1PA3A

Crystal structure of glutathione-s-transferase from plasmodium falciparum
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
196
Chain Sequence
b'IVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione s-transferase, putative
publication title Native and inhibited structure of a Mu class-related glutathione S-transferase from Plasmodium falciparum
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 66
structure length 196
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pa3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pa3A01
3TUEA 1OVNA 2HE3A 3J7Yk 1AIUA 4KSOA 4JU5A 1R4WA 5J9CA 2VCZA 2R37A 3BBYA 2OJLA 3P8WA 3GX8A 2J9HA 1SKSB 4L8EA 1BYEA 2LNSA 1OC9A 4MP4A 2H71A 2CQ9A 4KCAA 1SD8A 2IMIA 4XTSA 1WIKA 3TOTA 1Z3EA 2N5BA 1R5PA 3GTUB 2V32A 3F4RA 3FKFA 1EOHA 4YH2A 2HSMA 4EF0A 4GTUA 3ZITA 2V6KA 5J4UA 5DBQA 1CQHA 1GUHA 1AQVA 1S3DA 3ED3A 2JZSA 1MTCA 2HLSA 3L78A 3FR9A 3QFAC 5AIXA 1DE1A 1T8EB 2FHEA 1U87A 4GXZA 1R5AA 4CW9A 3A5WA 2H1BA 2IWTA 1ZOFA 4IVFA 1GULA 3PR8A 4KH7A 3IK9A 4OWYA 2CVKA 3KGKA 3C73A 3WGXA 1TDIA 3BD2A 2YP6A 4KCEA 1E6BA 2HI7A 3FY7A 2MZCA 1M2AA 2GVPA 3H8QA 5D73A 3EMPA 3I69A 1X9WB 1AQWA 2V1MA 5CREA 1XW9A 4MJBA 14GSA 4AF2A 1ZYQB 3VWUA 2B5EA 3A2XA 5CRWA 1Z5YE 3GFKA 3HVSA 2MMNA 11GSA 1JZRA 3FRCA 4PGTA 4BA7A 1M2BA 1GL8A 3F8UA 5BMUA 4NWYA 4N11A 3C1SA 2LNTA 1OC9B 4DSSA 2VM1A 3C1RA 1QMVA 1XWKA 2GQKA 2KUCA 5G1KA 1VF4A 2XC2A 1F37A 1SENA 3HJPA 2N5AA 2CZ3A 4LL4B 3HZ4A 4TXOA 2VCXA 5HR2A 1G0TA 1TU8A 3IA1A 1SKRB 2GZZA 1SK0A 3O6TA 1Q98A 1UVZA 3D22A 4L0UA 5IMCA 3BCIA 2B3SA 1SL2B 4TR3A 3ZIVA 2FY6A 3W6GA 2I9HA 4IJIA 5ECQB 2P31A 2M46A 1ZMAA 4EKZA 3IK7A 9GSSA 3ERFA 5D96A 2A4VA 5HR0A 1A2LA 3IHQA 2GT5A 3LJRA 5KN3A 5D9WA 4FH8A 4XS1A 3VFIA 2C8UA 4JEDA 5D8IA 4JR4A 4N0VA 1AUCA 1WOUA 2QKEA 1JHBA 3SWLA 1FHEA 1TK5B 4IBPA 4EE0A 2H1GA 2L59A 4NMUA 4WKWA 2RLIA 2UZ8A 5HFKA 3KCMA 2BMXA 1PSQA 2K18A 1MDKA 3IE3A 2YN1A 4IP6A 4WBRD 4DSSB 4K8MA 1FVKA 3RHBA 1TRSA 1FVJA 4IJ3A 4PQ1A 5F8BA 4F9ZA 1DBYA 4F2IA 1MDIA 4TRXA 1TP9A 2C0DA 1TI3A 5B8AA 4FYBA 1GSQA 4TXOB 3DIEA 5ECKB 5J41A 4IN0A 4MJCA 2JSZA 5IPHA 2A2SA 4EL1A 1ON4A 1UC7A 3TJKA 2E2MA 3TRQA 6GSUA 3GUSA 5H5QA 2KOKA 4IS0A 1PA3A 1EWXA 5IOWA 1ZZYA 4I2TA 4BPYA 2RUEA 1AC1A 4V2MA 1TI1A 5ELAA 4NHZA 4P3YB 5DQYA 1ERTA 4YAVA 3OR5A 1PMTA 4FYUA 4ECCA 1K3LA 4FYCA 1EEMA 4MCUA 2E7PA 1BG5A 2HQTA 5LCZA 2GDRA 4BVYA 3KH9A 2DMLA 1ST9A 2R4VA 2V2GA 4JBBA 5GSSA 1ZCPA 1XXUA 4WF4A 2VLVA 2VM2A 3QFBC 5CRDA 4MABA 2K8VA 2F9SA 1XZOA 3M8NA 1OE7A 3L9SA 2IMDA 2MMAA 3GSTA 4PNGA 3F6DA 5EY6A 1OKTA 1S3CA 4YQVA 1WMJA 3TRXA 5F06A 3APOA 2OKAA 3D5JA 4HS1A 1EP7A 2I4AA 1M99A 1MDJA 3UAPA 4TN8A 4JRRA 1LBKA 4OD7A 4MPGA 1KBNA 4KNDA 2L5LA 1Z6MA 3P7XA 3ZRDA 3QR6A 2LTKA 2HFDA 4MA9A 1TW9A 4YQUA 4V1Ag 5G2ZA 4PUFC 4QQ7A 2VD1A 18GSA 1J9BA 5IMVA 2WS2A 4RQXA 1OE8A 1JLVA 1K0AA 2C3TA 3CSJA 3MDKA 1VF2A 4RQRA 1F3AA 3IXRA 5ELGA 4ZXGA 22GSA 4BVYB 1V58A 3CRUA 4ML1A 5LNKe 3Q74A 3FW2A 3F6FA 1PGTA 3FR6A 4TVEA 1EP8A 4HUAA 1NW2A 1ERWA 3GSSA 3TKPA 4GLTA 2LSTA 2H0HA 5FWGA 5GSTA 1GSSA 2CA8A 1X5EA 1GLPA 3TCOA 4KB3A 4ULXA 2VCWA 3GKXA 4ZIJA 5J5NA 19GSA 1JLWA 3EURA 5CP1A 2FD3A 1EOGA 1TRVA 2FWEA 1M9BA 4ZL8A 3QDNA 2YJHA 2AV4A 3D0ZA 2FA8A 1FO5A 4WR4A 2PVOC 2C0EA 2EC4A 4GWRA 4GF0A 3DD3A 4DSRA 3VWXA 4AGSA 1GTBA 4PURA 3GA4A 3UEMA 1SJ6A 1ABAA 5G5FA 1WP0A 3APSA 1OYJA 3AY8A 5AN1A 2LKUA 1GRXA 2H01A 5KN1A 1MEKA 4TOPA 1ZGNA 3IC8A 2DJ3A 4F03A 1H4OA 5H5RA 1MD3A 4ECBA 4MF6A 4J56E 1K0OA 1PD21 3FEUA 4LLRA 4POLA 2XHFA 5DALA 1AXDA 2YANA 4O7HA 2JL4A 3TDGA 1Z7PA 5KEJA 1Z9HA 5DJMA 2DJ2A 1V2AA 4G10A 3GN3A 4WR5A 3ZMKA 2JU5A 2VL2A 3FYGA 5ECNB 3LWAA 2XBQA 2YV9A 4LMVA 4RI6A 5G31A 2B7KA 1K0DA 1UA5A 5ECMB 2WFCA 2F8FA 1YDKA 2MMZA 3GKMA 4K7OA 4XIHA 1LU4A 3H4KA 4X43A 3HCZA 1JZWA 2NTOA 3IOSA 1HNAA 3FZAA 5IPGA 2JACA 2OE0A 3CRTA 3Q18A 3QCPA 2R5GA 1GTUA 3EYTA 3I43A 1DUGA 4K6XA 2LEGA 5KN2A 1JZOA 3J7Yb 4NHWA 3P2AA 1B4QA 4O32A 5A4WA 3KTBA 3MSZA 3H93A 1KTEA 2C1YA 2YWIA 2VL2C 5J9BA 3MNGA 4V2LA 1PX6A 4ZB8A 3IPZA 3F9UA 2C4JA 1K0CA 2J23A 2O87A 3TJJA 3TJFA 3L9VA 1M7TA 5IO0A 1SU9A 2C0GA 4EDZA 3R3EA 4POKA 1I9DA 3IDVA 3FZ9A 1Z6NA 3M3MA 3UJ1A 5ECIB 2I3YA 4ILFA 1X5CA 4AJ7A 1Q4JA 5DALB 2LRTA 3U5RE 4NXIA 4PX1A 3S9FA 3LQ7A 2WZ9A 3ZZXA 4PQIA 3PGTA 2VCQA 3QD9A 1PL1A 13GSA 3HHVA 3NZNA 4ISDA 1GUMA 16GSA 3ME8A 4Q5NA 1TKDB 3KXOA 4HQSA 2KHPA 3I9V2 3C7MA 2EIOA 5JCWA 1XIYA 3EWLA 4N30A 4MF5A 2X99A 1OKDA 3HKRA 3KJYA 4HZ2A 3TJGA 1QGVA 2AYTA 4AJ8A 2R2JA 3EVIA 2F51A 2LUSA 5ECPB 3ME7A 3LXZA 1TRWA 1VGLA 2KLXA 2IMFA 4KDYA 4X0XA 3NIVA 4HEA2 6GSYA 1ILOA 1QFNA 3CTFA 1GSEA 5C04A 3KH7A 3RPNA 1GTIA 5DAKB 2O8VB 4IKHA 4XRDA 2LRNA 2B7JA 2PVQA 4K9ZA 4HJ2A 4XCSA 3KIJA 1A8YA 1YEXA 1SYRA 3G7IA 5E59A 2GLRA 2KP2A 4OFTA 2VIMA 5JWRB 1OC3A 4POMA 3VPTA 4Z7XA 3KM6A 4ZB6A 5CYYA 3UIWA 2BTOT 3LYKA 2ES7A 4IHUA 4L0WA 2OA7A 2L6DA 4NAXA 1GP1A 2PERA 3DVWA 2LJRA 2OADA 2M80A 1ZYEA 1TRUA 4JE1A 5H5SA 1M0UA 1GNWA 3GX0A 2CX4A 5ECOB 5F07A 7GSSA 4HI7A 2YPMA 3CMIA 1WWJA 4OFNA 4BL7A 5ID2A 1XWGA 2PWJA 1BAYA 4OCFA 1SJZA 2VO4A 1V57A 3IV4A 2H1DA 2VCTA 2JSYA 2FGXA 2H19A 2DJ0A 5KN0A 3DEXA 4MF7A 2CVBA 1FW1A 1A0FA 3EMXA 2LQOA 3EU3A 1PL2A 8GSSA 5IMAA 4PXOA 2FUG2 2D2ZA 1I5GA 2C80A 1VF3A 4EC0A 4K1FA 2PGTA 1QXHA 2HNLA 2GTUA 3ZYWA 5JWQB 3QAVA 3LORA 2ALBA 1U3AA 4YQMA 3RHCA 2OACA 3GV1A 1A24A 3PINA 2QSIA 3WT2A 5GAND 2X8CA 3DYRA 1XBSA 2C3NA 1K0BA 2R6KA 2FWHA 2NPBA 2QC7A 3DXBA 1PKZA 4K0NA 2YZUA 3TRPA 3U6VA 5A5KA 3IRAA 4V2NA 1V40A 4BL7B 5ID2B 3ZMLA 4ZBBA 3LEFA 1O81A 1BEDA 2IFQA 3HDCA 2VOCA 2YV7A 3WGDA 1O73A 1SL1B 5DVBA 4XHMA 1XW5A 2HT9A 4XS4A 1PN9A 4F82A 3HZ8A 1E2YA 1UN2A 2DJ1A 3V1WA 4KA0A 4WETA 1FB6A 5D9XA 3VPQA 4IQ1A 4TXVA 4QL7A 4MK3A 1RK4A 17GSA 4RUVA 2DMMA 1Y6EA 1THOA 3ZTLA 1T4ZA 1NSWA 1FB0A 1XOBA 5IQYA 2IIYA 3FZ5A 4KDXA 4MJAA 5D9TA 1U6TA 1WJKA 1ACVA 3KP9A 4IQAA 4LA1A 2HSHA 4HZ4A 3ISOA 3F0IA 1Y25A 3KD0A 4JZQA 2PU9C 2B6MA 3D4TA 1XWBA 2O85A 2GS3A 4DSQA 2TIRA 4X1UA 4MZBA 2OBKA 3I6AA 3UBKA 4GRFA 4WF5A 1NM3A 3M0FA 2REMA 2YOIA 4GSTA 4RI7A 1PKWA 2XBIA 3M9JA 4WBJA 5L71A 3CSIA 1HQOA 1M9AA 4PTSA 1QUWA 3VWVA 4ACSA 3WYWA 1X9MB 3VI5A 1TTZA 1KNGA 2PPTA 6GSVA 3FZ4A 4HJMA 1F9MA 2IFQB 2FA4A 1JFUA 2B1LA 1XWAA 4USSA 1K0NA 3US3A 5AISA 5CRGA 4XS4B 3GH6A 1A2JA 5CNWA 4HOJA 2CV4A 2H72A 1IYHA 3ZIJA 1GWCA 1WPIA 1GNEA 3FR3A 5G30A 2P5QA 2DJJA 3M9KA 3LGCA 5LD0A 3Q6OA 1PX7A 2JZTA 5FT3A 3GHAA 2OE3A 4G9HA 4L5OA 2WB9A 1EGRA 2CT6A 3HJOA 1T7PB 1WE0A 3L0HA 4OCEA 2NBSA 1WRYA 3MAKA 2GSRA 3FK8A 2CX3A 1AAZA 4GQFA 1A2MA 4TR0A 4YAPA 2H75A 2L5OA 1SKWB 1OC8A 2AB6A 4PUAA 1YZXA 2K9FA 4FQUA 2WJUA 1O7UA 3F63A 2I1UA 4I6XA 3ERGA 3GRXA 4N10A 1TU7A 4ZB9A 3ERWA 6GSWA 2Z9SA 3L4NA 3F3QA 1GTAA 2MYGA 4V1Ap 3JCML 3DMLA 3R2QA 3D6IA 2FNOA 2O89A 3TKSE 4FIWA 1A23A 5FHIA 4BWQA 4L5LA 1SD9A 1O8XA 2HRFA 1GUKA 1B48A 3KEBA 5IIZA 2MBSA 4I8BA 3FHKA 4O5RA 1H75A 3PPUA 3RDWA 4I2UA 3DVXA 4MZCA 4IGJA 2IMEA 3BCKA 4KX4A 1FOVA 1XVQA 1KEBA 2YCDA 4PQHA 4HU7A 2LQQA 2L4CA 1TK0B 4XS6A 1EEJA 3CXGA 3VURA 1X5DA 1VRSD 2DLXA 1XFLA 3LG6A 4MPFA 1T00A 4G0LA 3CTGA 2VCVA 5JWOB 2A2RA 1U3IA 3D21A 2L57A 2VL3A 2IPAA 4HDEA 3EINA 4ECJA 3QPMA 1CQGA 2FWGA 4GSSA 2H74A 3KTLA 1SK1A 5G5EA 5COHA 3VI7A 2H76A 3DWVA 4OO4A 6GSSA 2GGTA 2P0GA 5ECRB 3GYKA 3N5OA 1QK8A 5HQPA 1EV9A 1F3BA 5GZZB 3TGZA 5ECLB 5DAKA 1USBA 2RM5A 2VLUA 1YY7A 4Q5RA 1TJDA 5HFIA 4MH3A 2GT6A 2OBIA 3UVHA 1K3OA 4MZWA 2EIQA 5JCUA 2H6ZA 3HD5A 1M2DA 2PN8A 2X8HA 3WT1A 2AJQB 3UOMA 3G7JA 1RQMA 2PMTA 3C71A 1O85A 2WCIA 1ML6A 1G7OA 3CYNA 2RUFA 3ZVJA 1GSDA 3MWHA 5B8BA 3QMXA 4ZBAA 1XWCA 5IMFA 3H1NA 2GSSA 4TR1A 3KZQA 4KF9A 4BVXA 2L4QA 3HA9A 2DIYA 4FO5A 2N5FA 2E0QA 5D9VA 4Q5FA 1YKCA 4K0GA 4LMWA 4G2EA 3QAWA 1A8LA 4IP1A 5HR3A 3A2WA 2MMOA 3EE2A 5ENUA 4ZBDA 4G0IA 2E2GA 3HVVA 10GSA 3L9UA 2C0FA 2RM6A 2AAWA 4D73B 2BJXA 1RW1A 3A3TA 4CDOA 2F8AA 5IOXA 1X9SB 2R3XA 1R26A 3W8SA 3BOAA 1PRXA 5IM9A 4KDUA 1SYXA 4EDYA 3G7YA 2OE1A 1JZDA 2WULA 4IELA 1QQ2A 4N0ZA 1NHOA 4CHSA 3LSZA 1NHYA 3ZL5A 2L6CA 3TKQA 1TXXA 3GL5A 3A2VA 5E4WA 2V41A 3HYPA 1ERUA 3IAM2 4KGIA 2B1KA 1B9YC 5GAPD 3GH9A 1BJXA 3IBHA 2YWMA 3BJ5A 2DBCA 2DSAA 1VF1A 2HSMB 5AGYA 4ZILA 1TOFA 2P5RA 3KMOA 2AHEA 1FAAA 5G1LA 2TRXA 1SJIA 4EUYA 1B9XC 2IJYA 4H86A 2H73A 1HD2A 5F0GA 3APQA 4TR1B 3QOUA 4BVXB 4WXTA 1AW9A 3QAGA 2DJKA 3TKRA 2HRNA 5HFGA 3EU4A 2X64A 4G0KA 1S3AA 2CAQA 2FWFA 2XPDA 2V6OA 3F4TA 3Q19A 1N2AA 2TRCP 3IC4A 1BX9A 3GIXA 3TJBA 4KAEA 1OAZA 1XW6A 1B4PA 3F3RA 4F0BA 5DJLA 2VD0A 3CBUA 3GURA 6GSXA 5B6MA 2G2QA 1F2EA 3TOUA 20GSA 4O92A 2VLTA 4NPBA 1HNBA 1TK8B 3GNJA 3K8NA 2FLSA 1R7HA 4GQCA 2F3MA 5DDLA 3GKNA 3GKKA 2GSQA 1YF1A 4I5QA 4LL1B 2CVDA 1YF0A 5AIVA 2G0FA 2B5XA 4ZL9A 1DE2A 4Q5QA 1GH2A 1EGOA 4MMMA 4K7NA 5JCGA 4F0CA 2IMKA 3VWWA 4NV5A 3UVTA 2IL3A 2NDOA 2H70A 2HSNB 5A4VA 5HR1A 2H6YA 1J0FA 1GSFA 4HU9A 4TR4A 1B8XA 2PBJA 3WD6A 1W89A 4DEJA 2H0GA 2H66A 3CSHA 2FCHA 4ZL7A 4KSMA 1F6MC 2AUVA 4KW6A 3PH9A 1ERVA 1HYUA 2LRCA 3HXSA 3C8EA 5DCGA 3DGQA 4XRAA 4E8HA 2PUKC 4EO3A 3ZVJD 5DQSA 3UBLA 4G19A 4GCIA 4DVCA 1XCCA 4KUNA 3G9BA 2WRTA 3H79A 3E3EA 1T3BA 2GZPA 1V9WA 4E8EA 1T1VA 5EVOA 1XOAA 1URMA 2X8GA 4MDCA 2K6VA 4AJ6A 2M72A 2HRAA 1SK2A 1O8WA 2H30A 4OMVA 5CO3A 5CAXA 3KMNA 1X0RA 2HSYA 3IR4A 3WGEA 4JR6A 1PQNA 1AQXA 2LS5A 2KP1A 5C00A 2GQLA 4EVMA 3D4MA 5IMZA 5D93A 2ON5A 4KE3A 3GL3A 2HYXA 3RAZA 4I97A 1G6YA 3KP8A 1W4VA 4ID0A 2HRKA 1BQ7A 2QGVA 2JADA 3ZFBA 5B6NA 1GSYA 5INYA 4MJEA 3ZFLA 2YJ7A 1N8JA 2H6XA 2RIIA 2VAFA 4POBA 2ZCTA 2YWOA 3HVXA 2B5YA 2LJAA 3HJMA 2H1AA 4TW5A 3W8JA 5B7CA 4OO5A 1XPVA 6GSTA 1J08A 2DIZA 3UARA 1K3YA 1U88A 2WGRA 1C72A 4QL9A 1YEPA 2HZEA 3RBTA 3VK9A 3UL3A 5DCHA 3ZLPA 4ECIA 2C3QA 2LJKA 5ECHB 1T4YA 4TKYA 4GSNA 4K7IA 1Z7RA 3O76A 2GSTA 1G7EA 5A4UA 4J57E 12GSA 5F05A 5CRHA 1A0RP 1YQ1A 3ZREA 4ML6A 4J2FA 3O3TA 3TB2A 3TKSA 5ABRA 4HQZA 2CZ2A 5J3RA 2HXKA 3N9JA 2ZNMA 2MBTA 2VUPA 1EZKA 1IYIA 2H8LA 2YZHA 3IAS2 2HRKB 3F4SA 4IW9A 2HZFA 4EXJA 3E9JB 2K8SA 2DC5A 3DKSA 3DRNA 1V98A 2VL9A 4K2DA 5IMDA 1XVWA 2NVLA 3EC3A 1DSBA 2YNXA 3M1GA 2GQMA 1K0MA 2ON7A 3LFLA 2O7KA 3E0UA 3RPPA 3NOFA 2YWNA 1SL0B 1LJRA 1THXA 2GZYA 3TKSC 2ZUPA 2XPEA 3GTUA 2WDUA 2HZEB 1G6WA 1HNCA 2CAIA 4BWSA 1GLQA 2I81A 2JZRA 1FG4A 3LYPA 2H0IA 4OFMA 4MH2A 4NV2A 1ZL9A 4MLYA 5ECSA 1GSUA 5EL8A 1EV4A 3HY2A 3VLNA 5EPFA 2LV3A 1YKAA 1MD4A 3SBCA 3P90A 3UMAA 5IO2A 2EIRA 1O6JA 4PNFA 4WEYA 3GMFA 1YJ6A 3LXTA 4D73A 2IN3A
chains in the Genus database with same CATH superfamily
3TUEA 1OVNA 2HE3A 3J7Yk 1AIUA 4KSOA 4JU5A 1R4WA 5J9CA 2VCZA 2R37A 3BBYA 2OJLA 3P8WA 3GX8A 2J9HA 1SKSB 4L8EA 4AKGA 1BYEA 2LNSA 1OC9A 4MP4A 2H71A 2CQ9A 4KCAA 1SD8A 2IMIA 4XTSA 1WIKA 3TOTA 1Z3EA 2N5BA 1R5PA 3GTUB 2V32A 3F4RA 3FKFA 1EOHA 2O36A 4YH2A 2HSMA 4EF0A 4GTUA 3ZITA 2V6KA 5J4UA 5DBQA 1CQHA 2WVYA 1GUHA 1AQVA 1S3DA 3ED3A 2JZSA 1MTCA 2HLSA 3L78A 3FR9A 3QFAC 5AIXA 1DE1A 1T8EB 2FHEA 1U87A 4GXZA 1R5AA 4CW9A 3A5WA 2H1BA 2IWTA 1ZOFA 4IVFA 1GULA 3PR8A 4KH7A 3IK9A 4OWYA 2CVKA 3KGKA 3C73A 3WGXA 1TDIA 3BD2A 2YP6A 4KCEA 1E6BA 2HI7A 3FY7A 2MZCA 1M2AA 2GVPA 3H8QA 5D73A 3EMPA 3I69A 1X9WB 1AQWA 2V1MA 5CREA 1XW9A 4MJBA 14GSA 4AF2A 1ZYQB 4AKIA 3VWUA 2B5EA 3A2XA 5CRWA 1Z5YE 3GFKA 3HVSA 2MMNA 11GSA 1JZRA 3FRCA 4PGTA 4BA7A 3RGBC 1M2BA 1GL8A 3F8UA 5BMUA 4NWYA 4N11A 3C1SA 2LNTA 1OC9B 4DSSA 2VM1A 3C1RA 2OT3A 1QMVA 1XWKA 2GQKA 2KUCA 5G1KA 1VF4A 2XC2A 1F37A 1SENA 3HJPA 2N5AA 2CZ3A 4LL4B 3HZ4A 5J4YA 4TXOA 2VCXA 5HR2A 1G0TA 1TU8A 4K5SA 3IA1A 1SKRB 2GZZA 1SK0A 3O6TA 1Q98A 1UVZA 3D22A 4L0UA 5IMCA 3BCIA 2B3SA 1SL2B 2X49A 4TR3A 3ZIVA 2FY6A 3W6GA 2I9HA 4IJIA 5ECQB 2P31A 2M46A 1ZMAA 4EKZA 3IK7A 9GSSA 3ERFA 5D96A 2A4VA 5HR0A 1A2LA 3IHQA 2GT5A 3LJRA 5KN3A 5D9WA 4Z2RA 4FH8A 4XS1A 3VFIA 2C8UA 4JEDA 5D8IA 4JR4A 4N0VA 1AUCA 1WOUA 2QKEA 1JHBA 3SWLA 1FHEA 1TK5B 4IBPA 4EE0A 2H1GA 2L59A 4NMUA 4WKWA 2RLIA 2UZ8A 5HFKA 3KCMA 2BMXA 1PSQA 2K18A 1MDKA 3IE3A 2YN1A 5BMUB 4IP6A 4WBRD 4DSSB 4K8MA 1FVKA 3RHBA 1TRSA 1FVJA 4IJ3A 4PQ1A 5F8BA 4F9ZA 1DBYA 4F2IA 1MDIA 4TRXA 1TP9A 2C0DA 1TI3A 5B8AA 3MIXA 4K2XA 4FYBA 1GSQA 4TXOB 3DIEA 5ECKB 5J41A 4IN0A 4MJCA 2JSZA 5IPHA 2A2SA 4EL1A 1ON4A 1UC7A 3TJKA 2E2MA 3TRQA 6GSUA 3GUSA 5H5QA 2KOKA 4IS0A 4BIKA 1PA3A 1EWXA 5IOWA 1ZZYA 1S4BP 4I2TA 4BPYA 2RUEA 1AC1A 4V2MA 1TI1A 5ELAA 4NHZA 4P3YB 5DQYA 1ERTA 4YAVA 3OR5A 1PMTA 4FYUA 4ECCA 1K3LA 4FYCA 1EEMA 4MCUA 2E7PA 1BG5A 2HQTA 5LCZA 4N3ZA 2GDRA 1PN0A 4BVYA 3KH9A 2DMLA 2DKHA 1ST9A 2R4VA 2V2GA 4JBBA 5GSSA 1ZCPA 4CY8A 1XXUA 4WF4A 2VLVA 2VM2A 3QFBC 5CRDA 4MABA 2K8VA 4EIQA 2F9SA 1XZOA 3M8NA 1OE7A 3L9SA 2IMDA 2MMAA 3GSTA 4PNGA 3F6DA 5EY6A 1OKTA 1S3CA 4YQVA 1WMJA 3TRXA 5F06A 3APOA 2OKAA 3D5JA 4W66A 4HS1A 1EP7A 2I4AA 1M99A 1MDJA 2A4HA 3UAPA 2O5VA 4TN8A 4JRRA 1LBKA 4OD7A 4MPGA 1KBNA 5J4VA 4KNDA 5J47A 2L5LA 1Z6MA 3P7XA 3ZRDA 3QR6A 2LTKA 2HFDA 4MA9A 1TW9A 4YQUA 4V1Ag 5G2ZA 4PUFC 4MNNA 4QQ7A 2VD1A 18GSA 1J9BA 5IMVA 2WS2A 4G01A 4RQXA 1OE8A 1JLVA 1K0AA 2C3TA 3CSJA 3MDKA 1VF2A 3CWGA 4RQRA 1F3AA 3IXRA 5ELGA 4ZXGA 22GSA 4BVYB 1V58A 3CRUA 4ML1A 5LNKe 3Q74A 3FW2A 3F6FA 1PGTA 3FR6A 1TXUA 4TVEA 1EP8A 4HUAA 1NW2A 1ERWA 1YVLA 3GSSA 3TKPA 4GLTA 2LSTA 2H0HA 5FWGA 5GSTA 1GSSA 2CA8A 1X5EA 1GLPA 3TCOA 4KB3A 4ULXA 2VCWA 3GKXA 4ZIJA 5J5NA 19GSA 1JLWA 3EURA 5CP1A 2FD3A 1EOGA 1TRVA 2FWEA 1M9BA 1FOHA 4ZL8A 3QDNA 2YJHA 2AV4A 3D0ZA 2FA8A 1FO5A 4WR4A 2PVOC 2C0EA 2EC4A 4GWRA 4GF0A 3DD3A 4DSRA 3VWXA 4AGSA 1GTBA 4PURA 2X4AA 3GA4A 3UEMA 1SJ6A 1ABAA 5G5FA 1WP0A 3APSA 1OYJA 1BF5A 3AY8A 5AN1A 2LKUA 1GRXA 2H01A 5KN1A 1MEKA 4TOPA 1ZGNA 3IC8A 2DJ3A 4F03A 1H4OA 5H5RA 1MD3A 4ECBA 4MF6A 4J56E 1K0OA 1PD21 3FEUA 4LLRA 4POLA 2XHFA 5DALA 1AXDA 2YANA 4O7HA 2JL4A 3TDGA 1Z7PA 5KEJA 1Z9HA 5DJMA 2DJ2A 1V2AA 4G10A 3GN3A 4WR5A 3ZMKA 2JU5A 2VL2A 3FYGA 5ECNB 3LWAA 2XBQA 2YV9A 4LMVA 4RI6A 5G31A 5A5HB 2B7KA 1K0DA 1UA5A 5ECMB 2WFCA 2F8FA 1YDKA 2MMZA 3GKMA 4K7OA 4XIHA 1LU4A 3H4KA 4X43A 3HCZA 1JZWA 2R0GA 2NTOA 3IOSA 2EFDA 1HNAA 3FZAA 5IPGA 2JACA 2OE0A 3CRTA 3Q18A 5A34B 3QCPA 2R5GA 1GTUA 3EYTA 3I43A 1DUGA 4K6XA 2LEGA 5KN2A 1JZOA 3J7Yb 4NHWA 3P2AA 1B4QA 4O32A 5A4WA 3KTBA 3MSZA 3H93A 1KTEA 2C1YA 2YWIA 2VL2C 5J9BA 3MNGA 4V2LA 1PX6A 4ZB8A 3IPZA 3F9UA 2C4JA 1K0CA 2J23A 3CHXC 2O87A 3TJJA 3TJFA 3L9VA 2WW1A 1M7TA 5IO0A 1SU9A 2C0GA 4EDZA 3R3EA 4POKA 1I9DA 3IDVA 3FZ9A 1Z6NA 3M3MA 3UJ1A 5ECIB 2I3YA 4ILFA 1X5CA 4AJ7A 1Q4JA 5DALB 1M3JA 2LRTA 3U5RE 4NXIA 2EFHA 4PX1A 3S9FA 3LQ7A 2WZ9A 3ZZXA 4PQIA 2WZSA 3PGTA 2VCQA 3QD9A 1PL1A 13GSA 3HHVA 3NZNA 4ISDA 1GUMA 16GSA 3ME8A 4Q5NA 1TKDB 3KXOA 4HQSA 2KHPA 3I9V2 3C7MA 2EIOA 5JCWA 1XIYA 3EWLA 4N30A 4MF5A 2X99A 1OKDA 3HKRA 2DKIA 3KJYA 2QA1A 4HZ2A 3TJGA 1QGVA 2AYTA 4AJ8A 2R0PA 2R2JA 3EVIA 2F51A 2LUSA 5ECPB 3ME7A 3LXZA 1TRWA 1VGLA 2KLXA 2IMFA 4KDYA 4X0XA 3NIVA 4HEA2 6GSYA 1ILOA 1QFNA 3CTFA 1GSEA 5C04A 3KH7A 3RPNA 1GTIA 5DAKB 2O8VB 4IKHA 4XRDA 2LRNA 4A5PA 2B7JA 2PVQA 4K9ZA 4HJ2A 4XCSA 3KIJA 1A8YA 1YEXA 1SYRA 3G7IA 5E59A 2GLRA 2WW2A 2KP2A 4OFTA 2VIMA 5JWRB 1OC3A 4POMA 3VPTA 4Z7XA 1SVOA 3KM6A 4ZB6A 5CYYA 3UIWA 2BTOT 3LYKA 2ES7A 4IHUA 4L0WA 2OA7A 2L6DA 4NAXA 1GP1A 4PI0C 2PERA 3DVWA 2LJRA 1I1IP 2OADA 2M80A 1ZYEA 1TRUA 4JE1A 5H5SA 1M0UA 1GNWA 3GX0A 2CX4A 5ECOB 5F07A 7GSSA 4HI7A 2YPMA 3CMIA 1WWJA 4OFNA 4BL7A 5ID2A 1XWGA 2PWJA 1BAYA 4OCFA 1SJZA 2VO4A 1V57A 3IV4A 2H1DA 2VCTA 2JSYA 2FGXA 2H19A 2DJ0A 5KN0A 3DEXA 4O5QA 4MF7A 1BG1A 2CVBA 1FW1A 1A0FA 4YKFA 3EMXA 2LQOA 3EU3A 1PL2A 8GSSA 5IMAA 4PXOA 2FUG2 2D2ZA 1I5GA 2C80A 1VF3A 4EC0A 4K1FA 2PGTA 1QXHA 2HNLA 2GTUA 3ZYWA 5A1NA 5JWQB 3QAVA 1PFOA 3LORA 2ALBA 1U3AA 4YQMA 3RHCA 2OACA 3GV1A 1A24A 3PINA 2QSIA 3WT2A 5GAND 2X8CA 3DYRA 1XBSA 2C3NA 1K0BA 4Z2TA 2R6KA 2FWHA 2NPBA 2QC7A 3DXBA 1PKZA 4K0NA 2YZUA 3TRPA 3U6VA 5A5KA 3IRAA 4V2NA 1V40A 4BL7B 5ID2B 3ZMLA 4ZBBA 3LEFA 1O81A 1BEDA 2IFQA 3HDCA 2VOCA 2YV7A 2UV8G 3WGDA 1O73A 1SL1B 5DVBA 4XHMA 1XW5A 2HT9A 4XS4A 1PN9A 4F82A 3HZ8A 1E2YA 1ZYPA 2EFEA 1UN2A 2DJ1A 3V1WA 4KA0A 4WETA 1FB6A 5D9XA 3VPQA 4IQ1A 4TXVA 4QL7A 4MK3A 1RK4A 17GSA 4RUVA 2DMMA 1Y6EA 1THOA 3ZTLA 1T4ZA 1NSWA 1FB0A 1XOBA 5IQYA 2IIYA 3FZ5A 4KDXA 4MJAA 5D9TA 1U6TA 1WJKA 1ACVA 3KP9A 4IQAA 4LA1A 5A1NB 2HSHA 4HZ4A 3ISOA 3F0IA 1Y25A 3KD0A 4JZQA 2PU9C 2B6MA 3D4TA 1XWBA 2O85A 2GS3A 4DSQA 2TIRA 4X1UA 3RFRC 4MZBA 2OBKA 3I6AA 3UBKA 4GRFA 4WF5A 4X4JA 1NM3A 3M0FA 5J40A 2REMA 2YOIA 4GSTA 4RI7A 1PKWA 2XBIA 3M9JA 4WBJA 5L71A 3CSIA 1HQOA 1M9AA 4PTSA 4Z2UA 1QUWA 3VWVA 4ACSA 1YEWC 3WYWA 1X9MB 3VI5A 1TTZA 1KNGA 2PPTA 6GSVA 3FZ4A 4HJMA 1F9MA 2IFQB 2FA4A 1JFUA 2B1LA 1XWAA 4USSA 1K0NA 3US3A 5AISA 5CRGA 4XS4B 3GH6A 1A2JA 5CNWA 4HOJA 2CV4A 2H72A 1IYHA 3ZIJA 1GWCA 1WPIA 1GNEA 3FR3A 5G30A 5A5HA 2P5QA 2DJJA 5KOXA 3M9KA 3LGCA 5LD0A 3Q6OA 1PX7A 2JZTA 5FT3A 3GHAA 2OE3A 4G9HA 4L5OA 2WB9A 1EGRA 2CT6A 3HJOA 1T7PB 1WE0A 3L0HA 4OCEA 2NBSA 5A34A 1WRYA 3MAKA 2GSRA 3FK8A 2CX3A 1AAZA 4GQFA 1A2MA 4TR0A 4YAPA 2H75A 2L5OA 1SKWB 1OC8A 2AB6A 4PUAA 1YZXA 3FMWA 2K9FA 4FQUA 4AKHA 2WJUA 1O7UA 3F63A 2I1UA 4I6XA 3ERGA 3GRXA 4N10A 1TU7A 4ZB9A 3ERWA 6GSWA 2Z9SA 3L4NA 3F3QA 1GTAA 2MYGA 4V1Ap 3JCML 3DMLA 3R2QA 3D6IA 2FNOA 2O89A 3TKSE 4FIWA 1A23A 5FHIA 4BWQA 4L5LA 1SD9A 1O8XA 2HRFA 1GUKA 1B48A 3KEBA 5IIZA 2MBSA 4I8BA 3FHKA 4O5RA 1H75A 3PPUA 3RDWA 4I2UA 3DVXA 4MZCA 4IGJA 2IMEA 3BCKA 4KX4A 1FOVA 1XVQA 1KEBA 2YCDA 4PQHA 4HU7A 2LQQA 2L4CA 4ZB7A 2WVXA 1TK0B 4XS6A 1EEJA 3CXGA 3VURA 1X5DA 1VRSD 2DLXA 1XFLA 3LG6A 4MPFA 1T00A 4G0LA 3CTGA 2VCVA 5JWOB 2A2RA 3EPTA 1U3IA 3D21A 2L57A 2VL3A 2IPAA 4HDEA 3EINA 4ECJA 3QPMA 1CQGA 2FWGA 4GSSA 2H74A 3KTLA 1SK1A 5G5EA 5COHA 3VI7A 2H76A 3DWVA 4OO4A 6GSSA 2GGTA 2P0GA 5ECRB 3GYKA 3N5OA 1QK8A 5HQPA 1EV9A 2H1LA 1F3BA 3CQFA 5GZZB 3TGZA 5ECLB 5DAKA 4O5UA 1USBA 2RM5A 2VLUA 1YY7A 4Q5RA 1TJDA 5HFIA 4MH3A 4PI2C 2GT6A 2OBIA 3UVHA 1K3OA 4MZWA 2EIQA 5JCUA 2H6ZA 3HD5A 1M2DA 2PN8A 2X8HA 3WT1A 2AJQB 3UOMA 3G7JA 1RQMA 2PMTA 3C71A 1O85A 2WCIA 1ML6A 1G7OA 3CYNA 2RUFA 3ZVJA 1GSDA 3MWHA 5B8BA 3QMXA 4ZBAA 1XWCA 5KOWA 5IMFA 3H1NA 2GSSA 4TR1A 3KZQA 4KF9A 4BVXA 2L4QA 3HA9A 2DIYA 4FO5A 2N5FA 2E0QA 5D9VA 4Q5FA 2WW0A 1YKCA 4K0GA 4LMWA 2WVXB 4G2EA 1XG8A 3QAWA 1A8LA 1ZYNA 4IP1A 5HR3A 3A2WA 2MMOA 3EE2A 5ENUA 4ZBDA 4G0IA 2E2GA 2QA2A 10GSA 3HVVA 3L9UA 2C0FA 2RM6A 2AAWA 4D73B 2BJXA 1RW1A 3A3TA 1N25A 4CDOA 2F8AA 5IOXA 1X9SB 2R3XA 1R26A 3W8SA 3BOAA 4ICYA 1PRXA 5IM9A 4KDUA 2WVZA 4AKXB 1SYXA 4EDYA 3G7YA 2OE1A 1JZDA 2WULA 4IELA 1QQ2A 4N0ZA 1NHOA 4CHSA 3LSZA 1NHYA 3HMJG 3ZL5A 2L6CA 3TKQA 1TXXA 3GL5A 3A2VA 5E4WA 2V41A 3HYPA 1ERUA 3IAM2 4KGIA 2B1KA 3A5IA 1B9YC 5GAPD 3GH9A 1M3IA 1BJXA 3IHGA 3IBHA 2YWMA 3BJ5A 2DBCA 2DSAA 1VF1A 2HSMB 5AGYA 4ZILA 1TOFA 2P5RA 3KMOA 2AHEA 1FAAA 5G1LA 2TRXA 1SJIA 2HSNA 4EUYA 1B9XC 2IJYA 4H86A 2H73A 5BRTA 1HD2A 5F0GA 3APQA 4TR1B 3QOUA 4BVXB 4WXTA 1AW9A 3QAGA 2DJKA 3TKRA 2HRNA 5HFGA 3EU4A 2X64A 4G0KA 1S3AA 2CAQA 2FWFA 2XPDA 2V6OA 3F4TA 3Q19A 1N2AA 2TRCP 3IC4A 1BX9A 3GIXA 3TJBA 2O3EA 4KAEA 1OAZA 1XW6A 1B4PA 3F3RA 4F0BA 5DJLA 2VD0A 3CBUA 3GURA 6GSXA 5B6MA 2G2QA 1F2EA 3TOUA 20GSA 4O92A 2VLTA 4NPBA 1HNBA 4K5RA 1TK8B 3GNJA 3K8NA 2FLSA 1R7HA 4CY6A 4GQCA 2F3MA 5DDLA 3GKNA 1SVMA 3GKKA 2GSQA 1YF1A 2A2PA 4I5QA 3HVNA 4LL1B 4EIPA 2CVDA 1YF0A 5AIVA 2G0FA 2B5XA 4ZL9A 1DE2A 4Q5QA 1GH2A 4AI6A 1EGOA 4MMMA 1Y1UA 4K7NA 5JCGA 4F0CA 2IMKA 4HSCX 3VWWA 4NV5A 3UVTA 2IL3A 2NDOA 2H70A 2HSNB 5A4VA 5HR1A 2H6YA 1J0FA 1GSFA 4HU9A 4TR4A 1B8XA 2PBJA 3LW9A 3WD6A 1W89A 4DEJA 2H0GA 2H66A 3CSHA 3MYDA 2FCHA 4ZL7A 4KSMA 1F6MC 2EFCA 2R0CA 2AUVA 4KW6A 3PH9A 4PHZC 1ERVA 1HYUA 2LRCA 3HXSA 3C8EA 5DCGA 3DGQA 4XRAA 4YKGA 4E68A 4E8HA 2PUKC 4EO3A 3ZVJD 5DQSA 3UBLA 4G19A 4GCIA 4DVCA 1XCCA 4KUNA 3G9BA 2WRTA 3H79A 3E3EA 1T3BA 2GZPA 1V9WA 4E8EA 1T1VA 5EVOA 1XOAA 1URMA 2X8GA 4MDCA 2K6VA 4AJ6A 2M72A 2HRAA 1SK2A 1O8WA 2H30A 4OMVA 5CO3A 5CAXA 3KMNA 1X0RA 2HSYA 3IR4A 3WGEA 4JR6A 1PQNA 1AQXA 2LS5A 1S3RA 2KP1A 5C00A 2GQLA 4EVMA 3D4MA 5IMZA 5D93A 2ON5A 4KE3A 2VKZG 3GL3A 2HYXA 3RAZA 4I97A 1G6YA 3KP8A 1W4VA 4ID0A 2HRKA 1BQ7A 2QGVA 2JADA 3ZFBA 5B6NA 1GSYA 5INYA 4MJEA 3ZFLA 2YJ7A 1N8JA 2H6XA 2RIIA 2VAFA 4POBA 2ZCTA 2YWOA 3HVXA 2B5YA 2LJAA 3HJMA 2H1AA 4TW5A 3W8JA 5B7CA 4OO5A 1XPVA 6GSTA 1J08A 2DIZA 3UARA 1K3YA 1U88A 2WGRA 2WW3A 1C72A 4QL9A 1YEPA 2HZEA 3RBTA 3VK9A 3UL3A 5DCHA 3ZLPA 4ECIA 2C3QA 2LJKA 5ECHB 1T4YA 4GDFA 4TKYA 4GSNA 4K7IA 1Z7RA 3O76A 2GSTA 1G7EA 5A4UA 4J57E 12GSA 5F05A 5CRHA 1A0RP 1YQ1A 3ZREA 4ML6A 4J2FA 3O3TA 4FXYP 3TB2A 3TKSA 5ABRA 4HQZA 2CZ2A 5J3RA 2HXKA 3N9JA 2ZNMA 2MBTA 2VUPA 1EZKA 1IYIA 2H8LA 2YZHA 3IAS2 2HRKB 3F4SA 4IW9A 2HZFA 4EXJA 3E9JB 2K8SA 2DC5A 3DKSA 3DRNA 1V98A 2VL9A 4K2DA 5IMDA 1XVWA 2NVLA 3EC3A 1DSBA 2YNXA 3M1GA 2GQMA 1K0MA 2ON7A 1SVLA 3LFLA 2O7KA 3E0UA 3RPPA 3NOFA 2YWNA 1SL0B 1LJRA 1THXA 2GZYA 3TKSC 2ZUPA 2XPEA 3GTUA 2WDUA 2HZEB 1G6WA 1HNCA 2CAIA 4QMKA 4BWSA 1GLQA 2I81A 2JZRA 1FG4A 3LYPA 2H0IA 4OFMA 4MH2A 4NV2A 1ZL9A 4MLYA 5ECSA 1GSUA 5EL8A 1EV4A 3HY2A 3VLNA 5EPFA 2LV3A 1YKAA 1MD4A 3SBCA 3P90A 3UMAA 5IO2A 2EIRA 1O6JA 4PNFA 4WEYA 3GMFA 3TU3B 1YJ6A 3LXTA 4D73A 2IN3A
chains in the Genus database with same CATH topology
3TUEA 1OVNA 2HE3A 3J7Yk 1AIUA 4KSOA 4JU5A 1R4WA 5J9CA 2VCZA 2R37A 3BBYA 2OJLA 3P8WA 3GX8A 2J9HA 1SKSB 4L8EA 4AKGA 1BYEA 2LNSA 1OC9A 4MP4A 2H71A 2CQ9A 4KCAA 1SD8A 2IMIA 4XTSA 1WIKA 3TOTA 1Z3EA 2N5BA 1R5PA 3GTUB 2V32A 3F4RA 3FKFA 1EOHA 4YH2A 2HSMA 4EF0A 4GTUA 3ZITA 2V6KA 5J4UA 5DBQA 1CQHA 1GUHA 1AQVA 1S3DA 3ED3A 2JZSA 1MTCA 2HLSA 3L78A 3FR9A 3QFAC 5AIXA 1DE1A 1T8EB 2FHEA 1U87A 4GXZA 1R5AA 4CW9A 3A5WA 2H1BA 2IWTA 1ZOFA 4IVFA 1GULA 3PR8A 4KH7A 3IK9A 4OWYA 2CVKA 3KGKA 3C73A 3WGXA 1TDIA 3BD2A 2YP6A 4KCEA 1E6BA 2HI7A 3FY7A 2MZCA 1M2AA 2GVPA 3H8QA 5D73A 3EMPA 3I69A 1X9WB 1AQWA 2V1MA 5CREA 1XW9A 4MJBA 14GSA 4AF2A 1ZYQB 4AKIA 3VWUA 2B5EA 3A2XA 5CRWA 1Z5YE 3GFKA 3HVSA 2MMNA 11GSA 1JZRA 3FRCA 4PGTA 4BA7A 1M2BA 1GL8A 3F8UA 5BMUA 4NWYA 4N11A 3C1SA 2LNTA 1OC9B 4DSSA 2VM1A 3C1RA 2OT3A 1QMVA 1XWKA 2GQKA 2KUCA 5G1KA 1VF4A 2XC2A 1F37A 1SENA 3HJPA 2N5AA 2CZ3A 4LL4B 3HZ4A 5J4YA 4TXOA 2VCXA 5HR2A 1G0TA 1TU8A 4K5SA 3IA1A 1SKRB 2GZZA 1SK0A 3O6TA 1Q98A 1UVZA 3D22A 4L0UA 5IMCA 3BCIA 2B3SA 1SL2B 2X49A 4TR3A 3ZIVA 2FY6A 3W6GA 2I9HA 4IJIA 5ECQB 2P31A 2M46A 1ZMAA 4EKZA 3IK7A 9GSSA 3ERFA 5D96A 2A4VA 5HR0A 1A2LA 3IHQA 2GT5A 3LJRA 5KN3A 5D9WA 4Z2RA 4FH8A 4XS1A 3VFIA 2C8UA 4JEDA 5D8IA 4JR4A 4N0VA 1AUCA 1WOUA 2QKEA 1JHBA 3SWLA 1FHEA 1TK5B 4IBPA 4EE0A 2H1GA 2L59A 4NMUA 4WKWA 2RLIA 2UZ8A 5HFKA 3KCMA 2BMXA 1PSQA 2K18A 1MDKA 3IE3A 2YN1A 5BMUB 4IP6A 4WBRD 4DSSB 4K8MA 1FVKA 3RHBA 1TRSA 1FVJA 4IJ3A 4PQ1A 5F8BA 4F9ZA 1DBYA 4F2IA 1MDIA 4TRXA 1TP9A 2C0DA 1TI3A 5B8AA 3MIXA 4K2XA 4FYBA 1GSQA 4TXOB 3DIEA 5ECKB 5J41A 4IN0A 4MJCA 2JSZA 5IPHA 2A2SA 4EL1A 1ON4A 1UC7A 3TJKA 2E2MA 3TRQA 6GSUA 3GUSA 5H5QA 2KOKA 4IS0A 1PA3A 1EWXA 5IOWA 1ZZYA 4I2TA 4BPYA 2RUEA 1AC1A 4V2MA 1TI1A 5ELAA 4NHZA 4P3YB 5DQYA 1ERTA 4YAVA 3OR5A 1PMTA 4FYUA 4ECCA 1K3LA 4FYCA 1EEMA 4MCUA 2E7PA 1BG5A 2HQTA 5LCZA 4N3ZA 2GDRA 1PN0A 4BVYA 3KH9A 2DMLA 2DKHA 1ST9A 2R4VA 2V2GA 4JBBA 5GSSA 1ZCPA 4CY8A 1XXUA 4WF4A 2VLVA 2VM2A 3QFBC 5CRDA 4MABA 2K8VA 4EIQA 2F9SA 1XZOA 3M8NA 1OE7A 3L9SA 2IMDA 2MMAA 3GSTA 4PNGA 3F6DA 5EY6A 1OKTA 1S3CA 4YQVA 1WMJA 3TRXA 5F06A 3APOA 2OKAA 3D5JA 4W66A 4HS1A 1EP7A 2I4AA 1M99A 1MDJA 2A4HA 3UAPA 2O5VA 4TN8A 4JRRA 1LBKA 4OD7A 4MPGA 1KBNA 5J4VA 4KNDA 5J47A 2L5LA 1Z6MA 3P7XA 3ZRDA 3QR6A 2LTKA 2HFDA 4MA9A 1TW9A 4YQUA 4V1Ag 5G2ZA 4PUFC 4MNNA 4QQ7A 2VD1A 18GSA 1J9BA 5IMVA 2WS2A 4G01A 4RQXA 1OE8A 1JLVA 1K0AA 2C3TA 3CSJA 3MDKA 1VF2A 3CWGA 4RQRA 1F3AA 3IXRA 5ELGA 4ZXGA 22GSA 4BVYB 1V58A 3CRUA 4ML1A 5LNKe 3Q74A 3FW2A 3F6FA 1PGTA 3FR6A 1TXUA 4TVEA 1EP8A 4HUAA 1NW2A 1ERWA 1YVLA 3GSSA 3TKPA 4GLTA 2LSTA 2H0HA 5FWGA 5GSTA 1GSSA 2CA8A 1X5EA 1GLPA 3TCOA 4KB3A 4ULXA 2VCWA 3GKXA 4ZIJA 5J5NA 19GSA 1JLWA 3EURA 5CP1A 2FD3A 1EOGA 1TRVA 2FWEA 1M9BA 1FOHA 4ZL8A 3QDNA 2YJHA 2AV4A 3D0ZA 2FA8A 1FO5A 4WR4A 2PVOC 2C0EA 2EC4A 4GWRA 4GF0A 3DD3A 4DSRA 3VWXA 4AGSA 1GTBA 4PURA 2X4AA 3GA4A 3UEMA 1SJ6A 1ABAA 5G5FA 1WP0A 3APSA 1OYJA 1BF5A 3AY8A 5AN1A 2LKUA 1GRXA 2H01A 5KN1A 1MEKA 4TOPA 1ZGNA 3IC8A 2DJ3A 4F03A 1H4OA 5H5RA 1MD3A 4ECBA 4MF6A 4J56E 1K0OA 1PD21 3FEUA 4LLRA 4POLA 2XHFA 5DALA 1AXDA 2YANA 4O7HA 2JL4A 3TDGA 1Z7PA 5KEJA 1Z9HA 5DJMA 2DJ2A 1V2AA 4G10A 3GN3A 4WR5A 3ZMKA 2JU5A 2VL2A 3FYGA 5ECNB 3LWAA 2XBQA 2YV9A 4LMVA 4RI6A 5G31A 5A5HB 2B7KA 1K0DA 1UA5A 5ECMB 2WFCA 2F8FA 1YDKA 2MMZA 3GKMA 4K7OA 4XIHA 1LU4A 3H4KA 4X43A 3HCZA 1JZWA 2R0GA 2NTOA 3IOSA 2EFDA 1HNAA 3FZAA 5IPGA 2JACA 2OE0A 3CRTA 3Q18A 5A34B 3QCPA 2R5GA 1GTUA 3EYTA 3I43A 1DUGA 4K6XA 2LEGA 5KN2A 1JZOA 3J7Yb 4NHWA 3P2AA 1B4QA 4O32A 5A4WA 3KTBA 3MSZA 3H93A 1KTEA 2C1YA 2YWIA 2VL2C 5J9BA 3MNGA 4V2LA 1PX6A 4ZB8A 3IPZA 3F9UA 2C4JA 1K0CA 2J23A 2O87A 3TJJA 3TJFA 3L9VA 1M7TA 5IO0A 1SU9A 2C0GA 4EDZA 3R3EA 4POKA 1I9DA 3IDVA 3FZ9A 1Z6NA 3M3MA 3UJ1A 5ECIB 2I3YA 4ILFA 1X5CA 4AJ7A 1Q4JA 5DALB 2LRTA 3U5RE 4NXIA 2EFHA 4PX1A 3S9FA 3LQ7A 2WZ9A 3ZZXA 4PQIA 3PGTA 2VCQA 3QD9A 1PL1A 13GSA 3HHVA 3NZNA 4ISDA 1GUMA 16GSA 3ME8A 4Q5NA 1TKDB 3KXOA 4HQSA 2KHPA 3I9V2 3C7MA 2EIOA 5JCWA 1XIYA 3EWLA 4N30A 4MF5A 2X99A 1OKDA 3HKRA 2DKIA 3KJYA 2QA1A 4HZ2A 3TJGA 1QGVA 2AYTA 4AJ8A 2R0PA 2R2JA 3EVIA 2F51A 2LUSA 5ECPB 3ME7A 3LXZA 1TRWA 1VGLA 2KLXA 2IMFA 4KDYA 4X0XA 3NIVA 4HEA2 6GSYA 1ILOA 1QFNA 3CTFA 1GSEA 5C04A 3KH7A 3RPNA 1GTIA 5DAKB 2O8VB 4IKHA 4XRDA 2LRNA 4A5PA 2B7JA 2PVQA 4K9ZA 4HJ2A 4XCSA 3KIJA 1A8YA 1YEXA 1SYRA 3G7IA 5E59A 2GLRA 2KP2A 4OFTA 2VIMA 5JWRB 1OC3A 4POMA 3VPTA 4Z7XA 1SVOA 3KM6A 4ZB6A 5CYYA 3UIWA 2BTOT 3LYKA 2ES7A 4IHUA 4L0WA 2OA7A 2L6DA 4NAXA 1GP1A 2PERA 3DVWA 2LJRA 2OADA 2M80A 1ZYEA 1TRUA 4JE1A 5H5SA 1M0UA 1GNWA 3GX0A 2CX4A 5ECOB 5F07A 7GSSA 4HI7A 2YPMA 3CMIA 1WWJA 4OFNA 4BL7A 5ID2A 1XWGA 2PWJA 1BAYA 4OCFA 1SJZA 2VO4A 1V57A 3IV4A 2H1DA 2VCTA 2JSYA 2FGXA 2H19A 2DJ0A 5KN0A 3DEXA 4O5QA 4MF7A 1BG1A 2CVBA 1FW1A 1A0FA 4YKFA 3EMXA 2LQOA 3EU3A 1PL2A 8GSSA 5IMAA 4PXOA 2FUG2 2D2ZA 1I5GA 2C80A 1VF3A 4EC0A 4K1FA 2PGTA 1QXHA 2HNLA 2GTUA 3ZYWA 5A1NA 5JWQB 3QAVA 3LORA 2ALBA 1U3AA 4YQMA 3RHCA 2OACA 3GV1A 1A24A 3PINA 2QSIA 3WT2A 5GAND 2X8CA 3DYRA 1XBSA 2C3NA 1K0BA 4Z2TA 2R6KA 2FWHA 2NPBA 2QC7A 3DXBA 1PKZA 4K0NA 2YZUA 3TRPA 3U6VA 5A5KA 3IRAA 4V2NA 1V40A 4BL7B 5ID2B 3ZMLA 4ZBBA 3LEFA 1O81A 1BEDA 2IFQA 3HDCA 2VOCA 2YV7A 2UV8G 3WGDA 1O73A 1SL1B 5DVBA 4XHMA 1XW5A 2HT9A 4XS4A 1PN9A 4F82A 3HZ8A 1E2YA 1ZYPA 2EFEA 1UN2A 2DJ1A 3V1WA 4KA0A 4WETA 1FB6A 5D9XA 3VPQA 4IQ1A 4TXVA 4QL7A 4MK3A 1RK4A 17GSA 4RUVA 2DMMA 1Y6EA 1THOA 3ZTLA 1T4ZA 1NSWA 1FB0A 1XOBA 5IQYA 2IIYA 3FZ5A 4KDXA 4MJAA 5D9TA 1U6TA 1WJKA 1ACVA 3KP9A 4IQAA 4LA1A 5A1NB 2HSHA 4HZ4A 3ISOA 3F0IA 1Y25A 3KD0A 4JZQA 2PU9C 2B6MA 3D4TA 1XWBA 2O85A 2GS3A 4DSQA 2TIRA 4X1UA 4MZBA 2OBKA 3I6AA 3UBKA 4GRFA 4WF5A 4X4JA 1NM3A 3M0FA 5J40A 2REMA 2YOIA 4GSTA 4RI7A 1PKWA 2XBIA 3M9JA 4WBJA 5L71A 3CSIA 1HQOA 1M9AA 4PTSA 4Z2UA 1QUWA 3VWVA 4ACSA 3WYWA 1X9MB 3VI5A 1TTZA 1KNGA 2PPTA 6GSVA 3FZ4A 4HJMA 1F9MA 2IFQB 2FA4A 1JFUA 2B1LA 1XWAA 4USSA 1K0NA 3US3A 5AISA 5CRGA 4XS4B 3GH6A 1A2JA 5CNWA 4HOJA 2CV4A 2H72A 1IYHA 3ZIJA 1GWCA 1WPIA 1GNEA 3FR3A 5G30A 5A5HA 2P5QA 2DJJA 5KOXA 3M9KA 3LGCA 5LD0A 3Q6OA 1PX7A 2JZTA 5FT3A 3GHAA 2OE3A 4G9HA 4L5OA 2WB9A 1EGRA 2CT6A 3HJOA 1T7PB 1WE0A 3L0HA 4OCEA 2NBSA 5A34A 1WRYA 3MAKA 2GSRA 3FK8A 2CX3A 1AAZA 4GQFA 1A2MA 4TR0A 4YAPA 2H75A 2L5OA 1SKWB 1OC8A 2AB6A 4PUAA 1YZXA 3FMWA 2K9FA 4FQUA 4AKHA 2WJUA 1O7UA 3F63A 2I1UA 4I6XA 3ERGA 3GRXA 4N10A 1TU7A 4ZB9A 3ERWA 6GSWA 2Z9SA 3L4NA 3F3QA 1GTAA 2MYGA 4V1Ap 3JCML 3DMLA 3R2QA 3D6IA 2FNOA 2O89A 3TKSE 4FIWA 1A23A 5FHIA 4BWQA 4L5LA 1SD9A 1O8XA 2HRFA 1GUKA 1B48A 3KEBA 5IIZA 2MBSA 4I8BA 3FHKA 4O5RA 1H75A 3PPUA 3RDWA 4I2UA 3DVXA 4MZCA 4IGJA 2IMEA 3BCKA 4KX4A 1FOVA 1XVQA 1KEBA 2YCDA 4PQHA 4HU7A 2LQQA 2L4CA 4ZB7A 1TK0B 4XS6A 1EEJA 3CXGA 3VURA 1X5DA 1VRSD 2DLXA 1XFLA 3LG6A 4MPFA 1T00A 4G0LA 3CTGA 2VCVA 5JWOB 2A2RA 3EPTA 1U3IA 3D21A 2L57A 2VL3A 2IPAA 4HDEA 3EINA 4ECJA 3QPMA 1CQGA 2FWGA 4GSSA 2H74A 3KTLA 1SK1A 5G5EA 5COHA 3VI7A 2H76A 3DWVA 4OO4A 6GSSA 2GGTA 2P0GA 5ECRB 3GYKA 3N5OA 1QK8A 5HQPA 1EV9A 2H1LA 1F3BA 5GZZB 3TGZA 5ECLB 5DAKA 4O5UA 1USBA 2RM5A 2VLUA 1YY7A 4Q5RA 1TJDA 5HFIA 4MH3A 2GT6A 2OBIA 3UVHA 1K3OA 4MZWA 2EIQA 5JCUA 2H6ZA 3HD5A 1M2DA 2PN8A 2X8HA 3WT1A 2AJQB 3UOMA 3G7JA 1RQMA 2PMTA 3C71A 1O85A 2WCIA 1ML6A 1G7OA 3CYNA 2RUFA 3ZVJA 1GSDA 3MWHA 5B8BA 3QMXA 4ZBAA 1XWCA 5KOWA 5IMFA 3H1NA 2GSSA 4TR1A 3KZQA 4KF9A 4BVXA 2L4QA 3HA9A 2DIYA 4FO5A 2N5FA 2E0QA 5D9VA 4Q5FA 1YKCA 4K0GA 4LMWA 4G2EA 3QAWA 1A8LA 1ZYNA 4IP1A 5HR3A 3A2WA 2MMOA 3EE2A 5ENUA 4ZBDA 4G0IA 2E2GA 2QA2A 10GSA 3HVVA 3L9UA 2C0FA 2RM6A 2AAWA 4D73B 2BJXA 1RW1A 3A3TA 1N25A 4CDOA 2F8AA 5IOXA 1X9SB 2R3XA 1R26A 3W8SA 3BOAA 4ICYA 1PRXA 5IM9A 4KDUA 4AKXB 1SYXA 4EDYA 3G7YA 2OE1A 1JZDA 2WULA 4IELA 1QQ2A 4N0ZA 1NHOA 4CHSA 3LSZA 1NHYA 3HMJG 3ZL5A 2L6CA 3TKQA 1TXXA 3GL5A 3A2VA 5E4WA 2V41A 3HYPA 1ERUA 3IAM2 4KGIA 2B1KA 3A5IA 1B9YC 5GAPD 3GH9A 1BJXA 3IHGA 3IBHA 2YWMA 3BJ5A 2DBCA 2DSAA 1VF1A 2HSMB 5AGYA 4ZILA 1TOFA 2P5RA 3KMOA 2AHEA 1FAAA 5G1LA 2TRXA 1SJIA 2HSNA 4EUYA 1B9XC 2IJYA 4H86A 2H73A 5BRTA 1HD2A 5F0GA 3APQA 4TR1B 3QOUA 4BVXB 4WXTA 1AW9A 3QAGA 2DJKA 3TKRA 2HRNA 5HFGA 3EU4A 2X64A 4G0KA 1S3AA 2CAQA 2FWFA 2XPDA 2V6OA 3F4TA 3Q19A 1N2AA 2TRCP 3IC4A 1BX9A 3GIXA 3TJBA 4KAEA 1OAZA 1XW6A 1B4PA 3F3RA 4F0BA 5DJLA 2VD0A 3CBUA 3GURA 6GSXA 5B6MA 2G2QA 1F2EA 3TOUA 20GSA 4O92A 2VLTA 4NPBA 1HNBA 4K5RA 1TK8B 3GNJA 3K8NA 2FLSA 1R7HA 4CY6A 4GQCA 2F3MA 5DDLA 3GKNA 1SVMA 3GKKA 2GSQA 1YF1A 2A2PA 4I5QA 4LL1B 4EIPA 2CVDA 1YF0A 5AIVA 2G0FA 2B5XA 4ZL9A 1DE2A 4Q5QA 1GH2A 4AI6A 1EGOA 4MMMA 1Y1UA 4K7NA 5JCGA 4F0CA 2IMKA 3VWWA 4NV5A 3UVTA 2IL3A 2NDOA 2H70A 2HSNB 5A4VA 5HR1A 2H6YA 1J0FA 1GSFA 4HU9A 4TR4A 1B8XA 2PBJA 3LW9A 3WD6A 1W89A 4DEJA 2H0GA 2H66A 3CSHA 3MYDA 2FCHA 4ZL7A 4KSMA 1F6MC 2EFCA 2R0CA 2AUVA 4KW6A 3PH9A 1ERVA 1HYUA 2LRCA 3HXSA 3C8EA 5DCGA 3DGQA 4XRAA 4YKGA 4E68A 4E8HA 2PUKC 4EO3A 3ZVJD 5DQSA 3UBLA 4G19A 4GCIA 4DVCA 1XCCA 4KUNA 3G9BA 2WRTA 3H79A 3E3EA 1T3BA 2GZPA 1V9WA 4E8EA 1T1VA 5EVOA 1XOAA 1URMA 2X8GA 4MDCA 2K6VA 4AJ6A 2M72A 2HRAA 1SK2A 1O8WA 2H30A 4OMVA 5CO3A 5CAXA 3KMNA 1X0RA 2HSYA 3IR4A 3WGEA 4JR6A 1PQNA 1AQXA 2LS5A 2KP1A 5C00A 2GQLA 4EVMA 3D4MA 5IMZA 5D93A 2ON5A 4KE3A 2VKZG 3GL3A 2HYXA 3RAZA 4I97A 1G6YA 3KP8A 1W4VA 4ID0A 2HRKA 1BQ7A 2QGVA 2JADA 3ZFBA 5B6NA 1GSYA 5INYA 4MJEA 3ZFLA 2YJ7A 1N8JA 2H6XA 2RIIA 2VAFA 4POBA 2ZCTA 2YWOA 3HVXA 2B5YA 2LJAA 3HJMA 2H1AA 4TW5A 3W8JA 5B7CA 4OO5A 1XPVA 6GSTA 1J08A 2DIZA 3UARA 1K3YA 1U88A 2WGRA 1C72A 4QL9A 1YEPA 2HZEA 3RBTA 3VK9A 3UL3A 5DCHA 3ZLPA 4ECIA 2C3QA 2LJKA 5ECHB 1T4YA 4GDFA 4TKYA 4GSNA 4K7IA 1Z7RA 3O76A 2GSTA 1G7EA 5A4UA 4J57E 12GSA 5F05A 5CRHA 1A0RP 1YQ1A 3ZREA 4ML6A 4J2FA 3O3TA 3TB2A 3TKSA 5ABRA 4HQZA 2CZ2A 5J3RA 2HXKA 3N9JA 2ZNMA 2MBTA 2VUPA 1EZKA 1IYIA 2H8LA 2YZHA 3IAS2 2HRKB 3F4SA 4IW9A 2HZFA 4EXJA 3E9JB 2K8SA 2DC5A 3DKSA 3DRNA 1V98A 2VL9A 4K2DA 5IMDA 1XVWA 2NVLA 3EC3A 1DSBA 2YNXA 3M1GA 2GQMA 1K0MA 2ON7A 1SVLA 3LFLA 2O7KA 3E0UA 3RPPA 3NOFA 2YWNA 1SL0B 1LJRA 1THXA 2GZYA 3TKSC 2ZUPA 2XPEA 3GTUA 2WDUA 2HZEB 1G6WA 1HNCA 2CAIA 4QMKA 4BWSA 1GLQA 2I81A 2JZRA 1FG4A 3LYPA 2H0IA 4OFMA 4MH2A 4NV2A 1ZL9A 4MLYA 5ECSA 1GSUA 5EL8A 1EV4A 3HY2A 3VLNA 5EPFA 2LV3A 1YKAA 1MD4A 3SBCA 3P90A 3UMAA 5IO2A 2EIRA 1O6JA 4PNFA 4WEYA 3GMFA 3TU3B 1YJ6A 3LXTA 4D73A 2IN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUE A;  1OVN A;  2HE3 A;  3J7Y k;  1AIU A;  4KSO A;  4JU5 A;  1R4W A;  5J9C A;  2VCZ A;  2R37 A;  3BBY A;  2OJL A;  3P8W A;  3GX8 A;  2J9H A;  1SKS B;  4L8E A;  1BYE A;  2LNS A;  1OC9 A;  4MP4 A;  2H71 A;  2CQ9 A;  4KCA A;  1SD8 A;  2IMI A;  4XTS A;  1WIK A;  3TOT A;  1Z3E A;  2N5B A;  1R5P A;  3GTU B;  2V32 A;  3F4R A;  3FKF A;  1EOH A;  4YH2 A;  2HSM A;  4EF0 A;  4GTU A;  3ZIT A;  2V6K A;  5J4U A;  5DBQ A;  1CQH A;  1GUH A;  1AQV A;  1S3D A;  3ED3 A;  2JZS A;  1MTC A;  2HLS A;  3L78 A;  3FR9 A;  3QFA C;  5AIX A;  1DE1 A;  1T8E B;  2FHE A;  1U87 A;  4GXZ A;  1R5A A;  4CW9 A;  3A5W A;  2H1B A;  2IWT A;  1ZOF A;  4IVF A;  1GUL A;  3PR8 A;  4KH7 A;  3IK9 A;  4OWY A;  2CVK A;  3KGK A;  3C73 A;  3WGX A;  1TDI A;  3BD2 A;  2YP6 A;  4KCE A;  1E6B A;  2HI7 A;  3FY7 A;  2MZC A;  1M2A A;  2GVP A;  3H8Q A;  5D73 A;  3EMP A;  3I69 A;  1X9W B;  1AQW A;  2V1M A;  5CRE A;  1XW9 A;  4MJB A;  14GS A;  4AF2 A;  1ZYQ B;  3VWU A;  2B5E A;  3A2X A;  5CRW A;  1Z5Y E;  3GFK A;  3HVS A;  2MMN A;  11GS A;  1JZR A;  3FRC A;  4PGT A;  4BA7 A;  1M2B A;  1GL8 A;  3F8U A;  5BMU A;  4NWY A;  4N11 A;  3C1S A;  2LNT A;  1OC9 B;  4DSS A;  2VM1 A;  3C1R A;  1QMV A;  1XWK A;  2GQK A;  2KUC A;  5G1K A;  1VF4 A;  2XC2 A;  1F37 A;  1SEN A;  3HJP A;  2N5A A;  2CZ3 A;  4LL4 B;  3HZ4 A;  4TXO A;  2VCX A;  5HR2 A;  1G0T A;  1TU8 A;  3IA1 A;  1SKR B;  2GZZ A;  1SK0 A;  3O6T A;  1Q98 A;  1UVZ A;  3D22 A;  4L0U A;  5IMC A;  3BCI A;  2B3S A;  1SL2 B;  4TR3 A;  3ZIV A;  2FY6 A;  3W6G A;  2I9H A;  4IJI A;  5ECQ B;  2P31 A;  2M46 A;  1ZMA A;  4EKZ A;  3IK7 A;  9GSS A;  3ERF A;  5D96 A;  2A4V A;  5HR0 A;  1A2L A;  3IHQ A;  2GT5 A;  3LJR A;  5KN3 A;  5D9W A;  4FH8 A;  4XS1 A;  3VFI A;  2C8U A;  4JED A;  5D8I A;  4JR4 A;  4N0V A;  1AUC A;  1WOU A;  2QKE A;  1JHB A;  3SWL A;  1FHE A;  1TK5 B;  4IBP A;  4EE0 A;  2H1G A;  2L59 A;  4NMU A;  4WKW A;  2RLI A;  2UZ8 A;  5HFK A;  3KCM A;  2BMX A;  1PSQ A;  2K18 A;  1MDK A;  3IE3 A;  2YN1 A;  4IP6 A;  4WBR D;  4DSS B;  4K8M A;  1FVK A;  3RHB A;  1TRS A;  1FVJ A;  4IJ3 A;  4PQ1 A;  5F8B A;  4F9Z A;  1DBY A;  4F2I A;  1MDI A;  4TRX A;  1TP9 A;  2C0D A;  1TI3 A;  5B8A A;  4FYB A;  1GSQ A;  4TXO B;  3DIE A;  5ECK B;  5J41 A;  4IN0 A;  4MJC A;  2JSZ A;  5IPH A;  2A2S A;  4EL1 A;  1ON4 A;  1UC7 A;  3TJK A;  2E2M A;  3TRQ A;  6GSU A;  3GUS A;  5H5Q A;  2KOK A;  4IS0 A;  1PA3 A;  1EWX A;  5IOW A;  1ZZY A;  4I2T A;  4BPY A;  2RUE A;  1AC1 A;  4V2M A;  1TI1 A;  5ELA A;  4NHZ A;  4P3Y B;  5DQY A;  1ERT A;  4YAV A;  3OR5 A;  1PMT A;  4FYU A;  4ECC A;  1K3L A;  4FYC A;  1EEM A;  4MCU A;  2E7P A;  1BG5 A;  2HQT A;  5LCZ A;  2GDR A;  4BVY A;  3KH9 A;  2DML A;  1ST9 A;  2R4V A;  2V2G A;  4JBB A;  5GSS A;  1ZCP A;  1XXU A;  4WF4 A;  2VLV A;  2VM2 A;  3QFB C;  5CRD A;  4MAB A;  2K8V A;  2F9S A;  1XZO A;  3M8N A;  1OE7 A;  3L9S A;  2IMD A;  2MMA A;  3GST A;  4PNG A;  3F6D A;  5EY6 A;  1OKT A;  1S3C A;  4YQV A;  1WMJ A;  3TRX A;  5F06 A;  3APO A;  2OKA A;  3D5J A;  4HS1 A;  1EP7 A;  2I4A A;  1M99 A;  1MDJ A;  3UAP A;  4TN8 A;  4JRR A;  1LBK A;  4OD7 A;  4MPG A;  1KBN A;  4KND A;  2L5L A;  1Z6M A;  3P7X A;  3ZRD A;  3QR6 A;  2LTK A;  2HFD A;  4MA9 A;  1TW9 A;  4YQU A;  4V1A g;  5G2Z A;  4PUF C;  4QQ7 A;  2VD1 A;  18GS A;  1J9B A;  5IMV A;  2WS2 A;  4RQX A;  1OE8 A;  1JLV A;  1K0A A;  2C3T A;  3CSJ A;  3MDK A;  1VF2 A;  4RQR A;  1F3A A;  3IXR A;  5ELG A;  4ZXG A;  22GS A;  4BVY B;  1V58 A;  3CRU A;  4ML1 A;  5LNK e;  3Q74 A;  3FW2 A;  3F6F A;  1PGT A;  3FR6 A;  4TVE A;  1EP8 A;  4HUA A;  1NW2 A;  1ERW A;  3GSS A;  3TKP A;  4GLT A;  2LST A;  2H0H A;  5FWG A;  5GST A;  1GSS A;  2CA8 A;  1X5E A;  1GLP A;  3TCO A;  4KB3 A;  4ULX A;  2VCW A;  3GKX A;  4ZIJ A;  5J5N A;  19GS A;  1JLW A;  3EUR A;  5CP1 A;  2FD3 A;  1EOG A;  1TRV A;  2FWE A;  1M9B A;  4ZL8 A;  3QDN A;  2YJH A;  2AV4 A;  3D0Z A;  2FA8 A;  1FO5 A;  4WR4 A;  2PVO C;  2C0E A;  2EC4 A;  4GWR A;  4GF0 A;  3DD3 A;  4DSR A;  3VWX A;  4AGS A;  1GTB A;  4PUR A;  3GA4 A;  3UEM A;  1SJ6 A;  1ABA A;  5G5F A;  1WP0 A;  3APS A;  1OYJ A;  3AY8 A;  5AN1 A;  2LKU A;  1GRX A;  2H01 A;  5KN1 A;  1MEK A;  4TOP A;  1ZGN A;  3IC8 A;  2DJ3 A;  4F03 A;  1H4O A;  5H5R A;  1MD3 A;  4ECB A;  4MF6 A;  4J56 E;  1K0O A;  1PD2 1;  3FEU A;  4LLR A;  4POL A;  2XHF A;  5DAL A;  1AXD A;  2YAN A;  4O7H A;  2JL4 A;  3TDG A;  1Z7P A;  5KEJ A;  1Z9H A;  5DJM A;  2DJ2 A;  1V2A A;  4G10 A;  3GN3 A;  4WR5 A;  3ZMK A;  2JU5 A;  2VL2 A;  3FYG A;  5ECN B;  3LWA A;  2XBQ A;  2YV9 A;  4LMV A;  4RI6 A;  5G31 A;  2B7K A;  1K0D A;  1UA5 A;  5ECM B;  2WFC A;  2F8F A;  1YDK A;  2MMZ A;  3GKM A;  4K7O A;  4XIH A;  1LU4 A;  3H4K A;  4X43 A;  3HCZ A;  1JZW A;  2NTO A;  3IOS A;  1HNA A;  3FZA A;  5IPG A;  2JAC A;  2OE0 A;  3CRT A;  3Q18 A;  3QCP A;  2R5G A;  1GTU A;  3EYT A;  3I43 A;  1DUG A;  4K6X A;  2LEG A;  5KN2 A;  1JZO A;  3J7Y b;  4NHW A;  3P2A A;  1B4Q A;  4O32 A;  5A4W A;  3KTB A;  3MSZ A;  3H93 A;  1KTE A;  2C1Y A;  2YWI A;  2VL2 C;  5J9B A;  3MNG A;  4V2L A;  1PX6 A;  4ZB8 A;  3IPZ A;  3F9U A;  2C4J A;  1K0C A;  2J23 A;  2O87 A;  3TJJ A;  3TJF A;  3L9V A;  1M7T A;  5IO0 A;  1SU9 A;  2C0G A;  4EDZ A;  3R3E A;  4POK A;  1I9D A;  3IDV A;  3FZ9 A;  1Z6N A;  3M3M A;  3UJ1 A;  5ECI B;  2I3Y A;  4ILF A;  1X5C A;  4AJ7 A;  1Q4J A;  5DAL B;  2LRT A;  3U5R E;  4NXI A;  4PX1 A;  3S9F A;  3LQ7 A;  2WZ9 A;  3ZZX A;  4PQI A;  3PGT A;  2VCQ A;  3QD9 A;  1PL1 A;  13GS A;  3HHV A;  3NZN A;  4ISD A;  1GUM A;  16GS A;  3ME8 A;  4Q5N A;  1TKD B;  3KXO A;  4HQS A;  2KHP A;  3I9V 2;  3C7M A;  2EIO A;  5JCW A;  1XIY A;  3EWL A;  4N30 A;  4MF5 A;  2X99 A;  1OKD A;  3HKR A;  3KJY A;  4HZ2 A;  3TJG A;  1QGV A;  2AYT A;  4AJ8 A;  2R2J A;  3EVI A;  2F51 A;  2LUS A;  5ECP B;  3ME7 A;  3LXZ A;  1TRW A;  1VGL A;  2KLX A;  2IMF A;  4KDY A;  4X0X A;  3NIV A;  4HEA 2;  6GSY A;  1ILO A;  1QFN A;  3CTF A;  1GSE A;  5C04 A;  3KH7 A;  3RPN A;  1GTI A;  5DAK B;  2O8V B;  4IKH A;  4XRD A;  2LRN A;  2B7J A;  2PVQ A;  4K9Z A;  4HJ2 A;  4XCS A;  3KIJ A;  1A8Y A;  1YEX A;  1SYR A;  3G7I A;  5E59 A;  2GLR A;  2KP2 A;  4OFT A;  2VIM A;  5JWR B;  1OC3 A;  4POM A;  3VPT A;  4Z7X A;  3KM6 A;  4ZB6 A;  5CYY A;  3UIW A;  2BTO T;  3LYK A;  2ES7 A;  4IHU A;  4L0W A;  2OA7 A;  2L6D A;  4NAX A;  1GP1 A;  2PER A;  3DVW A;  2LJR A;  2OAD A;  2M80 A;  1ZYE A;  1TRU A;  4JE1 A;  5H5S A;  1M0U A;  1GNW A;  3GX0 A;  2CX4 A;  5ECO B;  5F07 A;  7GSS A;  4HI7 A;  2YPM A;  3CMI A;  1WWJ A;  4OFN A;  4BL7 A;  5ID2 A;  1XWG A;  2PWJ A;  1BAY A;  4OCF A;  1SJZ A;  2VO4 A;  1V57 A;  3IV4 A;  2H1D A;  2VCT A;  2JSY A;  2FGX A;  2H19 A;  2DJ0 A;  5KN0 A;  3DEX A;  4MF7 A;  2CVB A;  1FW1 A;  1A0F A;  3EMX A;  2LQO A;  3EU3 A;  1PL2 A;  8GSS A;  5IMA A;  4PXO A;  2FUG 2;  2D2Z A;  1I5G A;  2C80 A;  1VF3 A;  4EC0 A;  4K1F A;  2PGT A;  1QXH A;  2HNL A;  2GTU A;  3ZYW A;  5JWQ B;  3QAV A;  3LOR A;  2ALB A;  1U3A A;  4YQM A;  3RHC A;  2OAC A;  3GV1 A;  1A24 A;  3PIN A;  2QSI A;  3WT2 A;  5GAN D;  2X8C A;  3DYR A;  1XBS A;  2C3N A;  1K0B A;  2R6K A;  2FWH A;  2NPB A;  2QC7 A;  3DXB A;  1PKZ A;  4K0N A;  2YZU A;  3TRP A;  3U6V A;  5A5K A;  3IRA A;  4V2N A;  1V40 A;  4BL7 B;  5ID2 B;  3ZML A;  4ZBB A;  3LEF A;  1O81 A;  1BED A;  2IFQ A;  3HDC A;  2VOC A;  2YV7 A;  3WGD A;  1O73 A;  1SL1 B;  5DVB A;  4XHM A;  1XW5 A;  2HT9 A;  4XS4 A;  1PN9 A;  4F82 A;  3HZ8 A;  1E2Y A;  1UN2 A;  2DJ1 A;  3V1W A;  4KA0 A;  4WET A;  1FB6 A;  5D9X A;  3VPQ A;  4IQ1 A;  4TXV A;  4QL7 A;  4MK3 A;  1RK4 A;  17GS A;  4RUV A;  2DMM A;  1Y6E A;  1THO A;  3ZTL A;  1T4Z A;  1NSW A;  1FB0 A;  1XOB A;  5IQY A;  2IIY A;  3FZ5 A;  4KDX A;  4MJA A;  5D9T A;  1U6T A;  1WJK A;  1ACV A;  3KP9 A;  4IQA A;  4LA1 A;  2HSH A;  4HZ4 A;  3ISO A;  3F0I A;  1Y25 A;  3KD0 A;  4JZQ A;  2PU9 C;  2B6M A;  3D4T A;  1XWB A;  2O85 A;  2GS3 A;  4DSQ A;  2TIR A;  4X1U A;  4MZB A;  2OBK A;  3I6A A;  3UBK A;  4GRF A;  4WF5 A;  1NM3 A;  3M0F A;  2REM A;  2YOI A;  4GST A;  4RI7 A;  1PKW A;  2XBI A;  3M9J A;  4WBJ A;  5L71 A;  3CSI A;  1HQO A;  1M9A A;  4PTS A;  1QUW A;  3VWV A;  4ACS A;  3WYW A;  1X9M B;  3VI5 A;  1TTZ A;  1KNG A;  2PPT A;  6GSV A;  3FZ4 A;  4HJM A;  1F9M A;  2IFQ B;  2FA4 A;  1JFU A;  2B1L A;  1XWA A;  4USS A;  1K0N A;  3US3 A;  5AIS A;  5CRG A;  4XS4 B;  3GH6 A;  1A2J A;  5CNW A;  4HOJ A;  2CV4 A;  2H72 A;  1IYH A;  3ZIJ A;  1GWC A;  1WPI A;  1GNE A;  3FR3 A;  5G30 A;  2P5Q A;  2DJJ A;  3M9K A;  3LGC A;  5LD0 A;  3Q6O A;  1PX7 A;  2JZT A;  5FT3 A;  3GHA A;  2OE3 A;  4G9H A;  4L5O A;  2WB9 A;  1EGR A;  2CT6 A;  3HJO A;  1T7P B;  1WE0 A;  3L0H A;  4OCE A;  2NBS A;  1WRY A;  3MAK A;  2GSR A;  3FK8 A;  2CX3 A;  1AAZ A;  4GQF A;  1A2M A;  4TR0 A;  4YAP A;  2H75 A;  2L5O A;  1SKW B;  1OC8 A;  2AB6 A;  4PUA A;  1YZX A;  2K9F A;  4FQU A;  2WJU A;  1O7U A;  3F63 A;  2I1U A;  4I6X A;  3ERG A;  3GRX A;  4N10 A;  1TU7 A;  4ZB9 A;  3ERW A;  6GSW A;  2Z9S A;  3L4N A;  3F3Q A;  1GTA A;  2MYG A;  4V1A p;  3JCM L;  3DML A;  3R2Q A;  3D6I A;  2FNO A;  2O89 A;  3TKS E;  4FIW A;  1A23 A;  5FHI A;  4BWQ A;  4L5L A;  1SD9 A;  1O8X A;  2HRF A;  1GUK A;  1B48 A;  3KEB A;  5IIZ A;  2MBS A;  4I8B A;  3FHK A;  4O5R A;  1H75 A;  3PPU A;  3RDW A;  4I2U A;  3DVX A;  4MZC A;  4IGJ A;  2IME A;  3BCK A;  4KX4 A;  1FOV A;  1XVQ A;  1KEB A;  2YCD A;  4PQH A;  4HU7 A;  2LQQ A;  2L4C A;  1TK0 B;  4XS6 A;  1EEJ A;  3CXG A;  3VUR A;  1X5D A;  1VRS D;  2DLX A;  1XFL A;  3LG6 A;  4MPF A;  1T00 A;  4G0L A;  3CTG A;  2VCV A;  5JWO B;  2A2R A;  1U3I A;  3D21 A;  2L57 A;  2VL3 A;  2IPA A;  4HDE A;  3EIN A;  4ECJ A;  3QPM A;  1CQG A;  2FWG A;  4GSS A;  2H74 A;  3KTL A;  1SK1 A;  5G5E A;  5COH A;  3VI7 A;  2H76 A;  3DWV A;  4OO4 A;  6GSS A;  2GGT A;  2P0G A;  5ECR B;  3GYK A;  3N5O A;  1QK8 A;  5HQP A;  1EV9 A;  1F3B A;  5GZZ B;  3TGZ A;  5ECL B;  5DAK A;  1USB A;  2RM5 A;  2VLU A;  1YY7 A;  4Q5R A;  1TJD A;  5HFI A;  4MH3 A;  2GT6 A;  2OBI A;  3UVH A;  1K3O A;  4MZW A;  2EIQ A;  5JCU A;  2H6Z A;  3HD5 A;  1M2D A;  2PN8 A;  2X8H A;  3WT1 A;  2AJQ B;  3UOM A;  3G7J A;  1RQM A;  2PMT A;  3C71 A;  1O85 A;  2WCI A;  1ML6 A;  1G7O A;  3CYN A;  2RUF A;  3ZVJ A;  1GSD A;  3MWH A;  5B8B A;  3QMX A;  4ZBA A;  1XWC A;  5IMF A;  3H1N A;  2GSS A;  4TR1 A;  3KZQ A;  4KF9 A;  4BVX A;  2L4Q A;  3HA9 A;  2DIY A;  4FO5 A;  2N5F A;  2E0Q A;  5D9V A;  4Q5F A;  1YKC A;  4K0G A;  4LMW A;  4G2E A;  3QAW A;  1A8L A;  4IP1 A;  5HR3 A;  3A2W A;  2MMO A;  3EE2 A;  5ENU A;  4ZBD A;  4G0I A;  2E2G A;  3HVV A;  10GS A;  3L9U A;  2C0F A;  2RM6 A;  2AAW A;  4D73 B;  2BJX A;  1RW1 A;  3A3T A;  4CDO A;  2F8A A;  5IOX A;  1X9S B;  2R3X A;  1R26 A;  3W8S A;  3BOA A;  1PRX A;  5IM9 A;  4KDU A;  1SYX A;  4EDY A;  3G7Y A;  2OE1 A;  1JZD A;  2WUL A;  4IEL A;  1QQ2 A;  4N0Z A;  1NHO A;  4CHS A;  3LSZ A;  1NHY A;  3ZL5 A;  2L6C A;  3TKQ A;  1TXX A;  3GL5 A;  3A2V A;  5E4W A;  2V41 A;  3HYP A;  1ERU A;  3IAM 2;  4KGI A;  2B1K A;  1B9Y C;  5GAP D;  3GH9 A;  1BJX A;  3IBH A;  2YWM A;  3BJ5 A;  2DBC A;  2DSA A;  1VF1 A;  2HSM B;  5AGY A;  4ZIL A;  1TOF A;  2P5R A;  3KMO A;  2AHE A;  1FAA A;  5G1L A;  2TRX A;  1SJI A;  4EUY A;  1B9X C;  2IJY A;  4H86 A;  2H73 A;  1HD2 A;  5F0G A;  3APQ A;  4TR1 B;  3QOU A;  4BVX B;  4WXT A;  1AW9 A;  3QAG A;  2DJK A;  3TKR A;  2HRN A;  5HFG A;  3EU4 A;  2X64 A;  4G0K A;  1S3A A;  2CAQ A;  2FWF A;  2XPD A;  2V6O A;  3F4T A;  3Q19 A;  1N2A A;  2TRC P;  3IC4 A;  1BX9 A;  3GIX A;  3TJB A;  4KAE A;  1OAZ A;  1XW6 A;  1B4P A;  3F3R A;  4F0B A;  5DJL A;  2VD0 A;  3CBU A;  3GUR A;  6GSX A;  5B6M A;  2G2Q A;  1F2E A;  3TOU A;  20GS A;  4O92 A;  2VLT A;  4NPB A;  1HNB A;  1TK8 B;  3GNJ A;  3K8N A;  2FLS A;  1R7H A;  4GQC A;  2F3M A;  5DDL A;  3GKN A;  3GKK A;  2GSQ A;  1YF1 A;  4I5Q A;  4LL1 B;  2CVD A;  1YF0 A;  5AIV A;  2G0F A;  2B5X A;  4ZL9 A;  1DE2 A;  4Q5Q A;  1GH2 A;  1EGO A;  4MMM A;  4K7N A;  5JCG A;  4F0C A;  2IMK A;  3VWW A;  4NV5 A;  3UVT A;  2IL3 A;  2NDO A;  2H70 A;  2HSN B;  5A4V A;  5HR1 A;  2H6Y A;  1J0F A;  1GSF A;  4HU9 A;  4TR4 A;  1B8X A;  2PBJ A;  3WD6 A;  1W89 A;  4DEJ A;  2H0G A;  2H66 A;  3CSH A;  2FCH A;  4ZL7 A;  4KSM A;  1F6M C;  2AUV A;  4KW6 A;  3PH9 A;  1ERV A;  1HYU A;  2LRC A;  3HXS A;  3C8E A;  5DCG A;  3DGQ A;  4XRA A;  4E8H A;  2PUK C;  4EO3 A;  3ZVJ D;  5DQS A;  3UBL A;  4G19 A;  4GCI A;  4DVC A;  1XCC A;  4KUN A;  3G9B A;  2WRT A;  3H79 A;  3E3E A;  1T3B A;  2GZP A;  1V9W A;  4E8E A;  1T1V A;  5EVO A;  1XOA A;  1URM A;  2X8G A;  4MDC A;  2K6V A;  4AJ6 A;  2M72 A;  2HRA A;  1SK2 A;  1O8W A;  2H30 A;  4OMV A;  5CO3 A;  5CAX A;  3KMN A;  1X0R A;  2HSY A;  3IR4 A;  3WGE A;  4JR6 A;  1PQN A;  1AQX A;  2LS5 A;  2KP1 A;  5C00 A;  2GQL A;  4EVM A;  3D4M A;  5IMZ A;  5D93 A;  2ON5 A;  4KE3 A;  3GL3 A;  2HYX A;  3RAZ A;  4I97 A;  1G6Y A;  3KP8 A;  1W4V A;  4ID0 A;  2HRK A;  1BQ7 A;  2QGV A;  2JAD A;  3ZFB A;  5B6N A;  1GSY A;  5INY A;  4MJE A;  3ZFL A;  2YJ7 A;  1N8J A;  2H6X A;  2RII A;  2VAF A;  4POB A;  2ZCT A;  2YWO A;  3HVX A;  2B5Y A;  2LJA A;  3HJM A;  2H1A A;  4TW5 A;  3W8J A;  5B7C A;  4OO5 A;  1XPV A;  6GST A;  1J08 A;  2DIZ A;  3UAR A;  1K3Y A;  1U88 A;  2WGR A;  1C72 A;  4QL9 A;  1YEP A;  2HZE A;  3RBT A;  3VK9 A;  3UL3 A;  5DCH A;  3ZLP A;  4ECI A;  2C3Q A;  2LJK A;  5ECH B;  1T4Y A;  4TKY A;  4GSN A;  4K7I A;  1Z7R A;  3O76 A;  2GST A;  1G7E A;  5A4U A;  4J57 E;  12GS A;  5F05 A;  5CRH A;  1A0R P;  1YQ1 A;  3ZRE A;  4ML6 A;  4J2F A;  3O3T A;  3TB2 A;  3TKS A;  5ABR A;  4HQZ A;  2CZ2 A;  5J3R A;  2HXK A;  3N9J A;  2ZNM A;  2MBT A;  2VUP A;  1EZK A;  1IYI A;  2H8L A;  2YZH A;  3IAS 2;  2HRK B;  3F4S A;  4IW9 A;  2HZF A;  4EXJ A;  3E9J B;  2K8S A;  2DC5 A;  3DKS A;  3DRN A;  1V98 A;  2VL9 A;  4K2D A;  5IMD A;  1XVW A;  2NVL A;  3EC3 A;  1DSB A;  2YNX A;  3M1G A;  2GQM A;  1K0M A;  2ON7 A;  3LFL A;  2O7K A;  3E0U A;  3RPP A;  3NOF A;  2YWN A;  1SL0 B;  1LJR A;  1THX A;  2GZY A;  3TKS C;  2ZUP A;  2XPE A;  3GTU A;  2WDU A;  2HZE B;  1G6W A;  1HNC A;  2CAI A;  4BWS A;  1GLQ A;  2I81 A;  2JZR A;  1FG4 A;  3LYP A;  2H0I A;  4OFM A;  4MH2 A;  4NV2 A;  1ZL9 A;  4MLY A;  5ECS A;  1GSU A;  5EL8 A;  1EV4 A;  3HY2 A;  3VLN A;  5EPF A;  2LV3 A;  1YKA A;  1MD4 A;  3SBC A;  3P90 A;  3UMA A;  5IO2 A;  2EIR A;  1O6J A;  4PNF A;  4WEY A;  3GMF A;  1YJ6 A;  3LXT A;  4D73 A;  2IN3 A; 
#chains in the Genus database with same CATH topology
 3TUE A;  1OVN A;  2HE3 A;  3J7Y k;  1AIU A;  4KSO A;  4JU5 A;  1R4W A;  5J9C A;  2VCZ A;  2R37 A;  3BBY A;  2OJL A;  3P8W A;  3GX8 A;  2J9H A;  1SKS B;  4L8E A;  4AKG A;  1BYE A;  2LNS A;  1OC9 A;  4MP4 A;  2H71 A;  2CQ9 A;  4KCA A;  1SD8 A;  2IMI A;  4XTS A;  1WIK A;  3TOT A;  1Z3E A;  2N5B A;  1R5P A;  3GTU B;  2V32 A;  3F4R A;  3FKF A;  1EOH A;  2O36 A;  4YH2 A;  2HSM A;  4EF0 A;  4GTU A;  3ZIT A;  2V6K A;  5J4U A;  5DBQ A;  1CQH A;  2WVY A;  1GUH A;  1AQV A;  1S3D A;  3ED3 A;  2JZS A;  1MTC A;  2HLS A;  3L78 A;  3FR9 A;  3QFA C;  5AIX A;  1DE1 A;  1T8E B;  2FHE A;  1U87 A;  4GXZ A;  1R5A A;  4CW9 A;  3A5W A;  2H1B A;  2IWT A;  1ZOF A;  4IVF A;  1GUL A;  3PR8 A;  4KH7 A;  3IK9 A;  4OWY A;  2CVK A;  3KGK A;  3C73 A;  3WGX A;  1TDI A;  3BD2 A;  2YP6 A;  4KCE A;  1E6B A;  2HI7 A;  3FY7 A;  2MZC A;  1M2A A;  2GVP A;  3H8Q A;  5D73 A;  3EMP A;  3I69 A;  1X9W B;  1AQW A;  2V1M A;  5CRE A;  1XW9 A;  4MJB A;  14GS A;  4AF2 A;  1ZYQ B;  4AKI A;  3VWU A;  2B5E A;  3A2X A;  5CRW A;  1Z5Y E;  3GFK A;  3HVS A;  2MMN A;  11GS A;  1JZR A;  3FRC A;  4PGT A;  4BA7 A;  3RGB C;  1M2B A;  1GL8 A;  3F8U A;  5BMU A;  4NWY A;  4N11 A;  3C1S A;  2LNT A;  1OC9 B;  4DSS A;  2VM1 A;  3C1R A;  2OT3 A;  1QMV A;  1XWK A;  2GQK A;  2KUC A;  5G1K A;  1VF4 A;  2XC2 A;  1F37 A;  1SEN A;  3HJP A;  2N5A A;  2CZ3 A;  4LL4 B;  3HZ4 A;  5J4Y A;  4TXO A;  2VCX A;  5HR2 A;  1G0T A;  1TU8 A;  4K5S A;  3IA1 A;  1SKR B;  2GZZ A;  1SK0 A;  3O6T A;  1Q98 A;  1UVZ A;  3D22 A;  4L0U A;  5IMC A;  3BCI A;  2B3S A;  1SL2 B;  2X49 A;  4TR3 A;  3ZIV A;  2FY6 A;  3W6G A;  2I9H A;  4IJI A;  5ECQ B;  2P31 A;  2M46 A;  1ZMA A;  4EKZ A;  3IK7 A;  9GSS A;  3ERF A;  5D96 A;  2A4V A;  5HR0 A;  1A2L A;  3IHQ A;  2GT5 A;  3LJR A;  5KN3 A;  5D9W A;  4Z2R A;  4FH8 A;  4XS1 A;  3VFI A;  2C8U A;  4JED A;  5D8I A;  4JR4 A;  4N0V A;  1AUC A;  1WOU A;  2QKE A;  1JHB A;  3SWL A;  1FHE A;  1TK5 B;  4IBP A;  4EE0 A;  2H1G A;  2L59 A;  4NMU A;  4WKW A;  2RLI A;  2UZ8 A;  5HFK A;  3KCM A;  2BMX A;  1PSQ A;  2K18 A;  1MDK A;  3IE3 A;  2YN1 A;  5BMU B;  4IP6 A;  4WBR D;  4DSS B;  4K8M A;  1FVK A;  3RHB A;  1TRS A;  1FVJ A;  4IJ3 A;  4PQ1 A;  5F8B A;  4F9Z A;  1DBY A;  4F2I A;  1MDI A;  4TRX A;  1TP9 A;  2C0D A;  1TI3 A;  5B8A A;  3MIX A;  4K2X A;  4FYB A;  1GSQ A;  4TXO B;  3DIE A;  5ECK B;  5J41 A;  4IN0 A;  4MJC A;  2JSZ A;  5IPH A;  2A2S A;  4EL1 A;  1ON4 A;  1UC7 A;  3TJK A;  2E2M A;  3TRQ A;  6GSU A;  3GUS A;  5H5Q A;  2KOK A;  4IS0 A;  4BIK A;  1PA3 A;  1EWX A;  5IOW A;  1ZZY A;  1S4B P;  4I2T A;  4BPY A;  2RUE A;  1AC1 A;  4V2M A;  1TI1 A;  5ELA A;  4NHZ A;  4P3Y B;  5DQY A;  1ERT A;  4YAV A;  3OR5 A;  1PMT A;  4FYU A;  4ECC A;  1K3L A;  4FYC A;  1EEM A;  4MCU A;  2E7P A;  1BG5 A;  2HQT A;  5LCZ A;  4N3Z A;  2GDR A;  1PN0 A;  4BVY A;  3KH9 A;  2DML A;  2DKH A;  1ST9 A;  2R4V A;  2V2G A;  4JBB A;  5GSS A;  1ZCP A;  4CY8 A;  1XXU A;  4WF4 A;  2VLV A;  2VM2 A;  3QFB C;  5CRD A;  4MAB A;  2K8V A;  4EIQ A;  2F9S A;  1XZO A;  3M8N A;  1OE7 A;  3L9S A;  2IMD A;  2MMA A;  3GST A;  4PNG A;  3F6D A;  5EY6 A;  1OKT A;  1S3C A;  4YQV A;  1WMJ A;  3TRX A;  5F06 A;  3APO A;  2OKA A;  3D5J A;  4W66 A;  4HS1 A;  1EP7 A;  2I4A A;  1M99 A;  1MDJ A;  2A4H A;  3UAP A;  2O5V A;  4TN8 A;  4JRR A;  1LBK A;  4OD7 A;  4MPG A;  1KBN A;  5J4V A;  4KND A;  5J47 A;  2L5L A;  1Z6M A;  3P7X A;  3ZRD A;  3QR6 A;  2LTK A;  2HFD A;  4MA9 A;  1TW9 A;  4YQU A;  4V1A g;  5G2Z A;  4PUF C;  4MNN A;  4QQ7 A;  2VD1 A;  18GS A;  1J9B A;  5IMV A;  2WS2 A;  4G01 A;  4RQX A;  1OE8 A;  1JLV A;  1K0A A;  2C3T A;  3CSJ A;  3MDK A;  1VF2 A;  3CWG A;  4RQR A;  1F3A A;  3IXR A;  5ELG A;  4ZXG A;  22GS A;  4BVY B;  1V58 A;  3CRU A;  4ML1 A;  5LNK e;  3Q74 A;  3FW2 A;  3F6F A;  1PGT A;  3FR6 A;  1TXU A;  4TVE A;  1EP8 A;  4HUA A;  1NW2 A;  1ERW A;  1YVL A;  3GSS A;  3TKP A;  4GLT A;  2LST A;  2H0H A;  5FWG A;  5GST A;  1GSS A;  2CA8 A;  1X5E A;  1GLP A;  3TCO A;  4KB3 A;  4ULX A;  2VCW A;  3GKX A;  4ZIJ A;  5J5N A;  19GS A;  1JLW A;  3EUR A;  5CP1 A;  2FD3 A;  1EOG A;  1TRV A;  2FWE A;  1M9B A;  1FOH A;  4ZL8 A;  3QDN A;  2YJH A;  2AV4 A;  3D0Z A;  2FA8 A;  1FO5 A;  4WR4 A;  2PVO C;  2C0E A;  2EC4 A;  4GWR A;  4GF0 A;  3DD3 A;  4DSR A;  3VWX A;  4AGS A;  1GTB A;  4PUR A;  2X4A A;  3GA4 A;  3UEM A;  1SJ6 A;  1ABA A;  5G5F A;  1WP0 A;  3APS A;  1OYJ A;  1BF5 A;  3AY8 A;  5AN1 A;  2LKU A;  1GRX A;  2H01 A;  5KN1 A;  1MEK A;  4TOP A;  1ZGN A;  3IC8 A;  2DJ3 A;  4F03 A;  1H4O A;  5H5R A;  1MD3 A;  4ECB A;  4MF6 A;  4J56 E;  1K0O A;  1PD2 1;  3FEU A;  4LLR A;  4POL A;  2XHF A;  5DAL A;  1AXD A;  2YAN A;  4O7H A;  2JL4 A;  3TDG A;  1Z7P A;  5KEJ A;  1Z9H A;  5DJM A;  2DJ2 A;  1V2A A;  4G10 A;  3GN3 A;  4WR5 A;  3ZMK A;  2JU5 A;  2VL2 A;  3FYG A;  5ECN B;  3LWA A;  2XBQ A;  2YV9 A;  4LMV A;  4RI6 A;  5G31 A;  5A5H B;  2B7K A;  1K0D A;  1UA5 A;  5ECM B;  2WFC A;  2F8F A;  1YDK A;  2MMZ A;  3GKM A;  4K7O A;  4XIH A;  1LU4 A;  3H4K A;  4X43 A;  3HCZ A;  1JZW A;  2R0G A;  2NTO A;  3IOS A;  2EFD A;  1HNA A;  3FZA A;  5IPG A;  2JAC A;  2OE0 A;  3CRT A;  3Q18 A;  5A34 B;  3QCP A;  2R5G A;  1GTU A;  3EYT A;  3I43 A;  1DUG A;  4K6X A;  2LEG A;  5KN2 A;  1JZO A;  3J7Y b;  4NHW A;  3P2A A;  1B4Q A;  4O32 A;  5A4W A;  3KTB A;  3MSZ A;  3H93 A;  1KTE A;  2C1Y A;  2YWI A;  2VL2 C;  5J9B A;  3MNG A;  4V2L A;  1PX6 A;  4ZB8 A;  3IPZ A;  3F9U A;  2C4J A;  1K0C A;  2J23 A;  3CHX C;  2O87 A;  3TJJ A;  3TJF A;  3L9V A;  2WW1 A;  1M7T A;  5IO0 A;  1SU9 A;  2C0G A;  4EDZ A;  3R3E A;  4POK A;  1I9D A;  3IDV A;  3FZ9 A;  1Z6N A;  3M3M A;  3UJ1 A;  5ECI B;  2I3Y A;  4ILF A;  1X5C A;  4AJ7 A;  1Q4J A;  5DAL B;  1M3J A;  2LRT A;  3U5R E;  4NXI A;  2EFH A;  4PX1 A;  3S9F A;  3LQ7 A;  2WZ9 A;  3ZZX A;  4PQI A;  2WZS A;  3PGT A;  2VCQ A;  3QD9 A;  1PL1 A;  13GS A;  3HHV A;  3NZN A;  4ISD A;  1GUM A;  16GS A;  3ME8 A;  4Q5N A;  1TKD B;  3KXO A;  4HQS A;  2KHP A;  3I9V 2;  3C7M A;  2EIO A;  5JCW A;  1XIY A;  3EWL A;  4N30 A;  4MF5 A;  2X99 A;  1OKD A;  3HKR A;  2DKI A;  3KJY A;  2QA1 A;  4HZ2 A;  3TJG A;  1QGV A;  2AYT A;  4AJ8 A;  2R0P A;  2R2J A;  3EVI A;  2F51 A;  2LUS A;  5ECP B;  3ME7 A;  3LXZ A;  1TRW A;  1VGL A;  2KLX A;  2IMF A;  4KDY A;  4X0X A;  3NIV A;  4HEA 2;  6GSY A;  1ILO A;  1QFN A;  3CTF A;  1GSE A;  5C04 A;  3KH7 A;  3RPN A;  1GTI A;  5DAK B;  2O8V B;  4IKH A;  4XRD A;  2LRN A;  4A5P A;  2B7J A;  2PVQ A;  4K9Z A;  4HJ2 A;  4XCS A;  3KIJ A;  1A8Y A;  1YEX A;  1SYR A;  3G7I A;  5E59 A;  2GLR A;  2WW2 A;  2KP2 A;  4OFT A;  2VIM A;  5JWR B;  1OC3 A;  4POM A;  3VPT A;  4Z7X A;  1SVO A;  3KM6 A;  4ZB6 A;  5CYY A;  3UIW A;  2BTO T;  3LYK A;  2ES7 A;  4IHU A;  4L0W A;  2OA7 A;  2L6D A;  4NAX A;  1GP1 A;  4PI0 C;  2PER A;  3DVW A;  2LJR A;  1I1I P;  2OAD A;  2M80 A;  1ZYE A;  1TRU A;  4JE1 A;  5H5S A;  1M0U A;  1GNW A;  3GX0 A;  2CX4 A;  5ECO B;  5F07 A;  7GSS A;  4HI7 A;  2YPM A;  3CMI A;  1WWJ A;  4OFN A;  4BL7 A;  5ID2 A;  1XWG A;  2PWJ A;  1BAY A;  4OCF A;  1SJZ A;  2VO4 A;  1V57 A;  3IV4 A;  2H1D A;  2VCT A;  2JSY A;  2FGX A;  2H19 A;  2DJ0 A;  5KN0 A;  3DEX A;  4O5Q A;  4MF7 A;  1BG1 A;  2CVB A;  1FW1 A;  1A0F A;  4YKF A;  3EMX A;  2LQO A;  3EU3 A;  1PL2 A;  8GSS A;  5IMA A;  4PXO A;  2FUG 2;  2D2Z A;  1I5G A;  2C80 A;  1VF3 A;  4EC0 A;  4K1F A;  2PGT A;  1QXH A;  2HNL A;  2GTU A;  3ZYW A;  5A1N A;  5JWQ B;  3QAV A;  1PFO A;  3LOR A;  2ALB A;  1U3A A;  4YQM A;  3RHC A;  2OAC A;  3GV1 A;  1A24 A;  3PIN A;  2QSI A;  3WT2 A;  5GAN D;  2X8C A;  3DYR A;  1XBS A;  2C3N A;  1K0B A;  4Z2T A;  2R6K A;  2FWH A;  2NPB A;  2QC7 A;  3DXB A;  1PKZ A;  4K0N A;  2YZU A;  3TRP A;  3U6V A;  5A5K A;  3IRA A;  4V2N A;  1V40 A;  4BL7 B;  5ID2 B;  3ZML A;  4ZBB A;  3LEF A;  1O81 A;  1BED A;  2IFQ A;  3HDC A;  2VOC A;  2YV7 A;  2UV8 G;  3WGD A;  1O73 A;  1SL1 B;  5DVB A;  4XHM A;  1XW5 A;  2HT9 A;  4XS4 A;  1PN9 A;  4F82 A;  3HZ8 A;  1E2Y A;  1ZYP A;  2EFE A;  1UN2 A;  2DJ1 A;  3V1W A;  4KA0 A;  4WET A;  1FB6 A;  5D9X A;  3VPQ A;  4IQ1 A;  4TXV A;  4QL7 A;  4MK3 A;  1RK4 A;  17GS A;  4RUV A;  2DMM A;  1Y6E A;  1THO A;  3ZTL A;  1T4Z A;  1NSW A;  1FB0 A;  1XOB A;  5IQY A;  2IIY A;  3FZ5 A;  4KDX A;  4MJA A;  5D9T A;  1U6T A;  1WJK A;  1ACV A;  3KP9 A;  4IQA A;  4LA1 A;  5A1N B;  2HSH A;  4HZ4 A;  3ISO A;  3F0I A;  1Y25 A;  3KD0 A;  4JZQ A;  2PU9 C;  2B6M A;  3D4T A;  1XWB A;  2O85 A;  2GS3 A;  4DSQ A;  2TIR A;  4X1U A;  3RFR C;  4MZB A;  2OBK A;  3I6A A;  3UBK A;  4GRF A;  4WF5 A;  4X4J A;  1NM3 A;  3M0F A;  5J40 A;  2REM A;  2YOI A;  4GST A;  4RI7 A;  1PKW A;  2XBI A;  3M9J A;  4WBJ A;  5L71 A;  3CSI A;  1HQO A;  1M9A A;  4PTS A;  4Z2U A;  1QUW A;  3VWV A;  4ACS A;  1YEW C;  3WYW A;  1X9M B;  3VI5 A;  1TTZ A;  1KNG A;  2PPT A;  6GSV A;  3FZ4 A;  4HJM A;  1F9M A;  2IFQ B;  2FA4 A;  1JFU A;  2B1L A;  1XWA A;  4USS A;  1K0N A;  3US3 A;  5AIS A;  5CRG A;  4XS4 B;  3GH6 A;  1A2J A;  5CNW A;  4HOJ A;  2CV4 A;  2H72 A;  1IYH A;  3ZIJ A;  1GWC A;  1WPI A;  1GNE A;  3FR3 A;  5G30 A;  5A5H A;  2P5Q A;  2DJJ A;  5KOX A;  3M9K A;  3LGC A;  5LD0 A;  3Q6O A;  1PX7 A;  2JZT A;  5FT3 A;  3GHA A;  2OE3 A;  4G9H A;  4L5O A;  2WB9 A;  1EGR A;  2CT6 A;  3HJO A;  1T7P B;  1WE0 A;  3L0H A;  4OCE A;  2NBS A;  5A34 A;  1WRY A;  3MAK A;  2GSR A;  3FK8 A;  2CX3 A;  1AAZ A;  4GQF A;  1A2M A;  4TR0 A;  4YAP A;  2H75 A;  2L5O A;  1SKW B;  1OC8 A;  2AB6 A;  4PUA A;  1YZX A;  3FMW A;  2K9F A;  4FQU A;  4AKH A;  2WJU A;  1O7U A;  3F63 A;  2I1U A;  4I6X A;  3ERG A;  3GRX A;  4N10 A;  1TU7 A;  4ZB9 A;  3ERW A;  6GSW A;  2Z9S A;  3L4N A;  3F3Q A;  1GTA A;  2MYG A;  4V1A p;  3JCM L;  3DML A;  3R2Q A;  3D6I A;  2FNO A;  2O89 A;  3TKS E;  4FIW A;  1A23 A;  5FHI A;  4BWQ A;  4L5L A;  1SD9 A;  1O8X A;  2HRF A;  1GUK A;  1B48 A;  3KEB A;  5IIZ A;  2MBS A;  4I8B A;  3FHK A;  4O5R A;  1H75 A;  3PPU A;  3RDW A;  4I2U A;  3DVX A;  4MZC A;  4IGJ A;  2IME A;  3BCK A;  4KX4 A;  1FOV A;  1XVQ A;  1KEB A;  2YCD A;  4PQH A;  4HU7 A;  2LQQ A;  2L4C A;  4ZB7 A;  2WVX A;  1TK0 B;  4XS6 A;  1EEJ A;  3CXG A;  3VUR A;  1X5D A;  1VRS D;  2DLX A;  1XFL A;  3LG6 A;  4MPF A;  1T00 A;  4G0L A;  3CTG A;  2VCV A;  5JWO B;  2A2R A;  3EPT A;  1U3I A;  3D21 A;  2L57 A;  2VL3 A;  2IPA A;  4HDE A;  3EIN A;  4ECJ A;  3QPM A;  1CQG A;  2FWG A;  4GSS A;  2H74 A;  3KTL A;  1SK1 A;  5G5E A;  5COH A;  3VI7 A;  2H76 A;  3DWV A;  4OO4 A;  6GSS A;  2GGT A;  2P0G A;  5ECR B;  3GYK A;  3N5O A;  1QK8 A;  5HQP A;  1EV9 A;  2H1L A;  1F3B A;  3CQF A;  5GZZ B;  3TGZ A;  5ECL B;  5DAK A;  4O5U A;  1USB A;  2RM5 A;  2VLU A;  1YY7 A;  4Q5R A;  1TJD A;  5HFI A;  4MH3 A;  4PI2 C;  2GT6 A;  2OBI A;  3UVH A;  1K3O A;  4MZW A;  2EIQ A;  5JCU A;  2H6Z A;  3HD5 A;  1M2D A;  2PN8 A;  2X8H A;  3WT1 A;  2AJQ B;  3UOM A;  3G7J A;  1RQM A;  2PMT A;  3C71 A;  1O85 A;  2WCI A;  1ML6 A;  1G7O A;  3CYN A;  2RUF A;  3ZVJ A;  1GSD A;  3MWH A;  5B8B A;  3QMX A;  4ZBA A;  1XWC A;  5KOW A;  5IMF A;  3H1N A;  2GSS A;  4TR1 A;  3KZQ A;  4KF9 A;  4BVX A;  2L4Q A;  3HA9 A;  2DIY A;  4FO5 A;  2N5F A;  2E0Q A;  5D9V A;  4Q5F A;  2WW0 A;  1YKC A;  4K0G A;  4LMW A;  2WVX B;  4G2E A;  1XG8 A;  3QAW A;  1A8L A;  1ZYN A;  4IP1 A;  5HR3 A;  3A2W A;  2MMO A;  3EE2 A;  5ENU A;  4ZBD A;  4G0I A;  2E2G A;  2QA2 A;  10GS A;  3HVV A;  3L9U A;  2C0F A;  2RM6 A;  2AAW A;  4D73 B;  2BJX A;  1RW1 A;  3A3T A;  1N25 A;  4CDO A;  2F8A A;  5IOX A;  1X9S B;  2R3X A;  1R26 A;  3W8S A;  3BOA A;  4ICY A;  1PRX A;  5IM9 A;  4KDU A;  2WVZ A;  4AKX B;  1SYX A;  4EDY A;  3G7Y A;  2OE1 A;  1JZD A;  2WUL A;  4IEL A;  1QQ2 A;  4N0Z A;  1NHO A;  4CHS A;  3LSZ A;  1NHY A;  3HMJ G;  3ZL5 A;  2L6C A;  3TKQ A;  1TXX A;  3GL5 A;  3A2V A;  5E4W A;  2V41 A;  3HYP A;  1ERU A;  3IAM 2;  4KGI A;  2B1K A;  3A5I A;  1B9Y C;  5GAP D;  3GH9 A;  1M3I A;  1BJX A;  3IHG A;  3IBH A;  2YWM A;  3BJ5 A;  2DBC A;  2DSA A;  1VF1 A;  2HSM B;  5AGY A;  4ZIL A;  1TOF A;  2P5R A;  3KMO A;  2AHE A;  1FAA A;  5G1L A;  2TRX A;  1SJI A;  2HSN A;  4EUY A;  1B9X C;  2IJY A;  4H86 A;  2H73 A;  5BRT A;  1HD2 A;  5F0G A;  3APQ A;  4TR1 B;  3QOU A;  4BVX B;  4WXT A;  1AW9 A;  3QAG A;  2DJK A;  3TKR A;  2HRN A;  5HFG A;  3EU4 A;  2X64 A;  4G0K A;  1S3A A;  2CAQ A;  2FWF A;  2XPD A;  2V6O A;  3F4T A;  3Q19 A;  1N2A A;  2TRC P;  3IC4 A;  1BX9 A;  3GIX A;  3TJB A;  2O3E A;  4KAE A;  1OAZ A;  1XW6 A;  1B4P A;  3F3R A;  4F0B A;  5DJL A;  2VD0 A;  3CBU A;  3GUR A;  6GSX A;  5B6M A;  2G2Q A;  1F2E A;  3TOU A;  20GS A;  4O92 A;  2VLT A;  4NPB A;  1HNB A;  4K5R A;  1TK8 B;  3GNJ A;  3K8N A;  2FLS A;  1R7H A;  4CY6 A;  4GQC A;  2F3M A;  5DDL A;  3GKN A;  1SVM A;  3GKK A;  2GSQ A;  1YF1 A;  2A2P A;  4I5Q A;  3HVN A;  4LL1 B;  4EIP A;  2CVD A;  1YF0 A;  5AIV A;  2G0F A;  2B5X A;  4ZL9 A;  1DE2 A;  4Q5Q A;  1GH2 A;  4AI6 A;  1EGO A;  4MMM A;  1Y1U A;  4K7N A;  5JCG A;  4F0C A;  2IMK A;  4HSC X;  3VWW A;  4NV5 A;  3UVT A;  2IL3 A;  2NDO A;  2H70 A;  2HSN B;  5A4V A;  5HR1 A;  2H6Y A;  1J0F A;  1GSF A;  4HU9 A;  4TR4 A;  1B8X A;  2PBJ A;  3LW9 A;  3WD6 A;  1W89 A;  4DEJ A;  2H0G A;  2H66 A;  3CSH A;  3MYD A;  2FCH A;  4ZL7 A;  4KSM A;  1F6M C;  2EFC A;  2R0C A;  2AUV A;  4KW6 A;  3PH9 A;  4PHZ C;  1ERV A;  1HYU A;  2LRC A;  3HXS A;  3C8E A;  5DCG A;  3DGQ A;  4XRA A;  4YKG A;  4E68 A;  4E8H A;  2PUK C;  4EO3 A;  3ZVJ D;  5DQS A;  3UBL A;  4G19 A;  4GCI A;  4DVC A;  1XCC A;  4KUN A;  3G9B A;  2WRT A;  3H79 A;  3E3E A;  1T3B A;  2GZP A;  1V9W A;  4E8E A;  1T1V A;  5EVO A;  1XOA A;  1URM A;  2X8G A;  4MDC A;  2K6V A;  4AJ6 A;  2M72 A;  2HRA A;  1SK2 A;  1O8W A;  2H30 A;  4OMV A;  5CO3 A;  5CAX A;  3KMN A;  1X0R A;  2HSY A;  3IR4 A;  3WGE A;  4JR6 A;  1PQN A;  1AQX A;  2LS5 A;  1S3R A;  2KP1 A;  5C00 A;  2GQL A;  4EVM A;  3D4M A;  5IMZ A;  5D93 A;  2ON5 A;  4KE3 A;  2VKZ G;  3GL3 A;  2HYX A;  3RAZ A;  4I97 A;  1G6Y A;  3KP8 A;  1W4V A;  4ID0 A;  2HRK A;  1BQ7 A;  2QGV A;  2JAD A;  3ZFB A;  5B6N A;  1GSY A;  5INY A;  4MJE A;  3ZFL A;  2YJ7 A;  1N8J A;  2H6X A;  2RII A;  2VAF A;  4POB A;  2ZCT A;  2YWO A;  3HVX A;  2B5Y A;  2LJA A;  3HJM A;  2H1A A;  4TW5 A;  3W8J A;  5B7C A;  4OO5 A;  1XPV A;  6GST A;  1J08 A;  2DIZ A;  3UAR A;  1K3Y A;  1U88 A;  2WGR A;  2WW3 A;  1C72 A;  4QL9 A;  1YEP A;  2HZE A;  3RBT A;  3VK9 A;  3UL3 A;  5DCH A;  3ZLP A;  4ECI A;  2C3Q A;  2LJK A;  5ECH B;  1T4Y A;  4GDF A;  4TKY A;  4GSN A;  4K7I A;  1Z7R A;  3O76 A;  2GST A;  1G7E A;  5A4U A;  4J57 E;  12GS A;  5F05 A;  5CRH A;  1A0R P;  1YQ1 A;  3ZRE A;  4ML6 A;  4J2F A;  3O3T A;  4FXY P;  3TB2 A;  3TKS A;  5ABR A;  4HQZ A;  2CZ2 A;  5J3R A;  2HXK A;  3N9J A;  2ZNM A;  2MBT A;  2VUP A;  1EZK A;  1IYI A;  2H8L A;  2YZH A;  3IAS 2;  2HRK B;  3F4S A;  4IW9 A;  2HZF A;  4EXJ A;  3E9J B;  2K8S A;  2DC5 A;  3DKS A;  3DRN A;  1V98 A;  2VL9 A;  4K2D A;  5IMD A;  1XVW A;  2NVL A;  3EC3 A;  1DSB A;  2YNX A;  3M1G A;  2GQM A;  1K0M A;  2ON7 A;  1SVL A;  3LFL A;  2O7K A;  3E0U A;  3RPP A;  3NOF A;  2YWN A;  1SL0 B;  1LJR A;  1THX A;  2GZY A;  3TKS C;  2ZUP A;  2XPE A;  3GTU A;  2WDU A;  2HZE B;  1G6W A;  1HNC A;  2CAI A;  4QMK A;  4BWS A;  1GLQ A;  2I81 A;  2JZR A;  1FG4 A;  3LYP A;  2H0I A;  4OFM A;  4MH2 A;  4NV2 A;  1ZL9 A;  4MLY A;  5ECS A;  1GSU A;  5EL8 A;  1EV4 A;  3HY2 A;  3VLN A;  5EPF A;  2LV3 A;  1YKA A;  1MD4 A;  3SBC A;  3P90 A;  3UMA A;  5IO2 A;  2EIR A;  1O6J A;  4PNF A;  4WEY A;  3GMF A;  3TU3 B;  1YJ6 A;  3LXT A;  4D73 A;  2IN3 A; 
#chains in the Genus database with same CATH homology
 3TUE A;  1OVN A;  2HE3 A;  3J7Y k;  1AIU A;  4KSO A;  4JU5 A;  1R4W A;  5J9C A;  2VCZ A;  2R37 A;  3BBY A;  2OJL A;  3P8W A;  3GX8 A;  2J9H A;  1SKS B;  4L8E A;  4AKG A;  1BYE A;  2LNS A;  1OC9 A;  4MP4 A;  2H71 A;  2CQ9 A;  4KCA A;  1SD8 A;  2IMI A;  4XTS A;  1WIK A;  3TOT A;  1Z3E A;  2N5B A;  1R5P A;  3GTU B;  2V32 A;  3F4R A;  3FKF A;  1EOH A;  4YH2 A;  2HSM A;  4EF0 A;  4GTU A;  3ZIT A;  2V6K A;  5J4U A;  5DBQ A;  1CQH A;  1GUH A;  1AQV A;  1S3D A;  3ED3 A;  2JZS A;  1MTC A;  2HLS A;  3L78 A;  3FR9 A;  3QFA C;  5AIX A;  1DE1 A;  1T8E B;  2FHE A;  1U87 A;  4GXZ A;  1R5A A;  4CW9 A;  3A5W A;  2H1B A;  2IWT A;  1ZOF A;  4IVF A;  1GUL A;  3PR8 A;  4KH7 A;  3IK9 A;  4OWY A;  2CVK A;  3KGK A;  3C73 A;  3WGX A;  1TDI A;  3BD2 A;  2YP6 A;  4KCE A;  1E6B A;  2HI7 A;  3FY7 A;  2MZC A;  1M2A A;  2GVP A;  3H8Q A;  5D73 A;  3EMP A;  3I69 A;  1X9W B;  1AQW A;  2V1M A;  5CRE A;  1XW9 A;  4MJB A;  14GS A;  4AF2 A;  1ZYQ B;  4AKI A;  3VWU A;  2B5E A;  3A2X A;  5CRW A;  1Z5Y E;  3GFK A;  3HVS A;  2MMN A;  11GS A;  1JZR A;  3FRC A;  4PGT A;  4BA7 A;  1M2B A;  1GL8 A;  3F8U A;  5BMU A;  4NWY A;  4N11 A;  3C1S A;  2LNT A;  1OC9 B;  4DSS A;  2VM1 A;  3C1R A;  2OT3 A;  1QMV A;  1XWK A;  2GQK A;  2KUC A;  5G1K A;  1VF4 A;  2XC2 A;  1F37 A;  1SEN A;  3HJP A;  2N5A A;  2CZ3 A;  4LL4 B;  3HZ4 A;  5J4Y A;  4TXO A;  2VCX A;  5HR2 A;  1G0T A;  1TU8 A;  4K5S A;  3IA1 A;  1SKR B;  2GZZ A;  1SK0 A;  3O6T A;  1Q98 A;  1UVZ A;  3D22 A;  4L0U A;  5IMC A;  3BCI A;  2B3S A;  1SL2 B;  2X49 A;  4TR3 A;  3ZIV A;  2FY6 A;  3W6G A;  2I9H A;  4IJI A;  5ECQ B;  2P31 A;  2M46 A;  1ZMA A;  4EKZ A;  3IK7 A;  9GSS A;  3ERF A;  5D96 A;  2A4V A;  5HR0 A;  1A2L A;  3IHQ A;  2GT5 A;  3LJR A;  5KN3 A;  5D9W A;  4Z2R A;  4FH8 A;  4XS1 A;  3VFI A;  2C8U A;  4JED A;  5D8I A;  4JR4 A;  4N0V A;  1AUC A;  1WOU A;  2QKE A;  1JHB A;  3SWL A;  1FHE A;  1TK5 B;  4IBP A;  4EE0 A;  2H1G A;  2L59 A;  4NMU A;  4WKW A;  2RLI A;  2UZ8 A;  5HFK A;  3KCM A;  2BMX A;  1PSQ A;  2K18 A;  1MDK A;  3IE3 A;  2YN1 A;  5BMU B;  4IP6 A;  4WBR D;  4DSS B;  4K8M A;  1FVK A;  3RHB A;  1TRS A;  1FVJ A;  4IJ3 A;  4PQ1 A;  5F8B A;  4F9Z A;  1DBY A;  4F2I A;  1MDI A;  4TRX A;  1TP9 A;  2C0D A;  1TI3 A;  5B8A A;  3MIX A;  4K2X A;  4FYB A;  1GSQ A;  4TXO B;  3DIE A;  5ECK B;  5J41 A;  4IN0 A;  4MJC A;  2JSZ A;  5IPH A;  2A2S A;  4EL1 A;  1ON4 A;  1UC7 A;  3TJK A;  2E2M A;  3TRQ A;  6GSU A;  3GUS A;  5H5Q A;  2KOK A;  4IS0 A;  1PA3 A;  1EWX A;  5IOW A;  1ZZY A;  4I2T A;  4BPY A;  2RUE A;  1AC1 A;  4V2M A;  1TI1 A;  5ELA A;  4NHZ A;  4P3Y B;  5DQY A;  1ERT A;  4YAV A;  3OR5 A;  1PMT A;  4FYU A;  4ECC A;  1K3L A;  4FYC A;  1EEM A;  4MCU A;  2E7P A;  1BG5 A;  2HQT A;  5LCZ A;  4N3Z A;  2GDR A;  1PN0 A;  4BVY A;  3KH9 A;  2DML A;  2DKH A;  1ST9 A;  2R4V A;  2V2G A;  4JBB A;  5GSS A;  1ZCP A;  4CY8 A;  1XXU A;  4WF4 A;  2VLV A;  2VM2 A;  3QFB C;  5CRD A;  4MAB A;  2K8V A;  4EIQ A;  2F9S A;  1XZO A;  3M8N A;  1OE7 A;  3L9S A;  2IMD A;  2MMA A;  3GST A;  4PNG A;  3F6D A;  5EY6 A;  1OKT A;  1S3C A;  4YQV A;  1WMJ A;  3TRX A;  5F06 A;  3APO A;  2OKA A;  3D5J A;  4W66 A;  4HS1 A;  1EP7 A;  2I4A A;  1M99 A;  1MDJ A;  2A4H A;  3UAP A;  2O5V A;  4TN8 A;  4JRR A;  1LBK A;  4OD7 A;  4MPG A;  1KBN A;  5J4V A;  4KND A;  5J47 A;  2L5L A;  1Z6M A;  3P7X A;  3ZRD A;  3QR6 A;  2LTK A;  2HFD A;  4MA9 A;  1TW9 A;  4YQU A;  4V1A g;  5G2Z A;  4PUF C;  4MNN A;  4QQ7 A;  2VD1 A;  18GS A;  1J9B A;  5IMV A;  2WS2 A;  4G01 A;  4RQX A;  1OE8 A;  1JLV A;  1K0A A;  2C3T A;  3CSJ A;  3MDK A;  1VF2 A;  3CWG A;  4RQR A;  1F3A A;  3IXR A;  5ELG A;  4ZXG A;  22GS A;  4BVY B;  1V58 A;  3CRU A;  4ML1 A;  5LNK e;  3Q74 A;  3FW2 A;  3F6F A;  1PGT A;  3FR6 A;  1TXU A;  4TVE A;  1EP8 A;  4HUA A;  1NW2 A;  1ERW A;  1YVL A;  3GSS A;  3TKP A;  4GLT A;  2LST A;  2H0H A;  5FWG A;  5GST A;  1GSS A;  2CA8 A;  1X5E A;  1GLP A;  3TCO A;  4KB3 A;  4ULX A;  2VCW A;  3GKX A;  4ZIJ A;  5J5N A;  19GS A;  1JLW A;  3EUR A;  5CP1 A;  2FD3 A;  1EOG A;  1TRV A;  2FWE A;  1M9B A;  1FOH A;  4ZL8 A;  3QDN A;  2YJH A;  2AV4 A;  3D0Z A;  2FA8 A;  1FO5 A;  4WR4 A;  2PVO C;  2C0E A;  2EC4 A;  4GWR A;  4GF0 A;  3DD3 A;  4DSR A;  3VWX A;  4AGS A;  1GTB A;  4PUR A;  2X4A A;  3GA4 A;  3UEM A;  1SJ6 A;  1ABA A;  5G5F A;  1WP0 A;  3APS A;  1OYJ A;  1BF5 A;  3AY8 A;  5AN1 A;  2LKU A;  1GRX A;  2H01 A;  5KN1 A;  1MEK A;  4TOP A;  1ZGN A;  3IC8 A;  2DJ3 A;  4F03 A;  1H4O A;  5H5R A;  1MD3 A;  4ECB A;  4MF6 A;  4J56 E;  1K0O A;  1PD2 1;  3FEU A;  4LLR A;  4POL A;  2XHF A;  5DAL A;  1AXD A;  2YAN A;  4O7H A;  2JL4 A;  3TDG A;  1Z7P A;  5KEJ A;  1Z9H A;  5DJM A;  2DJ2 A;  1V2A A;  4G10 A;  3GN3 A;  4WR5 A;  3ZMK A;  2JU5 A;  2VL2 A;  3FYG A;  5ECN B;  3LWA A;  2XBQ A;  2YV9 A;  4LMV A;  4RI6 A;  5G31 A;  5A5H B;  2B7K A;  1K0D A;  1UA5 A;  5ECM B;  2WFC A;  2F8F A;  1YDK A;  2MMZ A;  3GKM A;  4K7O A;  4XIH A;  1LU4 A;  3H4K A;  4X43 A;  3HCZ A;  1JZW A;  2R0G A;  2NTO A;  3IOS A;  2EFD A;  1HNA A;  3FZA A;  5IPG A;  2JAC A;  2OE0 A;  3CRT A;  3Q18 A;  5A34 B;  3QCP A;  2R5G A;  1GTU A;  3EYT A;  3I43 A;  1DUG A;  4K6X A;  2LEG A;  5KN2 A;  1JZO A;  3J7Y b;  4NHW A;  3P2A A;  1B4Q A;  4O32 A;  5A4W A;  3KTB A;  3MSZ A;  3H93 A;  1KTE A;  2C1Y A;  2YWI A;  2VL2 C;  5J9B A;  3MNG A;  4V2L A;  1PX6 A;  4ZB8 A;  3IPZ A;  3F9U A;  2C4J A;  1K0C A;  2J23 A;  2O87 A;  3TJJ A;  3TJF A;  3L9V A;  1M7T A;  5IO0 A;  1SU9 A;  2C0G A;  4EDZ A;  3R3E A;  4POK A;  1I9D A;  3IDV A;  3FZ9 A;  1Z6N A;  3M3M A;  3UJ1 A;  5ECI B;  2I3Y A;  4ILF A;  1X5C A;  4AJ7 A;  1Q4J A;  5DAL B;  2LRT A;  3U5R E;  4NXI A;  2EFH A;  4PX1 A;  3S9F A;  3LQ7 A;  2WZ9 A;  3ZZX A;  4PQI A;  3PGT A;  2VCQ A;  3QD9 A;  1PL1 A;  13GS A;  3HHV A;  3NZN A;  4ISD A;  1GUM A;  16GS A;  3ME8 A;  4Q5N A;  1TKD B;  3KXO A;  4HQS A;  2KHP A;  3I9V 2;  3C7M A;  2EIO A;  5JCW A;  1XIY A;  3EWL A;  4N30 A;  4MF5 A;  2X99 A;  1OKD A;  3HKR A;  2DKI A;  3KJY A;  2QA1 A;  4HZ2 A;  3TJG A;  1QGV A;  2AYT A;  4AJ8 A;  2R0P A;  2R2J A;  3EVI A;  2F51 A;  2LUS A;  5ECP B;  3ME7 A;  3LXZ A;  1TRW A;  1VGL A;  2KLX A;  2IMF A;  4KDY A;  4X0X A;  3NIV A;  4HEA 2;  6GSY A;  1ILO A;  1QFN A;  3CTF A;  1GSE A;  5C04 A;  3KH7 A;  3RPN A;  1GTI A;  5DAK B;  2O8V B;  4IKH A;  4XRD A;  2LRN A;  4A5P A;  2B7J A;  2PVQ A;  4K9Z A;  4HJ2 A;  4XCS A;  3KIJ A;  1A8Y A;  1YEX A;  1SYR A;  3G7I A;  5E59 A;  2GLR A;  2KP2 A;  4OFT A;  2VIM A;  5JWR B;  1OC3 A;  4POM A;  3VPT A;  4Z7X A;  1SVO A;  3KM6 A;  4ZB6 A;  5CYY A;  3UIW A;  2BTO T;  3LYK A;  2ES7 A;  4IHU A;  4L0W A;  2OA7 A;  2L6D A;  4NAX A;  1GP1 A;  2PER A;  3DVW A;  2LJR A;  2OAD A;  2M80 A;  1ZYE A;  1TRU A;  4JE1 A;  5H5S A;  1M0U A;  1GNW A;  3GX0 A;  2CX4 A;  5ECO B;  5F07 A;  7GSS A;  4HI7 A;  2YPM A;  3CMI A;  1WWJ A;  4OFN A;  4BL7 A;  5ID2 A;  1XWG A;  2PWJ A;  1BAY A;  4OCF A;  1SJZ A;  2VO4 A;  1V57 A;  3IV4 A;  2H1D A;  2VCT A;  2JSY A;  2FGX A;  2H19 A;  2DJ0 A;  5KN0 A;  3DEX A;  4O5Q A;  4MF7 A;  1BG1 A;  2CVB A;  1FW1 A;  1A0F A;  4YKF A;  3EMX A;  2LQO A;  3EU3 A;  1PL2 A;  8GSS A;  5IMA A;  4PXO A;  2FUG 2;  2D2Z A;  1I5G A;  2C80 A;  1VF3 A;  4EC0 A;  4K1F A;  2PGT A;  1QXH A;  2HNL A;  2GTU A;  3ZYW A;  5A1N A;  5JWQ B;  3QAV A;  3LOR A;  2ALB A;  1U3A A;  4YQM A;  3RHC A;  2OAC A;  3GV1 A;  1A24 A;  3PIN A;  2QSI A;  3WT2 A;  5GAN D;  2X8C A;  3DYR A;  1XBS A;  2C3N A;  1K0B A;  4Z2T A;  2R6K A;  2FWH A;  2NPB A;  2QC7 A;  3DXB A;  1PKZ A;  4K0N A;  2YZU A;  3TRP A;  3U6V A;  5A5K A;  3IRA A;  4V2N A;  1V40 A;  4BL7 B;  5ID2 B;  3ZML A;  4ZBB A;  3LEF A;  1O81 A;  1BED A;  2IFQ A;  3HDC A;  2VOC A;  2YV7 A;  2UV8 G;  3WGD A;  1O73 A;  1SL1 B;  5DVB A;  4XHM A;  1XW5 A;  2HT9 A;  4XS4 A;  1PN9 A;  4F82 A;  3HZ8 A;  1E2Y A;  1ZYP A;  2EFE A;  1UN2 A;  2DJ1 A;  3V1W A;  4KA0 A;  4WET A;  1FB6 A;  5D9X A;  3VPQ A;  4IQ1 A;  4TXV A;  4QL7 A;  4MK3 A;  1RK4 A;  17GS A;  4RUV A;  2DMM A;  1Y6E A;  1THO A;  3ZTL A;  1T4Z A;  1NSW A;  1FB0 A;  1XOB A;  5IQY A;  2IIY A;  3FZ5 A;  4KDX A;  4MJA A;  5D9T A;  1U6T A;  1WJK A;  1ACV A;  3KP9 A;  4IQA A;  4LA1 A;  5A1N B;  2HSH A;  4HZ4 A;  3ISO A;  3F0I A;  1Y25 A;  3KD0 A;  4JZQ A;  2PU9 C;  2B6M A;  3D4T A;  1XWB A;  2O85 A;  2GS3 A;  4DSQ A;  2TIR A;  4X1U A;  4MZB A;  2OBK A;  3I6A A;  3UBK A;  4GRF A;  4WF5 A;  4X4J A;  1NM3 A;  3M0F A;  5J40 A;  2REM A;  2YOI A;  4GST A;  4RI7 A;  1PKW A;  2XBI A;  3M9J A;  4WBJ A;  5L71 A;  3CSI A;  1HQO A;  1M9A A;  4PTS A;  4Z2U A;  1QUW A;  3VWV A;  4ACS A;  3WYW A;  1X9M B;  3VI5 A;  1TTZ A;  1KNG A;  2PPT A;  6GSV A;  3FZ4 A;  4HJM A;  1F9M A;  2IFQ B;  2FA4 A;  1JFU A;  2B1L A;  1XWA A;  4USS A;  1K0N A;  3US3 A;  5AIS A;  5CRG A;  4XS4 B;  3GH6 A;  1A2J A;  5CNW A;  4HOJ A;  2CV4 A;  2H72 A;  1IYH A;  3ZIJ A;  1GWC A;  1WPI A;  1GNE A;  3FR3 A;  5G30 A;  5A5H A;  2P5Q A;  2DJJ A;  5KOX A;  3M9K A;  3LGC A;  5LD0 A;  3Q6O A;  1PX7 A;  2JZT A;  5FT3 A;  3GHA A;  2OE3 A;  4G9H A;  4L5O A;  2WB9 A;  1EGR A;  2CT6 A;  3HJO A;  1T7P B;  1WE0 A;  3L0H A;  4OCE A;  2NBS A;  5A34 A;  1WRY A;  3MAK A;  2GSR A;  3FK8 A;  2CX3 A;  1AAZ A;  4GQF A;  1A2M A;  4TR0 A;  4YAP A;  2H75 A;  2L5O A;  1SKW B;  1OC8 A;  2AB6 A;  4PUA A;  1YZX A;  3FMW A;  2K9F A;  4FQU A;  4AKH A;  2WJU A;  1O7U A;  3F63 A;  2I1U A;  4I6X A;  3ERG A;  3GRX A;  4N10 A;  1TU7 A;  4ZB9 A;  3ERW A;  6GSW A;  2Z9S A;  3L4N A;  3F3Q A;  1GTA A;  2MYG A;  4V1A p;  3JCM L;  3DML A;  3R2Q A;  3D6I A;  2FNO A;  2O89 A;  3TKS E;  4FIW A;  1A23 A;  5FHI A;  4BWQ A;  4L5L A;  1SD9 A;  1O8X A;  2HRF A;  1GUK A;  1B48 A;  3KEB A;  5IIZ A;  2MBS A;  4I8B A;  3FHK A;  4O5R A;  1H75 A;  3PPU A;  3RDW A;  4I2U A;  3DVX A;  4MZC A;  4IGJ A;  2IME A;  3BCK A;  4KX4 A;  1FOV A;  1XVQ A;  1KEB A;  2YCD A;  4PQH A;  4HU7 A;  2LQQ A;  2L4C A;  4ZB7 A;  1TK0 B;  4XS6 A;  1EEJ A;  3CXG A;  3VUR A;  1X5D A;  1VRS D;  2DLX A;  1XFL A;  3LG6 A;  4MPF A;  1T00 A;  4G0L A;  3CTG A;  2VCV A;  5JWO B;  2A2R A;  3EPT A;  1U3I A;  3D21 A;  2L57 A;  2VL3 A;  2IPA A;  4HDE A;  3EIN A;  4ECJ A;  3QPM A;  1CQG A;  2FWG A;  4GSS A;  2H74 A;  3KTL A;  1SK1 A;  5G5E A;  5COH A;  3VI7 A;  2H76 A;  3DWV A;  4OO4 A;  6GSS A;  2GGT A;  2P0G A;  5ECR B;  3GYK A;  3N5O A;  1QK8 A;  5HQP A;  1EV9 A;  2H1L A;  1F3B A;  5GZZ B;  3TGZ A;  5ECL B;  5DAK A;  4O5U A;  1USB A;  2RM5 A;  2VLU A;  1YY7 A;  4Q5R A;  1TJD A;  5HFI A;  4MH3 A;  2GT6 A;  2OBI A;  3UVH A;  1K3O A;  4MZW A;  2EIQ A;  5JCU A;  2H6Z A;  3HD5 A;  1M2D A;  2PN8 A;  2X8H A;  3WT1 A;  2AJQ B;  3UOM A;  3G7J A;  1RQM A;  2PMT A;  3C71 A;  1O85 A;  2WCI A;  1ML6 A;  1G7O A;  3CYN A;  2RUF A;  3ZVJ A;  1GSD A;  3MWH A;  5B8B A;  3QMX A;  4ZBA A;  1XWC A;  5KOW A;  5IMF A;  3H1N A;  2GSS A;  4TR1 A;  3KZQ A;  4KF9 A;  4BVX A;  2L4Q A;  3HA9 A;  2DIY A;  4FO5 A;  2N5F A;  2E0Q A;  5D9V A;  4Q5F A;  1YKC A;  4K0G A;  4LMW A;  4G2E A;  3QAW A;  1A8L A;  1ZYN A;  4IP1 A;  5HR3 A;  3A2W A;  2MMO A;  3EE2 A;  5ENU A;  4ZBD A;  4G0I A;  2E2G A;  2QA2 A;  10GS A;  3HVV A;  3L9U A;  2C0F A;  2RM6 A;  2AAW A;  4D73 B;  2BJX A;  1RW1 A;  3A3T A;  1N25 A;  4CDO A;  2F8A A;  5IOX A;  1X9S B;  2R3X A;  1R26 A;  3W8S A;  3BOA A;  4ICY A;  1PRX A;  5IM9 A;  4KDU A;  4AKX B;  1SYX A;  4EDY A;  3G7Y A;  2OE1 A;  1JZD A;  2WUL A;  4IEL A;  1QQ2 A;  4N0Z A;  1NHO A;  4CHS A;  3LSZ A;  1NHY A;  3HMJ G;  3ZL5 A;  2L6C A;  3TKQ A;  1TXX A;  3GL5 A;  3A2V A;  5E4W A;  2V41 A;  3HYP A;  1ERU A;  3IAM 2;  4KGI A;  2B1K A;  3A5I A;  1B9Y C;  5GAP D;  3GH9 A;  1BJX A;  3IHG A;  3IBH A;  2YWM A;  3BJ5 A;  2DBC A;  2DSA A;  1VF1 A;  2HSM B;  5AGY A;  4ZIL A;  1TOF A;  2P5R A;  3KMO A;  2AHE A;  1FAA A;  5G1L A;  2TRX A;  1SJI A;  2HSN A;  4EUY A;  1B9X C;  2IJY A;  4H86 A;  2H73 A;  5BRT A;  1HD2 A;  5F0G A;  3APQ A;  4TR1 B;  3QOU A;  4BVX B;  4WXT A;  1AW9 A;  3QAG A;  2DJK A;  3TKR A;  2HRN A;  5HFG A;  3EU4 A;  2X64 A;  4G0K A;  1S3A A;  2CAQ A;  2FWF A;  2XPD A;  2V6O A;  3F4T A;  3Q19 A;  1N2A A;  2TRC P;  3IC4 A;  1BX9 A;  3GIX A;  3TJB A;  4KAE A;  1OAZ A;  1XW6 A;  1B4P A;  3F3R A;  4F0B A;  5DJL A;  2VD0 A;  3CBU A;  3GUR A;  6GSX A;  5B6M A;  2G2Q A;  1F2E A;  3TOU A;  20GS A;  4O92 A;  2VLT A;  4NPB A;  1HNB A;  4K5R A;  1TK8 B;  3GNJ A;  3K8N A;  2FLS A;  1R7H A;  4CY6 A;  4GQC A;  2F3M A;  5DDL A;  3GKN A;  1SVM A;  3GKK A;  2GSQ A;  1YF1 A;  2A2P A;  4I5Q A;  4LL1 B;  4EIP A;  2CVD A;  1YF0 A;  5AIV A;  2G0F A;  2B5X A;  4ZL9 A;  1DE2 A;  4Q5Q A;  1GH2 A;  4AI6 A;  1EGO A;  4MMM A;  1Y1U A;  4K7N A;  5JCG A;  4F0C A;  2IMK A;  3VWW A;  4NV5 A;  3UVT A;  2IL3 A;  2NDO A;  2H70 A;  2HSN B;  5A4V A;  5HR1 A;  2H6Y A;  1J0F A;  1GSF A;  4HU9 A;  4TR4 A;  1B8X A;  2PBJ A;  3LW9 A;  3WD6 A;  1W89 A;  4DEJ A;  2H0G A;  2H66 A;  3CSH A;  3MYD A;  2FCH A;  4ZL7 A;  4KSM A;  1F6M C;  2EFC A;  2R0C A;  2AUV A;  4KW6 A;  3PH9 A;  1ERV A;  1HYU A;  2LRC A;  3HXS A;  3C8E A;  5DCG A;  3DGQ A;  4XRA A;  4YKG A;  4E68 A;  4E8H A;  2PUK C;  4EO3 A;  3ZVJ D;  5DQS A;  3UBL A;  4G19 A;  4GCI A;  4DVC A;  1XCC A;  4KUN A;  3G9B A;  2WRT A;  3H79 A;  3E3E A;  1T3B A;  2GZP A;  1V9W A;  4E8E A;  1T1V A;  5EVO A;  1XOA A;  1URM A;  2X8G A;  4MDC A;  2K6V A;  4AJ6 A;  2M72 A;  2HRA A;  1SK2 A;  1O8W A;  2H30 A;  4OMV A;  5CO3 A;  5CAX A;  3KMN A;  1X0R A;  2HSY A;  3IR4 A;  3WGE A;  4JR6 A;  1PQN A;  1AQX A;  2LS5 A;  2KP1 A;  5C00 A;  2GQL A;  4EVM A;  3D4M A;  5IMZ A;  5D93 A;  2ON5 A;  4KE3 A;  2VKZ G;  3GL3 A;  2HYX A;  3RAZ A;  4I97 A;  1G6Y A;  3KP8 A;  1W4V A;  4ID0 A;  2HRK A;  1BQ7 A;  2QGV A;  2JAD A;  3ZFB A;  5B6N A;  1GSY A;  5INY A;  4MJE A;  3ZFL A;  2YJ7 A;  1N8J A;  2H6X A;  2RII A;  2VAF A;  4POB A;  2ZCT A;  2YWO A;  3HVX A;  2B5Y A;  2LJA A;  3HJM A;  2H1A A;  4TW5 A;  3W8J A;  5B7C A;  4OO5 A;  1XPV A;  6GST A;  1J08 A;  2DIZ A;  3UAR A;  1K3Y A;  1U88 A;  2WGR A;  1C72 A;  4QL9 A;  1YEP A;  2HZE A;  3RBT A;  3VK9 A;  3UL3 A;  5DCH A;  3ZLP A;  4ECI A;  2C3Q A;  2LJK A;  5ECH B;  1T4Y A;  4GDF A;  4TKY A;  4GSN A;  4K7I A;  1Z7R A;  3O76 A;  2GST A;  1G7E A;  5A4U A;  4J57 E;  12GS A;  5F05 A;  5CRH A;  1A0R P;  1YQ1 A;  3ZRE A;  4ML6 A;  4J2F A;  3O3T A;  3TB2 A;  3TKS A;  5ABR A;  4HQZ A;  2CZ2 A;  5J3R A;  2HXK A;  3N9J A;  2ZNM A;  2MBT A;  2VUP A;  1EZK A;  1IYI A;  2H8L A;  2YZH A;  3IAS 2;  2HRK B;  3F4S A;  4IW9 A;  2HZF A;  4EXJ A;  3E9J B;  2K8S A;  2DC5 A;  3DKS A;  3DRN A;  1V98 A;  2VL9 A;  4K2D A;  5IMD A;  1XVW A;  2NVL A;  3EC3 A;  1DSB A;  2YNX A;  3M1G A;  2GQM A;  1K0M A;  2ON7 A;  1SVL A;  3LFL A;  2O7K A;  3E0U A;  3RPP A;  3NOF A;  2YWN A;  1SL0 B;  1LJR A;  1THX A;  2GZY A;  3TKS C;  2ZUP A;  2XPE A;  3GTU A;  2WDU A;  2HZE B;  1G6W A;  1HNC A;  2CAI A;  4QMK A;  4BWS A;  1GLQ A;  2I81 A;  2JZR A;  1FG4 A;  3LYP A;  2H0I A;  4OFM A;  4MH2 A;  4NV2 A;  1ZL9 A;  4MLY A;  5ECS A;  1GSU A;  5EL8 A;  1EV4 A;  3HY2 A;  3VLN A;  5EPF A;  2LV3 A;  1YKA A;  1MD4 A;  3SBC A;  3P90 A;  3UMA A;  5IO2 A;  2EIR A;  1O6J A;  4PNF A;  4WEY A;  3GMF A;  3TU3 B;  1YJ6 A;  3LXT A;  4D73 A;  2IN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...