1PA3A

Crystal structure of glutathione-s-transferase from plasmodium falciparum
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
196
Chain Sequence
IVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione s-transferase, putative
publication title Native and inhibited structure of a Mu class-related glutathione S-transferase from Plasmodium falciparum
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 66
structure length 196
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pa3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pa3A01
1O7UA 5LD0A 1AC1A 2FHEA 5CRWA 5LCZA 4N10A 2RM5A 3UVTA 2AYTA 5ECIB 4WBRD 3RBTA 5ELAA 3GTUA 1F37A 2YJHA 2H66A 3P90A 5GAPD 5ABRA 5GZZB 2YZHA 3KEBA 5HFIA 1FB0A 2F3MA 2LJAA 1VRSD 3W8SA 3ZYWA 1Q98A 1MDKA 3MNGA 2HRKA 1R7HA 2GLRA 2C3TA 3EU4A 1OC9B 4RQXA 1M99A 2LQOA 5D9VA 1OC3A 1FW1A 4KCAA 3RHBA 2L4QA 3KM6A 4IELA 3HXSA 1ST9A 1NW2A 3LGCA 5B6NA 5AN1A 1SD9A 2PPTA 1U87A 1SU9A 2HZEB 2V41A 2CQ9A 3GFKA 4Q5NA 2IL3A 2FNOA 2CA8A 3GUSA 3IAS2 3LQ7A 2FWEA 4F0CA 4KDXA 4L5OA 2OE1A 3F6FA 3ZL5A 2VLUA 2ON5A 2FA8A 1TK5B 3U6VA 3HVSA 4KAEA 4ZILA 2DJ0A 2EC4A 2GQMA 1X0RA 3R2QA 1SKSB 6GSTA 2IMFA 2I81A 3W6GA 3HA9A 1FAAA 5F06A 4USSA 3LSZA 4ZB6A 1O81A 1K0DA 2G2QA 3G9BA 2FCHA 1O6JA 4G0KA 4RUVA 1PX6A 4F03A 3RHCA 1A8LA 6GSVA 5FT3A 1SJIA 3FZAA 1AW9A 3HDCA 4YQMA 1JHBA 5HQPA 2H0IA 5DJMA 2NDOA 4XIHA 1B4PA 1T4YA 4MJEA 3U5RE 4X0XA 3GIXA 1T3BA 2E2GA 1XW5A 3VWVA 2R5GA 4ISDA 5H5SA 4IGJA 1OC9A 3H4KA 3DD3A 4OCEA 2XPEA 2H0GA 4AJ7A 4KNDA 2ES7A 3IR4A 3GX8A 3M1GA 1VF2A 3DEXA 1PGTA 1WOUA 4LL4B 1HQOA 3O3TA 3IDVA 4Q5RA 3LXTA 3ZZXA 5IM9A 1ERTA 3UIWA 5ECRB 5ECQB 1KTEA 1M0UA 2VD0A 2OE0A 3GV1A 3D22A 4ML1A 4DVCA 1OE8A 1DE1A 3HKRA 5IMVA 4DSQA 2YV7A 2NVLA 3ZIVA 3TKPA 3H8QA 2GTUA 3ME7A 1XWAA 1A24A 5A4VA 1XPVA 3A3TA 1J9BA 2X99A 3L9VA 2AB6A 3VPTA 5CREA 4ECCA 1GSDA 2K8VA 4NAXA 3EWLA 2M46A 2WS2A 3APQA 2OBKA 1V2AA 2GSRA 5AGYA 4N0ZA 2LJRA 3KP9A 5D73A 5DAKA 1RQMA 4TRXA 4GLTA 4L8EA 1X9MB 3WGXA 2N5AA 3V1WA 2JL4A 4MPGA 3KMOA 1UN2A 4J57E 1V57A 1EEMA 4ZB8A 1NSWA 3C1SA 1ZL9A 3GURA 3ZITA 4JR6A 2VL3A 2WB9A 2P0GA 3UBKA 4IN0A 5JCWA 2VLTA 1T8EB 5EPFA 1THXA 4POLA 4XRAA 4OFTA 1A2JA 2GGTA 3ERWA 2HNLA 1K0OA 4HZ4A 3FHKA 1FVKA 3VI7A 5J4UA 1PQNA 2P5QA 3ZMLA 5ENUA 3CXGA 1Z6NA 4HUAA 2X8HA 2I1UA 2L59A 3ZREA 4TR1B 5CRDA 1S3AA 2LEGA 1GH2A 2FUG2 5IO2A 5J3RA 5COHA 4BVXA 4JEDA 2VUPA 2FY6A 3DWVA 1GSUA 1X9SB 4OMVA 4EUYA 3EURA 2E0QA 5ECMB 3IA1A 5JCGA 1YEPA 3TCOA 4XRDA 3TB2A 5H5RA 3C8EA 1JZOA 1YEXA 4V2MA 3F4RA 4BL7A 3GKNA 3HHVA 1C72A 1ZMAA 3ZFBA 4PX1A 2IMIA 3TJBA 4D73B 1ILOA 3MAKA 3ZVJA 1HNAA 4OO5A 3N5OA 1SYXA 3IE3A 2C0EA 3IHQA 5AISA 4KA0A 2DMLA 1I9DA 5INYA 3D5JA 5CP1A 2IJYA 2H19A 1EV4A 2IMKA 2VM1A 4IJ3A 4NV5A 1E6BA 3NIVA 1BAYA 2YNXA 2CT6A 5FWGA 1GTAA 1OKTA 3IBHA 3H1NA 5IOXA 1RK4A 4GCIA 4KSMA 4KUNA 4OD7A 4GRFA 3BCKA 3KH7A 2HI7A 1M2AA 3FK8A 4KDYA 3G7IA 3TGZA 2X8GA 2O87A 2PUKC 1SK2A 4MP4A 2R6KA 4ZB9A 2LUSA 4J56E 3GTUB 5IMCA 1G7EA 1V58A 3GKXA 1WRYA 3Q6OA 2YCDA 1B4QA 1XIYA 1A8YA 2YOIA 2VM2A 11GSA 4WF4A 2C8UA 5AIXA 2O89A 1FOVA 2JACA 1TU7A 4O92A 3UBLA 3AY8A 4LA1A 4J2FA 2WRTA 5ELGA 4KDUA 1PKWA 3UOMA 5IPGA 5IMAA 1Y6EA 1XW6A 2VCZA 5HR3A 2YPMA 3F3QA 3P7XA 4G19A 2VIMA 1V98A 4POKA 4WKWA 6GSWA 2FGXA 2L57A 4RI6A 1YJ6A 1GSFA 1XWKA 3ME8A 4QQ7A 4XTSA 1Z6MA 2GDRA 3LXZA 4XCSA 3GHAA 3M8NA 2JSYA 1IYHA 4ECIA 2GQLA 4JR4A 4PGTA 8GSSA 2GSTA 1TI1A 4FYCA 3DKSA 1U88A 2WULA 4HU9A 1JFUA 1URMA 2H6YA 2CVKA 3EVIA 5D9XA 4NWYA 2ON7A 3UVHA 3F6DA 1OYJA 1JZWA 3WGEA 3RDWA 2RIIA 1ERUA 3GN3A 3IK7A 2DJJA 4H86A 1TJDA 2HXKA 1Z3EA 1TTZA 4MABA 17GSA 2AHEA 1TRUA 1LJRA 1LU4A 4XHMA 4BWQA 1U3AA 5CYYA 3O76A 2LSTA 2HSNB 5IO0A 1Z7PA 3TUEA 2D2ZA 1Z9HA 3OR5A 1ZGNA 2K9FA 1O85A 1X5EA 4JBBA 3F3RA 2WZ9A 1G6YA 4YAVA 4Z7XA 3VWXA 2BTOT 1DE2A 1G6WA 4TW5A 1Q4JA 1GTIA 2CZ3A 2H74A 1KEBA 2GSQA 2GVPA 3IRAA 2AAWA 3GL3A 3L78A 4HI7A 3TRPA 1GLQA 1F3BA 1MD3A 3SWLA 4CW9A 3QFAC 3J7Yb 14GSA 3WGDA 4BA7A 1B8XA 4K7IA 3BOAA 2PERA 2YWIA 4IKHA 3VLNA 4X43A 3APOA 5GAND 2KP2A 5DQYA 2V6OA 2OACA 4L0UA 3L9SA 3FR3A 4JZQA 2B5XA 1S3DA 5CO3A 1AXDA 1EP7A 1N8JA 2B1LA 3A2VA 2B5EA 3IV4A 4XS1A 1VF4A 2XPDA 2BMXA 4ID0A 4AJ8A 2EIOA 1OKDA 2FD3A 3L9UA 3KMNA 4MCUA 1AUCA 4WEYA 3PH9A 3E3EA 5L71A 4I97A 3H79A 2CV4A 3GH9A 3F63A 2HRFA 1TXXA 3TJFA 1W4VA 3NZNA 1K0BA 3IXRA 4K7NA 3JCML 3VK9A 3IK9A 2CAQA 1GWCA 5AIVA 2X8CA 2MZCA 3C71A 5C00A 3KTLA 5B6MA 4TR4A 3LG6A 1IYIA 2YWOA 3PR8A 1T1VA 4E8EA 1ZYQB 4KX4A 1GNWA 18GSA 1BYEA 1JLWA 5DAKB 3UARA 2H73A 4BVYB 4IS0A 2V1MA 2DJ3A 4YH2A 2PVQA 2PGTA 3VWWA 1PL2A 3BJ5A 4ULXA 1PA3A 1ZCPA 3FZ9A 1EGRA 2VCTA 3LJRA 1DBYA 3G7YA 2I3YA 1SL1B 1WMJA 1PX7A 5F07A 2IMDA 3IC4A 4NPBA 3Q19A 3M0FA 5D93A 3I9V2 4WETA 2B6MA 3C1RA 3UMAA 4ZBAA 3L4NA 4EC0A 1PL1A 4LLRA 1OAZA 1QUWA 2R37A 1VF1A 2YP6A 4ML6A 1EV9A 3PPUA 1V9WA 3F4SA 1U3IA 5G5FA 2B3SA 2PVOC 2UZ8A 1B9YC 3WT2A 3M9KA 5DBQA 4POBA 3BD2A 2VCVA 1F2EA 3EINA 4ZL8A 1GTBA 4LMWA 3ZRDA 4EO3A 3TKQA 2LJKA 3IPZA 2DJ2A 2QC7A 1GLPA 3QPMA 2WJUA 1E2YA 3KZQA 4ECBA 1FO5A 4BVXB 4I2UA 5KEJA 1V40A 2C4JA 6GSUA 2R2JA 4PQHA 3FEUA 2DIYA 4Q5QA 1RW1A 1GUKA 2I4AA 1I5GA 2JZRA 1AQWA 5HFGA 1SJZA 3GH6A 4NHZA 1F6MC 2WGRA 4ZL7A 2O85A 1VGLA 5BMUA 1NM3A 2F8AA 3D0ZA 1MDJA 2YANA 3HVXA 2GT5A 4QL9A 4BL7B 2IIYA 3US3A 1JZDA 2WDUA 3UJ1A 2TRCP 2E2MA 4FO5A 4MMMA 5DVBA 1XOBA 1SK0A 2FA4A 3DIEA 3W8JA 1EOHA 2GZZA 2TRXA 2DLXA 3PGTA 4BVYA 2H6XA 2EIRA 5DCHA 1O73A 5C04A 1H75A 4GSSA 3ED3A 3D4TA 3GSSA 3ZFLA 2L4CA 3QFBC 4HS1A 4K1FA 5A5KA 3QAGA 2GS3A 1BG5A 4PXOA 5B7CA 2V2GA 2HSYA 1WWJA 1K3YA 4OFMA 2PN8A 2HFDA 4MLYA 3KCMA 5DJLA 4TXVA 1EWXA 3WT1A 1GRXA 3CSHA 2LRCA 4BWSA 1T4ZA 5CRGA 1YKCA 1EEJA 1PN9A 1BX9A 1U6TA 5B8BA 2DBCA 1DSBA 1X5CA 3A2WA 2B5YA 3A5WA 2CVBA 1M7TA 1GL8A 3I43A 5IPHA 3CRTA 4YQVA 3EE2A 2NBSA 3LFLA 2I9HA 5E59A 2MMAA 4EE0A 3EMPA 3GKMA 4NV2A 4PQ1A 2O8VB 2L5OA 1TK8B 4GQCA 3D21A 1XWBA 1TI3A 2LKUA 5IMFA 2F51A 2J23A 1J0FA 1FG4A 2JSZA 2K8SA 1QMVA 1UC7A 1GUHA 5ECSA 3O6TA 1HD2A 4NHWA 2MYGA 4K0GA 3FRCA 1YY7A 3HJPA 1XVQA 3MWHA 4MH2A 5KN1A 1YF0A 4N11A 2DJKA 3F0IA 1ERVA 5IOWA 3KJYA 10GSA 3QR6A 5B8AA 3VWUA 5HR1A 4TXOA 2NPBA 1TP9A 3S9FA 2H01A 3BCIA 1T00A 4MF5A 2O7KA 3EC3A 5ID2A 2EIQA 1K0NA 1Y25A 2H70A 4MZWA 3VPQA 4EDYA 3FW2A 4K7OA 1R5PA 4HJ2A 4MH3A 4PQIA 1USBA 5EL8A 1XBSA 4EXJA 2LV3A 2ALBA 4HQZA 5G5EA 1XW9A 1YKAA 1OE7A 3C73A 2V6KA 1XXUA 4PUAA 2FWGA 1GSSA 4G9HA 2OADA 5DQSA 3UL3A 1WPIA 1THOA 4EVMA 4PNFA 2PU9C 2DSAA 4KF9A 1MDIA 5ECOB 4V1Ag 5G31A 4WR5A 1M2DA 2HE3A 3BBYA 1WIKA 3CBUA 3HZ8A 4FH8A 1BQ7A 2R3XA 3CTFA 3Q74A 1X9WB 5CAXA 2F9SA 4GSTA 5F0GA 3GYKA 1O8XA 3DRNA 4ZBDA 4MJBA 1Z7RA 4HQSA 5IMZA 2AV4A 4ECJA 4YAPA 3M9JA 3TDGA 2RUEA 2QSIA 1T7PB 4IP1A 9GSSA 1TKDB 2LRNA 2H75A 3ZMKA 2B1KA 2DMMA 3TKRA 2MBTA 2LS5A 1FB6A 4POMA 1BEDA 4WF5A 2M72A 5JCUA 3VURA 3CMIA 3ZLPA 2HSMA 5IQYA 2FWHA 2C80A 2DC5A 3GSTA 2AUVA 2Z9SA 2VL2C 2CAIA 2VL2A 3KGKA 3E9JB 4PURA 4FYUA 2H6ZA 3GA4A 4N0VA 4ZXGA 2E7PA 3FYGA 2YWMA 3KXOA 1QGVA 5D8IA 1ON4A 1YZXA 1TRSA 2P31A 1KNGA 2H72A 3EMXA 3HCZA 2VLVA 4EKZA 2QGVA 4F9ZA 3P8WA 4KGIA 5D9WA 3QD9A 3QCPA 2K18A 2PMTA 4MJAA 4TR0A 2H8LA 2VO4A 3PINA 1XWGA 1TW9A 2C0FA 2WFCA 5JWRB 2IMEA 2VL9A 1R5AA 1GSQA 3APSA 4MF7A 4AGSA 3HJOA 3FZ4A 4V2NA 2R4VA 5ECKB 4JU5A 2A2SA 3WD6A 1MEKA 5G1KA 5DALB 4QL7A 3DVXA 6GSYA 1A23A 22GSA 1GSYA 1GTUA 2OBIA 2BJXA 3UAPA 5DDLA 2JU5A 4ZIJA 4PNGA 1SKWB 4K0NA 3FY7A 1SENA 1NHYA 1A0FA 2V32A 2OA7A 2XBIA 4OO4A 1GUMA 4XS4B 1M2BA 2QKEA 5G30A 3H93A 4L0WA 3G7JA 3I69A 4KH7A 4OFNA 4TVEA 1YF1A 3CYNA 4IBPA 2YN1A 4MZCA 4OWYA 4BPYA 2HLSA 3KH9A 2JZTA 3ERGA 2GZPA 4ZBBA 3FKFA 4GWRA 1R26A 2ZUPA 3ERFA 4IW9A 5J41A 2CVDA 3GNJA 1CQGA 1TRVA 3KD0A 1G7OA 1BJXA 1AQXA 2DIZA 5KN3A 3D4MA 2H0HA 4DSRA 1XFLA 4JRRA 4G0LA 1SD8A 1TK0B 5JWQB 4V1Ap 1K0MA 2L6CA 3QAVA 2LTKA 2LRTA 4F82A 4MA9A 3CSJA 2LNSA 1PRXA 4LL1B 2MMOA 5ECHB 5LNKe 1XCCA 1AQVA 5FHIA 2H76A 3MDKA 3TKSC 3TKSA 1JLVA 3HY2A 4KCEA 4F2IA 2YV9A 3TJKA 4KB3A 4E8HA 3IC8A 3LWAA 2A2RA 3E0UA 4IJIA 5DALA 4FYBA 3RPPA 1N2AA 3IAM2 2JZSA 3LYPA 3CTGA 2IN3A 2NTOA 3HVVA 2P5RA 2N5BA 4N30A 2REMA 2G0FA 3RPNA 4LMVA 1FVJA 5G2ZA 12GSA 1HYUA 4L5LA 1WE0A 2HQTA 4GSNA 4XS4A 2MMNA 3A2XA 5EVOA 4O5RA 1EOGA 2H1AA 2H71A 1ZOFA 5D9TA 5F8BA 3ZVJD 3P2AA 4GXZA 1EZKA 4TKYA 4HZ2A 3R3EA 3TRXA 2K6VA 4NMUA 1PMTA 1ZZYA 3J7Yk 1OC8A 1QK8A 3LEFA 3ISOA 2HZEA 2XC2A 3K8NA 3TOTA 1A2LA 2GT6A 2YJ7A 4G10A 4DSSB 4OCFA 2H1GA 1K3LA 1AIUA 4HOJA 4EL1A 2ZCTA 2C3NA 4ACSA 5GSTA 3EYTA 6GSXA 4K8MA 4KE3A 1JZRA 2YWNA 4TXOB 4TR3A 3F4TA 3LYKA 5J5NA 2KOKA 4GF0A 1G0TA 2GSSA 2ZNMA 4I2TA 4K6XA 3WYWA 3L0HA 1TOFA 5EY6A 3SBCA 5ID2B 1M9BA 5DCGA 3DXBA 1A0RP 4HJMA 4XS6A 1GNEA 4IQ1A 1SL2B 4K9ZA 2IPAA 3QDNA 1SKRB 2CX3A 1GSEA 3F9UA 3GX0A 3GRXA 1W89A 4HU7A 1SK1A 3FZ5A 1J08A 5J9BA 2H1BA 4WR4A 4ILFA 2HT9A 2KP1A 1OVNA 1SJ6A 4YQUA 2HRAA 4RI7A 3KTBA 1PSQA 1WJKA 2LQQA 4TN8A 3NOFA 3GMFA 3ZIJA 3M3MA 4PUFC 1XOAA 3HZ4A 2C3QA 6GSSA 2VCQA 3QMXA 1F3AA 4MDCA 1Z5YE 2X64A 1SYRA 1UVZA 4AF2A 2HYXA 2HSHA 2JADA 4ZL9A 4CDOA 2PBJA 2N5FA 2GQKA 4MZBA 2RM6A 4IQAA 3ZTLA 1ERWA 5ECLB 2OE3A 3GL5A 5KN2A 4Q5FA 2B7JA 13GSA 2XBQA 3FR9A 3D6IA 3IOSA 1R4WA 1EP8A 1GP1A 1ABAA 2IWTA 1S3CA 2XHFA 2FLSA 4EDZA 4DSSA 4GTUA 1GULA 5GSSA 2MBSA 19GSA 3I6AA 3MSZA 1LBKA 4FQUA 2HSMB 4F0BA 4I5QA 1O8WA 1XZOA 3UEMA 4MK3A 1NHOA 1DUGA 1XVWA 1F9MA 4CHSA 2L6DA 1K3OA 2MMZA 4PTSA 1B9XC 1UA5A 5A4UA 4WBJA 2OKAA 4HDEA 5E4WA 3DGQA 1HNBA 4GQFA 4KW6A 2A4VA 3C7MA 2VOCA 20GSA 3Q18A 1YQ1A 1M9AA 3CSIA 4HEA2 2M80A 5G1LA 2YZUA 2VD1A 2IFQB 1AAZA 1ACVA 3VFIA 2RUFA 2KUCA 4G0IA 3LORA 2KHPA 3DMLA 4IVFA 2CZ2A 2H1DA 3DVWA 5ECNB 2WCIA 3TKSE 4V2LA 1QQ2A 5IMDA 2FWFA 1TU8A 1ZYEA 1XWCA 3HYPA 1ML6A 3TOUA 1MD4A 2VAFA 7GSSA 2L5LA 2GZYA 2OJLA 2DJ1A 3HD5A 4FIWA 4JE1A 16GSA 4AJ6A 4IHUA 2HRKB 2RLIA 3N9JA 2PWJA 5JWOB 5H5QA 4MPFA 1QFNA 3KP8A 4TR1A 1K0AA 2VCWA 1B48A 1CQHA 1TDIA 5ECPB 4WXTA 2CX4A 4DEJA 5HR2A 5CNWA 3VI5A 1FHEA 3QOUA 5HFKA 5F05A 4P3YB 2HZFA 3EU3A 1SL0B 1WP0A 5HR0A 1YDKA 2B7KA 4IP6A 3F8UA 1A2MA 5CRHA 1HNCA 1QXHA 1PKZA 2HRNA 2C0GA 2C0DA 5D96A 4MF6A 1VF3A 3GKKA 2F8FA 3QAWA 4X1UA 3TJJA 3TJGA 3HJMA 1K0CA 1TRWA 3TRQA 2J9HA 2AJQB 4RQRA 4I8BA 1KBNA 3CRUA 3RAZA 4D73A 3FR6A 5KN0A 3KIJA 4K2DA 2TIRA 5J9CA 1MTCA 4G2EA 4O32A 2KLXA 4KSOA 4O7HA 1X5DA 1PD21 2C1YA 4EF0A 4NXIA 2H30A 4MJCA 5IIZA 3DYRA 1H4OA 2IFQA 2VCXA 5A4WA 1EGOA 4I6XA 2LNTA 4TOPA
chains in the Genus database with same CATH superfamily
1O7UA 5LD0A 1AC1A 2FHEA 5CRWA 5LCZA 4N10A 2RM5A 3UVTA 2AYTA 5ECIB 4WBRD 3RBTA 5ELAA 3GTUA 4N3ZA 1F37A 2YJHA 2H66A 3P90A 5GAPD 5ABRA 5GZZB 2YZHA 3KEBA 5HFIA 1FB0A 2F3MA 2LJAA 1VRSD 2R0PA 3W8SA 3ZYWA 1Q98A 1MDKA 3MNGA 2HRKA 1R7HA 2QA1A 2GLRA 2C3TA 3EU4A 1OC9B 4RQXA 1M99A 2LQOA 5D9VA 1OC3A 1FW1A 4KCAA 3RHBA 2L4QA 3KM6A 4IELA 2EFCA 3HXSA 4A5PA 1ST9A 1NW2A 3LGCA 5B6NA 5AN1A 1SD9A 2PPTA 1U87A 1SU9A 2HZEB 2V41A 2CQ9A 3GFKA 4Q5NA 2IL3A 2FNOA 2CA8A 3GUSA 3IAS2 3LQ7A 2FWEA 4F0CA 4KDXA 4L5OA 2OE1A 3F6FA 3ZL5A 2VLUA 2ON5A 2FA8A 1TK5B 3U6VA 3HVSA 4KAEA 4ZILA 1M3JA 2DJ0A 2EC4A 2GQMA 1X0RA 3R2QA 1SKSB 4PI0C 6GSTA 2IMFA 2I81A 3W6GA 3HA9A 1FAAA 5F06A 4USSA 3LSZA 4ZB6A 1O81A 1K0DA 2G2QA 3G9BA 4EIPA 2FCHA 1O6JA 2HSNA 4G0KA 4RUVA 1PX6A 4F03A 3RHCA 1A8LA 6GSVA 5FT3A 1SJIA 3FZAA 1AW9A 3HDCA 4YQMA 1JHBA 5HQPA 2H0IA 3CQFA 5DJMA 2NDOA 4XIHA 1B4PA 1T4YA 4MJEA 3U5RE 4X0XA 3GIXA 2O36A 1T3BA 2E2GA 1XW5A 3VWVA 2R5GA 4ISDA 3CWGA 5H5SA 4IGJA 1I1IP 1OC9A 3H4KA 3DD3A 4OCEA 2XPEA 2H0GA 4AJ7A 4KNDA 2ES7A 3IR4A 3GX8A 3M1GA 1VF2A 3DEXA 1PGTA 1WOUA 4LL4B 1HQOA 3O3TA 3IDVA 4Q5RA 3LXTA 3ZZXA 5IM9A 1ERTA 3UIWA 5ECRB 5ECQB 1KTEA 1M0UA 2VD0A 2OE0A 3GV1A 3D22A 4ML1A 4DVCA 1OE8A 1DE1A 3HKRA 5IMVA 4DSQA 2YV7A 2NVLA 3ZIVA 3TKPA 1S4BP 3H8QA 2GTUA 3ME7A 1XWAA 1A24A 5A4VA 1XPVA 3A3TA 1J9BA 2X99A 2WVXB 3L9VA 2AB6A 3VPTA 5CREA 4ECCA 1GSDA 2H1LA 2K8VA 4NAXA 3EWLA 2M46A 2WS2A 3APQA 2OBKA 1V2AA 2GSRA 5AGYA 4N0ZA 2LJRA 3KP9A 5D73A 5DAKA 1RQMA 4TRXA 4ICYA 4GLTA 4L8EA 1X9MB 3WGXA 2N5AA 3V1WA 2X49A 2JL4A 4MPGA 3KMOA 1UN2A 4J57E 1V57A 1EEMA 4ZB8A 1NSWA 3C1SA 1ZL9A 3GURA 3ZITA 4JR6A 2VL3A 2WB9A 2P0GA 3UBKA 4IN0A 5JCWA 2VLTA 1S3RA 1T8EB 5EPFA 1PFOA 1THXA 4POLA 4XRAA 4OFTA 1A2JA 2GGTA 3ERWA 2HNLA 1K0OA 4HZ4A 3FHKA 1FVKA 3VI7A 5J4UA 1PQNA 2P5QA 3ZMLA 5ENUA 4EIQA 3CXGA 1Z6NA 4HUAA 2X8HA 2I1UA 2L59A 3ZREA 4TR1B 5CRDA 1S3AA 2LEGA 4Z2RA 4AKIA 1GH2A 2FUG2 5IO2A 5J3RA 5COHA 4BVXA 4JEDA 2VUPA 2FY6A 3DWVA 1GSUA 1X9SB 1ZYNA 4OMVA 4EUYA 3EURA 3MIXA 1ZYPA 4PHZC 2E0QA 5ECMB 3IA1A 5JCGA 1YEPA 3TCOA 4XRDA 3TB2A 5H5RA 3C8EA 1JZOA 1YEXA 4V2MA 2WVXA 3F4RA 4BL7A 3GKNA 3HHVA 1C72A 5J47A 1ZMAA 3ZFBA 4PX1A 2IMIA 3TJBA 4D73B 1ILOA 3MAKA 3ZVJA 1HNAA 4OO5A 3N5OA 1SYXA 3IE3A 2C0EA 3IHQA 5AISA 4KA0A 2DMLA 1I9DA 5INYA 5A34B 2VKZG 3D5JA 5CP1A 2IJYA 3RFRC 2H19A 1EV4A 2IMKA 2VM1A 4IJ3A 4K5RA 4NV5A 1E6BA 3NIVA 1BAYA 2YNXA 2CT6A 5FWGA 1GTAA 1OKTA 3IBHA 3H1NA 3RGBC 5IOXA 1RK4A 4GCIA 4KSMA 4KUNA 4OD7A 4GRFA 3BCKA 3KH7A 2HI7A 1M2AA 3FK8A 4KDYA 3G7IA 3TGZA 2O5VA 2X8GA 2O87A 2PUKC 1SK2A 4MP4A 2R6KA 4MNNA 2WZSA 4ZB9A 2LUSA 4J56E 3GTUB 5IMCA 1G7EA 1V58A 3A5IA 3GKXA 1WRYA 3Q6OA 2YCDA 1B4QA 1XIYA 1A8YA 2YOIA 2VM2A 11GSA 4WF4A 5BRTA 2C8UA 5AIXA 2O89A 1FOVA 2JACA 1TU7A 4O92A 3UBLA 3AY8A 4LA1A 4J2FA 2WRTA 5ELGA 4KDUA 1PKWA 3UOMA 5IPGA 5IMAA 1Y6EA 1XW6A 2VCZA 5HR3A 2YPMA 3F3QA 3P7XA 4G19A 2VIMA 1V98A 4POKA 4WKWA 6GSWA 2FGXA 2L57A 4RI6A 1YJ6A 1GSFA 1XWKA 1BG1A 3ME8A 4QQ7A 4XTSA 5J4YA 1Z6MA 2GDRA 3LXZA 4XCSA 3GHAA 3M8NA 1FOHA 2JSYA 1IYHA 4ECIA 2GQLA 4JR4A 4PGTA 8GSSA 2UV8G 2GSTA 4AI6A 1TI1A 4FYCA 3DKSA 1U88A 2WULA 4HU9A 1JFUA 1URMA 2H6YA 2CVKA 3EVIA 5D9XA 4NWYA 2ON7A 3UVHA 3F6DA 1OYJA 1JZWA 3WGEA 3RDWA 2RIIA 1ERUA 3GN3A 3IK7A 2DJJA 4H86A 1TJDA 2HXKA 1Z3EA 1TTZA 4MABA 17GSA 2AHEA 1TRUA 1LJRA 1LU4A 4XHMA 4BWQA 1U3AA 5CYYA 3O76A 2LSTA 2HSNB 5IO0A 1Z7PA 3TUEA 2D2ZA 1Z9HA 3OR5A 1ZGNA 2K9FA 1O85A 1X5EA 4JBBA 3F3RA 2WZ9A 1G6YA 4YAVA 4Z7XA 3VWXA 2BTOT 1DE2A 1G6WA 4TW5A 1Q4JA 3EPTA 1GTIA 2CZ3A 2H74A 1KEBA 2GSQA 2GVPA 3IRAA 2AAWA 3GL3A 4W66A 4HI7A 3L78A 1GLQA 3TRPA 1F3BA 4QMKA 1MD3A 3SWLA 4CW9A 3QFAC 3J7Yb 14GSA 3WGDA 4BA7A 1B8XA 4K7IA 3BOAA 2PERA 2YWIA 4IKHA 3VLNA 4X43A 3APOA 5GAND 2KP2A 5DQYA 2V6OA 2OACA 4L0UA 3L9SA 3FR3A 4JZQA 2B5XA 1S3DA 5KOWA 5CO3A 1AXDA 1EP7A 1N8JA 2B1LA 3A2VA 2B5EA 3IV4A 4XS1A 1VF4A 2XPDA 5A1NB 2BMXA 4ID0A 4AJ8A 2EIOA 1OKDA 2FD3A 3L9UA 3KMNA 4MCUA 1AUCA 4WEYA 3PH9A 3E3EA 5L71A 4I97A 3H79A 2CV4A 3GH9A 3F63A 2HRFA 1TXXA 3TJFA 5BMUB 1W4VA 3NZNA 1K0BA 3IXRA 4K7NA 3JCML 3VK9A 3IK9A 2CAQA 1GWCA 5AIVA 2X8CA 2MZCA 3C71A 5C00A 3KTLA 5B6MA 4TR4A 3LG6A 1IYIA 2YWOA 3PR8A 1T1VA 4E8EA 1ZYQB 4KX4A 1GNWA 18GSA 1BYEA 1JLWA 5DAKB 3UARA 1M3IA 2H73A 4BVYB 4IS0A 2V1MA 2DJ3A 4YH2A 2PVQA 2PGTA 3VWWA 1PL2A 3BJ5A 4ULXA 1PA3A 1ZCPA 3FZ9A 1EGRA 2VCTA 3LJRA 1DBYA 3G7YA 2I3YA 1SL1B 1WMJA 1PX7A 5F07A 2IMDA 3IC4A 4NPBA 3Q19A 3M0FA 5D93A 3I9V2 4WETA 2B6MA 3C1RA 3UMAA 4ZBAA 3L4NA 2X4AA 4EC0A 1PL1A 4LLRA 1OAZA 1QUWA 2R37A 1VF1A 2YP6A 4ML6A 1EV9A 3PPUA 1V9WA 3F4SA 4CY8A 1U3IA 5G5FA 2B3SA 2PVOC 4E68A 2UZ8A 1B9YC 3WT2A 3M9KA 5DBQA 4POBA 3BD2A 2VCVA 5J4VA 1F2EA 3EINA 4ZL8A 1GTBA 4LMWA 3ZRDA 4EO3A 3TKQA 2LJKA 3IPZA 2DJ2A 2QC7A 1GLPA 3QPMA 2WJUA 1E2YA 2DKIA 2O3EA 3KZQA 4ECBA 1FO5A 4BVXB 4I2UA 5KEJA 5A1NA 1V40A 2C4JA 6GSUA 4O5QA 2R2JA 4PQHA 3FEUA 2DIYA 4Q5QA 1RW1A 1GUKA 2I4AA 1I5GA 2JZRA 1AQWA 5HFGA 1SJZA 1YEWC 3GH6A 4NHZA 1F6MC 2WGRA 4ZL7A 2O85A 1VGLA 5BMUA 1NM3A 2F8AA 3D0ZA 1MDJA 2YANA 3HVXA 2GT5A 4QL9A 4BL7B 2IIYA 3US3A 1JZDA 2WDUA 3UJ1A 2TRCP 1Y1UA 2E2MA 4FO5A 4MMMA 5DVBA 1XOBA 1SK0A 2FA4A 3DIEA 3W8JA 2DKHA 1EOHA 2GZZA 2TRXA 2DLXA 3PGTA 4BVYA 2H6XA 2EIRA 5DCHA 1O73A 5C04A 1H75A 4GSSA 3ED3A 3D4TA 3GSSA 3ZFLA 2L4CA 3QFBC 4HS1A 4K1FA 5A5KA 3QAGA 2GS3A 1BG5A 4PXOA 5B7CA 2V2GA 2HSYA 1WWJA 1K3YA 4OFMA 2PN8A 2HFDA 4MLYA 3KCMA 5DJLA 4TXVA 1EWXA 3WT1A 1GRXA 3CSHA 2LRCA 4BWSA 1T4ZA 5CRGA 1YKCA 1EEJA 1PN9A 1BX9A 1U6TA 5B8BA 2DBCA 1DSBA 1X5CA 3A2WA 2B5YA 3A5WA 2CVBA 1M7TA 1GL8A 3I43A 5IPHA 3CRTA 4YQVA 3EE2A 2NBSA 4K5SA 3LFLA 2I9HA 5E59A 2WW2A 2MMAA 4EE0A 3EMPA 3GKMA 4NV2A 4PQ1A 2O8VB 2L5OA 4AKXB 4O5UA 1TK8B 4GQCA 3D21A 1XWBA 1TI3A 2LKUA 5IMFA 2F51A 2R0CA 2J23A 1J0FA 1FG4A 2JSZA 2K8SA 1QMVA 1UC7A 1GUHA 5ECSA 3O6TA 1HD2A 4NHWA 2MYGA 4K0GA 3FRCA 4GDFA 1YY7A 3HJPA 1XVQA 3MWHA 4MH2A 5KN1A 1SVOA 1YF0A 4N11A 2DJKA 4AKHA 3F0IA 1ERVA 5IOWA 3KJYA 10GSA 3QR6A 5B8AA 3VWUA 5HR1A 4HSCX 4TXOA 2NPBA 1TP9A 3S9FA 2H01A 3BCIA 1T00A 4MF5A 2O7KA 3EC3A 5ID2A 2EIQA 1K0NA 1Y25A 2H70A 4MZWA 3VPQA 4EDYA 3FW2A 4K7OA 1R5PA 4HJ2A 4MH3A 4PQIA 2EFEA 1USBA 5EL8A 1XBSA 4X4JA 4EXJA 2LV3A 2EFHA 2ALBA 4HQZA 5G5EA 1XW9A 1YKAA 1OE7A 3C73A 2V6KA 1XXUA 4PUAA 4PI2C 2FWGA 1GSSA 4G9HA 2OADA 5DQSA 2R0GA 3UL3A 1WPIA 1THOA 4EVMA 4PNFA 2PU9C 2DSAA 4KF9A 1MDIA 5ECOB 4V1Ag 5G31A 4WR5A 1M2DA 2HE3A 3BBYA 1WIKA 3CBUA 3HZ8A 4FH8A 1BQ7A 2R3XA 3CTFA 3Q74A 1X9WB 5CAXA 2F9SA 4GSTA 5F0GA 3GYKA 1O8XA 3DRNA 4ZBDA 4MJBA 1Z7RA 4HQSA 5IMZA 2AV4A 4ECJA 4YAPA 3M9JA 3TDGA 4FXYP 2RUEA 2QSIA 1T7PB 4IP1A 9GSSA 1TKDB 2LRNA 2H75A 4Z2TA 3ZMKA 2B1KA 2DMMA 3TKRA 2MBTA 2LS5A 1FB6A 4POMA 2A4HA 1BEDA 4WF5A 2M72A 5JCUA 1BF5A 3VURA 3CMIA 3ZLPA 2HSMA 5IQYA 2FWHA 2C80A 2DC5A 3GSTA 2AUVA 2Z9SA 2VL2C 2CAIA 2VL2A 3KGKA 3E9JB 4PURA 4FYUA 2H6ZA 3GA4A 4N0VA 4ZXGA 2E7PA 3FYGA 1YVLA 2YWMA 3KXOA 1QGVA 5D8IA 1ON4A 1YZXA 1TRSA 3MYDA 2P31A 1KNGA 2H72A 4ZB7A 3EMXA 3HCZA 2VLVA 4EKZA 2QGVA 4F9ZA 3P8WA 4KGIA 5D9WA 3QD9A 3QCPA 4G01A 2K18A 2PMTA 4MJAA 4TR0A 2H8LA 2VO4A 3PINA 1XWGA 1TW9A 2C0FA 2WFCA 5JWRB 2IMEA 2VL9A 1R5AA 1GSQA 3APSA 4MF7A 4AGSA 3HJOA 3FZ4A 4V2NA 2R4VA 5ECKB 4JU5A 2A2SA 3WD6A 1MEKA 5G1KA 5DALB 4QL7A 3DVXA 6GSYA 1A23A 22GSA 1GSYA 1GTUA 1N25A 2OBIA 2BJXA 3UAPA 5DDLA 2JU5A 4ZIJA 4PNGA 1SKWB 4K0NA 3FY7A 1SENA 1NHYA 1A0FA 2V32A 2OA7A 2XBIA 4OO4A 1GUMA 4XS4B 1M2BA 2QKEA 5G30A 3H93A 4L0WA 3G7JA 3I69A 4KH7A 4OFNA 4TVEA 1YF1A 3CYNA 4IBPA 2YN1A 4MZCA 4OWYA 4BPYA 2HLSA 2WVZA 3KH9A 2JZTA 3ERGA 2GZPA 4ZBBA 3FKFA 4GWRA 1R26A 2ZUPA 3ERFA 4IW9A 5J41A 2CVDA 3GNJA 1CQGA 1TRVA 3KD0A 1G7OA 1BJXA 1AQXA 2DIZA 5KN3A 3D4MA 2H0HA 4DSRA 1XFLA 4JRRA 4G0LA 1SD8A 1TK0B 5JWQB 4YKFA 4V1Ap 1K0MA 2L6CA 3QAVA 2LTKA 2LRTA 4F82A 4MA9A 3CSJA 2LNSA 1PRXA 4CY6A 4LL1B 2MMOA 5ECHB 5LNKe 1XCCA 1AQVA 5FHIA 2H76A 3MDKA 3TKSC 3TKSA 1JLVA 3HY2A 4KCEA 4F2IA 2YV9A 3TJKA 4KB3A 4E8HA 3IC8A 3TU3B 3LWAA 2A2RA 3E0UA 4IJIA 5DALA 4FYBA 3RPPA 1N2AA 1TXUA 3IAM2 2JZSA 3LYPA 3CTGA 2IN3A 2NTOA 3HVVA 2P5RA 2N5BA 4N30A 2REMA 2G0FA 3RPNA 4LMVA 1FVJA 5G2ZA 12GSA 1HYUA 4L5LA 1WE0A 2HQTA 4GSNA 4XS4A 2MMNA 5J40A 3A2XA 5EVOA 4O5RA 1EOGA 2H1AA 2H71A 2EFDA 1ZOFA 5D9TA 5F8BA 3ZVJD 3P2AA 4GXZA 1EZKA 4TKYA 4HZ2A 3CHXC 3R3EA 3TRXA 2K6VA 4NMUA 1PMTA 1ZZYA 3J7Yk 1OC8A 1QK8A 3LEFA 3ISOA 2HZEA 2XC2A 3K8NA 3TOTA 1A2LA 2GT6A 2YJ7A 4G10A 4DSSB 4OCFA 2H1GA 1K3LA 1AIUA 4HOJA 4EL1A 2ZCTA 2C3NA 4ACSA 5GSTA 3EYTA 6GSXA 4K8MA 4KE3A 1JZRA 2YWNA 4TXOB 4TR3A 3F4TA 3LYKA 5J5NA 2KOKA 4GF0A 1G0TA 2GSSA 2ZNMA 4I2TA 4K6XA 2WVYA 3WYWA 3L0HA 1TOFA 5EY6A 3SBCA 5ID2B 1M9BA 5DCGA 3DXBA 2WW3A 1A0RP 4HJMA 4XS6A 1GNEA 4IQ1A 1SL2B 4K9ZA 2IPAA 3QDNA 1SKRB 2CX3A 1GSEA 3HMJG 3F9UA 3GX0A 3GRXA 1W89A 4HU7A 1SK1A 3FZ5A 1J08A 2A2PA 5J9BA 2H1BA 4WR4A 4ILFA 2HT9A 2KP1A 1OVNA 1SJ6A 4YQUA 2HRAA 4RI7A 3KTBA 1PSQA 1WJKA 2LQQA 3IHGA 4TN8A 3NOFA 3GMFA 3ZIJA 3M3MA 4PUFC 1XOAA 3LW9A 3HZ4A 2C3QA 5A5HB 6GSSA 2VCQA 3QMXA 1F3AA 4MDCA 1Z5YE 2X64A 1SYRA 4BIKA 1UVZA 4AF2A 2HYXA 2HSHA 2JADA 4ZL9A 4CDOA 2PBJA 2N5FA 4AKGA 2GQKA 4MZBA 2RM6A 4IQAA 3ZTLA 1ERWA 5ECLB 2OE3A 3GL5A 5KN2A 4Q5FA 1SVLA 2B7JA 13GSA 2XBQA 3FR9A 3D6IA 3IOSA 1R4WA 1EP8A 1GP1A 1ABAA 2IWTA 1S3CA 2XHFA 2FLSA 4EDZA 4DSSA 4GTUA 1GULA 5GSSA 2MBSA 19GSA 3I6AA 3MSZA 1LBKA 4FQUA 2HSMB 4F0BA 4I5QA 5KOXA 1O8WA 1XZOA 2WW0A 3UEMA 4K2XA 4MK3A 1NHOA 1DUGA 1XVWA 1F9MA 4CHSA 2L6DA 1K3OA 2MMZA 4PTSA 1B9XC 1UA5A 5A4UA 4WBJA 2OKAA 4HDEA 5E4WA 3DGQA 1HNBA 4GQFA 4KW6A 2A4VA 3C7MA 2VOCA 20GSA 3Q18A 1YQ1A 1M9AA 3CSIA 4HEA2 2M80A 5G1LA 2YZUA 2VD1A 2IFQB 1AAZA 1ACVA 3VFIA 2RUFA 2KUCA 4G0IA 3LORA 2KHPA 3DMLA 4IVFA 2CZ2A 2H1DA 3DVWA 5ECNB 2WCIA 3TKSE 4V2LA 1QQ2A 5IMDA 2FWFA 1TU8A 1ZYEA 1XWCA 1PN0A 5A5HA 3HYPA 1ML6A 3TOUA 2QA2A 3FMWA 1MD4A 2VAFA 4YKGA 7GSSA 2L5LA 2GZYA 2OJLA 2DJ1A 3HD5A 4FIWA 4JE1A 16GSA 4AJ6A 4IHUA 2HRKB 2RLIA 3N9JA 2PWJA 5JWOB 5H5QA 4MPFA 1QFNA 3KP8A 4TR1A 1K0AA 2OT3A 2VCWA 1B48A 1CQHA 1TDIA 5ECPB 3HVNA 4WXTA 2CX4A 4DEJA 5HR2A 5CNWA 3VI5A 1FHEA 4Z2UA 3QOUA 5HFKA 5F05A 4P3YB 2HZFA 3EU3A 1SL0B 1WP0A 5HR0A 1YDKA 2B7KA 4IP6A 3F8UA 1A2MA 5CRHA 1HNCA 1QXHA 1PKZA 2HRNA 2C0GA 2C0DA 5D96A 4MF6A 1VF3A 3GKKA 2F8FA 3QAWA 4X1UA 3TJJA 3TJGA 3HJMA 1K0CA 1TRWA 3TRQA 2J9HA 2WW1A 2AJQB 4RQRA 4I8BA 1KBNA 3CRUA 3RAZA 4D73A 3FR6A 5KN0A 3KIJA 4K2DA 2TIRA 5J9CA 1MTCA 4G2EA 1SVMA 4O32A 2KLXA 4KSOA 4O7HA 1X5DA 1PD21 2C1YA 5A34A 4EF0A 4NXIA 2H30A 4MJCA 5IIZA 3DYRA 1H4OA 2IFQA 2VCXA 5A4WA 1EGOA 4I6XA 1XG8A 2LNTA 4TOPA
chains in the Genus database with same CATH topology
1O7UA 5LD0A 1AC1A 2FHEA 5CRWA 5LCZA 4N10A 2RM5A 3UVTA 2AYTA 5ECIB 4WBRD 3RBTA 5ELAA 3GTUA 4N3ZA 1F37A 2YJHA 2H66A 3P90A 5GAPD 5ABRA 5GZZB 2YZHA 3KEBA 5HFIA 1FB0A 2F3MA 2LJAA 1VRSD 2R0PA 3W8SA 3ZYWA 1Q98A 1MDKA 3MNGA 2HRKA 1R7HA 2QA1A 2GLRA 2C3TA 3EU4A 1OC9B 4RQXA 1M99A 2LQOA 5D9VA 1OC3A 1FW1A 4KCAA 3RHBA 2L4QA 3KM6A 4IELA 2EFCA 3HXSA 4A5PA 1ST9A 1NW2A 3LGCA 5B6NA 5AN1A 1SD9A 2PPTA 1U87A 1SU9A 2HZEB 2V41A 2CQ9A 3GFKA 4Q5NA 2IL3A 2FNOA 2CA8A 3GUSA 3IAS2 3LQ7A 2FWEA 4F0CA 4KDXA 4L5OA 2OE1A 3F6FA 3ZL5A 2VLUA 2ON5A 2FA8A 1TK5B 3U6VA 3HVSA 4KAEA 4ZILA 2DJ0A 2EC4A 2GQMA 1X0RA 3R2QA 1SKSB 6GSTA 2IMFA 2I81A 3W6GA 3HA9A 1FAAA 5F06A 4USSA 3LSZA 4ZB6A 1O81A 1K0DA 2G2QA 3G9BA 4EIPA 2FCHA 1O6JA 2HSNA 4G0KA 4RUVA 1PX6A 4F03A 3RHCA 1A8LA 6GSVA 5FT3A 1SJIA 3FZAA 1AW9A 3HDCA 4YQMA 1JHBA 5HQPA 2H0IA 5DJMA 2NDOA 4XIHA 1B4PA 1T4YA 4MJEA 3U5RE 4X0XA 3GIXA 1T3BA 2E2GA 1XW5A 3VWVA 2R5GA 4ISDA 3CWGA 5H5SA 4IGJA 1OC9A 3H4KA 3DD3A 4OCEA 2XPEA 2H0GA 4AJ7A 4KNDA 2ES7A 3IR4A 3GX8A 3M1GA 1VF2A 3DEXA 1PGTA 1WOUA 4LL4B 1HQOA 3O3TA 3IDVA 4Q5RA 3LXTA 3ZZXA 5IM9A 1ERTA 3UIWA 5ECRB 5ECQB 1KTEA 1M0UA 2VD0A 2OE0A 3GV1A 3D22A 4ML1A 4DVCA 1OE8A 1DE1A 3HKRA 5IMVA 4DSQA 2YV7A 2NVLA 3ZIVA 3TKPA 3H8QA 2GTUA 3ME7A 1XWAA 1A24A 5A4VA 1XPVA 3A3TA 1J9BA 2X99A 3L9VA 2AB6A 3VPTA 5CREA 4ECCA 1GSDA 2H1LA 2K8VA 4NAXA 3EWLA 2M46A 2WS2A 3APQA 2OBKA 1V2AA 2GSRA 5AGYA 4N0ZA 2LJRA 3KP9A 5D73A 5DAKA 1RQMA 4TRXA 4ICYA 4GLTA 4L8EA 1X9MB 3WGXA 2N5AA 3V1WA 2X49A 2JL4A 4MPGA 3KMOA 1UN2A 4J57E 1V57A 1EEMA 4ZB8A 1NSWA 3C1SA 1ZL9A 3GURA 3ZITA 4JR6A 2VL3A 2WB9A 2P0GA 3UBKA 4IN0A 5JCWA 2VLTA 1T8EB 5EPFA 1THXA 4POLA 4XRAA 4OFTA 1A2JA 2GGTA 3ERWA 2HNLA 1K0OA 4HZ4A 3FHKA 1FVKA 3VI7A 5J4UA 1PQNA 2P5QA 3ZMLA 5ENUA 4EIQA 3CXGA 1Z6NA 4HUAA 2X8HA 2I1UA 2L59A 3ZREA 4TR1B 5CRDA 1S3AA 2LEGA 4Z2RA 4AKIA 1GH2A 2FUG2 5IO2A 5J3RA 5COHA 4BVXA 4JEDA 2VUPA 2FY6A 3DWVA 1GSUA 1X9SB 1ZYNA 4OMVA 4EUYA 3EURA 3MIXA 1ZYPA 2E0QA 5ECMB 3IA1A 5JCGA 1YEPA 3TCOA 4XRDA 3TB2A 5H5RA 3C8EA 1JZOA 1YEXA 4V2MA 3F4RA 4BL7A 3GKNA 3HHVA 1C72A 5J47A 1ZMAA 3ZFBA 4PX1A 2IMIA 3TJBA 4D73B 1ILOA 3MAKA 3ZVJA 1HNAA 4OO5A 3N5OA 1SYXA 3IE3A 2C0EA 3IHQA 5AISA 4KA0A 2DMLA 1I9DA 5INYA 5A34B 2VKZG 3D5JA 5CP1A 2IJYA 2H19A 1EV4A 2IMKA 2VM1A 4IJ3A 4K5RA 4NV5A 1E6BA 3NIVA 1BAYA 2YNXA 2CT6A 5FWGA 1GTAA 1OKTA 3IBHA 3H1NA 5IOXA 1RK4A 4GCIA 4KSMA 4KUNA 4OD7A 4GRFA 3BCKA 3KH7A 2HI7A 1M2AA 3FK8A 4KDYA 3G7IA 3TGZA 2O5VA 2X8GA 2O87A 2PUKC 1SK2A 4MP4A 2R6KA 4MNNA 4ZB9A 2LUSA 4J56E 3GTUB 5IMCA 1G7EA 1V58A 3A5IA 3GKXA 1WRYA 3Q6OA 2YCDA 1B4QA 1XIYA 1A8YA 2YOIA 2VM2A 11GSA 4WF4A 5BRTA 2C8UA 5AIXA 2O89A 1FOVA 2JACA 1TU7A 4O92A 3UBLA 3AY8A 4LA1A 4J2FA 2WRTA 5ELGA 4KDUA 1PKWA 3UOMA 5IPGA 5IMAA 1Y6EA 1XW6A 2VCZA 5HR3A 2YPMA 3F3QA 3P7XA 4G19A 2VIMA 1V98A 4POKA 4WKWA 6GSWA 2FGXA 2L57A 4RI6A 1YJ6A 1GSFA 1XWKA 1BG1A 3ME8A 4QQ7A 4XTSA 5J4YA 1Z6MA 2GDRA 3LXZA 4XCSA 3GHAA 3M8NA 1FOHA 2JSYA 1IYHA 4ECIA 2GQLA 4JR4A 4PGTA 8GSSA 2UV8G 2GSTA 4AI6A 1TI1A 4FYCA 3DKSA 1U88A 2WULA 4HU9A 1JFUA 1URMA 2H6YA 2CVKA 3EVIA 5D9XA 4NWYA 2ON7A 3UVHA 3F6DA 1OYJA 1JZWA 3WGEA 3RDWA 2RIIA 1ERUA 3GN3A 3IK7A 2DJJA 4H86A 1TJDA 2HXKA 1Z3EA 1TTZA 4MABA 17GSA 2AHEA 1TRUA 1LJRA 1LU4A 4XHMA 4BWQA 1U3AA 5CYYA 3O76A 2LSTA 2HSNB 5IO0A 1Z7PA 3TUEA 2D2ZA 1Z9HA 3OR5A 1ZGNA 2K9FA 1O85A 1X5EA 4JBBA 3F3RA 2WZ9A 1G6YA 4YAVA 4Z7XA 3VWXA 2BTOT 1DE2A 1G6WA 4TW5A 1Q4JA 3EPTA 1GTIA 2CZ3A 2H74A 1KEBA 2GSQA 2GVPA 3IRAA 2AAWA 3GL3A 4W66A 4HI7A 3L78A 1GLQA 3TRPA 1F3BA 4QMKA 1MD3A 3SWLA 4CW9A 3QFAC 3J7Yb 14GSA 3WGDA 4BA7A 1B8XA 4K7IA 3BOAA 2PERA 2YWIA 4IKHA 3VLNA 4X43A 3APOA 5GAND 2KP2A 5DQYA 2V6OA 2OACA 4L0UA 3L9SA 3FR3A 4JZQA 2B5XA 1S3DA 5KOWA 5CO3A 1AXDA 1EP7A 1N8JA 2B1LA 3A2VA 2B5EA 3IV4A 4XS1A 1VF4A 2XPDA 5A1NB 2BMXA 4ID0A 4AJ8A 2EIOA 1OKDA 2FD3A 3L9UA 3KMNA 4MCUA 1AUCA 4WEYA 3PH9A 3E3EA 5L71A 4I97A 3H79A 2CV4A 3GH9A 3F63A 2HRFA 1TXXA 3TJFA 5BMUB 1W4VA 3NZNA 1K0BA 3IXRA 4K7NA 3JCML 3VK9A 3IK9A 2CAQA 1GWCA 5AIVA 2X8CA 2MZCA 3C71A 5C00A 3KTLA 5B6MA 4TR4A 3LG6A 1IYIA 2YWOA 3PR8A 1T1VA 4E8EA 1ZYQB 4KX4A 1GNWA 18GSA 1BYEA 1JLWA 5DAKB 3UARA 2H73A 4BVYB 4IS0A 2V1MA 2DJ3A 4YH2A 2PVQA 2PGTA 3VWWA 1PL2A 3BJ5A 4ULXA 1PA3A 1ZCPA 3FZ9A 1EGRA 2VCTA 3LJRA 1DBYA 3G7YA 2I3YA 1SL1B 1WMJA 1PX7A 5F07A 2IMDA 3IC4A 4NPBA 3Q19A 3M0FA 5D93A 3I9V2 4WETA 2B6MA 3C1RA 3UMAA 4ZBAA 3L4NA 2X4AA 4EC0A 1PL1A 4LLRA 1OAZA 1QUWA 2R37A 1VF1A 2YP6A 4ML6A 1EV9A 3PPUA 1V9WA 3F4SA 4CY8A 1U3IA 5G5FA 2B3SA 2PVOC 4E68A 2UZ8A 1B9YC 3WT2A 3M9KA 5DBQA 4POBA 3BD2A 2VCVA 5J4VA 1F2EA 3EINA 4ZL8A 1GTBA 4LMWA 3ZRDA 4EO3A 3TKQA 2LJKA 3IPZA 2DJ2A 2QC7A 1GLPA 3QPMA 2WJUA 1E2YA 2DKIA 3KZQA 4ECBA 1FO5A 4BVXB 4I2UA 5KEJA 5A1NA 1V40A 2C4JA 6GSUA 4O5QA 2R2JA 4PQHA 3FEUA 2DIYA 4Q5QA 1RW1A 1GUKA 2I4AA 1I5GA 2JZRA 1AQWA 5HFGA 1SJZA 3GH6A 4NHZA 1F6MC 2WGRA 4ZL7A 2O85A 1VGLA 5BMUA 1NM3A 2F8AA 3D0ZA 1MDJA 2YANA 3HVXA 2GT5A 4QL9A 4BL7B 2IIYA 3US3A 1JZDA 2WDUA 3UJ1A 2TRCP 1Y1UA 2E2MA 4FO5A 4MMMA 5DVBA 1XOBA 1SK0A 2FA4A 3DIEA 3W8JA 2DKHA 1EOHA 2GZZA 2TRXA 2DLXA 3PGTA 4BVYA 2H6XA 2EIRA 5DCHA 1O73A 5C04A 1H75A 4GSSA 3ED3A 3D4TA 3GSSA 3ZFLA 2L4CA 3QFBC 4HS1A 4K1FA 5A5KA 3QAGA 2GS3A 1BG5A 4PXOA 5B7CA 2V2GA 2HSYA 1WWJA 1K3YA 4OFMA 2PN8A 2HFDA 4MLYA 3KCMA 5DJLA 4TXVA 1EWXA 3WT1A 1GRXA 3CSHA 2LRCA 4BWSA 1T4ZA 5CRGA 1YKCA 1EEJA 1PN9A 1BX9A 1U6TA 5B8BA 2DBCA 1DSBA 1X5CA 3A2WA 2B5YA 3A5WA 2CVBA 1M7TA 1GL8A 3I43A 5IPHA 3CRTA 4YQVA 3EE2A 2NBSA 4K5SA 3LFLA 2I9HA 5E59A 2MMAA 4EE0A 3EMPA 3GKMA 4NV2A 4PQ1A 2O8VB 2L5OA 4AKXB 4O5UA 1TK8B 4GQCA 3D21A 1XWBA 1TI3A 2LKUA 5IMFA 2F51A 2R0CA 2J23A 1J0FA 1FG4A 2JSZA 2K8SA 1QMVA 1UC7A 1GUHA 5ECSA 3O6TA 1HD2A 4NHWA 2MYGA 4K0GA 3FRCA 4GDFA 1YY7A 3HJPA 1XVQA 3MWHA 4MH2A 5KN1A 1SVOA 1YF0A 4N11A 2DJKA 4AKHA 3F0IA 1ERVA 5IOWA 3KJYA 10GSA 3QR6A 5B8AA 3VWUA 5HR1A 4TXOA 2NPBA 1TP9A 3S9FA 2H01A 3BCIA 1T00A 4MF5A 2O7KA 3EC3A 5ID2A 2EIQA 1K0NA 1Y25A 2H70A 4MZWA 3VPQA 4EDYA 3FW2A 4K7OA 1R5PA 4HJ2A 4MH3A 4PQIA 2EFEA 1USBA 5EL8A 1XBSA 4X4JA 4EXJA 2LV3A 2EFHA 2ALBA 4HQZA 5G5EA 1XW9A 1YKAA 1OE7A 3C73A 2V6KA 1XXUA 4PUAA 2FWGA 1GSSA 4G9HA 2OADA 5DQSA 2R0GA 3UL3A 1WPIA 1THOA 4EVMA 4PNFA 2PU9C 2DSAA 4KF9A 1MDIA 5ECOB 4V1Ag 5G31A 4WR5A 1M2DA 2HE3A 3BBYA 1WIKA 3CBUA 3HZ8A 4FH8A 1BQ7A 2R3XA 3CTFA 3Q74A 1X9WB 5CAXA 2F9SA 4GSTA 5F0GA 3GYKA 1O8XA 3DRNA 4ZBDA 4MJBA 1Z7RA 4HQSA 5IMZA 2AV4A 4ECJA 4YAPA 3M9JA 3TDGA 2RUEA 2QSIA 1T7PB 4IP1A 9GSSA 1TKDB 2LRNA 2H75A 4Z2TA 3ZMKA 2B1KA 2DMMA 3TKRA 2MBTA 2LS5A 1FB6A 4POMA 2A4HA 1BEDA 4WF5A 2M72A 5JCUA 1BF5A 3VURA 3CMIA 3ZLPA 2HSMA 5IQYA 2FWHA 2C80A 2DC5A 3GSTA 2AUVA 2Z9SA 2VL2C 2CAIA 2VL2A 3KGKA 3E9JB 4PURA 4FYUA 2H6ZA 3GA4A 4N0VA 4ZXGA 2E7PA 3FYGA 1YVLA 2YWMA 3KXOA 1QGVA 5D8IA 1ON4A 1YZXA 1TRSA 3MYDA 2P31A 1KNGA 2H72A 4ZB7A 3EMXA 3HCZA 2VLVA 4EKZA 2QGVA 4F9ZA 3P8WA 4KGIA 5D9WA 3QD9A 3QCPA 4G01A 2K18A 2PMTA 4MJAA 4TR0A 2H8LA 2VO4A 3PINA 1XWGA 1TW9A 2C0FA 2WFCA 5JWRB 2IMEA 2VL9A 1R5AA 1GSQA 3APSA 4MF7A 4AGSA 3HJOA 3FZ4A 4V2NA 2R4VA 5ECKB 4JU5A 2A2SA 3WD6A 1MEKA 5G1KA 5DALB 4QL7A 3DVXA 6GSYA 1A23A 22GSA 1GSYA 1GTUA 1N25A 2OBIA 2BJXA 3UAPA 5DDLA 2JU5A 4ZIJA 4PNGA 1SKWB 4K0NA 3FY7A 1SENA 1NHYA 1A0FA 2V32A 2OA7A 2XBIA 4OO4A 1GUMA 4XS4B 1M2BA 2QKEA 5G30A 3H93A 4L0WA 3G7JA 3I69A 4KH7A 4OFNA 4TVEA 1YF1A 3CYNA 4IBPA 2YN1A 4MZCA 4OWYA 4BPYA 2HLSA 3KH9A 2JZTA 3ERGA 2GZPA 4ZBBA 3FKFA 4GWRA 1R26A 2ZUPA 3ERFA 4IW9A 5J41A 2CVDA 3GNJA 1CQGA 1TRVA 3KD0A 1G7OA 1BJXA 1AQXA 2DIZA 5KN3A 3D4MA 2H0HA 4DSRA 1XFLA 4JRRA 4G0LA 1SD8A 1TK0B 5JWQB 4YKFA 4V1Ap 1K0MA 2L6CA 3QAVA 2LTKA 2LRTA 4F82A 4MA9A 3CSJA 2LNSA 1PRXA 4CY6A 4LL1B 2MMOA 5ECHB 5LNKe 1XCCA 1AQVA 5FHIA 2H76A 3MDKA 3TKSC 3TKSA 1JLVA 3HY2A 4KCEA 4F2IA 2YV9A 3TJKA 4KB3A 4E8HA 3IC8A 3TU3B 3LWAA 2A2RA 3E0UA 4IJIA 5DALA 4FYBA 3RPPA 1N2AA 1TXUA 3IAM2 2JZSA 3LYPA 3CTGA 2IN3A 2NTOA 3HVVA 2P5RA 2N5BA 4N30A 2REMA 2G0FA 3RPNA 4LMVA 1FVJA 5G2ZA 12GSA 1HYUA 4L5LA 1WE0A 2HQTA 4GSNA 4XS4A 2MMNA 5J40A 3A2XA 5EVOA 4O5RA 1EOGA 2H1AA 2H71A 2EFDA 1ZOFA 5D9TA 5F8BA 3ZVJD 3P2AA 4GXZA 1EZKA 4TKYA 4HZ2A 3R3EA 3TRXA 2K6VA 4NMUA 1PMTA 1ZZYA 3J7Yk 1OC8A 1QK8A 3LEFA 3ISOA 2HZEA 2XC2A 3K8NA 3TOTA 1A2LA 2GT6A 2YJ7A 4G10A 4DSSB 4OCFA 2H1GA 1K3LA 1AIUA 4HOJA 4EL1A 2ZCTA 2C3NA 4ACSA 5GSTA 3EYTA 6GSXA 4K8MA 4KE3A 1JZRA 2YWNA 4TXOB 4TR3A 3F4TA 3LYKA 5J5NA 2KOKA 4GF0A 1G0TA 2GSSA 2ZNMA 4I2TA 4K6XA 3WYWA 3L0HA 1TOFA 5EY6A 3SBCA 5ID2B 1M9BA 5DCGA 3DXBA 1A0RP 4HJMA 4XS6A 1GNEA 4IQ1A 1SL2B 4K9ZA 2IPAA 3QDNA 1SKRB 2CX3A 1GSEA 3HMJG 3F9UA 3GX0A 3GRXA 1W89A 4HU7A 1SK1A 3FZ5A 1J08A 2A2PA 5J9BA 2H1BA 4WR4A 4ILFA 2HT9A 2KP1A 1OVNA 1SJ6A 4YQUA 2HRAA 4RI7A 3KTBA 1PSQA 1WJKA 2LQQA 3IHGA 4TN8A 3NOFA 3GMFA 3ZIJA 3M3MA 4PUFC 1XOAA 3LW9A 3HZ4A 2C3QA 5A5HB 6GSSA 2VCQA 3QMXA 1F3AA 4MDCA 1Z5YE 2X64A 1SYRA 1UVZA 4AF2A 2HYXA 2HSHA 2JADA 4ZL9A 4CDOA 2PBJA 2N5FA 4AKGA 2GQKA 4MZBA 2RM6A 4IQAA 3ZTLA 1ERWA 5ECLB 2OE3A 3GL5A 5KN2A 4Q5FA 1SVLA 2B7JA 13GSA 2XBQA 3FR9A 3D6IA 3IOSA 1R4WA 1EP8A 1GP1A 1ABAA 2IWTA 1S3CA 2XHFA 2FLSA 4EDZA 4DSSA 4GTUA 1GULA 5GSSA 2MBSA 19GSA 3I6AA 3MSZA 1LBKA 4FQUA 2HSMB 4F0BA 4I5QA 5KOXA 1O8WA 1XZOA 3UEMA 4K2XA 4MK3A 1NHOA 1DUGA 1XVWA 1F9MA 4CHSA 2L6DA 1K3OA 2MMZA 4PTSA 1B9XC 1UA5A 5A4UA 4WBJA 2OKAA 4HDEA 5E4WA 3DGQA 1HNBA 4GQFA 4KW6A 2A4VA 3C7MA 2VOCA 20GSA 3Q18A 1YQ1A 1M9AA 3CSIA 4HEA2 2M80A 5G1LA 2YZUA 2VD1A 2IFQB 1AAZA 1ACVA 3VFIA 2RUFA 2KUCA 4G0IA 3LORA 2KHPA 3DMLA 4IVFA 2CZ2A 2H1DA 3DVWA 5ECNB 2WCIA 3TKSE 4V2LA 1QQ2A 5IMDA 2FWFA 1TU8A 1ZYEA 1XWCA 1PN0A 5A5HA 3HYPA 1ML6A 3TOUA 2QA2A 3FMWA 1MD4A 2VAFA 4YKGA 7GSSA 2L5LA 2GZYA 2OJLA 2DJ1A 3HD5A 4FIWA 4JE1A 16GSA 4AJ6A 4IHUA 2HRKB 2RLIA 3N9JA 2PWJA 5JWOB 5H5QA 4MPFA 1QFNA 3KP8A 4TR1A 1K0AA 2OT3A 2VCWA 1B48A 1CQHA 1TDIA 5ECPB 4WXTA 2CX4A 4DEJA 5HR2A 5CNWA 3VI5A 1FHEA 4Z2UA 3QOUA 5HFKA 5F05A 4P3YB 2HZFA 3EU3A 1SL0B 1WP0A 5HR0A 1YDKA 2B7KA 4IP6A 3F8UA 1A2MA 5CRHA 1HNCA 1QXHA 1PKZA 2HRNA 2C0GA 2C0DA 5D96A 4MF6A 1VF3A 3GKKA 2F8FA 3QAWA 4X1UA 3TJJA 3TJGA 3HJMA 1K0CA 1TRWA 3TRQA 2J9HA 2AJQB 4RQRA 4I8BA 1KBNA 3CRUA 3RAZA 4D73A 3FR6A 5KN0A 3KIJA 4K2DA 2TIRA 5J9CA 1MTCA 4G2EA 1SVMA 4O32A 2KLXA 4KSOA 4O7HA 1X5DA 1PD21 2C1YA 5A34A 4EF0A 4NXIA 2H30A 4MJCA 5IIZA 3DYRA 1H4OA 2IFQA 2VCXA 5A4WA 1EGOA 4I6XA 2LNTA 4TOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7U A;  5LD0 A;  1AC1 A;  2FHE A;  5CRW A;  5LCZ A;  4N10 A;  2RM5 A;  3UVT A;  2AYT A;  5ECI B;  4WBR D;  3RBT A;  5ELA A;  3GTU A;  1F37 A;  2YJH A;  2H66 A;  3P90 A;  5GAP D;  5ABR A;  5GZZ B;  2YZH A;  3KEB A;  5HFI A;  1FB0 A;  2F3M A;  2LJA A;  1VRS D;  3W8S A;  3ZYW A;  1Q98 A;  1MDK A;  3MNG A;  2HRK A;  1R7H A;  2GLR A;  2C3T A;  3EU4 A;  1OC9 B;  4RQX A;  1M99 A;  2LQO A;  5D9V A;  1OC3 A;  1FW1 A;  4KCA A;  3RHB A;  2L4Q A;  3KM6 A;  4IEL A;  3HXS A;  1ST9 A;  1NW2 A;  3LGC A;  5B6N A;  5AN1 A;  1SD9 A;  2PPT A;  1U87 A;  1SU9 A;  2HZE B;  2V41 A;  2CQ9 A;  3GFK A;  4Q5N A;  2IL3 A;  2FNO A;  2CA8 A;  3GUS A;  3IAS 2;  3LQ7 A;  2FWE A;  4F0C A;  4KDX A;  4L5O A;  2OE1 A;  3F6F A;  3ZL5 A;  2VLU A;  2ON5 A;  2FA8 A;  1TK5 B;  3U6V A;  3HVS A;  4KAE A;  4ZIL A;  2DJ0 A;  2EC4 A;  2GQM A;  1X0R A;  3R2Q A;  1SKS B;  6GST A;  2IMF A;  2I81 A;  3W6G A;  3HA9 A;  1FAA A;  5F06 A;  4USS A;  3LSZ A;  4ZB6 A;  1O81 A;  1K0D A;  2G2Q A;  3G9B A;  2FCH A;  1O6J A;  4G0K A;  4RUV A;  1PX6 A;  4F03 A;  3RHC A;  1A8L A;  6GSV A;  5FT3 A;  1SJI A;  3FZA A;  1AW9 A;  3HDC A;  4YQM A;  1JHB A;  5HQP A;  2H0I A;  5DJM A;  2NDO A;  4XIH A;  1B4P A;  1T4Y A;  4MJE A;  3U5R E;  4X0X A;  3GIX A;  1T3B A;  2E2G A;  1XW5 A;  3VWV A;  2R5G A;  4ISD A;  5H5S A;  4IGJ A;  1OC9 A;  3H4K A;  3DD3 A;  4OCE A;  2XPE A;  2H0G A;  4AJ7 A;  4KND A;  2ES7 A;  3IR4 A;  3GX8 A;  3M1G A;  1VF2 A;  3DEX A;  1PGT A;  1WOU A;  4LL4 B;  1HQO A;  3O3T A;  3IDV A;  4Q5R A;  3LXT A;  3ZZX A;  5IM9 A;  1ERT A;  3UIW A;  5ECR B;  5ECQ B;  1KTE A;  1M0U A;  2VD0 A;  2OE0 A;  3GV1 A;  3D22 A;  4ML1 A;  4DVC A;  1OE8 A;  1DE1 A;  3HKR A;  5IMV A;  4DSQ A;  2YV7 A;  2NVL A;  3ZIV A;  3TKP A;  3H8Q A;  2GTU A;  3ME7 A;  1XWA A;  1A24 A;  5A4V A;  1XPV A;  3A3T A;  1J9B A;  2X99 A;  3L9V A;  2AB6 A;  3VPT A;  5CRE A;  4ECC A;  1GSD A;  2K8V A;  4NAX A;  3EWL A;  2M46 A;  2WS2 A;  3APQ A;  2OBK A;  1V2A A;  2GSR A;  5AGY A;  4N0Z A;  2LJR A;  3KP9 A;  5D73 A;  5DAK A;  1RQM A;  4TRX A;  4GLT A;  4L8E A;  1X9M B;  3WGX A;  2N5A A;  3V1W A;  2JL4 A;  4MPG A;  3KMO A;  1UN2 A;  4J57 E;  1V57 A;  1EEM A;  4ZB8 A;  1NSW A;  3C1S A;  1ZL9 A;  3GUR A;  3ZIT A;  4JR6 A;  2VL3 A;  2WB9 A;  2P0G A;  3UBK A;  4IN0 A;  5JCW A;  2VLT A;  1T8E B;  5EPF A;  1THX A;  4POL A;  4XRA A;  4OFT A;  1A2J A;  2GGT A;  3ERW A;  2HNL A;  1K0O A;  4HZ4 A;  3FHK A;  1FVK A;  3VI7 A;  5J4U A;  1PQN A;  2P5Q A;  3ZML A;  5ENU A;  3CXG A;  1Z6N A;  4HUA A;  2X8H A;  2I1U A;  2L59 A;  3ZRE A;  4TR1 B;  5CRD A;  1S3A A;  2LEG A;  1GH2 A;  2FUG 2;  5IO2 A;  5J3R A;  5COH A;  4BVX A;  4JED A;  2VUP A;  2FY6 A;  3DWV A;  1GSU A;  1X9S B;  4OMV A;  4EUY A;  3EUR A;  2E0Q A;  5ECM B;  3IA1 A;  5JCG A;  1YEP A;  3TCO A;  4XRD A;  3TB2 A;  5H5R A;  3C8E A;  1JZO A;  1YEX A;  4V2M A;  3F4R A;  4BL7 A;  3GKN A;  3HHV A;  1C72 A;  1ZMA A;  3ZFB A;  4PX1 A;  2IMI A;  3TJB A;  4D73 B;  1ILO A;  3MAK A;  3ZVJ A;  1HNA A;  4OO5 A;  3N5O A;  1SYX A;  3IE3 A;  2C0E A;  3IHQ A;  5AIS A;  4KA0 A;  2DML A;  1I9D A;  5INY A;  3D5J A;  5CP1 A;  2IJY A;  2H19 A;  1EV4 A;  2IMK A;  2VM1 A;  4IJ3 A;  4NV5 A;  1E6B A;  3NIV A;  1BAY A;  2YNX A;  2CT6 A;  5FWG A;  1GTA A;  1OKT A;  3IBH A;  3H1N A;  5IOX A;  1RK4 A;  4GCI A;  4KSM A;  4KUN A;  4OD7 A;  4GRF A;  3BCK A;  3KH7 A;  2HI7 A;  1M2A A;  3FK8 A;  4KDY A;  3G7I A;  3TGZ A;  2X8G A;  2O87 A;  2PUK C;  1SK2 A;  4MP4 A;  2R6K A;  4ZB9 A;  2LUS A;  4J56 E;  3GTU B;  5IMC A;  1G7E A;  1V58 A;  3GKX A;  1WRY A;  3Q6O A;  2YCD A;  1B4Q A;  1XIY A;  1A8Y A;  2YOI A;  2VM2 A;  11GS A;  4WF4 A;  2C8U A;  5AIX A;  2O89 A;  1FOV A;  2JAC A;  1TU7 A;  4O92 A;  3UBL A;  3AY8 A;  4LA1 A;  4J2F A;  2WRT A;  5ELG A;  4KDU A;  1PKW A;  3UOM A;  5IPG A;  5IMA A;  1Y6E A;  1XW6 A;  2VCZ A;  5HR3 A;  2YPM A;  3F3Q A;  3P7X A;  4G19 A;  2VIM A;  1V98 A;  4POK A;  4WKW A;  6GSW A;  2FGX A;  2L57 A;  4RI6 A;  1YJ6 A;  1GSF A;  1XWK A;  3ME8 A;  4QQ7 A;  4XTS A;  1Z6M A;  2GDR A;  3LXZ A;  4XCS A;  3GHA A;  3M8N A;  2JSY A;  1IYH A;  4ECI A;  2GQL A;  4JR4 A;  4PGT A;  8GSS A;  2GST A;  1TI1 A;  4FYC A;  3DKS A;  1U88 A;  2WUL A;  4HU9 A;  1JFU A;  1URM A;  2H6Y A;  2CVK A;  3EVI A;  5D9X A;  4NWY A;  2ON7 A;  3UVH A;  3F6D A;  1OYJ A;  1JZW A;  3WGE A;  3RDW A;  2RII A;  1ERU A;  3GN3 A;  3IK7 A;  2DJJ A;  4H86 A;  1TJD A;  2HXK A;  1Z3E A;  1TTZ A;  4MAB A;  17GS A;  2AHE A;  1TRU A;  1LJR A;  1LU4 A;  4XHM A;  4BWQ A;  1U3A A;  5CYY A;  3O76 A;  2LST A;  2HSN B;  5IO0 A;  1Z7P A;  3TUE A;  2D2Z A;  1Z9H A;  3OR5 A;  1ZGN A;  2K9F A;  1O85 A;  1X5E A;  4JBB A;  3F3R A;  2WZ9 A;  1G6Y A;  4YAV A;  4Z7X A;  3VWX A;  2BTO T;  1DE2 A;  1G6W A;  4TW5 A;  1Q4J A;  1GTI A;  2CZ3 A;  2H74 A;  1KEB A;  2GSQ A;  2GVP A;  3IRA A;  2AAW A;  3GL3 A;  3L78 A;  4HI7 A;  3TRP A;  1GLQ A;  1F3B A;  1MD3 A;  3SWL A;  4CW9 A;  3QFA C;  3J7Y b;  14GS A;  3WGD A;  4BA7 A;  1B8X A;  4K7I A;  3BOA A;  2PER A;  2YWI A;  4IKH A;  3VLN A;  4X43 A;  3APO A;  5GAN D;  2KP2 A;  5DQY A;  2V6O A;  2OAC A;  4L0U A;  3L9S A;  3FR3 A;  4JZQ A;  2B5X A;  1S3D A;  5CO3 A;  1AXD A;  1EP7 A;  1N8J A;  2B1L A;  3A2V A;  2B5E A;  3IV4 A;  4XS1 A;  1VF4 A;  2XPD A;  2BMX A;  4ID0 A;  4AJ8 A;  2EIO A;  1OKD A;  2FD3 A;  3L9U A;  3KMN A;  4MCU A;  1AUC A;  4WEY A;  3PH9 A;  3E3E A;  5L71 A;  4I97 A;  3H79 A;  2CV4 A;  3GH9 A;  3F63 A;  2HRF A;  1TXX A;  3TJF A;  1W4V A;  3NZN A;  1K0B A;  3IXR A;  4K7N A;  3JCM L;  3VK9 A;  3IK9 A;  2CAQ A;  1GWC A;  5AIV A;  2X8C A;  2MZC A;  3C71 A;  5C00 A;  3KTL A;  5B6M A;  4TR4 A;  3LG6 A;  1IYI A;  2YWO A;  3PR8 A;  1T1V A;  4E8E A;  1ZYQ B;  4KX4 A;  1GNW A;  18GS A;  1BYE A;  1JLW A;  5DAK B;  3UAR A;  2H73 A;  4BVY B;  4IS0 A;  2V1M A;  2DJ3 A;  4YH2 A;  2PVQ A;  2PGT A;  3VWW A;  1PL2 A;  3BJ5 A;  4ULX A;  1PA3 A;  1ZCP A;  3FZ9 A;  1EGR A;  2VCT A;  3LJR A;  1DBY A;  3G7Y A;  2I3Y A;  1SL1 B;  1WMJ A;  1PX7 A;  5F07 A;  2IMD A;  3IC4 A;  4NPB A;  3Q19 A;  3M0F A;  5D93 A;  3I9V 2;  4WET A;  2B6M A;  3C1R A;  3UMA A;  4ZBA A;  3L4N A;  4EC0 A;  1PL1 A;  4LLR A;  1OAZ A;  1QUW A;  2R37 A;  1VF1 A;  2YP6 A;  4ML6 A;  1EV9 A;  3PPU A;  1V9W A;  3F4S A;  1U3I A;  5G5F A;  2B3S A;  2PVO C;  2UZ8 A;  1B9Y C;  3WT2 A;  3M9K A;  5DBQ A;  4POB A;  3BD2 A;  2VCV A;  1F2E A;  3EIN A;  4ZL8 A;  1GTB A;  4LMW A;  3ZRD A;  4EO3 A;  3TKQ A;  2LJK A;  3IPZ A;  2DJ2 A;  2QC7 A;  1GLP A;  3QPM A;  2WJU A;  1E2Y A;  3KZQ A;  4ECB A;  1FO5 A;  4BVX B;  4I2U A;  5KEJ A;  1V40 A;  2C4J A;  6GSU A;  2R2J A;  4PQH A;  3FEU A;  2DIY A;  4Q5Q A;  1RW1 A;  1GUK A;  2I4A A;  1I5G A;  2JZR A;  1AQW A;  5HFG A;  1SJZ A;  3GH6 A;  4NHZ A;  1F6M C;  2WGR A;  4ZL7 A;  2O85 A;  1VGL A;  5BMU A;  1NM3 A;  2F8A A;  3D0Z A;  1MDJ A;  2YAN A;  3HVX A;  2GT5 A;  4QL9 A;  4BL7 B;  2IIY A;  3US3 A;  1JZD A;  2WDU A;  3UJ1 A;  2TRC P;  2E2M A;  4FO5 A;  4MMM A;  5DVB A;  1XOB A;  1SK0 A;  2FA4 A;  3DIE A;  3W8J A;  1EOH A;  2GZZ A;  2TRX A;  2DLX A;  3PGT A;  4BVY A;  2H6X A;  2EIR A;  5DCH A;  1O73 A;  5C04 A;  1H75 A;  4GSS A;  3ED3 A;  3D4T A;  3GSS A;  3ZFL A;  2L4C A;  3QFB C;  4HS1 A;  4K1F A;  5A5K A;  3QAG A;  2GS3 A;  1BG5 A;  4PXO A;  5B7C A;  2V2G A;  2HSY A;  1WWJ A;  1K3Y A;  4OFM A;  2PN8 A;  2HFD A;  4MLY A;  3KCM A;  5DJL A;  4TXV A;  1EWX A;  3WT1 A;  1GRX A;  3CSH A;  2LRC A;  4BWS A;  1T4Z A;  5CRG A;  1YKC A;  1EEJ A;  1PN9 A;  1BX9 A;  1U6T A;  5B8B A;  2DBC A;  1DSB A;  1X5C A;  3A2W A;  2B5Y A;  3A5W A;  2CVB A;  1M7T A;  1GL8 A;  3I43 A;  5IPH A;  3CRT A;  4YQV A;  3EE2 A;  2NBS A;  3LFL A;  2I9H A;  5E59 A;  2MMA A;  4EE0 A;  3EMP A;  3GKM A;  4NV2 A;  4PQ1 A;  2O8V B;  2L5O A;  1TK8 B;  4GQC A;  3D21 A;  1XWB A;  1TI3 A;  2LKU A;  5IMF A;  2F51 A;  2J23 A;  1J0F A;  1FG4 A;  2JSZ A;  2K8S A;  1QMV A;  1UC7 A;  1GUH A;  5ECS A;  3O6T A;  1HD2 A;  4NHW A;  2MYG A;  4K0G A;  3FRC A;  1YY7 A;  3HJP A;  1XVQ A;  3MWH A;  4MH2 A;  5KN1 A;  1YF0 A;  4N11 A;  2DJK A;  3F0I A;  1ERV A;  5IOW A;  3KJY A;  10GS A;  3QR6 A;  5B8A A;  3VWU A;  5HR1 A;  4TXO A;  2NPB A;  1TP9 A;  3S9F A;  2H01 A;  3BCI A;  1T00 A;  4MF5 A;  2O7K A;  3EC3 A;  5ID2 A;  2EIQ A;  1K0N A;  1Y25 A;  2H70 A;  4MZW A;  3VPQ A;  4EDY A;  3FW2 A;  4K7O A;  1R5P A;  4HJ2 A;  4MH3 A;  4PQI A;  1USB A;  5EL8 A;  1XBS A;  4EXJ A;  2LV3 A;  2ALB A;  4HQZ A;  5G5E A;  1XW9 A;  1YKA A;  1OE7 A;  3C73 A;  2V6K A;  1XXU A;  4PUA A;  2FWG A;  1GSS A;  4G9H A;  2OAD A;  5DQS A;  3UL3 A;  1WPI A;  1THO A;  4EVM A;  4PNF A;  2PU9 C;  2DSA A;  4KF9 A;  1MDI A;  5ECO B;  4V1A g;  5G31 A;  4WR5 A;  1M2D A;  2HE3 A;  3BBY A;  1WIK A;  3CBU A;  3HZ8 A;  4FH8 A;  1BQ7 A;  2R3X A;  3CTF A;  3Q74 A;  1X9W B;  5CAX A;  2F9S A;  4GST A;  5F0G A;  3GYK A;  1O8X A;  3DRN A;  4ZBD A;  4MJB A;  1Z7R A;  4HQS A;  5IMZ A;  2AV4 A;  4ECJ A;  4YAP A;  3M9J A;  3TDG A;  2RUE A;  2QSI A;  1T7P B;  4IP1 A;  9GSS A;  1TKD B;  2LRN A;  2H75 A;  3ZMK A;  2B1K A;  2DMM A;  3TKR A;  2MBT A;  2LS5 A;  1FB6 A;  4POM A;  1BED A;  4WF5 A;  2M72 A;  5JCU A;  3VUR A;  3CMI A;  3ZLP A;  2HSM A;  5IQY A;  2FWH A;  2C80 A;  2DC5 A;  3GST A;  2AUV A;  2Z9S A;  2VL2 C;  2CAI A;  2VL2 A;  3KGK A;  3E9J B;  4PUR A;  4FYU A;  2H6Z A;  3GA4 A;  4N0V A;  4ZXG A;  2E7P A;  3FYG A;  2YWM A;  3KXO A;  1QGV A;  5D8I A;  1ON4 A;  1YZX A;  1TRS A;  2P31 A;  1KNG A;  2H72 A;  3EMX A;  3HCZ A;  2VLV A;  4EKZ A;  2QGV A;  4F9Z A;  3P8W A;  4KGI A;  5D9W A;  3QD9 A;  3QCP A;  2K18 A;  2PMT A;  4MJA A;  4TR0 A;  2H8L A;  2VO4 A;  3PIN A;  1XWG A;  1TW9 A;  2C0F A;  2WFC A;  5JWR B;  2IME A;  2VL9 A;  1R5A A;  1GSQ A;  3APS A;  4MF7 A;  4AGS A;  3HJO A;  3FZ4 A;  4V2N A;  2R4V A;  5ECK B;  4JU5 A;  2A2S A;  3WD6 A;  1MEK A;  5G1K A;  5DAL B;  4QL7 A;  3DVX A;  6GSY A;  1A23 A;  22GS A;  1GSY A;  1GTU A;  2OBI A;  2BJX A;  3UAP A;  5DDL A;  2JU5 A;  4ZIJ A;  4PNG A;  1SKW B;  4K0N A;  3FY7 A;  1SEN A;  1NHY A;  1A0F A;  2V32 A;  2OA7 A;  2XBI A;  4OO4 A;  1GUM A;  4XS4 B;  1M2B A;  2QKE A;  5G30 A;  3H93 A;  4L0W A;  3G7J A;  3I69 A;  4KH7 A;  4OFN A;  4TVE A;  1YF1 A;  3CYN A;  4IBP A;  2YN1 A;  4MZC A;  4OWY A;  4BPY A;  2HLS A;  3KH9 A;  2JZT A;  3ERG A;  2GZP A;  4ZBB A;  3FKF A;  4GWR A;  1R26 A;  2ZUP A;  3ERF A;  4IW9 A;  5J41 A;  2CVD A;  3GNJ A;  1CQG A;  1TRV A;  3KD0 A;  1G7O A;  1BJX A;  1AQX A;  2DIZ A;  5KN3 A;  3D4M A;  2H0H A;  4DSR A;  1XFL A;  4JRR A;  4G0L A;  1SD8 A;  1TK0 B;  5JWQ B;  4V1A p;  1K0M A;  2L6C A;  3QAV A;  2LTK A;  2LRT A;  4F82 A;  4MA9 A;  3CSJ A;  2LNS A;  1PRX A;  4LL1 B;  2MMO A;  5ECH B;  5LNK e;  1XCC A;  1AQV A;  5FHI A;  2H76 A;  3MDK A;  3TKS C;  3TKS A;  1JLV A;  3HY2 A;  4KCE A;  4F2I A;  2YV9 A;  3TJK A;  4KB3 A;  4E8H A;  3IC8 A;  3LWA A;  2A2R A;  3E0U A;  4IJI A;  5DAL A;  4FYB A;  3RPP A;  1N2A A;  3IAM 2;  2JZS A;  3LYP A;  3CTG A;  2IN3 A;  2NTO A;  3HVV A;  2P5R A;  2N5B A;  4N30 A;  2REM A;  2G0F A;  3RPN A;  4LMV A;  1FVJ A;  5G2Z A;  12GS A;  1HYU A;  4L5L A;  1WE0 A;  2HQT A;  4GSN A;  4XS4 A;  2MMN A;  3A2X A;  5EVO A;  4O5R A;  1EOG A;  2H1A A;  2H71 A;  1ZOF A;  5D9T A;  5F8B A;  3ZVJ D;  3P2A A;  4GXZ A;  1EZK A;  4TKY A;  4HZ2 A;  3R3E A;  3TRX A;  2K6V A;  4NMU A;  1PMT A;  1ZZY A;  3J7Y k;  1OC8 A;  1QK8 A;  3LEF A;  3ISO A;  2HZE A;  2XC2 A;  3K8N A;  3TOT A;  1A2L A;  2GT6 A;  2YJ7 A;  4G10 A;  4DSS B;  4OCF A;  2H1G A;  1K3L A;  1AIU A;  4HOJ A;  4EL1 A;  2ZCT A;  2C3N A;  4ACS A;  5GST A;  3EYT A;  6GSX A;  4K8M A;  4KE3 A;  1JZR A;  2YWN A;  4TXO B;  4TR3 A;  3F4T A;  3LYK A;  5J5N A;  2KOK A;  4GF0 A;  1G0T A;  2GSS A;  2ZNM A;  4I2T A;  4K6X A;  3WYW A;  3L0H A;  1TOF A;  5EY6 A;  3SBC A;  5ID2 B;  1M9B A;  5DCG A;  3DXB A;  1A0R P;  4HJM A;  4XS6 A;  1GNE A;  4IQ1 A;  1SL2 B;  4K9Z A;  2IPA A;  3QDN A;  1SKR B;  2CX3 A;  1GSE A;  3F9U A;  3GX0 A;  3GRX A;  1W89 A;  4HU7 A;  1SK1 A;  3FZ5 A;  1J08 A;  5J9B A;  2H1B A;  4WR4 A;  4ILF A;  2HT9 A;  2KP1 A;  1OVN A;  1SJ6 A;  4YQU A;  2HRA A;  4RI7 A;  3KTB A;  1PSQ A;  1WJK A;  2LQQ A;  4TN8 A;  3NOF A;  3GMF A;  3ZIJ A;  3M3M A;  4PUF C;  1XOA A;  3HZ4 A;  2C3Q A;  6GSS A;  2VCQ A;  3QMX A;  1F3A A;  4MDC A;  1Z5Y E;  2X64 A;  1SYR A;  1UVZ A;  4AF2 A;  2HYX A;  2HSH A;  2JAD A;  4ZL9 A;  4CDO A;  2PBJ A;  2N5F A;  2GQK A;  4MZB A;  2RM6 A;  4IQA A;  3ZTL A;  1ERW A;  5ECL B;  2OE3 A;  3GL5 A;  5KN2 A;  4Q5F A;  2B7J A;  13GS A;  2XBQ A;  3FR9 A;  3D6I A;  3IOS A;  1R4W A;  1EP8 A;  1GP1 A;  1ABA A;  2IWT A;  1S3C A;  2XHF A;  2FLS A;  4EDZ A;  4DSS A;  4GTU A;  1GUL A;  5GSS A;  2MBS A;  19GS A;  3I6A A;  3MSZ A;  1LBK A;  4FQU A;  2HSM B;  4F0B A;  4I5Q A;  1O8W A;  1XZO A;  3UEM A;  4MK3 A;  1NHO A;  1DUG A;  1XVW A;  1F9M A;  4CHS A;  2L6D A;  1K3O A;  2MMZ A;  4PTS A;  1B9X C;  1UA5 A;  5A4U A;  4WBJ A;  2OKA A;  4HDE A;  5E4W A;  3DGQ A;  1HNB A;  4GQF A;  4KW6 A;  2A4V A;  3C7M A;  2VOC A;  20GS A;  3Q18 A;  1YQ1 A;  1M9A A;  3CSI A;  4HEA 2;  2M80 A;  5G1L A;  2YZU A;  2VD1 A;  2IFQ B;  1AAZ A;  1ACV A;  3VFI A;  2RUF A;  2KUC A;  4G0I A;  3LOR A;  2KHP A;  3DML A;  4IVF A;  2CZ2 A;  2H1D A;  3DVW A;  5ECN B;  2WCI A;  3TKS E;  4V2L A;  1QQ2 A;  5IMD A;  2FWF A;  1TU8 A;  1ZYE A;  1XWC A;  3HYP A;  1ML6 A;  3TOU A;  1MD4 A;  2VAF A;  7GSS A;  2L5L A;  2GZY A;  2OJL A;  2DJ1 A;  3HD5 A;  4FIW A;  4JE1 A;  16GS A;  4AJ6 A;  4IHU A;  2HRK B;  2RLI A;  3N9J A;  2PWJ A;  5JWO B;  5H5Q A;  4MPF A;  1QFN A;  3KP8 A;  4TR1 A;  1K0A A;  2VCW A;  1B48 A;  1CQH A;  1TDI A;  5ECP B;  4WXT A;  2CX4 A;  4DEJ A;  5HR2 A;  5CNW A;  3VI5 A;  1FHE A;  3QOU A;  5HFK A;  5F05 A;  4P3Y B;  2HZF A;  3EU3 A;  1SL0 B;  1WP0 A;  5HR0 A;  1YDK A;  2B7K A;  4IP6 A;  3F8U A;  1A2M A;  5CRH A;  1HNC A;  1QXH A;  1PKZ A;  2HRN A;  2C0G A;  2C0D A;  5D96 A;  4MF6 A;  1VF3 A;  3GKK A;  2F8F A;  3QAW A;  4X1U A;  3TJJ A;  3TJG A;  3HJM A;  1K0C A;  1TRW A;  3TRQ A;  2J9H A;  2AJQ B;  4RQR A;  4I8B A;  1KBN A;  3CRU A;  3RAZ A;  4D73 A;  3FR6 A;  5KN0 A;  3KIJ A;  4K2D A;  2TIR A;  5J9C A;  1MTC A;  4G2E A;  4O32 A;  2KLX A;  4KSO A;  4O7H A;  1X5D A;  1PD2 1;  2C1Y A;  4EF0 A;  4NXI A;  2H30 A;  4MJC A;  5IIZ A;  3DYR A;  1H4O A;  2IFQ A;  2VCX A;  5A4W A;  1EGO A;  4I6X A;  2LNT A;  4TOP A; 
#chains in the Genus database with same CATH topology
 1O7U A;  5LD0 A;  1AC1 A;  2FHE A;  5CRW A;  5LCZ A;  4N10 A;  2RM5 A;  3UVT A;  2AYT A;  5ECI B;  4WBR D;  3RBT A;  5ELA A;  3GTU A;  4N3Z A;  1F37 A;  2YJH A;  2H66 A;  3P90 A;  5GAP D;  5ABR A;  5GZZ B;  2YZH A;  3KEB A;  5HFI A;  1FB0 A;  2F3M A;  2LJA A;  1VRS D;  2R0P A;  3W8S A;  3ZYW A;  1Q98 A;  1MDK A;  3MNG A;  2HRK A;  1R7H A;  2QA1 A;  2GLR A;  2C3T A;  3EU4 A;  1OC9 B;  4RQX A;  1M99 A;  2LQO A;  5D9V A;  1OC3 A;  1FW1 A;  4KCA A;  3RHB A;  2L4Q A;  3KM6 A;  4IEL A;  2EFC A;  3HXS A;  4A5P A;  1ST9 A;  1NW2 A;  3LGC A;  5B6N A;  5AN1 A;  1SD9 A;  2PPT A;  1U87 A;  1SU9 A;  2HZE B;  2V41 A;  2CQ9 A;  3GFK A;  4Q5N A;  2IL3 A;  2FNO A;  2CA8 A;  3GUS A;  3IAS 2;  3LQ7 A;  2FWE A;  4F0C A;  4KDX A;  4L5O A;  2OE1 A;  3F6F A;  3ZL5 A;  2VLU A;  2ON5 A;  2FA8 A;  1TK5 B;  3U6V A;  3HVS A;  4KAE A;  4ZIL A;  1M3J A;  2DJ0 A;  2EC4 A;  2GQM A;  1X0R A;  3R2Q A;  1SKS B;  4PI0 C;  6GST A;  2IMF A;  2I81 A;  3W6G A;  3HA9 A;  1FAA A;  5F06 A;  4USS A;  3LSZ A;  4ZB6 A;  1O81 A;  1K0D A;  2G2Q A;  3G9B A;  4EIP A;  2FCH A;  1O6J A;  2HSN A;  4G0K A;  4RUV A;  1PX6 A;  4F03 A;  3RHC A;  1A8L A;  6GSV A;  5FT3 A;  1SJI A;  3FZA A;  1AW9 A;  3HDC A;  4YQM A;  1JHB A;  5HQP A;  2H0I A;  3CQF A;  5DJM A;  2NDO A;  4XIH A;  1B4P A;  1T4Y A;  4MJE A;  3U5R E;  4X0X A;  3GIX A;  2O36 A;  1T3B A;  2E2G A;  1XW5 A;  3VWV A;  2R5G A;  4ISD A;  3CWG A;  5H5S A;  4IGJ A;  1I1I P;  1OC9 A;  3H4K A;  3DD3 A;  4OCE A;  2XPE A;  2H0G A;  4AJ7 A;  4KND A;  2ES7 A;  3IR4 A;  3GX8 A;  3M1G A;  1VF2 A;  3DEX A;  1PGT A;  1WOU A;  4LL4 B;  1HQO A;  3O3T A;  3IDV A;  4Q5R A;  3LXT A;  3ZZX A;  5IM9 A;  1ERT A;  3UIW A;  5ECR B;  5ECQ B;  1KTE A;  1M0U A;  2VD0 A;  2OE0 A;  3GV1 A;  3D22 A;  4ML1 A;  4DVC A;  1OE8 A;  1DE1 A;  3HKR A;  5IMV A;  4DSQ A;  2YV7 A;  2NVL A;  3ZIV A;  3TKP A;  1S4B P;  3H8Q A;  2GTU A;  3ME7 A;  1XWA A;  1A24 A;  5A4V A;  1XPV A;  3A3T A;  1J9B A;  2X99 A;  2WVX B;  3L9V A;  2AB6 A;  3VPT A;  5CRE A;  4ECC A;  1GSD A;  2H1L A;  2K8V A;  4NAX A;  3EWL A;  2M46 A;  2WS2 A;  3APQ A;  2OBK A;  1V2A A;  2GSR A;  5AGY A;  4N0Z A;  2LJR A;  3KP9 A;  5D73 A;  5DAK A;  1RQM A;  4TRX A;  4ICY A;  4GLT A;  4L8E A;  1X9M B;  3WGX A;  2N5A A;  3V1W A;  2X49 A;  2JL4 A;  4MPG A;  3KMO A;  1UN2 A;  4J57 E;  1V57 A;  1EEM A;  4ZB8 A;  1NSW A;  3C1S A;  1ZL9 A;  3GUR A;  3ZIT A;  4JR6 A;  2VL3 A;  2WB9 A;  2P0G A;  3UBK A;  4IN0 A;  5JCW A;  2VLT A;  1S3R A;  1T8E B;  5EPF A;  1PFO A;  1THX A;  4POL A;  4XRA A;  4OFT A;  1A2J A;  2GGT A;  3ERW A;  2HNL A;  1K0O A;  4HZ4 A;  3FHK A;  1FVK A;  3VI7 A;  5J4U A;  1PQN A;  2P5Q A;  3ZML A;  5ENU A;  4EIQ A;  3CXG A;  1Z6N A;  4HUA A;  2X8H A;  2I1U A;  2L59 A;  3ZRE A;  4TR1 B;  5CRD A;  1S3A A;  2LEG A;  4Z2R A;  4AKI A;  1GH2 A;  2FUG 2;  5IO2 A;  5J3R A;  5COH A;  4BVX A;  4JED A;  2VUP A;  2FY6 A;  3DWV A;  1GSU A;  1X9S B;  1ZYN A;  4OMV A;  4EUY A;  3EUR A;  3MIX A;  1ZYP A;  4PHZ C;  2E0Q A;  5ECM B;  3IA1 A;  5JCG A;  1YEP A;  3TCO A;  4XRD A;  3TB2 A;  5H5R A;  3C8E A;  1JZO A;  1YEX A;  4V2M A;  2WVX A;  3F4R A;  4BL7 A;  3GKN A;  3HHV A;  1C72 A;  5J47 A;  1ZMA A;  3ZFB A;  4PX1 A;  2IMI A;  3TJB A;  4D73 B;  1ILO A;  3MAK A;  3ZVJ A;  1HNA A;  4OO5 A;  3N5O A;  1SYX A;  3IE3 A;  2C0E A;  3IHQ A;  5AIS A;  4KA0 A;  2DML A;  1I9D A;  5INY A;  5A34 B;  2VKZ G;  3D5J A;  5CP1 A;  2IJY A;  3RFR C;  2H19 A;  1EV4 A;  2IMK A;  2VM1 A;  4IJ3 A;  4K5R A;  4NV5 A;  1E6B A;  3NIV A;  1BAY A;  2YNX A;  2CT6 A;  5FWG A;  1GTA A;  1OKT A;  3IBH A;  3H1N A;  3RGB C;  5IOX A;  1RK4 A;  4GCI A;  4KSM A;  4KUN A;  4OD7 A;  4GRF A;  3BCK A;  3KH7 A;  2HI7 A;  1M2A A;  3FK8 A;  4KDY A;  3G7I A;  3TGZ A;  2O5V A;  2X8G A;  2O87 A;  2PUK C;  1SK2 A;  4MP4 A;  2R6K A;  4MNN A;  2WZS A;  4ZB9 A;  2LUS A;  4J56 E;  3GTU B;  5IMC A;  1G7E A;  1V58 A;  3A5I A;  3GKX A;  1WRY A;  3Q6O A;  2YCD A;  1B4Q A;  1XIY A;  1A8Y A;  2YOI A;  2VM2 A;  11GS A;  4WF4 A;  5BRT A;  2C8U A;  5AIX A;  2O89 A;  1FOV A;  2JAC A;  1TU7 A;  4O92 A;  3UBL A;  3AY8 A;  4LA1 A;  4J2F A;  2WRT A;  5ELG A;  4KDU A;  1PKW A;  3UOM A;  5IPG A;  5IMA A;  1Y6E A;  1XW6 A;  2VCZ A;  5HR3 A;  2YPM A;  3F3Q A;  3P7X A;  4G19 A;  2VIM A;  1V98 A;  4POK A;  4WKW A;  6GSW A;  2FGX A;  2L57 A;  4RI6 A;  1YJ6 A;  1GSF A;  1XWK A;  1BG1 A;  3ME8 A;  4QQ7 A;  4XTS A;  5J4Y A;  1Z6M A;  2GDR A;  3LXZ A;  4XCS A;  3GHA A;  3M8N A;  1FOH A;  2JSY A;  1IYH A;  4ECI A;  2GQL A;  4JR4 A;  4PGT A;  8GSS A;  2UV8 G;  2GST A;  4AI6 A;  1TI1 A;  4FYC A;  3DKS A;  1U88 A;  2WUL A;  4HU9 A;  1JFU A;  1URM A;  2H6Y A;  2CVK A;  3EVI A;  5D9X A;  4NWY A;  2ON7 A;  3UVH A;  3F6D A;  1OYJ A;  1JZW A;  3WGE A;  3RDW A;  2RII A;  1ERU A;  3GN3 A;  3IK7 A;  2DJJ A;  4H86 A;  1TJD A;  2HXK A;  1Z3E A;  1TTZ A;  4MAB A;  17GS A;  2AHE A;  1TRU A;  1LJR A;  1LU4 A;  4XHM A;  4BWQ A;  1U3A A;  5CYY A;  3O76 A;  2LST A;  2HSN B;  5IO0 A;  1Z7P A;  3TUE A;  2D2Z A;  1Z9H A;  3OR5 A;  1ZGN A;  2K9F A;  1O85 A;  1X5E A;  4JBB A;  3F3R A;  2WZ9 A;  1G6Y A;  4YAV A;  4Z7X A;  3VWX A;  2BTO T;  1DE2 A;  1G6W A;  4TW5 A;  1Q4J A;  3EPT A;  1GTI A;  2CZ3 A;  2H74 A;  1KEB A;  2GSQ A;  2GVP A;  3IRA A;  2AAW A;  3GL3 A;  4W66 A;  4HI7 A;  3L78 A;  1GLQ A;  3TRP A;  1F3B A;  4QMK A;  1MD3 A;  3SWL A;  4CW9 A;  3QFA C;  3J7Y b;  14GS A;  3WGD A;  4BA7 A;  1B8X A;  4K7I A;  3BOA A;  2PER A;  2YWI A;  4IKH A;  3VLN A;  4X43 A;  3APO A;  5GAN D;  2KP2 A;  5DQY A;  2V6O A;  2OAC A;  4L0U A;  3L9S A;  3FR3 A;  4JZQ A;  2B5X A;  1S3D A;  5KOW A;  5CO3 A;  1AXD A;  1EP7 A;  1N8J A;  2B1L A;  3A2V A;  2B5E A;  3IV4 A;  4XS1 A;  1VF4 A;  2XPD A;  5A1N B;  2BMX A;  4ID0 A;  4AJ8 A;  2EIO A;  1OKD A;  2FD3 A;  3L9U A;  3KMN A;  4MCU A;  1AUC A;  4WEY A;  3PH9 A;  3E3E A;  5L71 A;  4I97 A;  3H79 A;  2CV4 A;  3GH9 A;  3F63 A;  2HRF A;  1TXX A;  3TJF A;  5BMU B;  1W4V A;  3NZN A;  1K0B A;  3IXR A;  4K7N A;  3JCM L;  3VK9 A;  3IK9 A;  2CAQ A;  1GWC A;  5AIV A;  2X8C A;  2MZC A;  3C71 A;  5C00 A;  3KTL A;  5B6M A;  4TR4 A;  3LG6 A;  1IYI A;  2YWO A;  3PR8 A;  1T1V A;  4E8E A;  1ZYQ B;  4KX4 A;  1GNW A;  18GS A;  1BYE A;  1JLW A;  5DAK B;  3UAR A;  1M3I A;  2H73 A;  4BVY B;  4IS0 A;  2V1M A;  2DJ3 A;  4YH2 A;  2PVQ A;  2PGT A;  3VWW A;  1PL2 A;  3BJ5 A;  4ULX A;  1PA3 A;  1ZCP A;  3FZ9 A;  1EGR A;  2VCT A;  3LJR A;  1DBY A;  3G7Y A;  2I3Y A;  1SL1 B;  1WMJ A;  1PX7 A;  5F07 A;  2IMD A;  3IC4 A;  4NPB A;  3Q19 A;  3M0F A;  5D93 A;  3I9V 2;  4WET A;  2B6M A;  3C1R A;  3UMA A;  4ZBA A;  3L4N A;  2X4A A;  4EC0 A;  1PL1 A;  4LLR A;  1OAZ A;  1QUW A;  2R37 A;  1VF1 A;  2YP6 A;  4ML6 A;  1EV9 A;  3PPU A;  1V9W A;  3F4S A;  4CY8 A;  1U3I A;  5G5F A;  2B3S A;  2PVO C;  4E68 A;  2UZ8 A;  1B9Y C;  3WT2 A;  3M9K A;  5DBQ A;  4POB A;  3BD2 A;  2VCV A;  5J4V A;  1F2E A;  3EIN A;  4ZL8 A;  1GTB A;  4LMW A;  3ZRD A;  4EO3 A;  3TKQ A;  2LJK A;  3IPZ A;  2DJ2 A;  2QC7 A;  1GLP A;  3QPM A;  2WJU A;  1E2Y A;  2DKI A;  2O3E A;  3KZQ A;  4ECB A;  1FO5 A;  4BVX B;  4I2U A;  5KEJ A;  5A1N A;  1V40 A;  2C4J A;  6GSU A;  4O5Q A;  2R2J A;  4PQH A;  3FEU A;  2DIY A;  4Q5Q A;  1RW1 A;  1GUK A;  2I4A A;  1I5G A;  2JZR A;  1AQW A;  5HFG A;  1SJZ A;  1YEW C;  3GH6 A;  4NHZ A;  1F6M C;  2WGR A;  4ZL7 A;  2O85 A;  1VGL A;  5BMU A;  1NM3 A;  2F8A A;  3D0Z A;  1MDJ A;  2YAN A;  3HVX A;  2GT5 A;  4QL9 A;  4BL7 B;  2IIY A;  3US3 A;  1JZD A;  2WDU A;  3UJ1 A;  2TRC P;  1Y1U A;  2E2M A;  4FO5 A;  4MMM A;  5DVB A;  1XOB A;  1SK0 A;  2FA4 A;  3DIE A;  3W8J A;  2DKH A;  1EOH A;  2GZZ A;  2TRX A;  2DLX A;  3PGT A;  4BVY A;  2H6X A;  2EIR A;  5DCH A;  1O73 A;  5C04 A;  1H75 A;  4GSS A;  3ED3 A;  3D4T A;  3GSS A;  3ZFL A;  2L4C A;  3QFB C;  4HS1 A;  4K1F A;  5A5K A;  3QAG A;  2GS3 A;  1BG5 A;  4PXO A;  5B7C A;  2V2G A;  2HSY A;  1WWJ A;  1K3Y A;  4OFM A;  2PN8 A;  2HFD A;  4MLY A;  3KCM A;  5DJL A;  4TXV A;  1EWX A;  3WT1 A;  1GRX A;  3CSH A;  2LRC A;  4BWS A;  1T4Z A;  5CRG A;  1YKC A;  1EEJ A;  1PN9 A;  1BX9 A;  1U6T A;  5B8B A;  2DBC A;  1DSB A;  1X5C A;  3A2W A;  2B5Y A;  3A5W A;  2CVB A;  1M7T A;  1GL8 A;  3I43 A;  5IPH A;  3CRT A;  4YQV A;  3EE2 A;  2NBS A;  4K5S A;  3LFL A;  2I9H A;  5E59 A;  2WW2 A;  2MMA A;  4EE0 A;  3EMP A;  3GKM A;  4NV2 A;  4PQ1 A;  2O8V B;  2L5O A;  4AKX B;  4O5U A;  1TK8 B;  4GQC A;  3D21 A;  1XWB A;  1TI3 A;  2LKU A;  5IMF A;  2F51 A;  2R0C A;  2J23 A;  1J0F A;  1FG4 A;  2JSZ A;  2K8S A;  1QMV A;  1UC7 A;  1GUH A;  5ECS A;  3O6T A;  1HD2 A;  4NHW A;  2MYG A;  4K0G A;  3FRC A;  4GDF A;  1YY7 A;  3HJP A;  1XVQ A;  3MWH A;  4MH2 A;  5KN1 A;  1SVO A;  1YF0 A;  4N11 A;  2DJK A;  4AKH A;  3F0I A;  1ERV A;  5IOW A;  3KJY A;  10GS A;  3QR6 A;  5B8A A;  3VWU A;  5HR1 A;  4HSC X;  4TXO A;  2NPB A;  1TP9 A;  3S9F A;  2H01 A;  3BCI A;  1T00 A;  4MF5 A;  2O7K A;  3EC3 A;  5ID2 A;  2EIQ A;  1K0N A;  1Y25 A;  2H70 A;  4MZW A;  3VPQ A;  4EDY A;  3FW2 A;  4K7O A;  1R5P A;  4HJ2 A;  4MH3 A;  4PQI A;  2EFE A;  1USB A;  5EL8 A;  1XBS A;  4X4J A;  4EXJ A;  2LV3 A;  2EFH A;  2ALB A;  4HQZ A;  5G5E A;  1XW9 A;  1YKA A;  1OE7 A;  3C73 A;  2V6K A;  1XXU A;  4PUA A;  4PI2 C;  2FWG A;  1GSS A;  4G9H A;  2OAD A;  5DQS A;  2R0G A;  3UL3 A;  1WPI A;  1THO A;  4EVM A;  4PNF A;  2PU9 C;  2DSA A;  4KF9 A;  1MDI A;  5ECO B;  4V1A g;  5G31 A;  4WR5 A;  1M2D A;  2HE3 A;  3BBY A;  1WIK A;  3CBU A;  3HZ8 A;  4FH8 A;  1BQ7 A;  2R3X A;  3CTF A;  3Q74 A;  1X9W B;  5CAX A;  2F9S A;  4GST A;  5F0G A;  3GYK A;  1O8X A;  3DRN A;  4ZBD A;  4MJB A;  1Z7R A;  4HQS A;  5IMZ A;  2AV4 A;  4ECJ A;  4YAP A;  3M9J A;  3TDG A;  4FXY P;  2RUE A;  2QSI A;  1T7P B;  4IP1 A;  9GSS A;  1TKD B;  2LRN A;  2H75 A;  4Z2T A;  3ZMK A;  2B1K A;  2DMM A;  3TKR A;  2MBT A;  2LS5 A;  1FB6 A;  4POM A;  2A4H A;  1BED A;  4WF5 A;  2M72 A;  5JCU A;  1BF5 A;  3VUR A;  3CMI A;  3ZLP A;  2HSM A;  5IQY A;  2FWH A;  2C80 A;  2DC5 A;  3GST A;  2AUV A;  2Z9S A;  2VL2 C;  2CAI A;  2VL2 A;  3KGK A;  3E9J B;  4PUR A;  4FYU A;  2H6Z A;  3GA4 A;  4N0V A;  4ZXG A;  2E7P A;  3FYG A;  1YVL A;  2YWM A;  3KXO A;  1QGV A;  5D8I A;  1ON4 A;  1YZX A;  1TRS A;  3MYD A;  2P31 A;  1KNG A;  2H72 A;  4ZB7 A;  3EMX A;  3HCZ A;  2VLV A;  4EKZ A;  2QGV A;  4F9Z A;  3P8W A;  4KGI A;  5D9W A;  3QD9 A;  3QCP A;  4G01 A;  2K18 A;  2PMT A;  4MJA A;  4TR0 A;  2H8L A;  2VO4 A;  3PIN A;  1XWG A;  1TW9 A;  2C0F A;  2WFC A;  5JWR B;  2IME A;  2VL9 A;  1R5A A;  1GSQ A;  3APS A;  4MF7 A;  4AGS A;  3HJO A;  3FZ4 A;  4V2N A;  2R4V A;  5ECK B;  4JU5 A;  2A2S A;  3WD6 A;  1MEK A;  5G1K A;  5DAL B;  4QL7 A;  3DVX A;  6GSY A;  1A23 A;  22GS A;  1GSY A;  1GTU A;  1N25 A;  2OBI A;  2BJX A;  3UAP A;  5DDL A;  2JU5 A;  4ZIJ A;  4PNG A;  1SKW B;  4K0N A;  3FY7 A;  1SEN A;  1NHY A;  1A0F A;  2V32 A;  2OA7 A;  2XBI A;  4OO4 A;  1GUM A;  4XS4 B;  1M2B A;  2QKE A;  5G30 A;  3H93 A;  4L0W A;  3G7J A;  3I69 A;  4KH7 A;  4OFN A;  4TVE A;  1YF1 A;  3CYN A;  4IBP A;  2YN1 A;  4MZC A;  4OWY A;  4BPY A;  2HLS A;  2WVZ A;  3KH9 A;  2JZT A;  3ERG A;  2GZP A;  4ZBB A;  3FKF A;  4GWR A;  1R26 A;  2ZUP A;  3ERF A;  4IW9 A;  5J41 A;  2CVD A;  3GNJ A;  1CQG A;  1TRV A;  3KD0 A;  1G7O A;  1BJX A;  1AQX A;  2DIZ A;  5KN3 A;  3D4M A;  2H0H A;  4DSR A;  1XFL A;  4JRR A;  4G0L A;  1SD8 A;  1TK0 B;  5JWQ B;  4YKF A;  4V1A p;  1K0M A;  2L6C A;  3QAV A;  2LTK A;  2LRT A;  4F82 A;  4MA9 A;  3CSJ A;  2LNS A;  1PRX A;  4CY6 A;  4LL1 B;  2MMO A;  5ECH B;  5LNK e;  1XCC A;  1AQV A;  5FHI A;  2H76 A;  3MDK A;  3TKS C;  3TKS A;  1JLV A;  3HY2 A;  4KCE A;  4F2I A;  2YV9 A;  3TJK A;  4KB3 A;  4E8H A;  3IC8 A;  3TU3 B;  3LWA A;  2A2R A;  3E0U A;  4IJI A;  5DAL A;  4FYB A;  3RPP A;  1N2A A;  1TXU A;  3IAM 2;  2JZS A;  3LYP A;  3CTG A;  2IN3 A;  2NTO A;  3HVV A;  2P5R A;  2N5B A;  4N30 A;  2REM A;  2G0F A;  3RPN A;  4LMV A;  1FVJ A;  5G2Z A;  12GS A;  1HYU A;  4L5L A;  1WE0 A;  2HQT A;  4GSN A;  4XS4 A;  2MMN A;  5J40 A;  3A2X A;  5EVO A;  4O5R A;  1EOG A;  2H1A A;  2H71 A;  2EFD A;  1ZOF A;  5D9T A;  5F8B A;  3ZVJ D;  3P2A A;  4GXZ A;  1EZK A;  4TKY A;  4HZ2 A;  3CHX C;  3R3E A;  3TRX A;  2K6V A;  4NMU A;  1PMT A;  1ZZY A;  3J7Y k;  1OC8 A;  1QK8 A;  3LEF A;  3ISO A;  2HZE A;  2XC2 A;  3K8N A;  3TOT A;  1A2L A;  2GT6 A;  2YJ7 A;  4G10 A;  4DSS B;  4OCF A;  2H1G A;  1K3L A;  1AIU A;  4HOJ A;  4EL1 A;  2ZCT A;  2C3N A;  4ACS A;  5GST A;  3EYT A;  6GSX A;  4K8M A;  4KE3 A;  1JZR A;  2YWN A;  4TXO B;  4TR3 A;  3F4T A;  3LYK A;  5J5N A;  2KOK A;  4GF0 A;  1G0T A;  2GSS A;  2ZNM A;  4I2T A;  4K6X A;  2WVY A;  3WYW A;  3L0H A;  1TOF A;  5EY6 A;  3SBC A;  5ID2 B;  1M9B A;  5DCG A;  3DXB A;  2WW3 A;  1A0R P;  4HJM A;  4XS6 A;  1GNE A;  4IQ1 A;  1SL2 B;  4K9Z A;  2IPA A;  3QDN A;  1SKR B;  2CX3 A;  1GSE A;  3HMJ G;  3F9U A;  3GX0 A;  3GRX A;  1W89 A;  4HU7 A;  1SK1 A;  3FZ5 A;  1J08 A;  2A2P A;  5J9B A;  2H1B A;  4WR4 A;  4ILF A;  2HT9 A;  2KP1 A;  1OVN A;  1SJ6 A;  4YQU A;  2HRA A;  4RI7 A;  3KTB A;  1PSQ A;  1WJK A;  2LQQ A;  3IHG A;  4TN8 A;  3NOF A;  3GMF A;  3ZIJ A;  3M3M A;  4PUF C;  1XOA A;  3LW9 A;  3HZ4 A;  2C3Q A;  5A5H B;  6GSS A;  2VCQ A;  3QMX A;  1F3A A;  4MDC A;  1Z5Y E;  2X64 A;  1SYR A;  4BIK A;  1UVZ A;  4AF2 A;  2HYX A;  2HSH A;  2JAD A;  4ZL9 A;  4CDO A;  2PBJ A;  2N5F A;  4AKG A;  2GQK A;  4MZB A;  2RM6 A;  4IQA A;  3ZTL A;  1ERW A;  5ECL B;  2OE3 A;  3GL5 A;  5KN2 A;  4Q5F A;  1SVL A;  2B7J A;  13GS A;  2XBQ A;  3FR9 A;  3D6I A;  3IOS A;  1R4W A;  1EP8 A;  1GP1 A;  1ABA A;  2IWT A;  1S3C A;  2XHF A;  2FLS A;  4EDZ A;  4DSS A;  4GTU A;  1GUL A;  5GSS A;  2MBS A;  19GS A;  3I6A A;  3MSZ A;  1LBK A;  4FQU A;  2HSM B;  4F0B A;  4I5Q A;  5KOX A;  1O8W A;  1XZO A;  2WW0 A;  3UEM A;  4K2X A;  4MK3 A;  1NHO A;  1DUG A;  1XVW A;  1F9M A;  4CHS A;  2L6D A;  1K3O A;  2MMZ A;  4PTS A;  1B9X C;  1UA5 A;  5A4U A;  4WBJ A;  2OKA A;  4HDE A;  5E4W A;  3DGQ A;  1HNB A;  4GQF A;  4KW6 A;  2A4V A;  3C7M A;  2VOC A;  20GS A;  3Q18 A;  1YQ1 A;  1M9A A;  3CSI A;  4HEA 2;  2M80 A;  5G1L A;  2YZU A;  2VD1 A;  2IFQ B;  1AAZ A;  1ACV A;  3VFI A;  2RUF A;  2KUC A;  4G0I A;  3LOR A;  2KHP A;  3DML A;  4IVF A;  2CZ2 A;  2H1D A;  3DVW A;  5ECN B;  2WCI A;  3TKS E;  4V2L A;  1QQ2 A;  5IMD A;  2FWF A;  1TU8 A;  1ZYE A;  1XWC A;  1PN0 A;  5A5H A;  3HYP A;  1ML6 A;  3TOU A;  2QA2 A;  3FMW A;  1MD4 A;  2VAF A;  4YKG A;  7GSS A;  2L5L A;  2GZY A;  2OJL A;  2DJ1 A;  3HD5 A;  4FIW A;  4JE1 A;  16GS A;  4AJ6 A;  4IHU A;  2HRK B;  2RLI A;  3N9J A;  2PWJ A;  5JWO B;  5H5Q A;  4MPF A;  1QFN A;  3KP8 A;  4TR1 A;  1K0A A;  2OT3 A;  2VCW A;  1B48 A;  1CQH A;  1TDI A;  5ECP B;  3HVN A;  4WXT A;  2CX4 A;  4DEJ A;  5HR2 A;  5CNW A;  3VI5 A;  1FHE A;  4Z2U A;  3QOU A;  5HFK A;  5F05 A;  4P3Y B;  2HZF A;  3EU3 A;  1SL0 B;  1WP0 A;  5HR0 A;  1YDK A;  2B7K A;  4IP6 A;  3F8U A;  1A2M A;  5CRH A;  1HNC A;  1QXH A;  1PKZ A;  2HRN A;  2C0G A;  2C0D A;  5D96 A;  4MF6 A;  1VF3 A;  3GKK A;  2F8F A;  3QAW A;  4X1U A;  3TJJ A;  3TJG A;  3HJM A;  1K0C A;  1TRW A;  3TRQ A;  2J9H A;  2WW1 A;  2AJQ B;  4RQR A;  4I8B A;  1KBN A;  3CRU A;  3RAZ A;  4D73 A;  3FR6 A;  5KN0 A;  3KIJ A;  4K2D A;  2TIR A;  5J9C A;  1MTC A;  4G2E A;  1SVM A;  4O32 A;  2KLX A;  4KSO A;  4O7H A;  1X5D A;  1PD2 1;  2C1Y A;  5A34 A;  4EF0 A;  4NXI A;  2H30 A;  4MJC A;  5IIZ A;  3DYR A;  1H4O A;  2IFQ A;  2VCX A;  5A4W A;  1EGO A;  4I6X A;  1XG8 A;  2LNT A;  4TOP A; 
#chains in the Genus database with same CATH homology
 1O7U A;  5LD0 A;  1AC1 A;  2FHE A;  5CRW A;  5LCZ A;  4N10 A;  2RM5 A;  3UVT A;  2AYT A;  5ECI B;  4WBR D;  3RBT A;  5ELA A;  3GTU A;  4N3Z A;  1F37 A;  2YJH A;  2H66 A;  3P90 A;  5GAP D;  5ABR A;  5GZZ B;  2YZH A;  3KEB A;  5HFI A;  1FB0 A;  2F3M A;  2LJA A;  1VRS D;  2R0P A;  3W8S A;  3ZYW A;  1Q98 A;  1MDK A;  3MNG A;  2HRK A;  1R7H A;  2QA1 A;  2GLR A;  2C3T A;  3EU4 A;  1OC9 B;  4RQX A;  1M99 A;  2LQO A;  5D9V A;  1OC3 A;  1FW1 A;  4KCA A;  3RHB A;  2L4Q A;  3KM6 A;  4IEL A;  2EFC A;  3HXS A;  4A5P A;  1ST9 A;  1NW2 A;  3LGC A;  5B6N A;  5AN1 A;  1SD9 A;  2PPT A;  1U87 A;  1SU9 A;  2HZE B;  2V41 A;  2CQ9 A;  3GFK A;  4Q5N A;  2IL3 A;  2FNO A;  2CA8 A;  3GUS A;  3IAS 2;  3LQ7 A;  2FWE A;  4F0C A;  4KDX A;  4L5O A;  2OE1 A;  3F6F A;  3ZL5 A;  2VLU A;  2ON5 A;  2FA8 A;  1TK5 B;  3U6V A;  3HVS A;  4KAE A;  4ZIL A;  2DJ0 A;  2EC4 A;  2GQM A;  1X0R A;  3R2Q A;  1SKS B;  6GST A;  2IMF A;  2I81 A;  3W6G A;  3HA9 A;  1FAA A;  5F06 A;  4USS A;  3LSZ A;  4ZB6 A;  1O81 A;  1K0D A;  2G2Q A;  3G9B A;  4EIP A;  2FCH A;  1O6J A;  2HSN A;  4G0K A;  4RUV A;  1PX6 A;  4F03 A;  3RHC A;  1A8L A;  6GSV A;  5FT3 A;  1SJI A;  3FZA A;  1AW9 A;  3HDC A;  4YQM A;  1JHB A;  5HQP A;  2H0I A;  5DJM A;  2NDO A;  4XIH A;  1B4P A;  1T4Y A;  4MJE A;  3U5R E;  4X0X A;  3GIX A;  1T3B A;  2E2G A;  1XW5 A;  3VWV A;  2R5G A;  4ISD A;  3CWG A;  5H5S A;  4IGJ A;  1OC9 A;  3H4K A;  3DD3 A;  4OCE A;  2XPE A;  2H0G A;  4AJ7 A;  4KND A;  2ES7 A;  3IR4 A;  3GX8 A;  3M1G A;  1VF2 A;  3DEX A;  1PGT A;  1WOU A;  4LL4 B;  1HQO A;  3O3T A;  3IDV A;  4Q5R A;  3LXT A;  3ZZX A;  5IM9 A;  1ERT A;  3UIW A;  5ECR B;  5ECQ B;  1KTE A;  1M0U A;  2VD0 A;  2OE0 A;  3GV1 A;  3D22 A;  4ML1 A;  4DVC A;  1OE8 A;  1DE1 A;  3HKR A;  5IMV A;  4DSQ A;  2YV7 A;  2NVL A;  3ZIV A;  3TKP A;  3H8Q A;  2GTU A;  3ME7 A;  1XWA A;  1A24 A;  5A4V A;  1XPV A;  3A3T A;  1J9B A;  2X99 A;  3L9V A;  2AB6 A;  3VPT A;  5CRE A;  4ECC A;  1GSD A;  2H1L A;  2K8V A;  4NAX A;  3EWL A;  2M46 A;  2WS2 A;  3APQ A;  2OBK A;  1V2A A;  2GSR A;  5AGY A;  4N0Z A;  2LJR A;  3KP9 A;  5D73 A;  5DAK A;  1RQM A;  4TRX A;  4ICY A;  4GLT A;  4L8E A;  1X9M B;  3WGX A;  2N5A A;  3V1W A;  2X49 A;  2JL4 A;  4MPG A;  3KMO A;  1UN2 A;  4J57 E;  1V57 A;  1EEM A;  4ZB8 A;  1NSW A;  3C1S A;  1ZL9 A;  3GUR A;  3ZIT A;  4JR6 A;  2VL3 A;  2WB9 A;  2P0G A;  3UBK A;  4IN0 A;  5JCW A;  2VLT A;  1T8E B;  5EPF A;  1THX A;  4POL A;  4XRA A;  4OFT A;  1A2J A;  2GGT A;  3ERW A;  2HNL A;  1K0O A;  4HZ4 A;  3FHK A;  1FVK A;  3VI7 A;  5J4U A;  1PQN A;  2P5Q A;  3ZML A;  5ENU A;  4EIQ A;  3CXG A;  1Z6N A;  4HUA A;  2X8H A;  2I1U A;  2L59 A;  3ZRE A;  4TR1 B;  5CRD A;  1S3A A;  2LEG A;  4Z2R A;  4AKI A;  1GH2 A;  2FUG 2;  5IO2 A;  5J3R A;  5COH A;  4BVX A;  4JED A;  2VUP A;  2FY6 A;  3DWV A;  1GSU A;  1X9S B;  1ZYN A;  4OMV A;  4EUY A;  3EUR A;  3MIX A;  1ZYP A;  2E0Q A;  5ECM B;  3IA1 A;  5JCG A;  1YEP A;  3TCO A;  4XRD A;  3TB2 A;  5H5R A;  3C8E A;  1JZO A;  1YEX A;  4V2M A;  3F4R A;  4BL7 A;  3GKN A;  3HHV A;  1C72 A;  5J47 A;  1ZMA A;  3ZFB A;  4PX1 A;  2IMI A;  3TJB A;  4D73 B;  1ILO A;  3MAK A;  3ZVJ A;  1HNA A;  4OO5 A;  3N5O A;  1SYX A;  3IE3 A;  2C0E A;  3IHQ A;  5AIS A;  4KA0 A;  2DML A;  1I9D A;  5INY A;  5A34 B;  2VKZ G;  3D5J A;  5CP1 A;  2IJY A;  2H19 A;  1EV4 A;  2IMK A;  2VM1 A;  4IJ3 A;  4K5R A;  4NV5 A;  1E6B A;  3NIV A;  1BAY A;  2YNX A;  2CT6 A;  5FWG A;  1GTA A;  1OKT A;  3IBH A;  3H1N A;  5IOX A;  1RK4 A;  4GCI A;  4KSM A;  4KUN A;  4OD7 A;  4GRF A;  3BCK A;  3KH7 A;  2HI7 A;  1M2A A;  3FK8 A;  4KDY A;  3G7I A;  3TGZ A;  2O5V A;  2X8G A;  2O87 A;  2PUK C;  1SK2 A;  4MP4 A;  2R6K A;  4MNN A;  4ZB9 A;  2LUS A;  4J56 E;  3GTU B;  5IMC A;  1G7E A;  1V58 A;  3A5I A;  3GKX A;  1WRY A;  3Q6O A;  2YCD A;  1B4Q A;  1XIY A;  1A8Y A;  2YOI A;  2VM2 A;  11GS A;  4WF4 A;  5BRT A;  2C8U A;  5AIX A;  2O89 A;  1FOV A;  2JAC A;  1TU7 A;  4O92 A;  3UBL A;  3AY8 A;  4LA1 A;  4J2F A;  2WRT A;  5ELG A;  4KDU A;  1PKW A;  3UOM A;  5IPG A;  5IMA A;  1Y6E A;  1XW6 A;  2VCZ A;  5HR3 A;  2YPM A;  3F3Q A;  3P7X A;  4G19 A;  2VIM A;  1V98 A;  4POK A;  4WKW A;  6GSW A;  2FGX A;  2L57 A;  4RI6 A;  1YJ6 A;  1GSF A;  1XWK A;  1BG1 A;  3ME8 A;  4QQ7 A;  4XTS A;  5J4Y A;  1Z6M A;  2GDR A;  3LXZ A;  4XCS A;  3GHA A;  3M8N A;  1FOH A;  2JSY A;  1IYH A;  4ECI A;  2GQL A;  4JR4 A;  4PGT A;  8GSS A;  2UV8 G;  2GST A;  4AI6 A;  1TI1 A;  4FYC A;  3DKS A;  1U88 A;  2WUL A;  4HU9 A;  1JFU A;  1URM A;  2H6Y A;  2CVK A;  3EVI A;  5D9X A;  4NWY A;  2ON7 A;  3UVH A;  3F6D A;  1OYJ A;  1JZW A;  3WGE A;  3RDW A;  2RII A;  1ERU A;  3GN3 A;  3IK7 A;  2DJJ A;  4H86 A;  1TJD A;  2HXK A;  1Z3E A;  1TTZ A;  4MAB A;  17GS A;  2AHE A;  1TRU A;  1LJR A;  1LU4 A;  4XHM A;  4BWQ A;  1U3A A;  5CYY A;  3O76 A;  2LST A;  2HSN B;  5IO0 A;  1Z7P A;  3TUE A;  2D2Z A;  1Z9H A;  3OR5 A;  1ZGN A;  2K9F A;  1O85 A;  1X5E A;  4JBB A;  3F3R A;  2WZ9 A;  1G6Y A;  4YAV A;  4Z7X A;  3VWX A;  2BTO T;  1DE2 A;  1G6W A;  4TW5 A;  1Q4J A;  3EPT A;  1GTI A;  2CZ3 A;  2H74 A;  1KEB A;  2GSQ A;  2GVP A;  3IRA A;  2AAW A;  3GL3 A;  4W66 A;  4HI7 A;  3L78 A;  1GLQ A;  3TRP A;  1F3B A;  4QMK A;  1MD3 A;  3SWL A;  4CW9 A;  3QFA C;  3J7Y b;  14GS A;  3WGD A;  4BA7 A;  1B8X A;  4K7I A;  3BOA A;  2PER A;  2YWI A;  4IKH A;  3VLN A;  4X43 A;  3APO A;  5GAN D;  2KP2 A;  5DQY A;  2V6O A;  2OAC A;  4L0U A;  3L9S A;  3FR3 A;  4JZQ A;  2B5X A;  1S3D A;  5KOW A;  5CO3 A;  1AXD A;  1EP7 A;  1N8J A;  2B1L A;  3A2V A;  2B5E A;  3IV4 A;  4XS1 A;  1VF4 A;  2XPD A;  5A1N B;  2BMX A;  4ID0 A;  4AJ8 A;  2EIO A;  1OKD A;  2FD3 A;  3L9U A;  3KMN A;  4MCU A;  1AUC A;  4WEY A;  3PH9 A;  3E3E A;  5L71 A;  4I97 A;  3H79 A;  2CV4 A;  3GH9 A;  3F63 A;  2HRF A;  1TXX A;  3TJF A;  5BMU B;  1W4V A;  3NZN A;  1K0B A;  3IXR A;  4K7N A;  3JCM L;  3VK9 A;  3IK9 A;  2CAQ A;  1GWC A;  5AIV A;  2X8C A;  2MZC A;  3C71 A;  5C00 A;  3KTL A;  5B6M A;  4TR4 A;  3LG6 A;  1IYI A;  2YWO A;  3PR8 A;  1T1V A;  4E8E A;  1ZYQ B;  4KX4 A;  1GNW A;  18GS A;  1BYE A;  1JLW A;  5DAK B;  3UAR A;  2H73 A;  4BVY B;  4IS0 A;  2V1M A;  2DJ3 A;  4YH2 A;  2PVQ A;  2PGT A;  3VWW A;  1PL2 A;  3BJ5 A;  4ULX A;  1PA3 A;  1ZCP A;  3FZ9 A;  1EGR A;  2VCT A;  3LJR A;  1DBY A;  3G7Y A;  2I3Y A;  1SL1 B;  1WMJ A;  1PX7 A;  5F07 A;  2IMD A;  3IC4 A;  4NPB A;  3Q19 A;  3M0F A;  5D93 A;  3I9V 2;  4WET A;  2B6M A;  3C1R A;  3UMA A;  4ZBA A;  3L4N A;  2X4A A;  4EC0 A;  1PL1 A;  4LLR A;  1OAZ A;  1QUW A;  2R37 A;  1VF1 A;  2YP6 A;  4ML6 A;  1EV9 A;  3PPU A;  1V9W A;  3F4S A;  4CY8 A;  1U3I A;  5G5F A;  2B3S A;  2PVO C;  4E68 A;  2UZ8 A;  1B9Y C;  3WT2 A;  3M9K A;  5DBQ A;  4POB A;  3BD2 A;  2VCV A;  5J4V A;  1F2E A;  3EIN A;  4ZL8 A;  1GTB A;  4LMW A;  3ZRD A;  4EO3 A;  3TKQ A;  2LJK A;  3IPZ A;  2DJ2 A;  2QC7 A;  1GLP A;  3QPM A;  2WJU A;  1E2Y A;  2DKI A;  3KZQ A;  4ECB A;  1FO5 A;  4BVX B;  4I2U A;  5KEJ A;  5A1N A;  1V40 A;  2C4J A;  6GSU A;  4O5Q A;  2R2J A;  4PQH A;  3FEU A;  2DIY A;  4Q5Q A;  1RW1 A;  1GUK A;  2I4A A;  1I5G A;  2JZR A;  1AQW A;  5HFG A;  1SJZ A;  3GH6 A;  4NHZ A;  1F6M C;  2WGR A;  4ZL7 A;  2O85 A;  1VGL A;  5BMU A;  1NM3 A;  2F8A A;  3D0Z A;  1MDJ A;  2YAN A;  3HVX A;  2GT5 A;  4QL9 A;  4BL7 B;  2IIY A;  3US3 A;  1JZD A;  2WDU A;  3UJ1 A;  2TRC P;  1Y1U A;  2E2M A;  4FO5 A;  4MMM A;  5DVB A;  1XOB A;  1SK0 A;  2FA4 A;  3DIE A;  3W8J A;  2DKH A;  1EOH A;  2GZZ A;  2TRX A;  2DLX A;  3PGT A;  4BVY A;  2H6X A;  2EIR A;  5DCH A;  1O73 A;  5C04 A;  1H75 A;  4GSS A;  3ED3 A;  3D4T A;  3GSS A;  3ZFL A;  2L4C A;  3QFB C;  4HS1 A;  4K1F A;  5A5K A;  3QAG A;  2GS3 A;  1BG5 A;  4PXO A;  5B7C A;  2V2G A;  2HSY A;  1WWJ A;  1K3Y A;  4OFM A;  2PN8 A;  2HFD A;  4MLY A;  3KCM A;  5DJL A;  4TXV A;  1EWX A;  3WT1 A;  1GRX A;  3CSH A;  2LRC A;  4BWS A;  1T4Z A;  5CRG A;  1YKC A;  1EEJ A;  1PN9 A;  1BX9 A;  1U6T A;  5B8B A;  2DBC A;  1DSB A;  1X5C A;  3A2W A;  2B5Y A;  3A5W A;  2CVB A;  1M7T A;  1GL8 A;  3I43 A;  5IPH A;  3CRT A;  4YQV A;  3EE2 A;  2NBS A;  4K5S A;  3LFL A;  2I9H A;  5E59 A;  2MMA A;  4EE0 A;  3EMP A;  3GKM A;  4NV2 A;  4PQ1 A;  2O8V B;  2L5O A;  4AKX B;  4O5U A;  1TK8 B;  4GQC A;  3D21 A;  1XWB A;  1TI3 A;  2LKU A;  5IMF A;  2F51 A;  2R0C A;  2J23 A;  1J0F A;  1FG4 A;  2JSZ A;  2K8S A;  1QMV A;  1UC7 A;  1GUH A;  5ECS A;  3O6T A;  1HD2 A;  4NHW A;  2MYG A;  4K0G A;  3FRC A;  4GDF A;  1YY7 A;  3HJP A;  1XVQ A;  3MWH A;  4MH2 A;  5KN1 A;  1SVO A;  1YF0 A;  4N11 A;  2DJK A;  4AKH A;  3F0I A;  1ERV A;  5IOW A;  3KJY A;  10GS A;  3QR6 A;  5B8A A;  3VWU A;  5HR1 A;  4TXO A;  2NPB A;  1TP9 A;  3S9F A;  2H01 A;  3BCI A;  1T00 A;  4MF5 A;  2O7K A;  3EC3 A;  5ID2 A;  2EIQ A;  1K0N A;  1Y25 A;  2H70 A;  4MZW A;  3VPQ A;  4EDY A;  3FW2 A;  4K7O A;  1R5P A;  4HJ2 A;  4MH3 A;  4PQI A;  2EFE A;  1USB A;  5EL8 A;  1XBS A;  4X4J A;  4EXJ A;  2LV3 A;  2EFH A;  2ALB A;  4HQZ A;  5G5E A;  1XW9 A;  1YKA A;  1OE7 A;  3C73 A;  2V6K A;  1XXU A;  4PUA A;  2FWG A;  1GSS A;  4G9H A;  2OAD A;  5DQS A;  2R0G A;  3UL3 A;  1WPI A;  1THO A;  4EVM A;  4PNF A;  2PU9 C;  2DSA A;  4KF9 A;  1MDI A;  5ECO B;  4V1A g;  5G31 A;  4WR5 A;  1M2D A;  2HE3 A;  3BBY A;  1WIK A;  3CBU A;  3HZ8 A;  4FH8 A;  1BQ7 A;  2R3X A;  3CTF A;  3Q74 A;  1X9W B;  5CAX A;  2F9S A;  4GST A;  5F0G A;  3GYK A;  1O8X A;  3DRN A;  4ZBD A;  4MJB A;  1Z7R A;  4HQS A;  5IMZ A;  2AV4 A;  4ECJ A;  4YAP A;  3M9J A;  3TDG A;  2RUE A;  2QSI A;  1T7P B;  4IP1 A;  9GSS A;  1TKD B;  2LRN A;  2H75 A;  4Z2T A;  3ZMK A;  2B1K A;  2DMM A;  3TKR A;  2MBT A;  2LS5 A;  1FB6 A;  4POM A;  2A4H A;  1BED A;  4WF5 A;  2M72 A;  5JCU A;  1BF5 A;  3VUR A;  3CMI A;  3ZLP A;  2HSM A;  5IQY A;  2FWH A;  2C80 A;  2DC5 A;  3GST A;  2AUV A;  2Z9S A;  2VL2 C;  2CAI A;  2VL2 A;  3KGK A;  3E9J B;  4PUR A;  4FYU A;  2H6Z A;  3GA4 A;  4N0V A;  4ZXG A;  2E7P A;  3FYG A;  1YVL A;  2YWM A;  3KXO A;  1QGV A;  5D8I A;  1ON4 A;  1YZX A;  1TRS A;  3MYD A;  2P31 A;  1KNG A;  2H72 A;  4ZB7 A;  3EMX A;  3HCZ A;  2VLV A;  4EKZ A;  2QGV A;  4F9Z A;  3P8W A;  4KGI A;  5D9W A;  3QD9 A;  3QCP A;  4G01 A;  2K18 A;  2PMT A;  4MJA A;  4TR0 A;  2H8L A;  2VO4 A;  3PIN A;  1XWG A;  1TW9 A;  2C0F A;  2WFC A;  5JWR B;  2IME A;  2VL9 A;  1R5A A;  1GSQ A;  3APS A;  4MF7 A;  4AGS A;  3HJO A;  3FZ4 A;  4V2N A;  2R4V A;  5ECK B;  4JU5 A;  2A2S A;  3WD6 A;  1MEK A;  5G1K A;  5DAL B;  4QL7 A;  3DVX A;  6GSY A;  1A23 A;  22GS A;  1GSY A;  1GTU A;  1N25 A;  2OBI A;  2BJX A;  3UAP A;  5DDL A;  2JU5 A;  4ZIJ A;  4PNG A;  1SKW B;  4K0N A;  3FY7 A;  1SEN A;  1NHY A;  1A0F A;  2V32 A;  2OA7 A;  2XBI A;  4OO4 A;  1GUM A;  4XS4 B;  1M2B A;  2QKE A;  5G30 A;  3H93 A;  4L0W A;  3G7J A;  3I69 A;  4KH7 A;  4OFN A;  4TVE A;  1YF1 A;  3CYN A;  4IBP A;  2YN1 A;  4MZC A;  4OWY A;  4BPY A;  2HLS A;  3KH9 A;  2JZT A;  3ERG A;  2GZP A;  4ZBB A;  3FKF A;  4GWR A;  1R26 A;  2ZUP A;  3ERF A;  4IW9 A;  5J41 A;  2CVD A;  3GNJ A;  1CQG A;  1TRV A;  3KD0 A;  1G7O A;  1BJX A;  1AQX A;  2DIZ A;  5KN3 A;  3D4M A;  2H0H A;  4DSR A;  1XFL A;  4JRR A;  4G0L A;  1SD8 A;  1TK0 B;  5JWQ B;  4YKF A;  4V1A p;  1K0M A;  2L6C A;  3QAV A;  2LTK A;  2LRT A;  4F82 A;  4MA9 A;  3CSJ A;  2LNS A;  1PRX A;  4CY6 A;  4LL1 B;  2MMO A;  5ECH B;  5LNK e;  1XCC A;  1AQV A;  5FHI A;  2H76 A;  3MDK A;  3TKS C;  3TKS A;  1JLV A;  3HY2 A;  4KCE A;  4F2I A;  2YV9 A;  3TJK A;  4KB3 A;  4E8H A;  3IC8 A;  3TU3 B;  3LWA A;  2A2R A;  3E0U A;  4IJI A;  5DAL A;  4FYB A;  3RPP A;  1N2A A;  1TXU A;  3IAM 2;  2JZS A;  3LYP A;  3CTG A;  2IN3 A;  2NTO A;  3HVV A;  2P5R A;  2N5B A;  4N30 A;  2REM A;  2G0F A;  3RPN A;  4LMV A;  1FVJ A;  5G2Z A;  12GS A;  1HYU A;  4L5L A;  1WE0 A;  2HQT A;  4GSN A;  4XS4 A;  2MMN A;  5J40 A;  3A2X A;  5EVO A;  4O5R A;  1EOG A;  2H1A A;  2H71 A;  2EFD A;  1ZOF A;  5D9T A;  5F8B A;  3ZVJ D;  3P2A A;  4GXZ A;  1EZK A;  4TKY A;  4HZ2 A;  3R3E A;  3TRX A;  2K6V A;  4NMU A;  1PMT A;  1ZZY A;  3J7Y k;  1OC8 A;  1QK8 A;  3LEF A;  3ISO A;  2HZE A;  2XC2 A;  3K8N A;  3TOT A;  1A2L A;  2GT6 A;  2YJ7 A;  4G10 A;  4DSS B;  4OCF A;  2H1G A;  1K3L A;  1AIU A;  4HOJ A;  4EL1 A;  2ZCT A;  2C3N A;  4ACS A;  5GST A;  3EYT A;  6GSX A;  4K8M A;  4KE3 A;  1JZR A;  2YWN A;  4TXO B;  4TR3 A;  3F4T A;  3LYK A;  5J5N A;  2KOK A;  4GF0 A;  1G0T A;  2GSS A;  2ZNM A;  4I2T A;  4K6X A;  3WYW A;  3L0H A;  1TOF A;  5EY6 A;  3SBC A;  5ID2 B;  1M9B A;  5DCG A;  3DXB A;  1A0R P;  4HJM A;  4XS6 A;  1GNE A;  4IQ1 A;  1SL2 B;  4K9Z A;  2IPA A;  3QDN A;  1SKR B;  2CX3 A;  1GSE A;  3HMJ G;  3F9U A;  3GX0 A;  3GRX A;  1W89 A;  4HU7 A;  1SK1 A;  3FZ5 A;  1J08 A;  2A2P A;  5J9B A;  2H1B A;  4WR4 A;  4ILF A;  2HT9 A;  2KP1 A;  1OVN A;  1SJ6 A;  4YQU A;  2HRA A;  4RI7 A;  3KTB A;  1PSQ A;  1WJK A;  2LQQ A;  3IHG A;  4TN8 A;  3NOF A;  3GMF A;  3ZIJ A;  3M3M A;  4PUF C;  1XOA A;  3LW9 A;  3HZ4 A;  2C3Q A;  5A5H B;  6GSS A;  2VCQ A;  3QMX A;  1F3A A;  4MDC A;  1Z5Y E;  2X64 A;  1SYR A;  1UVZ A;  4AF2 A;  2HYX A;  2HSH A;  2JAD A;  4ZL9 A;  4CDO A;  2PBJ A;  2N5F A;  4AKG A;  2GQK A;  4MZB A;  2RM6 A;  4IQA A;  3ZTL A;  1ERW A;  5ECL B;  2OE3 A;  3GL5 A;  5KN2 A;  4Q5F A;  1SVL A;  2B7J A;  13GS A;  2XBQ A;  3FR9 A;  3D6I A;  3IOS A;  1R4W A;  1EP8 A;  1GP1 A;  1ABA A;  2IWT A;  1S3C A;  2XHF A;  2FLS A;  4EDZ A;  4DSS A;  4GTU A;  1GUL A;  5GSS A;  2MBS A;  19GS A;  3I6A A;  3MSZ A;  1LBK A;  4FQU A;  2HSM B;  4F0B A;  4I5Q A;  5KOX A;  1O8W A;  1XZO A;  3UEM A;  4K2X A;  4MK3 A;  1NHO A;  1DUG A;  1XVW A;  1F9M A;  4CHS A;  2L6D A;  1K3O A;  2MMZ A;  4PTS A;  1B9X C;  1UA5 A;  5A4U A;  4WBJ A;  2OKA A;  4HDE A;  5E4W A;  3DGQ A;  1HNB A;  4GQF A;  4KW6 A;  2A4V A;  3C7M A;  2VOC A;  20GS A;  3Q18 A;  1YQ1 A;  1M9A A;  3CSI A;  4HEA 2;  2M80 A;  5G1L A;  2YZU A;  2VD1 A;  2IFQ B;  1AAZ A;  1ACV A;  3VFI A;  2RUF A;  2KUC A;  4G0I A;  3LOR A;  2KHP A;  3DML A;  4IVF A;  2CZ2 A;  2H1D A;  3DVW A;  5ECN B;  2WCI A;  3TKS E;  4V2L A;  1QQ2 A;  5IMD A;  2FWF A;  1TU8 A;  1ZYE A;  1XWC A;  1PN0 A;  5A5H A;  3HYP A;  1ML6 A;  3TOU A;  2QA2 A;  3FMW A;  1MD4 A;  2VAF A;  4YKG A;  7GSS A;  2L5L A;  2GZY A;  2OJL A;  2DJ1 A;  3HD5 A;  4FIW A;  4JE1 A;  16GS A;  4AJ6 A;  4IHU A;  2HRK B;  2RLI A;  3N9J A;  2PWJ A;  5JWO B;  5H5Q A;  4MPF A;  1QFN A;  3KP8 A;  4TR1 A;  1K0A A;  2OT3 A;  2VCW A;  1B48 A;  1CQH A;  1TDI A;  5ECP B;  4WXT A;  2CX4 A;  4DEJ A;  5HR2 A;  5CNW A;  3VI5 A;  1FHE A;  4Z2U A;  3QOU A;  5HFK A;  5F05 A;  4P3Y B;  2HZF A;  3EU3 A;  1SL0 B;  1WP0 A;  5HR0 A;  1YDK A;  2B7K A;  4IP6 A;  3F8U A;  1A2M A;  5CRH A;  1HNC A;  1QXH A;  1PKZ A;  2HRN A;  2C0G A;  2C0D A;  5D96 A;  4MF6 A;  1VF3 A;  3GKK A;  2F8F A;  3QAW A;  4X1U A;  3TJJ A;  3TJG A;  3HJM A;  1K0C A;  1TRW A;  3TRQ A;  2J9H A;  2AJQ B;  4RQR A;  4I8B A;  1KBN A;  3CRU A;  3RAZ A;  4D73 A;  3FR6 A;  5KN0 A;  3KIJ A;  4K2D A;  2TIR A;  5J9C A;  1MTC A;  4G2E A;  1SVM A;  4O32 A;  2KLX A;  4KSO A;  4O7H A;  1X5D A;  1PD2 1;  2C1Y A;  5A34 A;  4EF0 A;  4NXI A;  2H30 A;  4MJC A;  5IIZ A;  3DYR A;  1H4O A;  2IFQ A;  2VCX A;  5A4W A;  1EGO A;  4I6X A;  2LNT A;  4TOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...