5D4PA 4IUFA 1RWWB 2EC0A 4PWUA 3NNHA 2XMUA 1ZM4A 1UKUA 2HQGA 3IGNA 4XDDA 4MMOA 2D3UA 3VCDA 3KLFA 1NK7A 2FJVA 3DLLQ 1URNA 4OI4A 3OL9A 3KG1A 4ETXA 4QZVB 5A0YA 2CQ1A 3MAAA 2GCFA 2HFSA 4K4YA 5HP1B 3DMJB 3ET6B 3WX4A 4DUZF 1IBLF 4JI5J 1FDDA 4FNIA 4B3OA 2J0QD 1X4FA 1I5OB 1PCAA 2HZCA 3THTA 1ZA2B 1U48A 3M8PA 4U9RA 1YG0A 1U1NA 1M90T 1NJIT 4Z7CA 1R27B 2B7CB 4RW4B 3MCOA 1Z4UA 2EVZA 3SFUA 1DARA 2V63A 2KFNA 4TYAA 3GZ7A 3SI8A 4Y0FA 1SQFA 2DGVA 3CD7A 4ZP8A 3OUYB 1NCLA 1A9NB 3ILLA 3QO9A 4KIAA 3V2UC 1JNZB 2XY7A 1NKCA 2R7TA 3FBFA 1P1TA 2EFGA 3V81B 1FD8A 4EZ9A 3SDEA 3NS5A 2CJKA 4ZJQA 1XMBA 5IT9U 3W2WA 3T5KA 5IWAF 1NRKA 2YNIA 4B9SA 2IM0A 2WW8A 3LAMA 5J2NB 3UNYA 3OHBA 1YJ7A 3TRGA 2MKKA 1Q7YT 4I7FA 1UW9A 2RJZA 2VC0A 1CJVB 2QA1A 2UXCF 2CQHA 2G0JA 3EX7B 2H5IB 1UVJA 4YY3F 2Y1JA 1NZ8A 3TAMA 2NSCA 3N01A 2R2RA 3FDSA 2N3LA 2YY3A 3BS9A 4F2SA 2YPYA 5KT6A 4ICLB 1BQNA 2C3OA 3ET6A 4LVNP 3V4IA 3DOKA 4JYAF 1IKWA 1REGX 4GKKF 1NSQA 2WCXA 2LDYA 4DFMA 4Y2KA 4EZ6A 2MQQA 1JLEA 3VAIA 2XZTB 2CJBA 2Y8WA 3WIUA 5DLFA 3FVYA 4FS2A 4JI4J 4KAIA 4DV1J 3CSKA 2D74B 4C4WA 4MFBB 3GCXP 2XULA 3MZIA 3H42A 3M9NB 2PI5A 2DH8A 1S5ZA 2I1RA 3GTYX 1FFGB 2NUHA 1KLNA 3UI3A 1TMMA 3DHXA 3EVMA 2HLTA 4FN5A 2GAHC 4ZN3A 3MR2A 1S1UB 2IRYA 3WQPA 4OI0A 1NPKA 3CJ5A 3U1MA 2NXNA 4EGLA 4L76A 4OJ3A 1U02A 4DR4F 3KLIA 5ETTA 2FGCA 1NUEA 1MWQA 3MMAB 3MPYA 4CDIA 4OIXA 4J9NA 5CD4H 2DGOA 3CVKA 5G0RB 4MKVA 4QWDA 2V2KA 2B4UA 3PV8A 4N41A 4DSLA 5KFNA 2VA3A 5A0YB 2X7IA 3BO4A 2GMHA 4CCHA 3I9V9 3OFHA 5J2QB 5BR8J 4Q43A 4IR9A 2E9TA 5KFIA 1EKRA 4NXMJ 3NNCA 2F40A 4X4TA 3MM5B 5AXMA 1RU2A 1FXRA 2HWHA 1XR6A 3K17A 3R5GA 5DZ6A 3OPKA 5E3CA 2XMJA 1IQTA 1M5VC 2FHOB 4KFBB 1FTCA 2X51A 1VK3A 1IQZA 4CH7A 3ZTPA 1U0HB 3BGLA 4C7QA 1SXLA 1VRUB 1C0TB 5C25B 1RI7A 3H5UA 5C24B 2DCLA 2GO9A 2X1GA 4O3PA 5CCLA 3TO8A 1YBAA 4TU7A 2M88A 2KM8B 2R8IA 3M8YA 3TA0A 1XBWA 3MTKA 2F4VJ 3GPAA 4FYDA 4J9UE 1FJGF 1KQKA 3W9HA 3P4UB 3LF0A 4X66F 4QWAA 3K2YA 2DVIA 2G13A 4Z2XA 1IR0A 5G4DA 2OMLA 4OZJA 1FDAA 2YBVA 3HD1A 4Y65A 2QT7A 4F36A 2UUCF 4KGKA 3D1HA 5HMWA 3J7Z5 3QGPA 1TELA 2LFVA 4JV1A 4WTOB 3X1LB 4NI2A 3QWPA 4ZP9A 3MR3A 1RWUA 2A0FB 5EGYA 1AYEA 3RRKA 3HJVA 3H40A 3NGTA 1GT8A 1Z2LA 2FZKB 2KT3A 3PJXA 4PUOB 3FZ2A 3HP6A 1IJFB 2ZWPA 2IIHA 5DS7A 1N8RT 4G1QA 4QYZJ 2R9LA 4PYAA 5F8MA 3AA9A 3PW0A 2DHHA 1O51A 2MKCA 1BC6A 1M5PC 1FJ7A 2MZTA 2KXFA 4CLZA 2FJWA 1MLAA 3ZZTA 3PR4A 4IG3A 1X9MA 3R1HA 4QIEA 2DKOB 1DTTA 1CJKA 1LWEB 5FD1A 1HQUB 3D0HE 2JNJA 5KFUA 2H54B 5KT4A 4KHRA 4DL0C 2DRAA 1N6QB 1RSCA 4LF9J 4DZDA 2HW3A 2VD3A 4G1PA 2BQRA 2LYVA 1WJ9A 2RAQA 2VL1A 3IR6B 4Y28C 3UPFA 2ZJPQ 4X4OA 4GKKJ 4AXIA 2OSQA 3UVJB 1UVMA 2KHCA 5CA5A 4URSA 4X4PA 3BGFA 5L1JA 4C48A 2ZDOA 3D4JA 3VGVA 2FZGB 2YWEA 1U6FA 1B64A 4C11A 2JEGA 3NLCA 1MNEA 3GQCA 1ZZNA 5KFFA 2ATLA 1RYRA 2CPFA 5GADI 2PFFB 3W5XA 3H5SA 1L5UA 2F4VF 4IQMA 1RWPB 2H4YB 4YOEA 2B7BB 3V4MA 4YR0A 1S9GB 4A47A 3DU5A 4YS2A 8RUCA 2M8HA 1HW9A 2FY1A 4QPXA 3HFVA 3JSMA 2KJWA 1GXUA 2V9KA 2ROGA 2HBQB 4IOAQ 2HHTA 4B9UA 4O0NA 1KFSA 3PO4A 1RCXB 2I38A 3AOBA 2VDIA 5E0OA 1FK9A 3DCAA 2HHWA 1L3TA 5AE2A 3CCQS 1RT5B 1PAEX 5L9NA 4W92B 3U02A 1TKTB 1OY8A 4DPUA 2NPIA 3RUBL 3T1YJ 1W25A 2YNFA 2I5JA 1RWVB 2W25A 3HHEA 4J5OA 2E5LJ 3TQ1A 1BQMB 1S10A 2H5JB 1RDRA 4L6V3 2ERRA 1OS5A 1JLBB 2LQBA 2CUYA 2DPJA 4YFUA 5EHHA 3J7AN 2AYEA 4ZCIA 1OPIA 3EGZA 4I1TA 4M8LA 1L3UA 5GMKa 2DNLA 3K8VA 3PIOQ 4WE1B 5CAAA 3KLHA 4GVBA 2OELA 4YP3A 1JMTA 2X1AA 4J9LA 1P8GA 1U1MA 3L09A 1LWXA 2J8SA 1PBAA 2HS0A 1URRA 3ZZ0A 6FDRA 4KHPJ 5IT9Y 2ZC3A 4FBUA 4WPAA 2HEKA 3MM6B 1TL3A 1DZ5A 4JV2A 3M8QB 1YLXA 3TOQA 4OYMA 3RB0A 1PGZA 1XQIA 3D1QA 1JJHA 1VQ6S 1LKZA 4B9LA 1HNVB 2F9JA 2GQCA 3R5BA 3O5TB 2ZM6F 3UD3P 2UUBJ 2C2OB 5E41A 3T6BA 2A6OA 1HQUA 1IKVA 2HBRB 4L75A 3C6TA 1VDHA 1RZMA 2AD9A 2WVDA 4QR0A 3MM5A 3W7BA 4RW8A 4KR0B 4OZ5A 2E7VA 4R5PA 5KFOA 3F41A 2RQMA 4U7CA 4WFXA 3HHLA 4DV3J 4B9TA 1FKOB 1Q7LB 2IRUA 3D6HB 5FJ4A 1TV6A 4KBIA 5CD4A 2JLEA 3DHWC 5HVGA 4N5SA 3KK1B 1BHNA 3F44A 2J6UA 2XZDB 4UT4A 2CKWA 3LW5C 3BDPA 5F8HA 1WC0A 3LA0A 2XCPA 3K59A 1U1RA 4O3RA 2KKHA 4Q8FA 4L3KA 5D15A 2HNZB 1QE1B 2CPEA 2ABYA 5DO2A 4LF2A 4EO6A 1KR4A 4G1QB 1LFPA 4ED7A 1REVB 3GJSB 3BH6B 4NRTA 1VQ9S 3C19A 4WIIA 1F5AA 4H4MA 2J76E 4F0MA 4AQYF 5B0CA 3H5XA 5KT3A 4J9KA 4JI3F 1U2CA 1U8SA 1QVFR 1FESA 2XSFA 3HD2A 3QAUA 2OMOA 4V1Ak 4C8LA 1PYSB 3R9LA 2MKHA 1VHIA 2IPOB 3CCWA 4KB7A 5EX3A 2F5GA 3TZYA 3G6ES 2HFVA 2E9RX 1WHVA 1FE4A 3DLEB 2YQ0A 1HKAA 2ZOGA 2ZHOA 2Y3YA 2G1DA 2PGCA 1Q8KA 5A6WA 1QVGR 1YRTA 2JHEA 1SL2A 3LUYA 3DYAB 1YZ7A 1RT7A 3CJKB 5A8RA 1RHUB 2V4RA 4USUA 3GJTB 4FYYB 1HNXF 5DG9A 1RJJA 4P72A 4ZVOB 2OPPB 4OX9F 1Q5VA 3ULHA 2EK1A 2I2YA 4FF3A 1A0OB 1MN7A 3ETOA 2ZOMA 3MCNA 2VG6B 2FVQA 3DLGB 3K5OA 3AD9C 1BWEA 1S1TB 3FBEA 2LXFA 4LSNB 1SIWB 3C8YA 2XB2D 1OY6A 1FNMA 1R3NA 3KKFA 4TY8A 5KG7A 2GHVC 1N0UA 3L95X 3MM7A 1U24A 5DG8A 3HVTA 4KKOA 5B08A 2HRUA 4NEYA 4KGMA 3VAGA 1YIJS 3HK2A 2HMIB 2FDNA 4HEA9 4PG8A 1CPZA 5DGBA 2C3YA 4RX6A 5KFQA 5E5NA 4PG5A 3E51A 4X65F 4ID8A 1LW2B 4DV4F 5EX0A 3RJMB 2HHSA 1BY9A 2ZVIA 1C1BB 1LWFA 2ACYA 3B4MA 1GFWB 3KLEA 1NJWA 4NXNF 1WWHA 1DQAA 1FKPA 2DXFA 2KT2A 2QFIA 1RABB 1GNKA 2GIRA 2QA2A 4USKA 4CZCA 5AJ3J 2B8QA 4UW2A 4NLDA 3TX8A 5C2GA 4RWXA 5ETVA 1OYEA 1YX2A 4KT0C 5ETQA 4B3OB 4F4KA 2KZZA 4WXOA 2V5HG 1EHWA 2NCKL 3E8OA 4PG7A 2AJQA 3GG1A 3KUEA 4XPEA 1VISA 5C24A 1HW8A 4Q2LA 2NXJA 2CVIA 3OXGA 3M2VA 2YPZA 4ALZA 4AL7A 2W2MP 2ATCB 1PIEA 1N4LA 1B7FA 1VS3A 2E1AA 4RLEA 4CLSA 5GADU 3A4TA 4DF4A 3N9UC 5ETPA 1TFWA 3T5JA 1X31C 1WF2A 1ZTTA 3TUJC 2MXYA 2BW2A 1VC5A 1RTZA 3CDEA 5HVFA 4LQ3A 1RTJB 1HNWJ 1VLOA 2CJYB 3NBPA 3OVBA 4X2BA 2KRBA 4MTPA 4EYHB 4NE9C 1N32J 1GH8A 4CLPA 4K59A 1X5PA 2E5HA 2HVZA 4C8ZA 3JTOA 1FVQA 5ETKA 2ZBQA 3BSAA 3NY0A 2FJAB 2YWKA 5IM0B 4H4KC 3QLHB 2QYGA 4C9DA 1IKXA 2RKIA 5LL6d 4PXBA 2EKNA 4ED8A 5A8KA 3SQOP 3KWMA 3C14A 1NK4A 1T03A 1WHYA 3DRRA 4N8OA 2CPXA 2N3OA 1JLFB 2AP6A 1KC8T 1N5YA 5IQ6A 1N34F 4DUZJ 2MKSA 4DUYJ 3PZPA 3PYFA 2UUAF 3HCXA 1P9YA 1TL7B 4YN3B 2R7RA 3GV8B 1T9UA 2GAGC 4YUDA 3K58A 4M95A 5KTQA 2GO8A 2HNZA 1SJQA 2VG7A 3PTWA 4OLPA 4QOTA 4O3OA 4JV5F 1N48A 1C2PA 5DLGA 4DSFA 2DH7A 2W01A 5CYMA 2DD8S 3F73A 1ZZFA 3BGRB 2AW0A 1K8AT 2BM1A 3CD5A 1IM4A 3QSIA 3A8IA 2LQJA 1UL3A 2VB6A 1FKOA 5A8WB 3BKTA 1SKWA 4Q0BB 2NXCA 5H1SV 2WVEA 3CCMS 3FGVA 4PYDA 5EDWA 1UJ4A 3MD3A 2DR7A 3W8GA 2YKAA 4EWTA 2Z58B 4FVMA 4DF8A 1Q1KA 1U09A 2WOMA 4NLWA 1KVIA 1B99A 2J6SA 1FT8A 2QMUB 3BB5A 2YH1A 2P8IA 4FKXA 4NRUA 1S0VA 3T9NA 1H74A 2VFSA 2DY1A 4DG1B 5IZHA 4CI0B 4DFPA 1YTYA 3MMCB 2G0IA 2AHOB 2RIJA 1LWFB 2EFPA 5B0AA 5HANA 2R7XA 3BM7A 3UD4P 1HA1A 2B6AB 2DHXA 2FJEB 5DZ7A 4EUVA 4ZITA 4FNHA 5KFLA 1CEZA 1ACMB 5HO4A 1TK5A 3C3LA 2G0CA 2IVYA 3CC4S 4LF8J 4ZLPA 3I82A 1ZM2A 3EDRB 5D4NA 4F3MA 1SL0A 3KLIB 1R8CA 1S1VB 2VPXB 4DUTA 1NDKA 1Q82T 4K5SA 3QT8A 5CYJA 4KKOB 2DNNA 1TAQA 1CJKB 2I8EA 2V8DA 4R25A 3SCJE 3Q8RB 3OTOF 2ZH1A 2YKNB 4JI2J 4UZBA 3J7YU 1XEZA 2A2DA 5KFMA 3DM2B 4KYZA 2XMAA 1RHMB 2VBZA 1S48A 4QR1A 3FQKA 3ENWA 2XI3A 2GFFA 3DLKA 1O0PA 2B51A 3SSRA 1S0MA 4H4OB 1UJ6A 3M32A 5F3TA 2Y9HA 1WEYA 4BS2A 4LR9A 1U1OA 4PWDB 3S01A 5IV3A 3T5LA 2LU2A 2YTCA 3RR7A 4ZVPB 1RT4B 4XO0A 2ASJA 1S1WA 3G4SS 1HMVA 3R7BB 4USTA 4NI2B 2UVVA 3D7SB 5CZXA 4HHHA 2I0XA 4CO5A 3MMBA 3NCRA 2W9AA 2WRMA 2A18A 2DK2A 3I87A 2MDAA 2Q66A 4OZ2A 3SCIE 3RBZA 2W4PA 4WFZA 3JQJA 2ZFHA 1JKHA 3AOAA 3MPWA 1IKYA 3H25A 1RHJB 5DDQC 3NGUA 1VBKA 4M5KA 4F4WA 4NLOA 3W5YA 4N8NA 2AZ3A 4WTYA 3RRHA 3KMQA 2HHUA 3VGUA 4DR7F 2X1FA 1ZOTA 1SH2A 1KHWA 1YGYA 3V6DB 2C28A 2PC6A 1DQ8A 3HVWA 3UDEA 3W9JA 2DYAA 5LJ3Y 4DV0J 5HQ8A 1IBMF 1YJTA 4ILRA 1NU4A 4LRBA 1X4CA 4O3NA 5JVHQ 2HAFA 2PFDA 3POTB 3KK3A 4DR2F 5H9FJ 4E0DA 4R0EA 1HBOB 2YNGB 4QQBA 3RB4A 2GS8A 2E7XA 3J81Y 4F7VA 3PEJA 4KV8A 2QLBB 1U1KA 4RW7A 5HK4A 4NWBA 2BUNA 4MIAA 3SDEB 4DPOA 1L3SA 2RKIB 2OO4A 4KH0B 4CO0A 4CNZA 1XNQJ 3OQ2A 1QAYA 2OD4A 2W2OP 4Q8EA 3VF0B 1S76D 3NNAA 1L3KA 4O4RA 2VQFJ 2UXDJ 2OLWA 3HSGA 1LV5A 4CRJA 1IBKJ 4DL2A 5K14B 2ZITA 2XGPA 4ECVA 2EBEA 2WAQD 1F6TA 1RUSA 2WHOA 3OL8A 4LF5F 1EETB 3OFEA 2V8HA 4FKYA 1IBCB 3LP0A 5AT1B 5IV4A 4CWBA 1UVLA 1IKWB 4UY8T 5J1EB 3Q23A 1S97A 3PJWA 3HSDA 3JYTB 2HBYB 4NCBA 3Q86A 3KNGA 4ZJLA 4C11B 1WF0A 2HIQA 4OI3A 2J9CA 1X4DA 5KFBA 4GC6A 3AD8C 1DQ9A 1SJ4P 4K0KF 3D28A 2MQLA 3CW2C 5HBMB 3CULA 4LF1A 1R0CB 4DPXA 4EI2A 3M30B 2BJEA 2FJBB 3M9OB 1N56A 3I5CA 1XC9A 5U47A 3C6TB 2VJVA 3QMQA 5B0EA 1ICEB 1KTVA 2KU7A 2MPUA 5CQGA 3IN5A 4J37A 2ROPA 4DR6J 4DR6F 4ELTA 2YNIB 3DLJA 2J5AA 1RKJA 5KG1A 3W63A 5I3QA 3TAQA 4KO0B 1LNQA 1NO8A 2MLXA 3LGHA 2MQNA 2N4CA 5C2CA 1CJUB 4I6YA 3R7NB 4OI1A 2OTJS 2GNKA 1TU0B 1TP7A 1YHQS 2PI4A 2Q1LA 3G96A 4ZVTB 1K47A 4WP9A 3LGMA 5JXSA 4U7UD 5K8PA 3HULA 2K3KA 1WACA 4Y2CA 3UFCX 4K50A 1FTRA 2YNFB 5SUHA 1HBUA 3U1NA 1CC7A 2WONB 1HHTP 3I31A 4I68A 1JLQA 2HGMA 2DNOA 3MEEB 3PM9A 2EWHA 2QSWA 1NK6A 2MSTA 2XGQA 1BE4A 2QL9B 4ZLJA 4J91A 5KFPA 2DNHA 3M32B 1GX6A 4JI5F 2ZH9A 2W7AA 2C2EA 3H2LA 2XLKA 2HS3A 3N28A 3K0JA 2QSFA 1C1CB 3E01B 2DIVA 3Q2SC 4DV0F 1WDTA 2KYZA 3CO9A 2DNQA 2W4CA 1WEXA 3I5AA 4NL5A 1VQYA 3OR1B 1CLFA 4NZ6A 2W9CB 1RWMB 3M6WA 4XDCA 4NYZA 4FXVA 1FHTA 4X62F 1EP4A 5JJBA 4U6PA 1S57A 2W7PA 1UAWA 3ICLA 2VBYA 5HSPA 3DOLA 4B08A 3BPSP 5LSOA 3G86A 4NASA 3AQOA 2IJRA 4HTJA 1F5BA 1T94A 4U8YA 2CXEA 2VQFF 1U8WA 4HLBA 1X4AA 1VR6A 1VRUA 2CJXB 2DNKA 2POKA 3D9BA 1S6OA 2RQKA 2IVFB 3B6BA 3IRXA 4NYPA 2R8HA 2NR0A 3B4DA 2MSSA 1HYSA 1QTMA 4HACA 1MWYA 2IM2A 2X1BA 2JC1A 4O0IA 2VODA 2RF2A 3MI7X 3MM8B 3MPUB 2OH2A 4LJMA 1RTDB 3NMRA 4YY3J 1K0TA 2BE2B 4L73A 4L72B 3LP1B 2YKMB 3FUYA 1R0AB 1EETA 3FSXA 4P7TA 4DSIA 2PA3A 2CJ9A 3MEKA 2VJUA 5J2MB 3CWJA 2OPRA 2XBPA 1HNWF 4F4AA 2M70A 1KQFB 2H9ZA 1VRQC 4C2MA 1NK8A 3I96A 4TQRA 4D3GA 1RGVA 4ECXA 4P2MA 2AX0A 3OR2B 1VC0A 3J7YI 1XERA 2MB0B 4QIVA 1X7VA 3KLEB 1D3WA 2U1AA 2HNDB 4DV5F 4U7UK 3TAPA 4AL5A 4EMDA 3A8EA 3HHKA 1BLUA 4NZ0A 3CJQA 1Q78A 4I2PB 3OL6A 1NSPA 1RT3A 3UE2A 2BOAA 4G6VB 3CJTA 1S0NA 2OP5A 4NPOA 4WK1A 1N5QA 2Q79A 4C3KA 4F25A 4GO5X 2L48A 2DEJA 2AQ4A 2C42A 3TZZA 3NS7B 3NGSA 1H0HB 5L8RC 4CM0A 3K5NA 4B3MF 2RUGA 4RL1A 1OSCA 3BQ1A 3G2XA 4RUBA 3KUHA 4ERDA 4BLGA 2RNEA 3GSIA 2FLPA 4UF4A 1NH7A 2YXLA 3OBIA 3EGWB 2QLFB 1D8YA 2W9BA 3GFYA 2JLFA 3LWLA 1MW7A 1RTJA 4ZCMA 1CJUA 4BC9A 1J5OB 3LPYA 4B17A 3IG1B 3OV7A 3CJSA 3BF4A 1S12A 3D6TB 2NPFA 3JTNA 3NG8A 1NK5A 2CQBA 1NPRA 1ZETA 4BC7A 4ENOA 3GR0A 4BDPA 1RAOA 4ZK7M 1HI8A 2FYXA 5KFHA 3C6UA 1WHWA 4QU6A 2J0XA 2IBOA 2QO3A 1X9SA 2P9EA 3VAFA 2JL9A 2XQCA 1TUVA 3V6JA 1U0HA 1CVJA 3EZUA 2CQDA 4Q2MA 3TA2A 5HROB 2R2UA 3CCJS 3DLHA 1OMSA 3DNCA 2IDEA 4YHHJ 2VIHA 1RT5A 1RWXB 4G3IA 1HWLA 3EYZA 2Z2LA 1DBDA 5T14A 5DG7A 5DETA 3I5BA 1Y9OA 3KDNA 3Q22A 1CQMA 4DQIA 4DPYA 1Y3KA 3PR5B 1GX5A 1S1XA 3M2VB 3PEHA 5BJRA 1LQ9A 3OLBA 2HWTA 3RBDA 2DRBA 4DSKA 1VK8A 4ECRA 1LFWA 2YWGA 1NJXA 2RB7A 3DXBA 5HAOA 4DV6F 1S9EB 2V34A 1UMJA 3IR5B 3R5JB 3CD6S 4NCAA 3NAIA 4ECSA 1Y4ZB 1SL1A 4OX9J 1RACB 4CLUA 3DOLB 3VALA 3L9ZA 3M8PB 4IFYB 3LO3A 2ZHBA 1FKPB 3D5MA 5E7OB 4ZDNA 3ZZZA 4F0HA 1FFWB 3IA0A 4OX6A 2AEMA 1VQ4S 3IRXB 1HYSB 2WOMB 3KK3B 4NCGA 1HBMA 5C42A 4WFNQ 1UWBA 1WC3A 2W24A 3QSYB 2V6AA 1H6KX 1AROP 2GQQA 2VZ9A 2BE9B 1M1KT 1Q8IA 2IYGA 3OR2A 3EXCX 4RR5A 4DV7J 2M5YA 1KP6A 3TVZA 3G6XA 4LFBF 2P6SA 3PRBA 4PAAA 3V4IB 2FPHX 2RH3A 5THWA 4LFBJ 6AT1B 1HLWA 2GV1A 2RVJA 5DQGA 2YH0A 1MMLA 4Q45A 1U1QA 1NK9A 4F02A 3F56A 2EPIA 3SSQA 2WB1D 2Z0GA 3MPVA 1FKAF 2V67A 1LXNA 5L1IA 7FD1A 4RW8B 4O44B 1T7PA 3M8WA 5HQMA 2XSJB 3PVXA 3QATA 3D67A 2NXEA 4KGZB 3K5PA 1RT4A 3R6GB 1UCNA 2RSQA 5B09A 5HJXA 1T03B 3RB3A 5ETOA 4UQTA 4I56A 4M1KA 2RU3A 3OVAA 1VQ7S 1VQ8S 4DV2J 2LQ5A 3AA8A 1RHKB 3B8HA 1M0SA 3OJSA 3NRBA 1EARA 4EYIB 4P75A 3BQ0A 4MIWA 2VU5A 1QE1A 1Y5LB 1Z1ZA 5M2PA 1YBTA 1VRTB 3H0PA 5F9LA 3RTVA 5ETSA 3DGPA 2B3TB 2WVBA 3RBXA 3HT0A 2WSFC 1QAJA 3FRZA 4YHHF 4J9RA 2CQ2A 3JYTA 3EZ5A 1J5EJ 2CNNB 5FIIA 3IBWA 4ANDA 1WC5A 1GTHA 3H2UB 2DR9A 2E44A 3KUGA 4C8MA 4ZVRB 4RU2A 3TI0A 2AIRB 1W2BR 3HHLB 3GR1A 3WDOA 2DJWA 3GFXA 4HH0A 5T7LB 1CULB 3EPGA 1SJRA 4XK8C 4KY3A 3UCZP 1NLKL 4RBVA 5KG3A 1YWXA 2LA6A 4PQAA 3K57A 3CPWR 1NB7A 1N34J 3LTOA 2HHPA 4EO8A 3C6UB 4CLTA 1S6UA 1Y3JA 4PXEA 4F8RA 1BD6A 3KHGA 1OWXA 2YNHA 2CPZA 5HATA 3CDUA 3R5AA 3TP2A 1HR0F 4H4OA 3NWRA 2E5IA 4ZPWR 2O1PA 3AXMA 1KSPA 4DMZA 2L41A 2UVWA 1YJ9S 2ZBCA 4DV7F 2VV5A 3Q2TC 3L3CA 4I2QA 3MCSA 1FWLA 1GK8A 5IC6B 1SQEA 2W8LA 1ITPA 4FBTA 3IBCB 2AJ4A 2QL5B 3CCRS 1HNZJ 3NOGA 5L39A 2DGWA 1F2HA 1D9DA 2DGQA 2DGXA 4ZVQB 5J2PA 4DR4J 1SVDA 4C0BA 4JI8F 2MKIA 3JXOA 4LFAJ 4H4MB 3FMWA 3ZZYA 3R27A 1NPPA 1LW2A 3O8WA 3CEDA 2W2PP 5HQLA 4RKUC 1HI0P 1C1CA 3RB6A 2V9WA 1FI4A 1LWCB 2JJ4D 4L74A 4UQGA 2W8KA 4TVAB 3UDCA 4LF6F 2JX2A 2E7WA 3K7RA 1R8HA 4EBCA 4C3LA 3QZ7A 1MROA 2DR6A 4NEZA 3T6JA 2XI2A 3BBBA 1GMVA 1KNZA 2BEFA 1RAGB 2AX1A 3KHRA 1UETA 4N77A 4ECUA 1APSA 3BKFA 2XMWA 3HSJA 1M5OC 1TKZB 2RQCA 4LF4J 4Q5VA 4MKAA 3UN5A 2HHXA 5FDLB 2G1HA 2B9WA 3DOMA 4K2JA 3KFWX 1F2GA 3I0RB 3ADAC 3ILOA 2D9PA 3MEEA 5ETLA 3MM8A 4ICLA 1D0EA 3PCOB 4V19X 3HO1A 1YK9A 4OYZA 4GKJJ 4FYXB 1HBUB 3TUPA 1FCAA 2XS5A 1K44A 3DLEA 3C16B 1T9TA 1VOMA 2JSXA 1UFLA 4J9OA 3UVJA 3I6PA 2E5LF 3M30A 3T9ZA 4LF7J 4NLYA 3RU0A 4JUZA 2BDPA 3RBEA 4DX8H 4P52A 4CO3A 5DDOC 3EE3A 2C3UA 3BJYA 3J80U 2LXIA 2J7UA 4DUYF 1UZHA 1KFDA 5HL7Q 2RRBA 4GO7X 5E2QA 4IO1A 2COLA 2X3DA 3CE8A 9ATCB 4KTQA 3QRPA 1HNZF 1A6LA 2P9CA 3W62A 2DH9A 3GP9A 4M5MA 2K2PA 4JV5J 5IXUA 1T9XA 4K4VA 4OV6A 3O6QA 4RW6A 3JSBA 2M8DB 3H98A 2ZE2B 2YNHB 2J6TA 1SIZA 2V8PA 4F50A 2HMIA 2P5VA 3P5TL 3GJQB 3MGJA 4ER8A 4DL5A 1RHRB 1FK9B 1VLYA 1VMBA 3IAM9 4ED6A 1P9QC 1F5CA 3FC9A 1U49A 2GHWA 2Q6BA 1KS2A 1PILA 3PG9A 4I64A 4LF6J 1S7HA 2J7WA 2WONA 2LEAA 5DQIA 5LMUJ 1L3VA 4DR5J 2IRXA 4DFJA 1OQ6A 2MLYA 3PYEA 1T3OA 2CA9A 3NGKA 2Q43A 2J8AA 5J2QA 4ZS6A 2GJFA 2QA4G 3M7VA 1IUJA 1LOUA 4JBCA 2VOOA 4UZCA 3DRRB 3G82A 1RTIB 4K2XA 3I55S 2NXUA 2ASLA 3FJ2A 2IHR1 3KLHB 1O6XA 1IKXB 1SI9A 4Z7YA 2DO0A 2KL8A 3T1AA 3CDBA 5KFRA 4ATNA 2QMWA 4XIUA 2V68A 1VRTA 4CLKA 4WFAQ 4NLQA 3R7SB 3RAMA 2GJIA 3CUNA 2UV8A 4DL7A 2RS8A 5I3UA 2Y1IA 1C0TA 4WKYA 5C25A 1EZZB 1RT3B 3MMCA 4MT1A 3KLGB 2HFNA 3GIMA 2O5DA 3A3PB 3P45B 4GMKA 3ZTRA 4B3MJ 2DISA 3CCVS 3V6HA 3W3SA 3S1TA 1RAFB 3OFFA 1RP5A 4I6WA 1NXIA 1N6QA 2LA4A 5LT5A 4LF7F 3WBZA 2M4MA 4F0KA 3HT3A 1F0XA 3EJMA 1FA0A 1TKDA 1AUDA 2XCAA 4CLLA 2HHQA 2QYCA 3M2RA 1N5VA 1UW4A 2F9DA 2MZRA 1UA1A 2D7SA 5GVQA 1QSSA 1EKSA 2WSCC 2QL7B 3FMBA 2V8VA 2YKMA 2YKPA 2ZDPA 3ELHA 1RAIB 1HMVB 3VV2B 2RS2A 3PW4A 3EVWA 4ED0A 3QGIA 3GYGA 4RW9B 4TXSA 5IOLA 2AZ1A 3EUNA 5EUHA 4PCQA 2DNPA 2OPRB 1J5OA 2P2CB 1Y5IB 1ZPVA 2CYYA 3PHTA 3IBFB 3FRYA 3ISND 4B3TJ 1WSRA 4ZVSB 1VHFA 3UR0A 3VR1A 2XHWA 5EWEA 4CH1A 4C8YA 2ZNZA 2CAJA 5EWFA 1DY3A 5CCMA 2ADBA 2V94A 1JXVA 2HNYB 2ZUGA 4DR5F 4HACB 5KFJA 4HDGA 1H72C 4P2FA 3EXYA 1FDNA 1S6PB 4TNOA 3ZFVA 3UO0A 1S1UA 3BSCA 3LOUA 4NA2A 5EWGA 3PFOA 4CT8A 3NAHA 5F8IA 2FD2A 4ZCLA 3PW5A 2IMOA 4JV0A 3TJAA 2VKRA 3CCTA 5F0UA 3IM8A 1R43A 4OZ1A 1VQKS 2QLWA 4YB1P 3N6NA 4WKRA 1SH3A 4I4BA 2FHJD 3A3OB 4C8OA 3M2RB 5F0WA 2IJFA 1TL4A 4F04B 4DHVA 2VFVA 2VQEJ 2Y8YA 4DSEA 1WKKA 2CQ4A 1K73T 2RHSB 5KG0A 2W2NP 5HI7A 3ZZUA 2EFVA 3W8PA 1A7GE 1HWJA 1XMOF 1FF2A 1YRXA 4DR1J 1TK0A 5KG2A 4LQ9A 3WHIA 3CJ0A 1U6ZA 3M1VA 3B78A 3THPA 3VZHA 2H65B 1KOHA 1Y0HA 2PA8D 4LSNA 3HHDA 5HMYA 4X4QA 3CDWA 5K8MA 4FPIA 2VICA 1WF1A 3KJQB 3HMJG 3RW7A 4CLWA 3PACA 2GMJA 4K0KJ 3BBCA 5AE1A 2YX7A 2YWHA 4WXWA 2PMWA 2WK4A 1Q79A 4JI1F 2AT1B 4JI1J 1HFEL 1NDLA 2IYIA 2DGTA 3RG6A 2GGPB 3FEZA 4DWIA 4LFCJ 1FX2A 2QE5A 3SV4A 3C2PA 3G9CA 3OUYA 1QDUB 2KT5A 2MMYA 4X64F 2QTWA 4DCPB 3DI6B 4TN2A 4J7CA 2RDJA 2C22A 5DRKA 4A4JA 2VPWB 3J81U 2IAJA 2JRSA 2KM8C 2E9ZA
chains in the Genus database with same CATH topology
3GTYX 1T11A 1W26A 2MLZA 2MLYA 2D3O1 3GU0A 2MLXA 1P9YA 1OMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTY X;  1T11 A;  1W26 A;  2MLZ A;  2MLY A;  2D3O 1;  3GU0 A;  2MLX A;  1P9Y A;  1OMS A; 
#chains in the Genus database with same CATH topology
 4B02 A;  6FD1 A;  1AZS A;  1H2T Z;  1S1W B;  2GVD A;  2DR5 A;  3KLV A;  4KHP F;  2BA9 A;  1OYD A;  4OJH A;  3SBM A;  3QGG A;  2FTR A;  2BRK A;  3UDL A;  1N36 F;  1HNI B;  1RT2 A;  2XSJ A;  1ZS6 A;  4E98 A;  4A8M P;  4PAB A;  2FZC B;  2CFX A;  4JI4 F;  2XNR A;  3P6Y C;  4QJV A;  1S1T A;  1EB0 A;  1HBN B;  2CRL A;  4YR2 A;  4B9V A;  3QQC D;  2ROE A;  2QGF B;  2C1E B;  3K8W A;  3ZTS A;  4IKA A;  3OSP A;  3KDO A;  4CO4 A;  4W98 A;  3KJV A;  2N4D A;  2FY8 A;  1FXD A;  4PPZ A;  4R8U B;  1WNE A;  2NZ4 A;  2F3J A;  2OSR A;  3JTP A;  1N33 J;  1DLO B;  2ASD A;  2B56 A;  1C0U A;  1DTT B;  2LDI A;  3ZC4 A;  4PR6 A;  1YSJ A;  3H4B A;  1T3N A;  1S6Q A;  4DL4 A;  3LP2 A;  1JLA B;  1Q4R A;  2DXD A;  4CYU B;  2W4D A;  4XPC A;  3MR5 A;  1LWC A;  1TK8 A;  1RWK B;  1FRX A;  2HS4 A;  1RWN B;  3BR9 A;  1GTE A;  4AD6 A;  3FEX B;  1QAI A;  2AEF A;  2LCW A;  4MIB A;  1RAH B;  4HT5 A;  2QA4 S;  2M52 A;  1S6P A;  4MK7 A;  3MDF A;  3J81 j;  1CS4 A;  3N79 A;  2J9E A;  2B5J A;  2PII A;  2EFQ A;  2HIY A;  4LBP A;  5H9E K;  1AZS B;  1LK7 A;  1NME B;  2CZV C;  2PT0 A;  4RNO A;  4OHW A;  1YVF A;  2CQ0 A;  4DR3 F;  3AJD A;  2F8M A;  3Q8P B;  2D3Z A;  2W1B A;  1T11 A;  3KMS A;  2ILZ A;  3MED A;  2ZNY A;  3J80 Y;  2XLI A;  1IWG A;  4ITS A;  1KVJ A;  1LXJ A;  3KJF B;  3BV8 A;  5CZV A;  2XWX A;  1ZM3 A;  4AT1 B;  3H7H B;  3MHY A;  5KAK A;  1MMD A;  4QIW D;  5LSL A;  2AJF E;  4FF1 A;  2JVO A;  3NL0 A;  4N76 A;  2AEJ A;  4B3R J;  3T3F A;  3KOA A;  3QZ8 A;  4LVO P;  1TL1 A;  4U96 A;  1WUU A;  3EWG A;  4OZL A;  3PFE A;  2JLG A;  3VGS A;  2OGU A;  4OYA A;  4ZN1 A;  2JEF A;  1SC4 B;  2CG4 A;  4M5G A;  1PKU A;  1QSY A;  1U0S A;  4J9V A;  3ZZO A;  4DDF A;  2ZH6 A;  1QAX A;  2H48 B;  4DV6 J;  5D3G B;  4MKY A;  3W60 A;  3UW1 A;  2DTJ A;  3EIC A;  2B43 A;  4C6A A;  3MM9 B;  1HHS A;  1R0A A;  5DJB A;  3R8Y A;  2BXJ A;  1FJE B;  1TKT A;  4Y34 A;  2A10 A;  3M1V B;  3H59 A;  4PUO A;  3CDA A;  1AA1 B;  3KK2 B;  3CD0 A;  3C46 A;  5SZT A;  4KGX B;  2KHD A;  2EI5 A;  2LMI A;  3C14 B;  3SCK E;  2MKJ A;  1IBM J;  3M6U A;  3CNQ P;  4IFV A;  1VQO S;  4FDF A;  4QPT A;  4BCA A;  2VFU A;  4WJB A;  2CJQ A;  1U47 A;  2V4J B;  2D9O A;  3LAN A;  4TYB A;  5AXN A;  3LWM A;  2QIF A;  3I32 A;  4ZVF A;  1GXT A;  4MAK A;  2DCU B;  5I42 B;  2ZH3 A;  1RE1 B;  2MTL A;  1VBY A;  9RUB A;  2K06 A;  3FSY A;  2G2Z A;  4OYW A;  4PZV A;  4N56 A;  3AD7 C;  2MY8 A;  3QGH A;  4NLV A;  2QC3 A;  3T1H J;  2DNY A;  4JI8 J;  2OTL S;  4OHY A;  1X0F A;  4DR7 J;  3DKD A;  2PSZ A;  1JNR B;  1Q8L A;  2B6A A;  3DOM B;  2NYH A;  3EM1 A;  2FUG 9;  3FCV A;  4X4S A;  4ELU A;  3CC2 S;  3JAM Y;  2SXL A;  2YVS A;  2Z30 B;  3MAA B;  1V5V A;  2EC2 A;  1OJ4 A;  5BR8 F;  4I0W A;  4DR2 J;  4B9N A;  2HFU A;  1FRI A;  2JFD A;  1IR2 A;  3WIV A;  2V0N A;  4CYU A;  4ZVE A;  1R7I A;  1HNI A;  1B4S A;  1RT2 B;  2HVD A;  2KXH A;  2DNM A;  4LRF A;  2C3P A;  4ZPB A;  3TUI C;  4KPC A;  3FZB A;  3L7O A;  4ZVU B;  3TWZ A;  1HQE B;  2IVM A;  3GIR A;  3VVT A;  2C3M A;  2HSE B;  1KOO A;  3BYP A;  2MHE A;  4ZPV R;  1FWK A;  2ALY B;  2HQI A;  4B3S J;  3G8Q A;  1BXN A;  4O4G A;  1IBK F;  3CJ4 A;  3I0S B;  1RAA B;  1TKZ A;  1T9W A;  2A2C A;  3RYL A;  1GAO A;  3MED B;  4PG4 A;  2UU9 F;  1WG1 A;  1OPZ A;  4WBF A;  3NCP A;  8ATC B;  2ADC A;  4C8K A;  1G7C B;  1X0P A;  2CDR B;  3GMG A;  3W61 A;  1S0O A;  3TAN A;  1JIH A;  2LEP A;  2B4O A;  5B7W A;  3QBC A;  1MG7 A;  2MGZ A;  3MR6 A;  2CPH A;  1FD2 A;  3JSY A;  4OFZ A;  4CQ1 A;  4NA3 A;  3QNW B;  2IAJ B;  2WBM A;  3W2V B;  1CJV A;  4ZMM A;  2OPQ A;  2PD1 A;  3VAM A;  4ECZ A;  2XS2 A;  1RT1 B;  1SKS A;  1JLA A;  1FVS A;  4ZA1 A;  1AXQ A;  4DOZ A;  4RJV A;  5GAE U;  1ZBT A;  1SB6 A;  5B0G A;  4YB7 A;  3MMJ A;  4WE1 A;  4K8R A;  4ZLN A;  2JZ5 A;  4NLX A;  2R7S A;  4EFA C;  4ES1 A;  1XNR F;  3PIP Q;  2ZJQ Q;  4RBU A;  4FS1 A;  4TY9 A;  2H3E B;  3FCH A;  5HRO A;  4J9M A;  4OYX A;  4O4G B;  1JLG B;  3HSZ A;  4DV5 J;  2J9D A;  1Q53 A;  4PWW A;  1BMQ B;  3KNA A;  4OYI A;  3FCW A;  5BYS A;  4LT6 A;  1KWM A;  3UQS A;  5A76 A;  4Y00 A;  5L46 A;  1SJ3 P;  2R4F A;  1B0P A;  3TAM B;  1S49 A;  3QFH A;  3U1L A;  4QBU A;  1B0T A;  3GIK A;  2YNG A;  3H8Y A;  1NKE A;  1B7Y B;  3CMA S;  2BJ1 A;  2W9B B;  3FBB A;  1UFK A;  2V2Q A;  2QFJ A;  2EW9 A;  2QEX S;  4A8F A;  5KG4 A;  1G2E A;  3NGR A;  1DTQ A;  2DEI A;  2B9X A;  4NLP A;  4QIG A;  4KHM A;  5BYR A;  4A46 A;  1RWO B;  2F65 A;  2BQ3 A;  2DGU A;  5G0R A;  1K0V A;  1FFS B;  3D3B J;  4UTG A;  5HN0 A;  5IT0 A;  4KO0 A;  1S77 D;  3BPD A;  1GMW D;  3MR7 A;  4UOF A;  1C1B A;  3Q0A A;  2VQE F;  5I42 A;  1YRU A;  3HFZ B;  3RW6 A;  1RT6 B;  1X5O A;  4O3S A;  2JEI A;  1WC1 A;  1YZ6 A;  1VI7 A;  1HD1 A;  1OO0 B;  1WC6 A;  3MMB B;  3NKY A;  2ZEJ A;  3AY0 A;  3IR7 B;  3PJ9 A;  1I3O B;  3R5D A;  2N82 B;  4OLO A;  4NZ7 A;  4U8V A;  1F60 B;  2KDO A;  4X66 J;  4K4W A;  4JI7 J;  1P1L A;  1FRJ A;  4JI2 F;  1Y11 A;  3OTO J;  2R2S A;  1IKV B;  4QR2 A;  3O3L A;  4JI3 J;  2R7U A;  3ZNJ 1;  3GU0 A;  3OTB A;  2LXU A;  3TQE A;  3OHA A;  2AYB A;  1X5T A;  2U2F A;  3W5Z A;  5F8L A;  1RT7 B;  3CO0 P;  3CJK A;  2KFY A;  2AWZ A;  2CDQ A;  5F8N A;  5FLX Y;  2X3G A;  3DM2 A;  2C2R A;  2Z57 B;  3Q89 A;  3THV A;  2ASY A;  1B3T A;  4DV2 F;  4OHV A;  4YDX A;  4OYP A;  5T41 A;  1Q8B A;  4ZKA A;  4DFK A;  3CXC R;  2DGS A;  4XTT A;  4F3O A;  4IDK A;  1MWZ A;  2N7C A;  1YJR A;  1SQG A;  4LMZ A;  4WYW A;  1IVZ A;  3KJN B;  5AXL A;  1WG4 A;  1RQ0 A;  3UR3 C;  1CBK A;  1ZPW X;  3FFI B;  1MU2 A;  5LMN J;  1PC5 A;  1JX4 A;  2M7S A;  2IC3 B;  1E6V B;  3Q8S B;  1P6T A;  1IR1 A;  2QRR A;  1H98 A;  1HBM B;  2DHA A;  2LKZ A;  3I0S A;  4RO0 A;  2F1F A;  3JQK A;  1VGY A;  1JXE A;  1QSL A;  4DQP A;  3TX0 A;  3HJF A;  2CWX A;  1YI2 S;  1GMW A;  1RU1 A;  2NS1 B;  1DLO A;  1NM2 A;  2BM0 A;  2OI2 A;  2QMX A;  3IWX A;  4OX8 A;  3VZI A;  4P71 A;  2HG4 A;  1UVK A;  2BOP A;  4MKB A;  3ILJ A;  1FRL A;  2UUW A;  2XLJ A;  2EG1 A;  2GX8 A;  4OZ0 A;  2DNG A;  1RAE B;  4RNM A;  2F63 A;  4IG0 B;  3G6Y A;  1T05 B;  4DV4 J;  1U2R A;  3LQV A;  2WZ1 A;  3E01 A;  5DDR C;  1T8E A;  4P10 A;  2IA6 A;  5KFX A;  3DXS X;  2HKE A;  4NLG A;  3SFG A;  1T02 A;  2L08 A;  1RTD A;  1CG2 A;  3MAH A;  1M5K C;  5AJ3 F;  2G2Y A;  2HBZ B;  1KDN A;  5ETM A;  5IC4 B;  4X62 J;  4UY8 5;  4DS4 A;  4HH1 A;  2HLU A;  2RQ4 A;  2HHH F;  3ENA A;  2JC0 A;  3BN4 A;  2HNY A;  3M8Z A;  5ETN A;  3PX4 A;  1O5J A;  5CHC B;  4JI7 F;  2XMK A;  3SV3 A;  2WVF A;  5M2U A;  3AOD A;  1NK0 A;  1UVI A;  3LH2 S;  5KFV A;  2HFO A;  5D0E A;  4TQS A;  1N5Y B;  2K1R B;  4C3M A;  3BGR A;  4USH A;  1ZAW A;  3QIP A;  3V6K A;  3IS9 A;  3PX0 A;  2ZH7 A;  1K1S A;  4OX7 A;  2DT9 A;  2FLO A;  1X4H A;  4NLU A;  3CCS S;  1DTQ B;  1ELO A;  1GXL A;  1I51 B;  3IAS 9;  3N0V A;  3OR1 A;  4WIQ A;  5E3Q A;  3UWT A;  5C7P A;  3TVK A;  2W9C A;  4KH1 B;  4ELV A;  3AAW B;  3ENQ A;  3CTR A;  1U26 A;  3MM9 A;  1I1G A;  2N7Y A;  4M5H A;  4OJ1 A;  5CH7 B;  1SPB P;  1I6J A;  2FVR A;  1S59 A;  3CIM A;  3R3T A;  1XR5 A;  1WC4 A;  3TJ8 A;  1TMJ A;  4OYO A;  3GJR B;  1E6Y B;  2BJ7 A;  2XMM A;  4QWB A;  4BWM A;  4A8X A;  1U6B A;  2JOQ A;  1RHQ B;  2LLZ A;  4FYW B;  1TVR A;  2BAN A;  2ZD1 A;  1QUV A;  1BQM A;  3ITH B;  3VAH A;  3ZZP A;  3HM9 A;  2C2Z B;  3IGV A;  4ANE A;  3NS6 A;  4I2P A;  2PMH A;  2VBW A;  4I7F B;  4ID5 A;  3TZX A;  2KXN B;  4GVL A;  1WEL A;  1R31 A;  3BZQ A;  2OAU A;  4UOG A;  4Q0B A;  2R7Q A;  3P8B B;  4Q7A A;  4JP8 A;  4P9S A;  3AXK A;  3LP1 A;  2BRL A;  3MD1 A;  1NZA A;  1TL1 B;  3W65 A;  2O01 C;  2ZH8 A;  3TEG A;  1BQN B;  1YBU A;  4D3H A;  1Y00 A;  2OUG A;  2RD5 C;  3HKW A;  5J2P B;  2XTJ P;  1M1G A;  3E2E A;  2WBR A;  4K7Q A;  3AHP A;  3M8Q A;  3Q8V A;  2B4P A;  1FEH A;  2XMV A;  3X3U A;  1IXK A;  3P3D A;  1ZA1 B;  2B0G A;  1NJY A;  2H4W B;  1VQ5 S;  4HVZ A;  5J1N A;  3SIP B;  3U27 A;  4FYV B;  5KG5 A;  3C16 A;  3OW2 R;  5E33 A;  2KYX A;  2MJU A;  5CAB A;  2E1P A;  5E3R A;  1P27 B;  4MYU A;  4FF2 A;  1MU2 B;  3LP2 B;  1X5S A;  1SKU B;  3D6M B;  4DN0 A;  4DBQ A;  1AT1 B;  3PO5 A;  2NQP A;  1S99 A;  1VCT A;  3W2W B;  4MFB A;  5IWA J;  2AGQ A;  5AE3 A;  1RTI A;  3DMJ A;  2G2O A;  3N4W A;  4UUX A;  4R8U A;  2LEC A;  2OD6 A;  4V19 J;  2K3I A;  1VFJ A;  2CWK A;  3GLJ A;  3GIL A;  4RW6 B;  1VQN S;  2HGL A;  4OHZ A;  2OJ3 A;  1KTQ A;  4C98 A;  2OEM A;  3GV5 B;  4G1I A;  5KFW A;  4RW4 A;  4B3S F;  3ZTO A;  2RT3 A;  2GZO A;  1F9F A;  2QJ3 A;  3AT1 B;  3DLB A;  4C97 A;  5I3P A;  4K4Z A;  3D68 A;  3GYN A;  2FC8 A;  3IXQ A;  3MMA A;  4YQW A;  4EBD A;  4X4V A;  2UU9 J;  4JYA J;  4HHJ A;  3AB2 B;  2LVW A;  4K5R A;  5LXR A;  1VQP S;  3L7U A;  4HI1 A;  2FGO A;  3NXZ A;  5LMN F;  5KG6 A;  3DRY A;  4DLE A;  1VJW A;  1HBO A;  3BN7 A;  2J0S D;  1WEZ A;  1N88 A;  2E29 A;  2R3V A;  5RUB A;  3G6V A;  1MSW D;  5L1L A;  4HYK A;  3RRG A;  2KH9 A;  1SC6 A;  4Y6I A;  3V6D A;  4ZIW A;  1KLM A;  5BYQ A;  2CNK B;  2DHG A;  4RUH A;  2BX6 A;  1OY9 A;  4AL6 A;  1LEO A;  4PEO A;  4WP3 A;  4CLF A;  1SUQ B;  1TKX B;  2HFZ A;  4HR2 A;  1IM6 A;  4DLG A;  1HR0 J;  3CCL S;  2MKY A;  1TAU A;  1REV A;  1O8B A;  3QWU A;  4X84 A;  4NOH A;  5K5M A;  1H38 A;  3W66 A;  2AU0 A;  2F7V A;  4XAK A;  3ISZ A;  2A3J A;  3N6M A;  3ZNU A;  3HHN B;  1NH8 A;  3QT6 A;  2AYG A;  5KOW A;  1FNO A;  1VIO A;  1TVR B;  1JLC B;  5D4O A;  3QYY A;  3KHL A;  4LR8 A;  1YIT S;  1IBL J;  3P49 B;  4EK2 A;  4OJG A;  1AFJ A;  3W1Y C;  4PPD A;  2OKQ A;  2ZKU A;  1IN0 A;  3BRE A;  3B82 A;  3JSR A;  2BKO A;  3KK2 A;  1YJN S;  2CPY A;  3LGN A;  4OI6 A;  1PAU B;  4OMF G;  4CT9 A;  4U95 A;  4UUW A;  4QIF A;  3DLK B;  2CNL B;  1PC4 A;  2Y0B B;  2QN6 B;  1WHX A;  2YX4 A;  3H90 A;  3QPI A;  2KO1 A;  4WYL A;  1SJ1 A;  1LK5 A;  4UOC A;  4CM2 A;  1CSJ A;  2A6M A;  3FNN A;  5LJ5 Y;  4X65 J;  2B9Y A;  2ZD1 B;  2CQP A;  4OI2 A;  4ZHR B;  4ED2 A;  4A48 A;  3QRQ A;  4PXC A;  2Z2Y B;  4DSJ A;  2BQU A;  2DPI A;  1HQ2 A;  1FWP A;  1WKL A;  3IM9 A;  3VWS A;  3GIJ A;  1WOP A;  2UXC J;  2NUU G;  2R8J A;  4I6A A;  1PJ7 A;  3M4X A;  2AYM A;  1FRH A;  1VJQ A;  2KVI A;  3DGP B;  1R8B A;  5J1P A;  3EPI A;  4F2R A;  1V3R A;  1FDB A;  2YQ1 A;  4EEY A;  1S9G A;  4I2Q B;  5I4M A;  4OQJ A;  4WU3 A;  7AT1 B;  3MFI A;  1TL7 A;  3CJ8 A;  3DRS B;  5L9X A;  4OHX A;  4QU7 A;  5D77 A;  4DXL A;  1U2F A;  4LRE A;  3GB0 A;  3MF5 A;  3K5L A;  2GVZ A;  2EFO A;  2OPS A;  4OZN A;  5E3A A;  4B3R F;  3KG4 A;  4RWW A;  4PQU A;  5HVH A;  3DFE A;  1IWA A;  3HVT B;  3IRW P;  1SKR A;  4GRS A;  1FRM A;  3HF5 A;  2UXB J;  3LAK A;  2CQG A;  2KG0 A;  1EQ0 A;  3IMQ J;  1XJW B;  4OYB A;  4P2S A;  2JEJ A;  3QRR A;  5T7L A;  4QW8 A;  1SCJ B;  5HMX A;  2V2V A;  1YJU A;  4JI0 F;  1WOO A;  1RAJ A;  3HPO A;  2DR8 A;  4K4T A;  4JI0 J;  1NKB A;  2E1C A;  4NX9 A;  1VQM S;  1WOS A;  3ITH A;  2XY6 A;  3AFG A;  1N36 J;  4IRD A;  4USJ C;  1JJC B;  1OSD A;  1RCO B;  1VYA A;  3EGN A;  2DIU A;  2CQC A;  1Q0N A;  4N47 A;  4RUC A;  1FE0 A;  4U67 Q;  4N7T A;  1S79 A;  2R7W A;  3GSD A;  2EKY A;  4CO2 A;  5K14 A;  3TA1 A;  2VUG A;  2BJ8 A;  2UP1 A;  4HKQ A;  2KZM A;  4QWC A;  1UWB B;  2YQ3 A;  2AKW B;  1TL5 A;  4FPR A;  2V4Q A;  3R1L A;  4NXN J;  1WTF A;  5A2Q U;  1MRO B;  5K8O A;  1I94 F;  1Y7P A;  1D9F A;  3PW2 A;  4B3T F;  1JLF A;  3TR5 A;  1XN9 A;  3NP5 A;  3M6X A;  2MGZ B;  1XR7 A;  5LSR A;  2GVZ B;  2HPU A;  4IO9 Q;  4PQU B;  3Q83 A;  1NDC A;  4A8Q A;  2IBK A;  4TU9 A;  3PX6 A;  1NSK L;  3IWL A;  3HX9 A;  3LPE A;  5ADZ A;  3OVS A;  2ZBR A;  1K9M T;  2KN4 A;  1VQL S;  1HD0 A;  2GQ2 A;  4LRA A;  4YR3 A;  1X4E A;  2D41 A;  4L3N A;  4CLY A;  3FSI A;  4IRC A;  2QZ8 A;  5MAO A;  3TZW A;  1UEV A;  1FX4 A;  1J27 A;  1KBR A;  2R42 A;  4DX6 A;  2MZJ A;  3UNG C;  1DFD A;  4NML A;  2E66 A;  3KXD A;  4LRC A;  3PKY A;  4ECW A;  2NRE A;  2ZH4 A;  4IDK B;  5GMD A;  2M3D A;  4YEA A;  3R97 A;  4AE5 A;  1FNX H;  4BBY A;  3KG0 A;  5JUM A;  2C2K B;  3QLH A;  2E1M C;  2NYI A;  3V81 A;  3HZG A;  2XO6 A;  2AJ0 A;  3AQP A;  2WVC A;  4DEZ A;  1NHU A;  2FVS A;  1W7W A;  1UZD A;  1XK8 A;  2GIF A;  3HHL D;  4HL9 A;  4B9M A;  3D6F B;  3PW7 A;  3ILI A;  4FZV A;  4P73 A;  1S4E A;  3D54 A;  4P6Q A;  2QG9 B;  1RTH B;  2B9E A;  4ZJO A;  4FP9 A;  3KLF B;  4ZVH A;  5A8W A;  1CJT A;  3GFZ A;  2OHD A;  1EAY C;  3WC2 A;  2AMC B;  1Y10 A;  2ZZT A;  3C15 A;  5C5J A;  2Z2M A;  4A8K A;  4C8N A;  2QLX A;  3KJV B;  1PO6 A;  1FJG J;  4ED1 A;  1WTB A;  5D0R A;  2HHV A;  3US5 A;  5CYQ A;  5EN1 A;  3SZ2 A;  4AQY J;  3DRS A;  5J2M A;  3IO1 A;  4IG0 A;  3V5R A;  5KFS A;  1FXL A;  3SCL E;  2KI2 A;  3M6V A;  3N5B A;  2Q6C A;  2YKN A;  2MQM A;  3AH6 A;  3ETM A;  1C4C A;  2FB0 A;  1EX8 A;  2ZBP A;  3NWG A;  1BUX A;  4DX5 A;  4LFC F;  1G1X A;  3FKB A;  3CJ3 A;  2PN6 A;  1RA7 A;  5DQH A;  1HL6 A;  2VA2 A;  4IR1 A;  1V3S A;  1HWI A;  1KHV A;  1N54 B;  4RW7 B;  4J9P A;  1U45 A;  2B5J B;  3T5H A;  5H9F K;  4ZPA A;  2VG7 B;  4I67 A;  1I94 J;  2JFK A;  2ZH2 A;  2HYI B;  3BQ2 A;  1NSA A;  2IC3 A;  4ETZ A;  1JJ4 A;  4R0J A;  4TY8 B;  3S6E A;  5FDL A;  3D1O A;  1SV5 B;  2LQ8 A;  1C4A A;  2ZH5 A;  3FFI A;  4YDD B;  3S8S A;  4WZM A;  1RLD A;  3Q8U A;  1F9E B;  2ZC4 A;  3MEC A;  1S1X B;  1X4G A;  1UWA A;  1EJ7 L;  4FXW A;  2UUB F;  2RRA A;  2R7V A;  1BQX A;  1V3Z A;  1WG5 A;  4O23 A;  5HP1 A;  3O2I A;  2IY5 B;  2C2D A;  4ED5 A;  4LIW A;  3BO2 A;  8AT1 B;  2JDJ A;  2BKN A;  1NDP A;  3FQL A;  1YQH A;  1XIQ A;  2BZ2 A;  4TLQ A;  2PMZ D;  3HHL C;  4ZHR A;  4NXM F;  1DRZ A;  3D66 A;  1T05 A;  4RPF A;  4NA1 A;  2FC9 A;  1RKI A;  2FVC A;  4Y2A A;  4GC7 A;  4HT7 A;  4PKD B;  2CZ4 A;  2DB1 A;  1R0B G;  2RUS A;  5KT2 A;  1RIS A;  1GMU A;  5GAH U;  1SC3 B;  4HTI A;  4TLR A;  3BO3 A;  3SQG B;  4KC5 A;  2HVE A;  5A8R B;  2VDH A;  4KV8 B;  2AGO A;  1NJZ A;  1H2V Z;  1CS4 B;  1HNV A;  1XNQ F;  2OFG X;  1PG5 B;  2RE1 A;  2BYC A;  2VON A;  2KJV A;  3POT A;  3CIZ A;  5F3Z A;  1MMN A;  2VC1 A;  3D3C J;  2WB4 A;  3QAE A;  2RRN A;  1QY7 A;  2L3M A;  2VFT A;  1FRK A;  3GFH A;  2QX0 A;  1G4C A;  5J2N A;  2MLZ A;  5H9E J;  1S9E A;  4LF9 F;  2J0W A;  1D09 B;  1YJV A;  3HI9 A;  3L4B C;  3TYT A;  1VBX A;  3MUV P;  3PXG a;  1V6H A;  1R89 A;  1KON A;  5D6G A;  2C2N A;  3UCG A;  3VTI A;  1IKY B;  2VPZ B;  3DN9 A;  4IRK A;  1TV6 B;  3K5M A;  2UUC J;  2L9D A;  2R2T A;  1H73 A;  2K1R A;  2BVZ A;  1HAR A;  2VFR A;  3BBF A;  4ILM A;  2XWY A;  3MCM A;  1T0T V;  3P96 A;  5D8H B;  1PJ6 A;  5HBM A;  4DPW A;  2R8G A;  2CZ9 A;  1QTN B;  2A1B A;  2XYG B;  3A8J A;  3BR8 A;  3QID A;  4PG6 A;  2KG1 A;  1N32 F;  5KFA A;  1SC1 B;  1WI6 A;  2ZJR Q;  2V69 A;  3SQG A;  4P74 A;  2XS7 A;  3G71 S;  2BJ9 A;  3CF5 Q;  1RTH A;  2FIU A;  4DS5 A;  5HMZ A;  4DU8 A;  5K20 B;  1RBO B;  4TU8 A;  2R8K A;  2PDA A;  3KYL A;  2KFZ A;  2HQ3 A;  2O66 A;  3SEO A;  4BWJ A;  3TEH B;  3WC0 A;  5GAE I;  5I3U B;  2MQO A;  2Y0S D;  4RZR A;  2VHG A;  5HJY A;  4ZP7 A;  4ED3 A;  2EG2 A;  2YKO A;  4RNF A;  2OPP A;  5HLF A;  1JXL A;  4X4N A;  2IM3 A;  2PE8 A;  4IH6 A;  4F4X A;  2AGP A;  5IQQ A;  3HKZ D;  1NBE B;  1CC8 A;  3M2U A;  3BDE A;  3K89 A;  4AYB D;  2DO4 A;  1S4F A;  2UV8 G;  3MEC B;  2XO7 A;  5KFG A;  4WFY A;  3H5Y A;  5CXT A;  2OIH A;  3CCU S;  4IYQ A;  2MQP A;  1SV5 A;  3I56 S;  1BGX T;  3T1H F;  4Y3C A;  4IOB A;  4M5D B;  4PXD A;  2K7J A;  2Z56 B;  1NEE A;  3ISN C;  3QJJ A;  2OPQ B;  4UOH A;  1DJ0 A;  2FHM A;  4AUK A;  4DU7 A;  1N33 F;  3OT9 A;  4X4U A;  1FER A;  4ZCK A;  1DAX A;  3OXL A;  3AB4 B;  4KE5 A;  2HQF A;  3JAM U;  2XY5 A;  4RW9 A;  1UJ5 A;  3UDV A;  3MM7 B;  3UCU P;  2YWF A;  5IM0 A;  3BYR A;  2ZWO A;  3DRP B;  3SXL A;  2DY9 A;  2DXE A;  2MYF A;  1UEK A;  3LP0 B;  3PHE A;  2BAB A;  4ZPT R;  5KFD A;  2BBE A;  1RA6 A;  5E3P A;  3JSM B;  1AW0 A;  2HND A;  4C0H A;  3RR8 A;  1HIY A;  2M9K A;  2AJ1 A;  2MZQ A;  2VPY B;  4USW A;  1G6B A;  3FK4 A;  4AXJ A;  1S7I A;  1M5H A;  1ROF A;  4K4S A;  3ZZR A;  1OIA A;  3H20 A;  2HVI A;  2O3D A;  2XC9 A;  1S1V A;  2ILY A;  3A8K A;  5D4L A;  1AB8 A;  3U7J A;  3VVU A;  4EU0 A;  1PYT A;  1KD1 T;  1R6Y A;  1JLQ B;  4M63 A;  3E3X A;  4K4X A;  2PEH A;  4DL6 A;  1BWV A;  2Z4P A;  4ZPC A;  4BHQ A;  2HAI A;  1T9Y A;  2FQQ B;  3D0G E;  4FXD A;  3AOC A;  1D8Z A;  1FO1 A;  3W2V A;  1HI1 A;  2EK6 A;  2C2M B;  1W2I A;  4J9Q A;  5AXK A;  2RF2 B;  3VQT A;  5KFE A;  1C0U B;  2CJA A;  3CMQ A;  2VG5 A;  2Y1L B;  4TKT A;  3BSO A;  3DGV A;  4Q44 A;  2BV3 A;  4LBI A;  4DJB A;  2IMW P;  1AFI A;  1FJC A;  1JQG A;  4RNN A;  2D3O 1;  3QO9 B;  2HRT A;  2H1Y A;  1R6V A;  4CNY A;  1RYS A;  2QV6 A;  4IG3 B;  3W64 A;  2CPI A;  2FHK A;  3QT5 A;  3NBP B;  4MK9 A;  4MYT A;  1YKW A;  4NYO A;  3T41 A;  1GQE A;  5B0D A;  4DG1 A;  2RML A;  4LSL B;  4LBH A;  1PJ5 A;  4M5I A;  2CG8 A;  3J7A 1;  3A3N B;  4CO1 A;  2H51 B;  3HFK A;  3EZO A;  2G9O A;  3S7R A;  1LWE A;  1N5S A;  3HDS A;  3CME S;  4LFA F;  3R2C J;  2RDI A;  3MEG B;  3D0I E;  3I9Z A;  4KSE B;  3MAQ A;  3H4D A;  1CUL A;  5F41 A;  2JVR A;  3VHQ A;  2ALZ A;  3JQM A;  2AJ2 A;  2HUR A;  2M2B A;  1X4B A;  2IDL A;  3DI6 A;  2CPJ A;  1N5T A;  3ZXW A;  1VBZ A;  2Z2Z A;  4WU2 A;  1Y5N B;  4ZIV A;  4QW9 A;  3M8S A;  1WOR A;  5KFZ A;  3RAX A;  1X9W A;  2G4B A;  2OFH X;  5B0F A;  2XYH B;  2H5E A;  2GVD B;  2YWW A;  2LEB A;  4CTA A;  4URQ U;  3QJP A;  1UFW A;  4IFY A;  2VG5 B;  3PDN A;  4DQS A;  1UEU A;  5HLF B;  1NAQ A;  1KRP A;  1TL3 B;  1SJF A;  3MUR P;  2HGN A;  2FJD B;  2EBG A;  3MUM P;  3AJ1 A;  2GJ2 A;  3UN2 A;  1D1U A;  3GV7 B;  4KJI A;  1FEE A;  3IC1 A;  5LOQ A;  4WWS A;  2E5J A;  4NLT A;  4RU9 A;  2NSB A;  1U1L A;  4H54 A;  3ZTQ A;  1NHK L;  4IFV B;  2BW7 A;  1S6Q B;  1TQL A;  2FLL A;  1XWL A;  2MEW A;  3BGU A;  3MPD A;  4O3Q A;  5D0H A;  2IJN A;  3MFH A;  1ZM9 A;  3EVO A;  3O1L A;  4WFB Q;  1F3V A;  1JKH B;  2ZE2 A;  2DIT A;  5IFM A;  1HWK A;  4DL3 A;  5D3G A;  3GYX B;  1SBR A;  4ANC A;  1JLE B;  1M5S A;  3N6L A;  2W2Q P;  3NEK A;  1NHV A;  5D78 A;  1HNX J;  3MTJ A;  2VBX A;  4S0M A;  3UN3 A;  3DRP A;  4JOU A;  2WTF A;  2BE7 D;  2BAN B;  3GCW P;  4DV1 F;  2R7O A;  4WZQ A;  2UUT A;  5FLX U;  4DI6 A;  2ZOF A;  4OV1 A;  1HHQ A;  3MOJ B;  5F9N A;  5KT5 A;  1E6Y A;  3L7P A;  1TUW A;  5GAG U;  4JI6 J;  1JB0 C;  3JS9 A;  4IQX A;  5KFY A;  4WK3 A;  4Z37 A;  4JB8 B;  4IH7 A;  3M9M B;  1HBN A;  2MQ8 A;  1B0V A;  1TZ0 A;  1WD6 A;  4NCG B;  4ZOS A;  4MJK A;  5IT4 A;  3DDN A;  1V9O A;  3SMZ A;  1E6V A;  1YDL A;  4KGV B;  3CJR A;  2GIQ A;  3IP0 A;  4MH8 A;  5IS2 A;  4X4R A;  4DCO B;  3KHH A;  3LAL A;  2F4F A;  1UPP A;  3W9I A;  5KFC A;  1QD1 A;  1S9F A;  5DGA A;  3G82 B;  2GW8 A;  5F8J A;  2CVE A;  2IFX A;  3HZE A;  2HK2 A;  4RUA A;  1JJ2 R;  4WCE Q;  4A8Y A;  1U1P A;  3I4P A;  4LRD A;  4HI2 A;  3PNI A;  2WW4 A;  5B0B A;  4FF4 A;  2VAS A;  2WSE C;  2JWN A;  5LM7 E;  2ZHA A;  3PY8 A;  1KN6 A;  4DR3 J;  3NOC A;  3KK1 A;  3RAQ A;  4IH5 A;  2P6T A;  3BKU A;  2XNQ A;  1R8P A;  2E1R A;  1QM9 A;  4KFB A;  2HWI A;  5KFT A;  4USI A;  4DV3 F;  3DYA A;  2ZBI A;  1ZAX A;  2RDD A;  1W26 A;  3DC2 A;  3DDK A;  5GAH I;  1X60 A;  4WP8 A;  1UP1 A;  2ACM A;  2VF3 A;  2PEB A;  4CIO A;  4O44 A;  4J9S A;  2L9W A;  2HK3 A;  4FVC A;  5KT7 A;  4M5J A;  1TR0 A;  3KLG A;  2LQ9 A;  4LR7 A;  3HVR A;  1JLG A;  2UXD F;  1PSD A;  3FEY B;  1J5E F;  2EFN A;  2VG6 A;  2LP4 A;  1CQN A;  1F9H A;  5C42 B;  4LF5 J;  2UXB F;  1KKH A;  3ZO7 A;  4W90 B;  2K7K A;  2CNO B;  3EGV A;  3IWN C;  5K8N A;  4QYZ K;  4LSL A;  1TUG B;  2CPD A;  3Q8Y A;  4J90 A;  1G3O A;  4GKJ F;  2GC8 A;  1RB0 A;  4ZLL A;  2D1C A;  3H2V E;  4KRW A;  3PYD A;  2VOP A;  2KVQ E;  5DM6 Q;  4DCJ B;  3BEG B;  2AV5 A;  3NMA A;  1N0V C;  2HVH A;  1T95 A;  1Q95 G;  4OZ3 A;  1RAD B;  1VC6 A;  2XHC A;  1RT1 A;  4E2F B;  2FJX A;  3G8T A;  1RBA A;  2GGP A;  4JI6 F;  3OLA A;  5CYQ B;  2KRR A;  2HZV A;  2DNZ A;  1SUQ A;  1TKX A;  1TTH B;  3T1Y F;  4M5N A;  3HXM A;  1Q86 T;  4DN9 A;  1EP4 B;  5F8G A;  1HQE A;  2EXU A;  3D2W A;  1PYO B;  2ZVS A;  3TVY A;  3DDI A;  2BR0 A;  1CJT B;  2CQI A;  3PRV A;  3VAJ A;  2XEX A;  5J1E A;  4PRF A;  4F4Y A;  4DPT A;  2BJ3 A;  2Q3P A;  3EDQ B;  5JMN A;  1XNR J;  3TJ9 A;  2HQC A;  1MN9 A;  2XZW A;  1ZH5 A;  3HVA A;  4OL8 A;  1WDD A;  3FBC A;  1T9V A;  2F8E X;  2V2Z A;  3DLG A;  3A12 A;  3F0N A;  1V5I B;  3MEG A;  3WX8 A;  2UVU A;  3BH7 B;  2RIL A;  3CB4 A;  1U4B A;  2DBB A;  1IJE B;  1DUR A;  2J7K A;  1HPZ B;  1K1Q A;  2MJN A;  1NB2 A;  1U25 A;  2VH7 A;  3G87 A;  4HHU A;  2HQD A;  2Y1R I;  3QT7 A;  3C15 B;  2BJD A;  3CCZ A;  4Y2I A;  2I9S A;  1JLC A;  3J7Z T;  1KQS R;  3Q8Q B;  5CYM B;  4AFF A;  1XMQ J;  4E8U A;  5DDP C;  3UD5 A;  2DNR A;  2LU1 A;  1HWU A;  1NND A;  3MOZ A;  2RHQ B;  4USM A;  1S72 S;  2ZZN A;  3QJL A;  4K4U A;  3CGI A;  3HLU A;  1ZTW A;  1JWW A;  4QWE A;  1OQ3 A;  3RZA A;  1RT6 A;  5GME A;  1KQG B;  3PRD A;  2E5G A;  3CC7 S;  1D9A A;  3BSN A;  4DR1 F;  2HHH J;  5A6P A;  4HDH A;  1KLM B;  1JK9 B;  3OJU A;  3KTQ A;  5A8K B;  2ZKT A;  3MUT P;  4P2X A;  4A8S A;  4NMX A;  3C66 A;  3GWC A;  3T19 A;  3ENV A;  4LF8 F;  3MM6 A;  3OSN A;  1Q16 B;  4A8W A;  4LF4 F;  3A1Y G;  2FHJ A;  1QJH A;  1RXO B;  2UZA A;  5MLC V;  3GON A;  1UPM B;  2VKZ G;  1RLC L;  4GVB B;  1EQM A;  2EEY A;  3P5B P;  4MK8 A;  2D3O R;  2FLN A;  4ILL A;  2V8G A;  4ZP6 A;  1RK8 A;  3GE9 A;  1HPZ A;  2BMB A;  2XM3 A;  3G8S A;  3AJ2 A;  3I4H X;  3OFG A;  1U7L A;  3OL7 A;  3Q24 A;  1JLB A;  4LIR A;  2O67 A;  3A13 A;  4YB5 A;  5GAG I;  2MZ1 A;  2GHP A;  5D0G A;  1LW0 A;  2L9N A;  2NLW A;  1Q81 T;  2CQ3 A;  4DX7 A;  5BXI A;  4EBE A;  3R2D J;  1ZYQ A;  3PKM A;  2J9D E;  2BE2 A;  2HRY A;  1WI8 A;  2BAC A;  3VGT A;  1QUP A;  3GG0 A;  4F26 A;  4F4Z A;  1H2U X;  5DM7 Q;  1YJW S;  4ZVG A;  2M0G B;  3VQS A;  3OTC A;  4URG A;  4X64 J;  4CP5 A;  2UVR A;  4PWD A;  2B4V A;  1X8D A;  1Q5Y A;  4WF9 Q;  1VIX A;  1Z2Z A;  1H3D A;  3MWB A;  4W4M A;  2OEK A;  1XTZ A;  3IG1 A;  1B70 B;  3TAR A;  3JB9 k;  1ZAV A;  2JH3 A;  2GA7 A;  2F8H A;  4LSZ B;  5ITH A;  3NGD A;  1VQS A;  1EIY B;  2FVP A;  5KFK A;  4G65 A;  3IFE A;  2D69 A;  1UTA A;  2ZUA A;  4IOC Q;  2MHN A;  4LUB A;  4ZPD A;  2HZA A;  3WZ0 A;  3CJ2 A;  7FDR A;  1XMQ F;  3TUZ C;  2V4J A;  5LMU F;  1WKJ A;  2UUA J;  1SH0 A;  4DQQ A;  2CAD A;  3QIP B;  2AF6 A;  3M2U B;  1DHM A;  1WSV A;  1ULR A;  3CT9 A;  3EMT A;  3R6L B;  2ZM6 J;  4KPY A;  1F1B B;  2XYP B;  4C0O C;  2OPS B;  3MXH P;  4P7V A;  2RU9 A;  3I0R A;  4M94 A;  4H4K A;  4ED4 A;  5JVG Q;  4M5L A;  5L38 A;  2IA0 A;  1N52 B;  2I5J B;  1R8A A;  3OTE A;  4R5P B;  4DQR A;  4QYR A;  2APO A;  1KEK A;  4Y2M A;  1LW0 B;  3OXF A;  3PYG A;  2XG8 A;  2YX1 A;  2Z8Q A;  4YME A;  1PBU A;  4CTA B;  3N5F A;  4I69 A;  4NLS A;  1XMO J;  3SSS A;  3ONQ A;  3VAK A;  2YKQ A;  3B54 A;  4QCL A;  2XMT A;  5ETR A;  4ES2 A;  2DRD A;  4USV A;  5M2R A;  4ID5 B;  1KVK A;  4RBT A;  4YB6 A;  4KQZ A;  3M05 A;  3TW0 A;  5A2Q Y;  3OTD A;  3NCQ A;  5K9F A;  3BGO P;  2DHS A;  3SYZ A;  3DOK B;  4ES3 A;  3M8R A;  3TNV A;  4ECT A;  3IS9 B;  2V50 A;  1RBL A;  2QLJ B;  1UVN A;  1M1H A;  3RGI A;  2PO4 A;  1F3F A;  1J2V A;  1GEH A;  2BKP A;  2P9G A;  3R5C A;  4DZ6 A;  4F3Q A;  3GII A;  2OEJ A;  1H7X A;  2GML A;  2KTQ A;  4CH0 S;  5KOX A;  4M5D A;  4ECQ A;  2K8G A;  1AUS L;  2MY7 A;  2MZS A;  4NLR A;  4F67 A;  2W7O A;  1UA0 A;  1QLN A;  2CIM A;  3OD2 A;  2KB2 A;  3QFW A;  2NZC A;  5LXY A;  2I6W A;  2IM1 A;  2ZZM A;  3DU6 A;  4RNH A;  3DRX A;  4A8O A;  3CCE S;  2B8P A;  5L1K A;  1H7W A;  4ECY A;  3O44 A;  1TFY A;  5D4P A;  4IUF A;  1RWW B;  2EC0 A;  4PWU A;  3NNH A;  2XMU A;  1ZM4 A;  1UKU A;  2HQG A;  3IGN A;  4XDD A;  4MMO A;  2D3U A;  3VCD A;  3KLF A;  1NK7 A;  2FJV A;  3DLL Q;  1URN A;  4OI4 A;  3OL9 A;  3KG1 A;  4ETX A;  4QZV B;  5A0Y A;  2CQ1 A;  3MAA A;  2GCF A;  2HFS A;  4K4Y A;  5HP1 B;  3DMJ B;  3ET6 B;  3WX4 A;  4DUZ F;  1IBL F;  4JI5 J;  1FDD A;  4FNI A;  4B3O A;  2J0Q D;  1X4F A;  1I5O B;  1PCA A;  2HZC A;  3THT A;  1ZA2 B;  1U48 A;  3M8P A;  4U9R A;  1YG0 A;  1U1N A;  1M90 T;  1NJI T;  4Z7C A;  1R27 B;  2B7C B;  4RW4 B;  3MCO A;  1Z4U A;  2EVZ A;  3SFU A;  1DAR A;  2V63 A;  2KFN A;  4TYA A;  3GZ7 A;  3SI8 A;  4Y0F A;  1SQF A;  2DGV A;  3CD7 A;  4ZP8 A;  3OUY B;  1NCL A;  1A9N B;  3ILL A;  3QO9 A;  4KIA A;  3V2U C;  1JNZ B;  2XY7 A;  1NKC A;  2R7T A;  3FBF A;  1P1T A;  2EFG A;  3V81 B;  1FD8 A;  4EZ9 A;  3SDE A;  3NS5 A;  2CJK A;  4ZJQ A;  1XMB A;  5IT9 U;  3W2W A;  3T5K A;  5IWA F;  1NRK A;  2YNI A;  4B9S A;  2IM0 A;  2WW8 A;  3LAM A;  5J2N B;  3UNY A;  3OHB A;  1YJ7 A;  3TRG A;  2MKK A;  1Q7Y T;  4I7F A;  1UW9 A;  2RJZ A;  2VC0 A;  1CJV B;  2QA1 A;  2UXC F;  2CQH A;  2G0J A;  3EX7 B;  2H5I B;  1UVJ A;  4YY3 F;  2Y1J A;  1NZ8 A;  3TAM A;  2NSC A;  3N01 A;  2R2R A;  3FDS A;  2N3L A;  2YY3 A;  3BS9 A;  4F2S A;  2YPY A;  5KT6 A;  4ICL B;  1BQN A;  2C3O A;  3ET6 A;  4LVN P;  3V4I A;  3DOK A;  4JYA F;  1IKW A;  1REG X;  4GKK F;  1NSQ A;  2WCX A;  2LDY A;  4DFM A;  4Y2K A;  4EZ6 A;  2MQQ A;  1JLE A;  3VAI A;  2XZT B;  2CJB A;  2Y8W A;  3WIU A;  5DLF A;  3FVY A;  4FS2 A;  4JI4 J;  4KAI A;  4DV1 J;  3CSK A;  2D74 B;  4C4W A;  4MFB B;  3GCX P;  2XUL A;  3MZI A;  3H42 A;  3M9N B;  2PI5 A;  2DH8 A;  1S5Z A;  2I1R A;  3GTY X;  1FFG B;  2NUH A;  1KLN A;  3UI3 A;  1TMM A;  3DHX A;  3EVM A;  2HLT A;  4FN5 A;  2GAH C;  4ZN3 A;  3MR2 A;  1S1U B;  2IRY A;  3WQP A;  4OI0 A;  1NPK A;  3CJ5 A;  3U1M A;  2NXN A;  4EGL A;  4L76 A;  4OJ3 A;  1U02 A;  4DR4 F;  3KLI A;  5ETT A;  2FGC A;  1NUE A;  1MWQ A;  3MMA B;  3MPY A;  4CDI A;  4OIX A;  4J9N A;  5CD4 H;  2DGO A;  3CVK A;  5G0R B;  4MKV A;  4QWD A;  2V2K A;  2B4U A;  3PV8 A;  4N41 A;  4DSL A;  5KFN A;  2VA3 A;  5A0Y B;  2X7I A;  3BO4 A;  2GMH A;  4CCH A;  3I9V 9;  3OFH A;  5J2Q B;  5BR8 J;  4Q43 A;  4IR9 A;  2E9T A;  5KFI A;  1EKR A;  4NXM J;  3NNC A;  2F40 A;  4X4T A;  3MM5 B;  5AXM A;  1RU2 A;  1FXR A;  2HWH A;  1XR6 A;  3K17 A;  3R5G A;  5DZ6 A;  3OPK A;  5E3C A;  2XMJ A;  1IQT A;  1M5V C;  2FHO B;  4KFB B;  1FTC A;  2X51 A;  1VK3 A;  1IQZ A;  4CH7 A;  3ZTP A;  1U0H B;  3BGL A;  4C7Q A;  1SXL A;  1VRU B;  1C0T B;  5C25 B;  1RI7 A;  3H5U A;  5C24 B;  2DCL A;  2GO9 A;  2X1G A;  4O3P A;  5CCL A;  3TO8 A;  1YBA A;  4TU7 A;  2M88 A;  2KM8 B;  2R8I A;  3M8Y A;  3TA0 A;  1XBW A;  3MTK A;  2F4V J;  3GPA A;  4FYD A;  4J9U E;  1FJG F;  1KQK A;  3W9H A;  3P4U B;  3LF0 A;  4X66 F;  4QWA A;  3K2Y A;  2DVI A;  2G13 A;  4Z2X A;  1IR0 A;  5G4D A;  2OML A;  4OZJ A;  1FDA A;  2YBV A;  3HD1 A;  4Y65 A;  2QT7 A;  4F36 A;  2UUC F;  4KGK A;  3D1H A;  5HMW A;  3J7Z 5;  3QGP A;  1TEL A;  2LFV A;  4JV1 A;  4WTO B;  3X1L B;  4NI2 A;  3QWP A;  4ZP9 A;  3MR3 A;  1RWU A;  2A0F B;  5EGY A;  1AYE A;  3RRK A;  3HJV A;  3H40 A;  3NGT A;  1GT8 A;  1Z2L A;  2FZK B;  2KT3 A;  3PJX A;  4PUO B;  3FZ2 A;  3HP6 A;  1IJF B;  2ZWP A;  2IIH A;  5DS7 A;  1N8R T;  4G1Q A;  4QYZ J;  2R9L A;  4PYA A;  5F8M A;  3AA9 A;  3PW0 A;  2DHH A;  1O51 A;  2MKC A;  1BC6 A;  1M5P C;  1FJ7 A;  2MZT A;  2KXF A;  4CLZ A;  2FJW A;  1MLA A;  3ZZT A;  3PR4 A;  4IG3 A;  1X9M A;  3R1H A;  4QIE A;  2DKO B;  1DTT A;  1CJK A;  1LWE B;  5FD1 A;  1HQU B;  3D0H E;  2JNJ A;  5KFU A;  2H54 B;  5KT4 A;  4KHR A;  4DL0 C;  2DRA A;  1N6Q B;  1RSC A;  4LF9 J;  4DZD A;  2HW3 A;  2VD3 A;  4G1P A;  2BQR A;  2LYV A;  1WJ9 A;  2RAQ A;  2VL1 A;  3IR6 B;  4Y28 C;  3UPF A;  2ZJP Q;  4X4O A;  4GKK J;  4AXI A;  2OSQ A;  3UVJ B;  1UVM A;  2KHC A;  5CA5 A;  4URS A;  4X4P A;  3BGF A;  5L1J A;  4C48 A;  2ZDO A;  3D4J A;  3VGV A;  2FZG B;  2YWE A;  1U6F A;  1B64 A;  4C11 A;  2JEG A;  3NLC A;  1MNE A;  3GQC A;  1ZZN A;  5KFF A;  2ATL A;  1RYR A;  2CPF A;  5GAD I;  2PFF B;  3W5X A;  3H5S A;  1L5U A;  2F4V F;  4IQM A;  1RWP B;  2H4Y B;  4YOE A;  2B7B B;  3V4M A;  4YR0 A;  1S9G B;  4A47 A;  3DU5 A;  4YS2 A;  8RUC A;  2M8H A;  1HW9 A;  2FY1 A;  4QPX A;  3HFV A;  3JSM A;  2KJW A;  1GXU A;  2V9K A;  2ROG A;  2HBQ B;  4IOA Q;  2HHT A;  4B9U A;  4O0N A;  1KFS A;  3PO4 A;  1RCX B;  2I38 A;  3AOB A;  2VDI A;  5E0O A;  1FK9 A;  3DCA A;  2HHW A;  1L3T A;  5AE2 A;  3CCQ S;  1RT5 B;  1PAE X;  5L9N A;  4W92 B;  3U02 A;  1TKT B;  1OY8 A;  4DPU A;  2NPI A;  3RUB L;  3T1Y J;  1W25 A;  2YNF A;  2I5J A;  1RWV B;  2W25 A;  3HHE A;  4J5O A;  2E5L J;  3TQ1 A;  1BQM B;  1S10 A;  2H5J B;  1RDR A;  4L6V 3;  2ERR A;  1OS5 A;  1JLB B;  2LQB A;  2CUY A;  2DPJ A;  4YFU A;  5EHH A;  3J7A N;  2AYE A;  4ZCI A;  1OPI A;  3EGZ A;  4I1T A;  4M8L A;  1L3U A;  5GMK a;  2DNL A;  3K8V A;  3PIO Q;  4WE1 B;  5CAA A;  3KLH A;  4GVB A;  2OEL A;  4YP3 A;  1JMT A;  2X1A A;  4J9L A;  1P8G A;  1U1M A;  3L09 A;  1LWX A;  2J8S A;  1PBA A;  2HS0 A;  1URR A;  3ZZ0 A;  6FDR A;  4KHP J;  5IT9 Y;  2ZC3 A;  4FBU A;  4WPA A;  2HEK A;  3MM6 B;  1TL3 A;  1DZ5 A;  4JV2 A;  3M8Q B;  1YLX A;  3TOQ A;  4OYM A;  3RB0 A;  1PGZ A;  1XQI A;  3D1Q A;  1JJH A;  1VQ6 S;  1LKZ A;  4B9L A;  1HNV B;  2F9J A;  2GQC A;  3R5B A;  3O5T B;  2ZM6 F;  3UD3 P;  2UUB J;  2C2O B;  5E41 A;  3T6B A;  2A6O A;  1HQU A;  1IKV A;  2HBR B;  4L75 A;  3C6T A;  1VDH A;  1RZM A;  2AD9 A;  2WVD A;  4QR0 A;  3MM5 A;  3W7B A;  4RW8 A;  4KR0 B;  4OZ5 A;  2E7V A;  4R5P A;  5KFO A;  3F41 A;  2RQM A;  4U7C A;  4WFX A;  3HHL A;  4DV3 J;  4B9T A;  1FKO B;  1Q7L B;  2IRU A;  3D6H B;  5FJ4 A;  1TV6 A;  4KBI A;  5CD4 A;  2JLE A;  3DHW C;  5HVG A;  4N5S A;  3KK1 B;  1BHN A;  3F44 A;  2J6U A;  2XZD B;  4UT4 A;  2CKW A;  3LW5 C;  3BDP A;  5F8H A;  1WC0 A;  3LA0 A;  2XCP A;  3K59 A;  1U1R A;  4O3R A;  2KKH A;  4Q8F A;  4L3K A;  5D15 A;  2HNZ B;  1QE1 B;  2CPE A;  2ABY A;  5DO2 A;  4LF2 A;  4EO6 A;  1KR4 A;  4G1Q B;  1LFP A;  4ED7 A;  1REV B;  3GJS B;  3BH6 B;  4NRT A;  1VQ9 S;  3C19 A;  4WII A;  1F5A A;  4H4M A;  2J76 E;  4F0M A;  4AQY F;  5B0C A;  3H5X A;  5KT3 A;  4J9K A;  4JI3 F;  1U2C A;  1U8S A;  1QVF R;  1FES A;  2XSF A;  3HD2 A;  3QAU A;  2OMO A;  4V1A k;  4C8L A;  1PYS B;  3R9L A;  2MKH A;  1VHI A;  2IPO B;  3CCW A;  4KB7 A;  5EX3 A;  2F5G A;  3TZY A;  3G6E S;  2HFV A;  2E9R X;  1WHV A;  1FE4 A;  3DLE B;  2YQ0 A;  1HKA A;  2ZOG A;  2ZHO A;  2Y3Y A;  2G1D A;  2PGC A;  1Q8K A;  5A6W A;  1QVG R;  1YRT A;  2JHE A;  1SL2 A;  3LUY A;  3DYA B;  1YZ7 A;  1RT7 A;  3CJK B;  5A8R A;  1RHU B;  2V4R A;  4USU A;  3GJT B;  4FYY B;  1HNX F;  5DG9 A;  1RJJ A;  4P72 A;  4ZVO B;  2OPP B;  4OX9 F;  1Q5V A;  3ULH A;  2EK1 A;  2I2Y A;  4FF3 A;  1A0O B;  1MN7 A;  3ETO A;  2ZOM A;  3MCN A;  2VG6 B;  2FVQ A;  3DLG B;  3K5O A;  3AD9 C;  1BWE A;  1S1T B;  3FBE A;  2LXF A;  4LSN B;  1SIW B;  3C8Y A;  2XB2 D;  1OY6 A;  1FNM A;  1R3N A;  3KKF A;  4TY8 A;  5KG7 A;  2GHV C;  1N0U A;  3L95 X;  3MM7 A;  1U24 A;  5DG8 A;  3HVT A;  4KKO A;  5B08 A;  2HRU A;  4NEY A;  4KGM A;  3VAG A;  1YIJ S;  3HK2 A;  2HMI B;  2FDN A;  4HEA 9;  4PG8 A;  1CPZ A;  5DGB A;  2C3Y A;  4RX6 A;  5KFQ A;  5E5N A;  4PG5 A;  3E51 A;  4X65 F;  4ID8 A;  1LW2 B;  4DV4 F;  5EX0 A;  3RJM B;  2HHS A;  1BY9 A;  2ZVI A;  1C1B B;  1LWF A;  2ACY A;  3B4M A;  1GFW B;  3KLE A;  1NJW A;  4NXN F;  1WWH A;  1DQA A;  1FKP A;  2DXF A;  2KT2 A;  2QFI A;  1RAB B;  1GNK A;  2GIR A;  2QA2 A;  4USK A;  4CZC A;  5AJ3 J;  2B8Q A;  4UW2 A;  4NLD A;  3TX8 A;  5C2G A;  4RWX A;  5ETV A;  1OYE A;  1YX2 A;  4KT0 C;  5ETQ A;  4B3O B;  4F4K A;  2KZZ A;  4WXO A;  2V5H G;  1EHW A;  2NCK L;  3E8O A;  4PG7 A;  2AJQ A;  3GG1 A;  3KUE A;  4XPE A;  1VIS A;  5C24 A;  1HW8 A;  4Q2L A;  2NXJ A;  2CVI A;  3OXG A;  3M2V A;  2YPZ A;  4ALZ A;  4AL7 A;  2W2M P;  2ATC B;  1PIE A;  1N4L A;  1B7F A;  1VS3 A;  2E1A A;  4RLE A;  4CLS A;  5GAD U;  3A4T A;  4DF4 A;  3N9U C;  5ETP A;  1TFW A;  3T5J A;  1X31 C;  1WF2 A;  1ZTT A;  3TUJ C;  2MXY A;  2BW2 A;  1VC5 A;  1RTZ A;  3CDE A;  5HVF A;  4LQ3 A;  1RTJ B;  1HNW J;  1VLO A;  2CJY B;  3NBP A;  3OVB A;  4X2B A;  2KRB A;  4MTP A;  4EYH B;  4NE9 C;  1N32 J;  1GH8 A;  4CLP A;  4K59 A;  1X5P A;  2E5H A;  2HVZ A;  4C8Z A;  3JTO A;  1FVQ A;  5ETK A;  2ZBQ A;  3BSA A;  3NY0 A;  2FJA B;  2YWK A;  5IM0 B;  4H4K C;  3QLH B;  2QYG A;  4C9D A;  1IKX A;  2RKI A;  5LL6 d;  4PXB A;  2EKN A;  4ED8 A;  5A8K A;  3SQO P;  3KWM A;  3C14 A;  1NK4 A;  1T03 A;  1WHY A;  3DRR A;  4N8O A;  2CPX A;  2N3O A;  1JLF B;  2AP6 A;  1KC8 T;  1N5Y A;  5IQ6 A;  1N34 F;  4DUZ J;  2MKS A;  4DUY J;  3PZP A;  3PYF A;  2UUA F;  3HCX A;  1P9Y A;  1TL7 B;  4YN3 B;  2R7R A;  3GV8 B;  1T9U A;  2GAG C;  4YUD A;  3K58 A;  4M95 A;  5KTQ A;  2GO8 A;  2HNZ A;  1SJQ A;  2VG7 A;  3PTW A;  4OLP A;  4QOT A;  4O3O A;  4JV5 F;  1N48 A;  1C2P A;  5DLG A;  4DSF A;  2DH7 A;  2W01 A;  5CYM A;  2DD8 S;  3F73 A;  1ZZF A;  3BGR B;  2AW0 A;  1K8A T;  2BM1 A;  3CD5 A;  1IM4 A;  3QSI A;  3A8I A;  2LQJ A;  1UL3 A;  2VB6 A;  1FKO A;  5A8W B;  3BKT A;  1SKW A;  4Q0B B;  2NXC A;  5H1S V;  2WVE A;  3CCM S;  3FGV A;  4PYD A;  5EDW A;  1UJ4 A;  3MD3 A;  2DR7 A;  3W8G A;  2YKA A;  4EWT A;  2Z58 B;  4FVM A;  4DF8 A;  1Q1K A;  1U09 A;  2WOM A;  4NLW A;  1KVI A;  1B99 A;  2J6S A;  1FT8 A;  2QMU B;  3BB5 A;  2YH1 A;  2P8I A;  4FKX A;  4NRU A;  1S0V A;  3T9N A;  1H74 A;  2VFS A;  2DY1 A;  4DG1 B;  5IZH A;  4CI0 B;  4DFP A;  1YTY A;  3MMC B;  2G0I A;  2AHO B;  2RIJ A;  1LWF B;  2EFP A;  5B0A A;  5HAN A;  2R7X A;  3BM7 A;  3UD4 P;  1HA1 A;  2B6A B;  2DHX A;  2FJE B;  5DZ7 A;  4EUV A;  4ZIT A;  4FNH A;  5KFL A;  1CEZ A;  1ACM B;  5HO4 A;  1TK5 A;  3C3L A;  2G0C A;  2IVY A;  3CC4 S;  4LF8 J;  4ZLP A;  3I82 A;  1ZM2 A;  3EDR B;  5D4N A;  4F3M A;  1SL0 A;  3KLI B;  1R8C A;  1S1V B;  2VPX B;  4DUT A;  1NDK A;  1Q82 T;  4K5S A;  3QT8 A;  5CYJ A;  4KKO B;  2DNN A;  1TAQ A;  1CJK B;  2I8E A;  2V8D A;  4R25 A;  3SCJ E;  3Q8R B;  3OTO F;  2ZH1 A;  2YKN B;  4JI2 J;  4UZB A;  3J7Y U;  1XEZ A;  2A2D A;  5KFM A;  3DM2 B;  4KYZ A;  2XMA A;  1RHM B;  2VBZ A;  1S48 A;  4QR1 A;  3FQK A;  3ENW A;  2XI3 A;  2GFF A;  3DLK A;  1O0P A;  2B51 A;  3SSR A;  1S0M A;  4H4O B;  1UJ6 A;  3M32 A;  5F3T A;  2Y9H A;  1WEY A;  4BS2 A;  4LR9 A;  1U1O A;  4PWD B;  3S01 A;  5IV3 A;  3T5L A;  2LU2 A;  2YTC A;  3RR7 A;  4ZVP B;  1RT4 B;  4XO0 A;  2ASJ A;  1S1W A;  3G4S S;  1HMV A;  3R7B B;  4UST A;  4NI2 B;  2UVV A;  3D7S B;  5CZX A;  4HHH A;  2I0X A;  4CO5 A;  3MMB A;  3NCR A;  2W9A A;  2WRM A;  2A18 A;  2DK2 A;  3I87 A;  2MDA A;  2Q66 A;  4OZ2 A;  3SCI E;  3RBZ A;  2W4P A;  4WFZ A;  3JQJ A;  2ZFH A;  1JKH A;  3AOA A;  3MPW A;  1IKY A;  3H25 A;  1RHJ B;  5DDQ C;  3NGU A;  1VBK A;  4M5K A;  4F4W A;  4NLO A;  3W5Y A;  4N8N A;  2AZ3 A;  4WTY A;  3RRH A;  3KMQ A;  2HHU A;  3VGU A;  4DR7 F;  2X1F A;  1ZOT A;  1SH2 A;  1KHW A;  1YGY A;  3V6D B;  2C28 A;  2PC6 A;  1DQ8 A;  3HVW A;  3UDE A;  3W9J A;  2DYA A;  5LJ3 Y;  4DV0 J;  5HQ8 A;  1IBM F;  1YJT A;  4ILR A;  1NU4 A;  4LRB A;  1X4C A;  4O3N A;  5JVH Q;  2HAF A;  2PFD A;  3POT B;  3KK3 A;  4DR2 F;  5H9F J;  4E0D A;  4R0E A;  1HBO B;  2YNG B;  4QQB A;  3RB4 A;  2GS8 A;  2E7X A;  3J81 Y;  4F7V A;  3PEJ A;  4KV8 A;  2QLB B;  1U1K A;  4RW7 A;  5HK4 A;  4NWB A;  2BUN A;  4MIA A;  3SDE B;  4DPO A;  1L3S A;  2RKI B;  2OO4 A;  4KH0 B;  4CO0 A;  4CNZ A;  1XNQ J;  3OQ2 A;  1QAY A;  2OD4 A;  2W2O P;  4Q8E A;  3VF0 B;  1S76 D;  3NNA A;  1L3K A;  4O4R A;  2VQF J;  2UXD J;  2OLW A;  3HSG A;  1LV5 A;  4CRJ A;  1IBK J;  4DL2 A;  5K14 B;  2ZIT A;  2XGP A;  4ECV A;  2EBE A;  2WAQ D;  1F6T A;  1RUS A;  2WHO A;  3OL8 A;  4LF5 F;  1EET B;  3OFE A;  2V8H A;  4FKY A;  1IBC B;  3LP0 A;  5AT1 B;  5IV4 A;  4CWB A;  1UVL A;  1IKW B;  4UY8 T;  5J1E B;  3Q23 A;  1S97 A;  3PJW A;  3HSD A;  3JYT B;  2HBY B;  4NCB A;  3Q86 A;  3KNG A;  4ZJL A;  4C11 B;  1WF0 A;  2HIQ A;  4OI3 A;  2J9C A;  1X4D A;  5KFB A;  4GC6 A;  3AD8 C;  1DQ9 A;  1SJ4 P;  4K0K F;  3D28 A;  2MQL A;  3CW2 C;  5HBM B;  3CUL A;  4LF1 A;  1R0C B;  4DPX A;  4EI2 A;  3M30 B;  2BJE A;  2FJB B;  3M9O B;  1N56 A;  3I5C A;  1XC9 A;  5U47 A;  3C6T B;  2VJV A;  3QMQ A;  5B0E A;  1ICE B;  1KTV A;  2KU7 A;  2MPU A;  5CQG A;  3IN5 A;  4J37 A;  2ROP A;  4DR6 J;  4DR6 F;  4ELT A;  2YNI B;  3DLJ A;  2J5A A;  1RKJ A;  5KG1 A;  3W63 A;  5I3Q A;  3TAQ A;  4KO0 B;  1LNQ A;  1NO8 A;  2MLX A;  3LGH A;  2MQN A;  2N4C A;  5C2C A;  1CJU B;  4I6Y A;  3R7N B;  4OI1 A;  2OTJ S;  2GNK A;  1TU0 B;  1TP7 A;  1YHQ S;  2PI4 A;  2Q1L A;  3G96 A;  4ZVT B;  1K47 A;  4WP9 A;  3LGM A;  5JXS A;  4U7U D;  5K8P A;  3HUL A;  2K3K A;  1WAC A;  4Y2C A;  3UFC X;  4K50 A;  1FTR A;  2YNF B;  5SUH A;  1HBU A;  3U1N A;  1CC7 A;  2WON B;  1HHT P;  3I31 A;  4I68 A;  1JLQ A;  2HGM A;  2DNO A;  3MEE B;  3PM9 A;  2EWH A;  2QSW A;  1NK6 A;  2MST A;  2XGQ A;  1BE4 A;  2QL9 B;  4ZLJ A;  4J91 A;  5KFP A;  2DNH A;  3M32 B;  1GX6 A;  4JI5 F;  2ZH9 A;  2W7A A;  2C2E A;  3H2L A;  2XLK A;  2HS3 A;  3N28 A;  3K0J A;  2QSF A;  1C1C B;  3E01 B;  2DIV A;  3Q2S C;  4DV0 F;  1WDT A;  2KYZ A;  3CO9 A;  2DNQ A;  2W4C A;  1WEX A;  3I5A A;  4NL5 A;  1VQY A;  3OR1 B;  1CLF A;  4NZ6 A;  2W9C B;  1RWM B;  3M6W A;  4XDC A;  4NYZ A;  4FXV A;  1FHT A;  4X62 F;  1EP4 A;  5JJB A;  4U6P A;  1S57 A;  2W7P A;  1UAW A;  3ICL A;  2VBY A;  5HSP A;  3DOL A;  4B08 A;  3BPS P;  5LSO A;  3G86 A;  4NAS A;  3AQO A;  2IJR A;  4HTJ A;  1F5B A;  1T94 A;  4U8Y A;  2CXE A;  2VQF F;  1U8W A;  4HLB A;  1X4A A;  1VR6 A;  1VRU A;  2CJX B;  2DNK A;  2POK A;  3D9B A;  1S6O A;  2RQK A;  2IVF B;  3B6B A;  3IRX A;  4NYP A;  2R8H A;  2NR0 A;  3B4D A;  2MSS A;  1HYS A;  1QTM A;  4HAC A;  1MWY A;  2IM2 A;  2X1B A;  2JC1 A;  4O0I A;  2VOD A;  2RF2 A;  3MI7 X;  3MM8 B;  3MPU B;  2OH2 A;  4LJM A;  1RTD B;  3NMR A;  4YY3 J;  1K0T A;  2BE2 B;  4L73 A;  4L72 B;  3LP1 B;  2YKM B;  3FUY A;  1R0A B;  1EET A;  3FSX A;  4P7T A;  4DSI A;  2PA3 A;  2CJ9 A;  3MEK A;  2VJU A;  5J2M B;  3CWJ A;  2OPR A;  2XBP A;  1HNW F;  4F4A A;  2M70 A;  1KQF B;  2H9Z A;  1VRQ C;  4C2M A;  1NK8 A;  3I96 A;  4TQR A;  4D3G A;  1RGV A;  4ECX A;  4P2M A;  2AX0 A;  3OR2 B;  1VC0 A;  3J7Y I;  1XER A;  2MB0 B;  4QIV A;  1X7V A;  3KLE B;  1D3W A;  2U1A A;  2HND B;  4DV5 F;  4U7U K;  3TAP A;  4AL5 A;  4EMD A;  3A8E A;  3HHK A;  1BLU A;  4NZ0 A;  3CJQ A;  1Q78 A;  4I2P B;  3OL6 A;  1NSP A;  1RT3 A;  3UE2 A;  2BOA A;  4G6V B;  3CJT A;  1S0N A;  2OP5 A;  4NPO A;  4WK1 A;  1N5Q A;  2Q79 A;  4C3K A;  4F25 A;  4GO5 X;  2L48 A;  2DEJ A;  2AQ4 A;  2C42 A;  3TZZ A;  3NS7 B;  3NGS A;  1H0H B;  5L8R C;  4CM0 A;  3K5N A;  4B3M F;  2RUG A;  4RL1 A;  1OSC A;  3BQ1 A;  3G2X A;  4RUB A;  3KUH A;  4ERD A;  4BLG A;  2RNE A;  3GSI A;  2FLP A;  4UF4 A;  1NH7 A;  2YXL A;  3OBI A;  3EGW B;  2QLF B;  1D8Y A;  2W9B A;  3GFY A;  2JLF A;  3LWL A;  1MW7 A;  1RTJ A;  4ZCM A;  1CJU A;  4BC9 A;  1J5O B;  3LPY A;  4B17 A;  3IG1 B;  3OV7 A;  3CJS A;  3BF4 A;  1S12 A;  3D6T B;  2NPF A;  3JTN A;  3NG8 A;  1NK5 A;  2CQB A;  1NPR A;  1ZET A;  4BC7 A;  4ENO A;  3GR0 A;  4BDP A;  1RAO A;  4ZK7 M;  1HI8 A;  2FYX A;  5KFH A;  3C6U A;  1WHW A;  4QU6 A;  2J0X A;  2IBO A;  2QO3 A;  1X9S A;  2P9E A;  3VAF A;  2JL9 A;  2XQC A;  1TUV A;  3V6J A;  1U0H A;  1CVJ A;  3EZU A;  2CQD A;  4Q2M A;  3TA2 A;  5HRO B;  2R2U A;  3CCJ S;  3DLH A;  1OMS A;  3DNC A;  2IDE A;  4YHH J;  2VIH A;  1RT5 A;  1RWX B;  4G3I A;  1HWL A;  3EYZ A;  2Z2L A;  1DBD A;  5T14 A;  5DG7 A;  5DET A;  3I5B A;  1Y9O A;  3KDN A;  3Q22 A;  1CQM A;  4DQI A;  4DPY A;  1Y3K A;  3PR5 B;  1GX5 A;  1S1X A;  3M2V B;  3PEH A;  5BJR A;  1LQ9 A;  3OLB A;  2HWT A;  3RBD A;  2DRB A;  4DSK A;  1VK8 A;  4ECR A;  1LFW A;  2YWG A;  1NJX A;  2RB7 A;  3DXB A;  5HAO A;  4DV6 F;  1S9E B;  2V34 A;  1UMJ A;  3IR5 B;  3R5J B;  3CD6 S;  4NCA A;  3NAI A;  4ECS A;  1Y4Z B;  1SL1 A;  4OX9 J;  1RAC B;  4CLU A;  3DOL B;  3VAL A;  3L9Z A;  3M8P B;  4IFY B;  3LO3 A;  2ZHB A;  1FKP B;  3D5M A;  5E7O B;  4ZDN A;  3ZZZ A;  4F0H A;  1FFW B;  3IA0 A;  4OX6 A;  2AEM A;  1VQ4 S;  3IRX B;  1HYS B;  2WOM B;  3KK3 B;  4NCG A;  1HBM A;  5C42 A;  4WFN Q;  1UWB A;  1WC3 A;  2W24 A;  3QSY B;  2V6A A;  1H6K X;  1ARO P;  2GQQ A;  2VZ9 A;  2BE9 B;  1M1K T;  1Q8I A;  2IYG A;  3OR2 A;  3EXC X;  4RR5 A;  4DV7 J;  2M5Y A;  1KP6 A;  3TVZ A;  3G6X A;  4LFB F;  2P6S A;  3PRB A;  4PAA A;  3V4I B;  2FPH X;  2RH3 A;  5THW A;  4LFB J;  6AT1 B;  1HLW A;  2GV1 A;  2RVJ A;  5DQG A;  2YH0 A;  1MML A;  4Q45 A;  1U1Q A;  1NK9 A;  4F02 A;  3F56 A;  2EPI A;  3SSQ A;  2WB1 D;  2Z0G A;  3MPV A;  1FKA F;  2V67 A;  1LXN A;  5L1I A;  7FD1 A;  4RW8 B;  4O44 B;  1T7P A;  3M8W A;  5HQM A;  2XSJ B;  3PVX A;  3QAT A;  3D67 A;  2NXE A;  4KGZ B;  3K5P A;  1RT4 A;  3R6G B;  1UCN A;  2RSQ A;  5B09 A;  5HJX A;  1T03 B;  3RB3 A;  5ETO A;  4UQT A;  4I56 A;  4M1K A;  2RU3 A;  3OVA A;  1VQ7 S;  1VQ8 S;  4DV2 J;  2LQ5 A;  3AA8 A;  1RHK B;  3B8H A;  1M0S A;  3OJS A;  3NRB A;  1EAR A;  4EYI B;  4P75 A;  3BQ0 A;  4MIW A;  2VU5 A;  1QE1 A;  1Y5L B;  1Z1Z A;  5M2P A;  1YBT A;  1VRT B;  3H0P A;  5F9L A;  3RTV A;  5ETS A;  3DGP A;  2B3T B;  2WVB A;  3RBX A;  3HT0 A;  2WSF C;  1QAJ A;  3FRZ A;  4YHH F;  4J9R A;  2CQ2 A;  3JYT A;  3EZ5 A;  1J5E J;  2CNN B;  5FII A;  3IBW A;  4AND A;  1WC5 A;  1GTH A;  3H2U B;  2DR9 A;  2E44 A;  3KUG A;  4C8M A;  4ZVR B;  4RU2 A;  3TI0 A;  2AIR B;  1W2B R;  3HHL B;  3GR1 A;  3WDO A;  2DJW A;  3GFX A;  4HH0 A;  5T7L B;  1CUL B;  3EPG A;  1SJR A;  4XK8 C;  4KY3 A;  3UCZ P;  1NLK L;  4RBV A;  5KG3 A;  1YWX A;  2LA6 A;  4PQA A;  3K57 A;  3CPW R;  1NB7 A;  1N34 J;  3LTO A;  2HHP A;  4EO8 A;  3C6U B;  4CLT A;  1S6U A;  1Y3J A;  4PXE A;  4F8R A;  1BD6 A;  3KHG A;  1OWX A;  2YNH A;  2CPZ A;  5HAT A;  3CDU A;  3R5A A;  3TP2 A;  1HR0 F;  4H4O A;  3NWR A;  2E5I A;  4ZPW R;  2O1P A;  3AXM A;  1KSP A;  4DMZ A;  2L41 A;  2UVW A;  1YJ9 S;  2ZBC A;  4DV7 F;  2VV5 A;  3Q2T C;  3L3C A;  4I2Q A;  3MCS A;  1FWL A;  1GK8 A;  5IC6 B;  1SQE A;  2W8L A;  1ITP A;  4FBT A;  3IBC B;  2AJ4 A;  2QL5 B;  3CCR S;  1HNZ J;  3NOG A;  5L39 A;  2DGW A;  1F2H A;  1D9D A;  2DGQ A;  2DGX A;  4ZVQ B;  5J2P A;  4DR4 J;  1SVD A;  4C0B A;  4JI8 F;  2MKI A;  3JXO A;  4LFA J;  4H4M B;  3FMW A;  3ZZY A;  3R27 A;  1NPP A;  1LW2 A;  3O8W A;  3CED A;  2W2P P;  5HQL A;  4RKU C;  1HI0 P;  1C1C A;  3RB6 A;  2V9W A;  1FI4 A;  1LWC B;  2JJ4 D;  4L74 A;  4UQG A;  2W8K A;  4TVA B;  3UDC A;  4LF6 F;  2JX2 A;  2E7W A;  3K7R A;  1R8H A;  4EBC A;  4C3L A;  3QZ7 A;  1MRO A;  2DR6 A;  4NEZ A;  3T6J A;  2XI2 A;  3BBB A;  1GMV A;  1KNZ A;  2BEF A;  1RAG B;  2AX1 A;  3KHR A;  1UET A;  4N77 A;  4ECU A;  1APS A;  3BKF A;  2XMW A;  3HSJ A;  1M5O C;  1TKZ B;  2RQC A;  4LF4 J;  4Q5V A;  4MKA A;  3UN5 A;  2HHX A;  5FDL B;  2G1H A;  2B9W A;  3DOM A;  4K2J A;  3KFW X;  1F2G A;  3I0R B;  3ADA C;  3ILO A;  2D9P A;  3MEE A;  5ETL A;  3MM8 A;  4ICL A;  1D0E A;  3PCO B;  4V19 X;  3HO1 A;  1YK9 A;  4OYZ A;  4GKJ J;  4FYX B;  1HBU B;  3TUP A;  1FCA A;  2XS5 A;  1K44 A;  3DLE A;  3C16 B;  1T9T A;  1VOM A;  2JSX A;  1UFL A;  4J9O A;  3UVJ A;  3I6P A;  2E5L F;  3M30 A;  3T9Z A;  4LF7 J;  4NLY A;  3RU0 A;  4JUZ A;  2BDP A;  3RBE A;  4DX8 H;  4P52 A;  4CO3 A;  5DDO C;  3EE3 A;  2C3U A;  3BJY A;  3J80 U;  2LXI A;  2J7U A;  4DUY F;  1UZH A;  1KFD A;  5HL7 Q;  2RRB A;  4GO7 X;  5E2Q A;  4IO1 A;  2COL A;  2X3D A;  3CE8 A;  9ATC B;  4KTQ A;  3QRP A;  1HNZ F;  1A6L A;  2P9C A;  3W62 A;  2DH9 A;  3GP9 A;  4M5M A;  2K2P A;  4JV5 J;  5IXU A;  1T9X A;  4K4V A;  4OV6 A;  3O6Q A;  4RW6 A;  3JSB A;  2M8D B;  3H98 A;  2ZE2 B;  2YNH B;  2J6T A;  1SIZ A;  2V8P A;  4F50 A;  2HMI A;  2P5V A;  3P5T L;  3GJQ B;  3MGJ A;  4ER8 A;  4DL5 A;  1RHR B;  1FK9 B;  1VLY A;  1VMB A;  3IAM 9;  4ED6 A;  1P9Q C;  1F5C A;  3FC9 A;  1U49 A;  2GHW A;  2Q6B A;  1KS2 A;  1PIL A;  3PG9 A;  4I64 A;  4LF6 J;  1S7H A;  2J7W A;  2WON A;  2LEA A;  5DQI A;  5LMU J;  1L3V A;  4DR5 J;  2IRX A;  4DFJ A;  1OQ6 A;  2MLY A;  3PYE A;  1T3O A;  2CA9 A;  3NGK A;  2Q43 A;  2J8A A;  5J2Q A;  4ZS6 A;  2GJF A;  2QA4 G;  3M7V A;  1IUJ A;  1LOU A;  4JBC A;  2VOO A;  4UZC A;  3DRR B;  3G82 A;  1RTI B;  4K2X A;  3I55 S;  2NXU A;  2ASL A;  3FJ2 A;  2IHR 1;  3KLH B;  1O6X A;  1IKX B;  1SI9 A;  4Z7Y A;  2DO0 A;  2KL8 A;  3T1A A;  3CDB A;  5KFR A;  4ATN A;  2QMW A;  4XIU A;  2V68 A;  1VRT A;  4CLK A;  4WFA Q;  4NLQ A;  3R7S B;  3RAM A;  2GJI A;  3CUN A;  2UV8 A;  4DL7 A;  2RS8 A;  5I3U A;  2Y1I A;  1C0T A;  4WKY A;  5C25 A;  1EZZ B;  1RT3 B;  3MMC A;  4MT1 A;  3KLG B;  2HFN A;  3GIM A;  2O5D A;  3A3P B;  3P45 B;  4GMK A;  3ZTR A;  4B3M J;  2DIS A;  3CCV S;  3V6H A;  3W3S A;  3S1T A;  1RAF B;  3OFF A;  1RP5 A;  4I6W A;  1NXI A;  1N6Q A;  2LA4 A;  5LT5 A;  4LF7 F;  3WBZ A;  2M4M A;  4F0K A;  3HT3 A;  1F0X A;  3EJM A;  1FA0 A;  1TKD A;  1AUD A;  2XCA A;  4CLL A;  2HHQ A;  2QYC A;  3M2R A;  1N5V A;  1UW4 A;  2F9D A;  2MZR A;  1UA1 A;  2D7S A;  5GVQ A;  1QSS A;  1EKS A;  2WSC C;  2QL7 B;  3FMB A;  2V8V A;  2YKM A;  2YKP A;  2ZDP A;  3ELH A;  1RAI B;  1HMV B;  3VV2 B;  2RS2 A;  3PW4 A;  3EVW A;  4ED0 A;  3QGI A;  3GYG A;  4RW9 B;  4TXS A;  5IOL A;  2AZ1 A;  3EUN A;  5EUH A;  4PCQ A;  2DNP A;  2OPR B;  1J5O A;  2P2C B;  1Y5I B;  1ZPV A;  2CYY A;  3PHT A;  3IBF B;  3FRY A;  3ISN D;  4B3T J;  1WSR A;  4ZVS B;  1VHF A;  3UR0 A;  3VR1 A;  2XHW A;  5EWE A;  4CH1 A;  4C8Y A;  2ZNZ A;  2CAJ A;  5EWF A;  1DY3 A;  5CCM A;  2ADB A;  2V94 A;  1JXV A;  2HNY B;  2ZUG A;  4DR5 F;  4HAC B;  5KFJ A;  4HDG A;  1H72 C;  4P2F A;  3EXY A;  1FDN A;  1S6P B;  4TNO A;  3ZFV A;  3UO0 A;  1S1U A;  3BSC A;  3LOU A;  4NA2 A;  5EWG A;  3PFO A;  4CT8 A;  3NAH A;  5F8I A;  2FD2 A;  4ZCL A;  3PW5 A;  2IMO A;  4JV0 A;  3TJA A;  2VKR A;  3CCT A;  5F0U A;  3IM8 A;  1R43 A;  4OZ1 A;  1VQK S;  2QLW A;  4YB1 P;  3N6N A;  4WKR A;  1SH3 A;  4I4B A;  2FHJ D;  3A3O B;  4C8O A;  3M2R B;  5F0W A;  2IJF A;  1TL4 A;  4F04 B;  4DHV A;  2VFV A;  2VQE J;  2Y8Y A;  4DSE A;  1WKK A;  2CQ4 A;  1K73 T;  2RHS B;  5KG0 A;  2W2N P;  5HI7 A;  3ZZU A;  2EFV A;  3W8P A;  1A7G E;  1HWJ A;  1XMO F;  1FF2 A;  1YRX A;  4DR1 J;  1TK0 A;  5KG2 A;  4LQ9 A;  3WHI A;  3CJ0 A;  1U6Z A;  3M1V A;  3B78 A;  3THP A;  3VZH A;  2H65 B;  1KOH A;  1Y0H A;  2PA8 D;  4LSN A;  3HHD A;  5HMY A;  4X4Q A;  3CDW A;  5K8M A;  4FPI A;  2VIC A;  1WF1 A;  3KJQ B;  3HMJ G;  3RW7 A;  4CLW A;  3PAC A;  2GMJ A;  4K0K J;  3BBC A;  5AE1 A;  2YX7 A;  2YWH A;  4WXW A;  2PMW A;  2WK4 A;  1Q79 A;  4JI1 F;  2AT1 B;  4JI1 J;  1HFE L;  1NDL A;  2IYI A;  2DGT A;  3RG6 A;  2GGP B;  3FEZ A;  4DWI A;  4LFC J;  1FX2 A;  2QE5 A;  3SV4 A;  3C2P A;  3G9C A;  3OUY A;  1QDU B;  2KT5 A;  2MMY A;  4X64 F;  2QTW A;  4DCP B;  3DI6 B;  4TN2 A;  4J7C A;  2RDJ A;  2C22 A;  5DRK A;  4A4J A;  2VPW B;  3J81 U;  2IAJ A;  2JRS A;  2KM8 C;  2E9Z A; 
#chains in the Genus database with same CATH homology
 3GTY X;  1T11 A;  1W26 A;  2MLZ A;  2MLY A;  2D3O 1;  3GU0 A;  2MLX A;  1P9Y A;  1OMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...