1PAUA

Crystal structure of the complex of apopain with the tetrapeptide aldehyde inhibitor ac-devd-cho
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
140
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The three-dimensional structure of apopain/CPP32, a key mediator of apoptosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords APOPAIN
total genus 46
structure length 140
sequence length 140
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 1996-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pauA00
4N7JA 2XZDA 1NMSA 4QU5A 3R7SA 4EHKA 1CVRA 1RWOA 4D3XA 4DCPA 4QUBA 3DEHA 5IC6A 1RWMA 1NW9B 1RWXA 3BIJA 3D6HA 3PD1A 3V3KA 4DCOA 3H1PA 1RHMA 3V55A 4JJ8A 4PRYA 3ITNA 1SHJA 5I9BA 3IBFA 3GJSA 3NS7A 3DEJA 5IAGA 1RWNA 5K20A 2HBZA 4ZVQA 3KJFA 3E4CA 4JJEA 4NBLA 3DEKA 3V6LA 5IBPA 2CJXA 3KJNA 4ZVRA 4HQ0A 4EHFA 5IABA 5LU9A 4PRZA 3R5JA 4FEAA 4FXOA 5JFTA 1RHQA 5IASA 2C2KA 2H4YA 2H65A 1I4OA 1RWPA 4IYRA 5IARA 1RWWA 1IBCA 2CJYA 1PYOA 4EHHA 2FP3A 2XZTA 4JQYA 5LUAA 2J30A 3R5KA 2H54A 4EJFA 1GQFA 3H0EA 4ZVSA 3V4OA 5IAEA 3K7EA 3D6FA 3NKFA 4JJ7A 3KJQA 4N6OA 4QU9A 4QULA 4N6GA 2XYGA 4QUAA 2DKOA 5IBCA 4I1PA 1PAUA 4M9RA 4QUEA 4ZVUA 4EHDA 2H5JA 1JXQA 1I3OA 2H51A 2QL5A 1QX3A 2QLJA 2QL9A 3S8EA 4JR1A 1F9EA 2FQQA 2CNKA 4N5DA 4JR2A 3R6LA 1I51A 4QUGA 1RHJA 1GFWA 2HBYA 5IBRA 3GJTA 2P2CA 1M72A 5IAKA 3R7NA 2K7ZA 1SC3A 2QLFA 2H5IA 4AWBA 1SHLA 3R7BA 3H11A 1QTNA 2QL7A 3P45A 2C2MA 1RHUA 2XYHA 4FGUA 3S70A 1BMQA 3GJRA 1I4EB 4I1RA 2NN3C 4ZVTA 4QTXA 3UOAB 4QUJA 5H0IA 3IBCA 4EHAA 3V6MA 2CDRA 2WDPA 3EDQA 4HVAA 1RWVA 3GJQA 3PD0A 1NMQA 3QNWA 2J31A 4QUDA 4N6NA 3D6MA 3R6GA 1QDUA 3H13A 3H11B 4JR0A 4QUIA 2C1EA 1RHKA 3P4UA 4AW9A 4QU8A 2HBRA 3SIPA 1RWKA 4QUHA 2J32A 5I9TA 5LUBA 3SIRA 2J33A 4NOMA 3UO8B 3DEIA 2C2OA 2Y0BA 4AWAA 4QTYA 5IAJA 3EDRA 4NOLA 2AR9A 4D3ZA 1K88A 5LU8A 2H48A 1F1JA 2FUNB 4IEFB 2Y1LA 3OD5A 4DCJA 3PCXA 4FDLA 1RHRA 4EHNA 1SC1A 2H4WA 4NOJA 1K86A 4N7MA 4LSZA 3NR2A 4JQZA 2C2ZA 4NBKA 4PS1A 4D3YA 1NMEA 2HBQA 2QLBA 3RJMA 4EHLA 4PS0A 4ZVPA 5IANA 5IC4A 4QU0A 1ICEA 1KMCA 4NBNA 4NOKA 4JB8A 1RE1A 1CP3A 2CNNA 4ZVOA 2CNOA 2CNLA 4HQRA 3V4LA 2XYPA 1SC4A
chains in the Genus database with same CATH superfamily
1RXIA 5G0SA 8ABPA 2JGKA 3FGOA 4D7AA 1W94A 3ZXSA 3PJGA 1SHTX 1JFTA 3NHJA 2ET6A 4JITA 4UBMA 1U90A 4EUHA 3A9RA 1FP4B 4KDCA 4TUYA 2A58A 5EE5B 2G63A 3RUEA 3ONDA 5FBVB 1JDBC 3GJ3A 2P90A 4WVFA 4CG2A 1D5WA 4TMYA 4LDAA 2FPSA 3DL4A 1TAGA 2PUTA 5JSZB 2G1PA 4GUDA 2OBXA 3KE8A 3NOOA 1DJPA 2XHEA 4IJKA 1LDNA 4JCCA 4ER7A 2IS2A 2IC5A 2PXAA 3LYHA 5F52A 3NVMB 1VA5A 4IOKA 4BCBA 2R11A 3OETA 1XPJA 3MTAA 1CQJA 3HCBA 4BVLA 3G2KA 1PWEA 1QP8A 3RTEA 4RTPA 4BRZA 1WX1A 2IPAB 3V80A 1LPNA 1P1JA 1QANA 3C43A 3QBDA 3OBIA 2CT8A 3L7OA 2VDLB 1T2VA 1VL1A 3FYUC 1SBHA 2XCQA 3K9QO 4Q1FA 2FFHA 2ODQA 1XQXA 4ZHQF 3UT5B 1YZFA 3P20A 3S6JA 1FMJA 4QYIA 1VE7A 2GTHA 3DAYA 1CLEA 3CZ4A 3N5CA 4TKZA 2QL5A 5F9FA 4R9VA 3N0XA 1XELA 1E8DA 3OX4A 5LYJF 3S8EA 5I5EA 3LPDA 4LJSA 3S81A 4YJFB 4B3DA 4L3WA 1L8OA 5K6RA 2ZRAA 3QVWA 2TMGA 2F62A 1W5SA 3LY9A 2GPWA 1ESMA 1YZQA 3G82C 1K8ZB 4O2AF 4CM1A 2BR3A 4NCIA 4E07A 2Z30A 2O7NA 1A7UA 2VSQA 3LCCA 4EQZA 2NUTB 3FJ1A 3F3SA 2W2KA 1GG5A 2NN3C 3OTWA 4ZOCA 4B6JA 4BUJA 5GVSA 1M5RA 1W88B 2P6NA 1FYEA 2I9PA 4MRSA 2V4ZA 2BLLA 2I6TA 4EB3A 2WD7B 3INTA 1RKVA 2A4MA 2OD7A 1WCV1 2OCGA 2WJAA 2J85A 3T3EA 1KPIA 1TNDA 1CX9B 2CL0X 2VHZA 1EGQA 5ISMA 1DEAA 3M9WA 3SZUA 1RRMA 3CPSA 4UEJA 3DCYA 4M0CA 4IUCS 2QYSA 4DR2B 4CEHB 3PIIA 4CL0A 1Y9AA 3ZD6A 1ICIA 1RDFA 2V7QD 2XPCA 3WWOA 3CKYA 3BPSA 1UBNA 3EG5A 1QQ7A 2DOKA 5T6BA 3UFXB 1Z8NA 5A5FA 1SXPA 3WDMA 1JKMA 1SZJG 2E6KA 2FSVA 2OESA 3CUEF 5AHOA 4FT2A 2EFGA 4JLMA 4X9XA 5CA0A 1EUZA 3W6UA 2QLMA 3OF3A 4L02A 3WLTA 2ZJ2A 2Z5LA 1SBIA 4UHDA 2VPIA 3BQNB 3OUTA 4KWIA 1JDNA 2CFCA 4NMWA 1K8QA 1PEAA 1QFXA 1VTKA 2O2XA 2FFRA 3WV5A 1R4MB 1CP3A 5FQNA 4F1KA 4HDSA 3LZCA 1GU7A 4BB9A 2DUMA 2CWWA 2OGWA 2R2AA 4LY0A 3WNZA 1YKGA 5B58C 1OLXA 2Z9CA 2ZRIA 4HN2A 4ZEMA 4RVNA 2RGAA 1CUAA 4IPTA 1JI0A 3MJVA 1VFNA 2P62A 3GFBA 1GM5A 3G0HA 4FHDA 5DHSA 1OE0A 1O6FA 3JQBA 2JHCA 4YS6A 1L8AA 4MYUA 3V8VA 3BC1A 3N28A 3RF7A 4OI4A 1M8JA 4V02A 3LI2A 4HYEA 1ZCBA 3NS7A 4DIDA 4BZWA 2A5YB 3H5LA 4FYPA 2D4HA 3RU3A 5CPFA 3A6ZA 1UM9A 1YMUA 4PZLA 1QNFA 5L8VA 3DLBA 1CJUC 4CM8B 2ZXFA 1CEQA 1CJTC 3OQ1A 3GJ8A 3I4LA 3ZCPA 3QJ5A 4CT4B 1ZR2A 4MS3B 2QN6A 4DLLA 2WHEA 1ULUA 4K6OA 4PR3A 1KQNA 3W6OA 2ON6A 4O1HA 3GP5A 3RIGA 3SU8A 3UTCA 4S1VA 3OQ6A 3TZHA 4LDPA 5AKIA 1SKUA 2E9SA 2EL7A 2WA2A 1LNSA 2V6FA 4ZAVA 5ECWA 5H82A 5BWMA 4Y1RB 3EF0A 1ZM3A 2X23A 3WK6A 4GS5A 3G5TA 4F0JA 4DV0B 2X5NA 3NC0C 2HNBA 4ZEVA 1TCAA 3HBFA 2DHEA 3ZS8A 3A36A 4BVEA 3ITKA 2UUOA 3L8CA 1NGSA 4LJ4A 2BPOA 3G2LA 1SY7A 4RF5A 2E4XA 3NEPX 2X86A 3GWGA 3V34A 5CB4F 1SO8A 2CL5A 1VI2A 4CVNA 5L40A 2V7BA 4LYHA 3UW3A 2JRCA 5LNK6 4DR5B 3KQKA 1UM8A 4M1TA 1FQJA 2CDNA 4GEKA 5A9TA 4JOSA 3U6KA 3SM3A 3VV3A 3E8SA 4NTZA 1SUAA 1GPMA 5CX1A 3Q4GA 1Z39A 3PDIA 3VPBA 3S4YA 1LH0A 4NONA 4ARZA 2ZAIA 3I3SR 4EECA 4RTKA 5PNTA 3EGWA 4CLEA 1FXWA 4P0QB 1WP9A 5HRCA 3F71A 4XR9A 5IWAB 1JZSA 2KQUA 1QQTA 1UF9A 4MUFA 5B1YA 2NGRA 4D3FA 4MQUA 1N9KA 4GMKA 4HDNA 3O0DA 3ZHCA 1MW9X 1UOQA 3WLFA 2AQKA 3HV0A 2R86A 4EY4A 2YUTA 2C42A 3PEWA 2AS0A 2H2FA 1QIGA 1YRQA 3EYAA 1C9NA 4MP3A 4CI9A 1Y5MA 2XNDA 3DMNA 4RVHA 4B44A 3NH6A 2TMKA 1GN8A 3Q2OA 3U3ZA 3UGJA 2VP2A 3VGJA 4L4YA 1BN6A 2VQ3A 3NWPA 4IV0A 1FDIA 1ARZA 5B4UA 1JIXA 2GXAA 1JT2A 3T5CA 4HVCA 5K01A 4NG4A 2Q6VA 3W8RA 3L0SA 4BVHA 4BZXA 2IIBA 4ZALA 4QEKA 4ZYLA 5EINA 2XF8A 5DH9A 1RLTA 2YIVX 3GUUA 4EGSA 1IRXA 4PLZA 5IG2A 2HV9A 3ZQKA 1D2CA 4TRJA 1E63A 3EXEB 4FP9A 1LK0A 2Q1UA 3GA7A 1SK9A 4QICA 4BL5A 5CDSA 2YYZA 2HOQA 2Y05A 4P08A 2WPNA 5TRTA 3SXPA 3QF4A 1UBHS 2EATA 1M0TA 3O3OB 4E5UA 3CKMA 2PV0A 3U4MA 1ENOA 2E4ZA 2FSGA 4O4HB 1XIVA 2HB6A 3M33A 5EMNA 5B3JA 2YS6A 4RJTA 4KITB 5ICMA 4N3BA 5JYDA 3AFHA 2EGGA 1NTRA 3N0TA 2C77A 2O2JA 1GD1O 3LVQE 3OU2A 4QATA 1T43A 2YVAA 4BAUA 3QIAA 1OBOA 2G3YA 5KNCD 1Y3BE 4U6QA 3I45A 3RUDA 3ETGA 2XR1A 1QS0A 2IXEA 1H6AA 5DSTA 3BH0A 3SEZA 1UT8A 2C84A 2WIDA 1D09A 1CIVA 1E94E 2N9UA 2C78A 2PQ2A 3ZDBA 2A1UA 4L75A 2SBTA 4P5DA 2NXNA 5HTKA 4LE1A 5A71A 1WQ1R 2B92A 2ZUCA 3BMQA 3TRIA 4AVYA 1WETA 2Y1OA 4Y9SA 1XQ9A 2YZGA 1L5FA 3B3JA 4JLSA 2D7DA 4BNGA 3FYDA 4BWYA 3ESCA 2DWPA 2OK7A 3AETB 2BOVA 2B20A 4A2WA 5LU9A 1EWKA 3KO8A 1NNEA 3W4IA 1JKXA 5KOHA 2J9YB 1AF4A 2ORVA 4B3IA 5LSAA 3TF5A 1PYOA 3L7CA 3RVRA 4I3HA 4XQGA 3O8OB 4R0VA 2WA1A 4NYJR 2HHAA 1X8LA 2MSLA 1C7JA 2FEOA 3M3HA 2EL9A 3A1SA 4QDJA 4RXMA 4DLNA 1RXVA 1SIBE 2V65A 5CCXA 3E53A 4MX8A 1OA0A 3R7DA 2H9IA 4HTFA 1DEKA 2NXCA 4R9NA 4D8WA 4KNYA 3WQSB 2XVYA 3K9BA 1MZVA 3BFVA 4MYHA 4JLUA 2AOUB 3AHGA 3TLYA 1L5VA 2IYOA 4GP6A 4RK0A 4MMXB 1CJKC 3C3PA 5G4KB 3H8SA 4NE7A 3ZY6A 4RJ2A 2P6RA 1KAGA 1RVDA 3NASA 1P29A 5EHNA 1XKQA 3CLHA 5MN4A 1E1LA 2A5FA 3PDWA 1SC3A 4PWZA 5BN5B 1YGYA 4UD6A 4XE5A 4FU0A 1L4YA 1J8YF 4UDXX 3DXFA 4QYWA 4E31A 1B6TA 1L7BA 3QHAA 3L0BA 2GKGA 4GHWA 1V7PC 3JSXA 4QM7A 3FWKA 1KI7A 3PVCA 4V1CI 4RE5A 2H1FA 1UBKS 4GT1A 4O4IA 1ZCAA 1UP7A 2BCJQ 2PX8A 5C1OA 2QN1A 1KJ8A 1ZH6A 5HS6A 4V1CB 1NMQA 3QLEA 1YVPA 2HA7A 2G06A 1AHNA 2A0FA 3KLBA 3NBQA 3Q98A 4ZCTA 3CVOA 3LWDA 1ZM4A 3DR3A 4UBJA 4KIFA 4MAFA 1KE2A 2A9FA 1H4QA 3WLRA 1FDTA 2Q5JA 4CF5A 1U9JA 3AM3A 1PQUA 2JLZA 4IXDA 2YRFA 1FQWA 1PZNA 1TQHA 4YQEA 4CMJA 3I5XA 1E3JA 1V47A 3AX6A 4CTJA 4F8JA 2B4YA 2UXDB 4X20A 4HB3A 3T95A 1YOVB 3TO5A 1WVMA 2P6UA 5CIWA 2QTBA 1NC3A 3HCDA 3GC6A 3IOCA 4NK4A 3S1AA 2ZYSA 3KFLA 4RD2A 4MGIR 1EUDB 2F00A 2SECE 5LMNB 2ID9A 4FX2A 4JSRA 3RYIB 5JWOA 4BRSA 3IDSA 5JQGF 1S4QA 4EHLA 4V0LA 1X19A 3IPCA 3MWDA 2Z3WA 1WY5A 3D1LA 4EBFA 1HEYA 2B5VA 2O07A 3KZVA 1TOAA 3HUDA 2ABWA 5BQOA 1SZDA 1RQPA 4HZIA 1J8VA 1C1DB 1NOJA 3QP9A 5DMXA 4E70A 4KPUB 1S9DA 2R96A 4XDHA 1EFAA 3SR3A 3KCQA 3FSEA 4HGNA 1Q3HA 1DKQA 2XUHA 1A8QA 2GO1A 4LW8A 2G1AA 4NU8X 1E1RD 2VSOA 4JEMA 4UNPA 1M1YA 1JE1A 2CLKB 5BN4A 5K0LA 4RY0A 1MOSA 2ZK7A 3KHSA 4PW0A 3PUXA 1YASA 3QEMA 4FYXA 5CK4A 4B7ZA 1YZHA 1U1GA 5D85A 2POCA 4OGKA 4B2YA 4C7VA 1MBZA 3H05A 3CUKA 4BS9A 1A0OA 3KOWA 1TRKA 1OBFO 4KG7A 2ILTA 4BKMA 2HK6A 2HTFA 4KPYA 2HK9A 4C03A 1JR3A 2QVBA 3BGWA 3VU9A 2IYSA 2ZSBA 1NPYA 3MGKA 4ECAA 2UU9B 3CTMA 4Y18A 4HQFA 3NUQA 4GYKA 1CQPA 4HXFB 1C3LA 1CG6A 1T3ZA 2HTEA 1ORTA 1Q7BA 4NARA 3QI7A 4LWZA 3WYFA 5LXTF 4IIJA 4OOEA 4YCMA 3BXFA 3NG1A 3N87A 4JD5A 4BO4A 3ZU5A 2VDRB 4MVJI 4AF6A 4D81A 1W36B 5GWXA 1PTJA 4RIEA 4LF9B 1AQYA 3P8ZA 5JQGB 1APBA 1P4HA 1Y9JA 4BNFA 4E22A 4DMUB 2F67A 4ON9A 2EC5A 3OVMA 1N5KA 2G6TA 3P9SA 4YCAA 3TTYA 2JASA 4B7XA 3A04A 1DFIA 4S1OA 5GAJA 2TS1A 1NJFA 4WASA 3AEUA 2FPKA 4L50A 4JR1A 2FQQA 2AI3A 2CNKA 4DQVA 4D97A 4YUYA 3ELWA 3NBMA 1NBIA 4F4CA 1CUWA 1QHYA 4QHTA 1JE0A 1HT0A 1Y1PA 4I1IA 1G2QA 4PC7A 1J56A 4C5CA 5COBA 1MV5A 1LTKA 1ZXLA 2GHQA 2R1VB 3IJRA 3KEOA 2P5SA 4G25A 3P0IA 4V3CA 4JC5A 3EXIB 1E1KA 4JT2A 1OFHA 3AFIA 4GRDA 1J8MF 1SBTA 1O1YA 1Z29A 1H05A 2VJAA 4JLVA 4LCBA 5T4FA 1TYZA 3U31A 3GROA 4RTSA 5KWIA 1Y8ZA 1V95A 4HG2A 1HOTA 3WYEA 4KPGA 4ENQA 1CP2A 3I53A 1JHZA 1NVTA 4D9EA 1BW9A 2CFSA 4KQCA 1YWGO 4KMSA 3KYIB 1LQUA 3P9ZA 2A14A 2F90A 5ALFA 1NW8A 2BGKA 2X0IA 3MYRA 2TYSB 3FDZB 3A58B 4JASB 3I5YA 3DOOA 2R1ZA 4KODA 1HEIA 1JGTA 4PLPA 4YGXB 4AJJA 2EEZA 4P2BA 4ZYZA 3KQOA 2IDZA 3F6PA 4CUKA 1M2JA 4JFAA 5AI5A 5JSQA 3ROEA 3CNLA 4RLQA 3K2EA 3NTUA 2ST1A 4YUVA 5LBIA 1Z56C 4JJAA 4DTCA 5AK4A 3L7NA 4GX2A 2KE5A 3K1YA 3ZV4A 2CK3A 3RRMA 2YMQA 4KCGA 4DT1A 5KTYA 3R76A 2NWQA 2VYNA 2W93A 1D8TA 5EJ9A 2XUFA 4RHFA 1YJBA 1QGUA 1I32A 2YZ7A 4JQZA 4D4GA 3IOEA 1TI7A 1E2BA 3D4BA 3UG7A 4BX2A 4WZBB 4MWSA 2QN9A 2WUEA 2HMAA 4L1KA 1UT5A 3UK2A 3O4VA 4XQEA 3PWTA 1Z33A 4TKLA 3D1VA 1F8UA 2PY6A 4NV0A 4C6RA 2W6ZA 1AN0A 3AM4A 5HDQA 3ROKA 4INOA 3LCRA 3U4QA 2QG9A 1ENZA 3EFHA 2GZAA 1HV8A 1XWFA 1E9SA 5BW5A 4XZ3A 3ZQJA 4LOKA 1QPZA 1QONA 3T5GA 2IQIA 2QV7A 3DEZA 3KTDA 1E1NA 1WUJS 2B0JA 3A2LA 1D7AA 3DKKA 5M04A 3BIJA 2VF8A 1X0VA 2F3QA 1QLWA 4RWEA 3WLEA 4WV3A 3SQLA 4OHYA 2I2AA 2R00A 2W6JD 4A8PA 2BTEA 2ZJBA 3Q7PA 4C87A 3MCTA 5AUOB 1M0WA 4NVRA 4WJLA 5ENVA 2O8NA 2PJZA 4Q3AA 3MVEA 1HA3A 3X1MA 1QKIA 3FE2A 1KMHB 4XUDA 1ONPA 2PR7A 5DO9A 5A5VA 4ENPA 5JNTA 4ZEXA 1UEXC 2PH7A 1RMYA 2DFVA 1AA9A 1K63A 5EJ2A 4FFSA 3ACBA 1OROA 3A6PC 3FD8A 1P8AA 2OWEA 5DRTA 2C7QA 2JEZA 1TCBA 2R47A 4DR6B 3FCUB 4TZ0A 4P5PA 2QW8A 2K4MA 4RE6A 3GBPA 1YTLA 2IZOA 4EIWA 1C81A 4IMPA 3B5JA 2YY5A 4CRWB 1NA5A 5JE8A 3RYTC 5AW7A 4DLUA 1TO6A 3VH2A 3KJZA 1MXHA 3LO5A 1HETA 4RIIA 4B43A 4QNRA 1W2WB 1UZMA 1E20A 3AHEA 3AOEA 3I28A 2FPOA 3HO8A 3N07A 3ZNNA 5TLSA 3PCRB 1ZZGA 2FWAA 1L0BA 1QX3A 4FS8A 2C2XA 4FGLA 3SJUA 4DADA 2OWDA 3OX1A 4DW8A 3K96A 3WGVA 1H8ED 2F43A 4XIGS 3W2HA 3CCBA 4MINA 2JAXA 3NM5A 3ZWCA 4E5DA 3RAGA 2V7EA 4NU5A 1ZJ6A 4X92A 3E05A 4HDSB 3X0DA 1KJWA 1IHOA 1O5IA 2AF3C 1ZCJA 2OFOA 5AOAA 1C0KA 2FKAA 1T2CA 5AI4A 2R5WA 3DEYX 4FDUA 4LNUA 3LQKA 4TXMA 2L42A 3K6SA 3DCIA 3H4VA 3I9V6 4YIHA 4MIOA 2NUPA 1DTEA 5BSWA 2XLBA 4RX1A 1W73A 2FGKA 2J48A 3OZBA 4JV5B 5DLPA 1QCDA 2C97A 3MQFA 1L5KA 3MCAA 3BA6A 3W8NA 4AJIA 4D6XA 4W1QA 2W2QA 2GDJA 1H66A 3S2GA 4FWIB 1QHSA 2C3MA 1ZUNA 5CNKA 1XRPA 2QRQA 5JECA 3TL3A 3AL2A 5ERYA 3FZQA 3F1KA 1OYOA 3QPAA 3KOYA 1RXWA 4QUHA 3ZE2B 1D9ZA 2WYOA 3BAZA 1WABA 5IFKA 1QQ6A 1TTQB 1TVKB 4UARA 4X84A 2PKQP 4K3UA 3UV3A 1ZH4A 2E4VA 1E4EB 5LDGA 1OC2A 1S8AA 4DXDA 3R3UA 1G8SA 2A2ZA 4AUNA 4BLUA 1G5RA 3CEHA 4G85A 1QF6A 4J0QA 5D84A 3TBFA 1ZPDA 1MG5A 1J00A 3AWDA 2IPXA 1U2SA 1PGOA 2W00A 2SCUA 4YI3A 4ZO6A 1OLSB 3G2QA 4G0MA 1NYTA 4DLXA 2XJ4A 3ZDZB 3PFIA 2OYSA 3HCEA 3OIFA 4Q03A 2X8WA 3HXPA 1ISFA 1IXRC 1J8FA 1YR3A 2ZJ1A 3T9DA 4YUXA 5IC4A 2XWQA 3E18A 4L73A 1JHPA 5BVHB 2HRQA 3ORSA 4JU8A 2OFXA 2QZJA 3RSZA 2QT9A 1Z12A 3IDQA 1YULA 3JD3A 1EZZA 4XJSA 4YBRA 4QA9A 4AT1A 4NAHA 4DYHA 2PGDA 1HDZA 4F91B 2ZE5A 5A0FA 3EGDA 2VP0A 3AERA 1F2UB 4HF7A 1Z82A 2EHJA 9ABPA 2D2EA 3EQZA 5AVTA 1P9OA 1VGVA 2BI4A 1VPTA 4EVRA 3F74A 3FUUA 4QBFA 2D1QA 4Q3DA 1JH8A 2F6RA 5GGYA 3QX3A 3LTNC 2QAJA 4WOPA 5THKA 2QTZA 1UMBA 3H5TA 3UWKA 1OAAA 3TOZA 4PAQA 4AN4A 1ZOLA 4PZEA 3WLOA 4BMZA 1Q0LA 3NTLA 4V0RA 1ZM2A 4G23A 4OHBA 3DGEC 3RFCA 5TGZA 3UJAA 1HKHA 3VZCA 1P2BA 4AD8A 3PWKA 4LRTB 3EJWA 3NT5A 4ER3A 1OC4A 2PUVA 3FYUA 4Q4AA 4NKRA 1Z7EA 4TLDA 5T3YA 2DY1A 2WLTA 1DV2A 2EWWA 1J7JA 1YL7A 3GDOA 2IPNA 2WIAA 1JXMA 4L3VA 2GD1O 2XMPA 4OHMA 3VR5A 4OREX 2XRZA 3PT5A 2H2DA 4ZMBA 2XUDA 3T0FA 1XRLA 3QX9A 3NAZA 1M6VB 3GAZA 1NUPA 1GUDA 3K0FA 1H2YA 1JL3A 1VGRA 3T5DA 3DLHA 3IPYA 5HTOA 2DJ5A 4YPFA 4PFKA 5DRYA 4PRKA 5IZCC 3QOFA 1JMYA 1VPVA 3H5WA 2HDNB 1XXLA 4FZRA 3ZYZA 4ABTA 1HL7A 1R15A 1KYVA 2GJKA 4PYQA 3SC6A 1Y33E 5LQSA 5CVCA 4YRCA 2INGX 2I03A 3A32A 2OECA 1NZDA 3ZDDA 4H17A 3IQZA 4BP9A 1BHJA 2A88A 3K70D 1I5OA 1LRLA 3N05A 2RI1A 5IWCA 4MQLA 3JWIA 1GRVA 4XDYA 1SQGA 1OLUB 5KYUB 1PQWA 2DVMA 2JBAB 1X87A 4CKEB 1U9ZA 4RSRA 4B4WA 2OOSA 1LSSA 2H4HA 3GQVA 3MJDA 2GUGA 4DJ5X 1ZONA 1XZFA 1Y5LA 5P21A 1NQVA 4X1YA 4L7VA 3R6GA 4OFWA 3GFGA 1BEEA 1E79A 3UAVA 3KB8A 4CGZA 4AK9A 1WPRA 3B2QA 2Z8XA 5LC1A 3BJZA 3Q3GE 2B82A 2WWGA 4M9XA 4DLTA 4MW0A 4TYWA 1ZW6A 4ZMSA 4DSAA 1P4JA 3OZVA 3DOUA 1I7LA 3MUFA 2C5GA 2QTNA 2HWXA 2NO5A 3RHZA 1XVVA 1OFVA 1JMVA 1P7WA 1U2QA 2WPDA 4MEAA 1ZR4A 1R6VA 1JBEA 5IAAA 2E37A 2DHDA 3UN1A 2OLEA 1LJUA 3D43A 1N2ZA 2KLHA 2WJJA 1EGAA 4UU0A 3L4KA 2QJOA 3Q9LA 4HNSA 5BWCA 4KIUA 2Z2ZA 5JS1A 3C0KA 3ZXYA 1CF4A 3AG6A 4Y2QA 4RGBA 3IQGX 1PUXA 5FFFA 3RV3A 3SCZA 1S6YA 1U2DC 4TM7A 1C8LA 4EZBA 2D1TA 4U8HA 2PUDA 2V96A 2BE7A 3NIDB 4F6RA 5JVDF 1QYWA 1WHSB 3L4BA 3WQBA 2ZB2A 1C9JA 3NM6B 3LXRA 2F4VB 4F1WA 1A88A 4HR7A 1KIFA 1MPTA 1NVAA 1QIDA 1U11A 1UZAA 2CF5A 1S8OA 2BM1A 3F3MA 1GPH1 4IZIA 5EESA 4WXEA 1HT3A 1YE3A 1E2GA 1G1AA 1ORIA 3IIMA 1F9AA 3OQBA 2ZUFA 3NHUA 4IP0A 4MRMA 1BQ3A 1WCWA 3LBHA 4B9AA 3ANSA 1IIBA 3CGGA 1YUMA 4OGWA 3O8QB 3SZ3A 1JT9A 5TEVA 3RYCA 4U5QA 2V8BA 5J5CA 5CCDA 1NNI1 2HRCA 1M2OB 3ELDA 4MV7A 4MUIA 3RG8A 2B5OA 1SC9A 3IHWA 4BECA 4OSPA 1JQLB 2ZRQA 5LJIA 2OYCA 1KR2A 1E2QA 3V5NA 4FGWA 4HAOA 1I33A 3C1AA 3D6AA 1BVUA 3P0HA 1GU1A 2MOKA 2DBZA 2XWSA 3EZ9A 4CTOA 4LQ4A 4MP8A 2Y1CA 1A8IA 4G1BA 3SF0A 4B33A 5LQCA 1VBMA 4F3RA 1TCVA 1KO7A 4O1MA 5ALNA 4LYEA 1TVEA 5JEEA 5DYYA 4GL2A 4EJFA 5JO0A 1I1QB 2G9NA 3O8NA 2GPTA 3WMXA 2RGCA 3WMGA 2J6IA 4AULA 3HPRA 3LWNA 4DSOA 5MHTA 4DQLA 1GL3A 4NP6A 3ZDXB 2FQWA 2C2HA 3U49A 4DDUA 1NXPA 2H92A 2Y1WA 3DOJA 4FI3C 4GBMA 4C7BA 5J63A 4K6HA 3BA1A 1YFJA 2RI0A 2WFLA 3EOAI 3GH1A 4R98A 3T5BA 5JPCA 2GERA 2EARA 2P9JA 3LT4A 3OM8A 5ERXA 2QVXX 2F8TA 2I3DA 5EC8A 4EW2A 1W48A 4JR2A 2PV7A 3H16A 4JT9A 1Q44A 4ZMRA 3PT9A 5ER6A 4C20A 5TQJA 2MHCA 4WA8A 2NUAB 4QL3A 5B2FA 1A8HA 1QO0D 3F47A 2DBRA 3SZMA 4B6SA 4C3UA 2OD9A 2Q8QA 1IG3A 1L7RA 4GXNA 2C2YA 1L4GA 1BMQA 3KHUA 3ODGA 3OZFA 4H6PA 3AQ4A 2OCXA 4JLBA 3UA3A 2Z6UA 2VP5A 2H1WA 2QTWB 1KVQA 2UVPA 2PCLA 4YB8A 3I30X 5FUBA 3MCWA 3I2JA 4R5HA 4DR3B 2ZM6B 5CYGA 5MN6A 4D25A 3E1SA 2AKAB 1UC4B 2I66A 3KZOA 3KUXA 2J6CA 4X6YA 1KMNA 4DARA 1RZRD 1JHQA 3GZTB 4LDNA 4LYAA 3GJXC 4DZTA 1NUUA 1ODLA 3FUVA 4WCFA 3ZVMA 2JEYA 3IEKA 1G8KA 1XHLA 4E13A 3DTVB 1OU0A 3CZ9A 3HBJA 3O90A 3ZU3A 1O96A 5K09A 4PN3A 4PHGA 2PL5A 3DDWA 3FPBA 1F4LA 3T94A 4F4JA 2ZRPA 4WESB 4PXYA 1JYEA 4HBGA 1BE0A 3IFSA 4ZPXA 1MIHA 1NDUA 2IU6A 1JP7A 4CCSA 3E5HA 3QITA 9MHTA 5FAXA 4ZI5A 5KKCA 1I1NA 2AF4C 3FCSB 1VMIA 2PKCA 3NR2A 4HJXA 2PTHA 5EZSA 3DWIA 1PTJC 4PO9A 3VJLA 2PWAA 3U7RA 1V5IA 1YZVA 4QPPA 1PJZA 3LKZA 2Z04A 3HJCA 3KE9A 4NJOA 2Q5EA 1SXQA 1T9KA 5T5QA 4IJUA 1S8FA 3EUWA 1AKMA 1HZZC 2WKPA 2EJCA 4GC5A 1EP3B 1BC5A 4ALMA 5AVVA 2HC9A 1I3LA 3EHEA 3KAQA 3P4XA 4WINA 3ELBA 2OHIA 5AMXA 4RTNA 1QFZA 3NKVA 1LBEA 4XXHA 4POOA 4JQCA 4LZWA 2L69A 4UCXA 1YCHA 3AW8A 1EKXA 1T2AA 2FETA 1XTQA 2QK4A 4Y6GB 4BMPB 1E92A 1QH1B 2ZANA 3WMRA 3T3GA 3ZNOA 4F5WA 4B6EA 1ACMA 3TM5A 4EK9A 4QDTA 4DV7B 2H1HA 3CRVA 5KMGB 4RCYA 1D04A 4JYBA 1DAFA 1ZI9A 2NPOA 2XB8A 5KJFA 4JYCA 5DHTA 1ZAKA 1I1HA 2QMEA 4NFSA 3UAZA 5K0SA 5JMOA 4M53A 3ENWA 1WY7A 3ZGLA 4EO4A 4S1TA 3B6ZA 2CJWB 2FMKA 5I7VA 4OGFA 5FOXA 1COWD 1A5SB 1DBVO 2AYYA 3A9CA 2PGLA 2Q5LA 1WZ2A 3H2JA 5FO0A 1QHXA 1QHFA 3GHHA 3MWKA 2OE2A 4N6OA 2ACKA 2OHVA 3L1UA 4GKJB 4ALIA 4XKJA 4IINA 2XYGA 1UAYA 2XNCA 3ZIAA 5JH7F 1E3MA 1DO2A 1MA0A 2N0SA 2G0NA 1ESNA 3AEKB 3DCJA 3OMWA 2YFQA 4WXRA 3RJTA 2H5JA 4W5RA 1P9WA 4B83A 1K0UA 5HW0A 2PSEA 2BDTA 2HJSA 3G0IA 3U6BA 4BZQA 4A36A 4RSHA 1VCMA 1YKFA 4DV1B 3PDHA 4DL9A 4QQFA 5K45A 1UJNA 4HX9A 3N2IA 4IH1A 3J81k 2OSBA 5I01A 3S2FA 4J03A 4AJEA 2PAAA 1NBME 1E0DA 1X7YA 2WV7A 4HDMA 3ICQB 1I3MA 4J1TC 3PFNA 3MCVA 4DMFA 3PXDA 4CLOA 2IODA 3FFWA 4HO1X 4IIEA 5FKJA 4ROTA 2B4QA 3DUFA 4U3JB 3A14A 5DHFA 3H7IA 2CNDA 5AJTA 3R5XA 5JAHA 2JCVA 1REQA 5FTJA 4QZVA 2GBCA 1KI1A 2ZS8A 5H83A 5TNXA 2Q3FA 2X5KO 4C4YA 3IT2A 5KQPA 4CM7A 1R4NB 1FPQA 2Y71A 3HXQA 3CH6A 3PLAE 1TUIA 4X63A 5KINB 5K8VA 1R5JA 5J1TB 1S2OA 2IEIA 1T36A 3KXDA 2VRCA 3N8GA 2J4CA 3ZUPA 1DKRA 4UM9B 1PYDA 2HSZA 2LCQA 4B8ZA 4K87A 3F90A 2NW6A 4K9RA 4MYTA 5EZYF 4YMHA 3I9LA 1KK2A 2GLUA 3AY0A 3X44A 1LWNA 5E0OA 5EJFA 5A3JA 1E5QA 1Z8HA 4UVDA 1E2HA 1PKEA 3DLPX 3ENNA 1PHRA 2AMJA 2Q2OA 5L53A 4EGCB 1J25A 2HZ7A 1U4NA 2X22A 3SLRA 1E6KA 2ZI5A 4LF6B 2X8LA 3EIEA 2R84A 3IH5A 3TGLA 1MT3A 2GX6A 3WDLA 3Q8KA 2OBLA 3E9YA 2C9DA 2IYZA 4I9FA 3T3OA 1T2NA 1UKZA 4RUKA 3UMBA 3UCEA 1I6WA 2GILA 2J46A 3VNVA 4OP2A 2NYAA 3HR7A 1KHTA 3HA2A 1NUTA 2OD2A 2WUGA 1IHUA 2NAFA 3HDHA 3KYDA 1A2OA 2IWHA 3S7ZA 3OCXA 4YR7A 4A2PA 3L7AA 3GLIA 1ZG3A 5GJCA 4L28A 5AW3A 1R16A 3WGNA 2VEOA 4ZODA 2I6GA 4A2QA 2H1OA 3HP1A 3NOQA 3LTEA 3U44B 1QUFA 3GLTA 3GN2A 4F6CA 2GCEA 4KAJA 4P4GA 4RULA 4LNUB 2AQIA 1C7QA 1PDOA 3SBDA 5IAGA 5AJWA 1ZNYA 1V96A 3AKDA 4WNAB 4L4UA 4LZLA 4Y2GA 3U0VA 5JDIC 1EFHA 1N9GB 2DHCA 1HTBA 3H5VA 1FP2A 2H52A 4MWBA 3ETHA 3QXCA 5EVJA 1Z38A 5IUNC 3P5BA 1R0LA 2Q9AA 2BMJA 1ZD5A 5HZHA 1EUCA 2RFLA 2ZIWB 3NHAA 2G9RA 2X76A 1FFSA 2ZI3A 3CE9A 3C8UA 5I7OA 1NJ5A 1IXKA 4OKNA 3T1NA 2CHQA 4Q00A 3TR0A 4PG4A 5KVCA 1Q0ZA 3N8NA 4KO2S 1LW6E 3T9FA 2HXSA 3PDCA 5I8WA 3TVDA 1GZ6A 5FDFA 3FCXA 5AO9A 2NYVA 3V4OA 1W36C 1V71A 4QU9A 1D1SA 2Q3DA 3ND5A 1RQLA 2EP7A 3NYRA 3NXSA 4G0YA 2GK7A 1BEZA 3HA5A 4YUZA 4CQMD 1NLZA 3DZIA 3HR8A 3HFSA 3KHTA 4Q82A 2AEMA 1NUQA 1C9MA 4PZPA 1I94B 3TIGA 3MJFA 1OYWA 1FY2A 2J3KA 3OKCA 3K1AB 4FX5A 1AD2A 1IB0A 2P68A 3RBXA 4OYYA 1N5MA 1ZW1A 1DLJA 2FCRA 1YBMA 2Q0XA 3AEQB 4LISA 4O2AA 4QXOA 3LYUA 3VBCA 4O0LA 1GKKA 4D26A 4GGOA 1MH9A 2QPAA 3NTOA 1I4TD 4YALA 4YMIA 3C7CB 5B53A 1NE2A 4F12A 1XEWX 4R2WA 5BT9A 2YHSA 4Q9KA 1BWRA 4PY2A 3HKCB 2XTNA 5K5EA 4HGOA 1VL6A 2IXAA 1RT9A 2O0KA 1EG7A 3OEEA 4RVGA 1EXVA 3AVPA 3HYLA 2NSLA 2HBRA 3FLMA 3ROFA 3C5VA 4Z1OA 2PK3A 1MEEA 2W2KB 3FPGA 4RXTA 4D9KA 1TIPA 1J33A 2VG8A 2NSDA 3VSEA 5LWQA 4TYYA 3FOFC 1VKJA 1ODJA 4MQ4A 2CFIA 2BCEA 4F8EA 1IY8A 1DKMA 1II0A 3AJAA 4MXDA 1L7QA 5AVUA 3NW9A 4QOFA 2ZTHA 4IJVA 3V4PB 1ORHA 3ZTWA 5SZIA 5TPWA 1KC3A 5B4VA 3CVUA 2CV1A 2PUEA 3RU9A 3IODA 3U4DA 5KAPA 2A1TR 2IHTA 1IJEA 1L7OA 3BE4A 3DOCA 3H75A 4RANA 2XD4A 1KZ4A 4YYZA 2RGGA 4NPHA 4HSEA 4RV5A 3BTOA 2O20A 2A9VA 2AW3A 1KEEB 4MKXA 5DI3A 3M81A 3K0FB 1D1QA 3EH2A 4OBWA 3SC4A 4IX1A 3VH1A 2GSWA 2IZ0A 3PNMA 5LYYA 4Q9IA 1A5AB 3IAFA 2J9FA 1IXYA 4AJ1A 3EEQA 1DU4A 3K94A 1E69A 2X6QA 3BB3A 3DJYA 1M7GA 2ZAMA 1Z13A 3DLAA 4MVJD 4F3YA 1JLRA 2BUBA 5EJ5A 2XE4A 2QVCA 1ZD3A 2JHGA 2FE1A 4RZQA 5FTKA 1FYXA 2M32A 2QZZA 5DN6A 4M1MA 1MRZA 1E6CA 1PSZA 1Z2AA 3DYBA 3NHYA 4ASUA 3E0QA 4E5NA 3H1TA 3GCWA 5JMPA 5AVXA 2WRZA 4A91A 3WNVA 4F06A 5JNVA 1HE4A 1F06A 3NRCA 3OC6A 5IKMA 2ADOA 3FWNA 2JFPA 3G85A 4HAIA 1SM4A 4FBLA 4NZPA 1V6SA 2IXDA 2P6MA 4JJEA 4YO8A 1R9MA 4F7DA 3RVLA 3BILA 2YWCA 1ISMA 5JJCA 2P75A 4X1YB 2OG1A 3B53X 3AIMA 3C39A 3KPJA 4PVDA 3I92A 3F7TA 4IYRA 3E3OA 4URHA 4M6WA 3GGSA 3OZXA 4MGYR 1NQWA 2ZJFA 3VPSA 3SN6A 4ETMA 1ZVKA 4HLUA 5KTPA 2EW2A 4ZAZA 1H0KA 2XVMA 1KZ9A 1Y82A 1NQAO 2XUAA 4KE8A 2EG9A 1LRJA 3EDOA 1ZM9A 3G5LA 1DAEA 1C7RA 1A9TA 2XRYA 2FWRA 1TGYA 2WAAA 3AILA 3WV4A 4N48A 5F4BA 1XMVA 2VRCD 3KPYA 2WU4A 2FFJA 1AK1A 1G4AE 3L6BA 1U3VA 4ILEA 1H3NA 2QR2A 2JFBA 3HACA 1VIDA 1S0UA 3OPYB 3QF7A 4MEBA 2I6XA 3FG9A 4ND8B 2FLKA 5KX5B 4QGSA 1FDSA 1NJSA 1VIVA 3AFNA 5LCXA 1VLVA 4Z9XA 3H9UA 4JX9A 3IQEA 4N5DA 3B38A 2JAQA 2V03A 2HCRA 3DM5A 3VZSA 1UOOA 5AHKA 1ORRA 8AT1A 5HM8A 3PI7A 4J76A 4DMGA 2QU8A 3UWOA 1IZZA 4KJZA 3I01A 4FWBA 1W34A 3IT3A 4OKIA 2ZTLA 1PJTA 4GLOA 1XNRB 4MUAA 3ESRA 2JJQA 5LD2B 2BMAA 1A82A 4P98A 5I4KA 3WIDA 4PTZA 2B9VA 2XB6A 3DD5A 3KFVA 2W2PA 1CUVA 1G8PA 1T15A 3B6MA 5TEWA 1DTWB 5B36A 2ZJOA 4UOEA 5AW2A 4KGVA 3OLVA 2E49A 4RZXA 4BNDB 4D82A 3JAWB 3QNWA 4FFBA 4HAYA 2NSYA 2YV4A 3GU3A 4R3NA 4X1KA 3SR4A 2RE8A 1A1VA 1EUYA 1XLTC 1PFKA 4Q24A 4B3SB 1Y34E 5JANA 3HCCA 2ZQ5A 1B8PA 1SBQA 1YBVA 3WLLA 1PFGA 2V45A 5KYXB 2FR0A 2PH3A 4HH1A 3WQHA 3HCPA 3DEIA 4G97A 4UCFA 2AFHE 3FR7A 1U8XX 3GEDA 3BHNA 5JCJD 1SWVA 1G2PA 3T41A 3UY4A 5BSFA 3U7HB 5DPMA 3UUWA 3NDPA 2R3SA 3JQ7A 3QBEA 5AKLA 5CFLA 4NCJA 3CVXA 5JJKA 4BO9A 5KNBA 1QYRA 3P9CA 2VTBB 2E87A 1G5HA 2IBTA 3EEOA 2VYFA 3BXXA 1U2PA 2OL4A 1PNOA 3DV0B 4JDUA 1MB9A 3R8FA 3UXMA 3ZYCA 4XPIA 3FI9A 1Z34A 2GCOA 2QMUA 4ZVOA 3RROA 3ZHOA 1O03A 5EJIA 2PYZA 3P2MA 4YJHA 4E6EA 3L0CA 1G0OA 2X2FA 5JNRA 2CYBA 3RV4A 1LBSA 2DM6A 3EQ9A 5L45A 1BS9A 3D2AA 3VAYA 2H1VA 3BRWD 3RC8A 2ZXEA 2DUNA 3KVRA 5C8DA 4PIPA 4BO5A 5JYBA 4QBGB 3LF2A 1OWMA 2X40A 3QRWA 3IEMA 3GWZA 3C5CA 2IFTA 3H3XA 3G23A 3HCNA 4OCZA 4BX9A 1SQ5A 1L6RA 1LC0A 3R9KA 3ND8A 3KR1A 1X13A 2VQEB 5FJIA 1W44A 5LA6A 4DJEC 3CRNA 3AOEC 4NE9A 3ME5A 1JPNA 1DX4A 1U5AA 1M6WA 1ZKMA 4GLBA 3TSOA 2YN4A 2LTAA 1HKUA 4CKCA 2VT2A 5ALXA 1UBMS 1W46A 3GO4A 1T5BA 1G6KA 3C3XA 1UBRS 1VG1A 2CBXA 4GWLA 2AYZA 1MZPA 2F3TA 1G7RA 1PV1A 2Q8NA 2WU8A 4FE7A 1BXGA 4GW3A 3GJ0A 4H15A 4E5YA 1KETA 4DA7A 1GL6A 1P0PA 2A9RA 4G67A 2R79A 3BMQB 4BAGA 3T3HA 2W6OA 5IJ0A 2AD1A 4B3JA 2G0TA 4YROA 1JLMA 1HDRA 5CG2A 1TZCA 2EQ5A 1KVRA 3AETA 5KREA 3U9TA 3JATA 5C3UA 5REQB 3V2IA 2WT9A 5GONB 1Y89A 5ALRA 3HKDB 2AC7A 5JQWA 4NCAA 1QUEA 1UMCB 1Y81A 5JAQA 3L4EA 3DZBA 3LBNA 5IXYA 2C5LA 2UYYA 1Q1GA 2RIRA 4BGDA 4JJGA 4FNGA 1DVRA 2D3TA 1O5TA 5FBRB 1GZ4A 3U9SA 3O38A 3S44A 4D4KA 3V2HA 4C76A 3H2BA 1QLHA 4HNQA 5G1NA 2FWIA 4FSDA 4BLQA 4P3OA 4JBGA 5K0FA 2O5RA 1NG1A 3BRCA 3H17A 3K6JA 2DX7A 4DY6A 2ODEA 4I1RA 1D9XA 4HOYA 3BWDD 2B6HA 4FB5A 2QUIA 4GFDA 1TEZA 3CH5A 1XDZA 4KN5A 3V6MA 3I52A 3K35A 2GF9A 1MPXA 1ADJA 2HHLA 1K4YA 3A6FA 4LMPA 4YJ2A 2CHVA 1Y5IA 4GWGA 1YRAA 4PYLA 3HN6A 4KXVA 1Y1QA 2ZWIA 4ZZ3A 1SUFA 2WV9A 4KVAA 1W25A 4EF5A 5IM4F 1L7EA 5CBKA 2XNSA 3DZCA 3UOGA 5H8WA 1V26A 2HJGA 4GKKB 2IIPA 1EH5A 3NFRA 2ACVA 4OB8A 5LN1A 4W5NA 4XX0A 2VDPB 1SCBA 3HB1A 5HKKD 3V4ZA 4JLKA 4UZEA 3NYWA 5INTA 3PNLA 2FUKA 2R68A 5A7HA 3PFFA 1U9IC 2R4TA 3A9TA 1QQ5A 4G1UC 4TVSA 4IAOA 5TC4A 2B25A 1IJKA 2BZSA 4J2TA 5E95A 4YXWD 4QPDA 3T7SA 1CJVC 1E2UA 3I64A 1PR9A 5EMKA 3DDOA 4DNPA 1IZ7A 1O6GA 1UFRA 1OR8A 3BS4A 3PEEA 3T7EA 1PGPA 3D54D 3VR2D 4B6FA 1GSAA 3F7OA 3L8HA 4DB2A 1G20B 1X8XA 3FZYA 3Q5EA 4QBKA 3KYCA 2V1UA 3PX7A 4WFQA 3IE1A 3R23A 4MS1A 3HYCA 4NPCA 4KKXB 3F6SA 5A7GA 5UKDA 1WCIA 3TEJA 1SKYB 1V8PA 3PQ2A 3WKEA 4DLYA 2GF0A 1AMOA 1RZUA 2MINB 3MT8A 5TSDA 5CNIA 3RYIA 3GEPA 3KDSE 4QGBA 5TQ2B 3ET5A 5DFAA 2J5KA 1E5VA 2OA0A 3ROZA 1OBHA 4X93A 3OZWA 4R71A 5K0TA 4M1OA 3D3NA 3GBSA 2Z2XA 4E3ZA 2CXUA 4Z0PA 1SAYA 1M8PA 4LJ7A 4C07A 2JF0A 4IWYA 1IY9A 1MC4A 4GE3A 3LU1A 1WWKA 4PBSA 3DEKA 4Q7EA 4RW0A 2PMBA 5TMEA 4TTJA 3V6LA 4FYWA 3WGTA 2ZSAA 3FDXA 3E8XA 5KHLB 2BDEA 1XV5A 2Q4OA 3AUUA 4ODIA 4UNQA 5AXBA 4EP1A 4EPYA 1F8FA 4ZAXA 1X8JA 2A0XA 3EPLA 1IBCA 2JJ2D 5K3OA 2XZTA 1AGPA 3EMVA 1MFZA 1X3SA 4MCHA 1WZIA 2FQ1A 2H11A 2G9ZA 1YDFA 1E9EA 2JEOA 2QSJA 3I37X 2B4TO 2O2GA 2FR8A 4EUEA 2PT6A 2H85A 1AK9A 4CCYA 3E9MA 4MB6A 1G7CA 1XQ1A 1LJ8A 4WECA 3I32A 2A57A 5HE8A 2WAOA 4BDTA 4E7OA 2F9LA 1NRXA 3LGAA 2HD4A 5TF4A 1VHJA 3TQQA 1SXJE 1SIUA 5KZMB 4CETA 1PDVA 4UPEA 3EW9A 5FAKA 1UDCA 3FOZA 4K26A 1WUYA 2HXYA 1UDBA 3JW8A 3NORA 5E9WA 2CVQA 4RV4A 3VO8A 4YRSA 1JQ3A 3AR8A 2WKQA 1OXTA 4ZI3A 1EP9A 4B3BA 1H9AA 4N8SA 2XWPA 3L1JA 2RH5A 4PZAA 2GFHA 1RLOA 3KR2A 3U0BA 4LTMA 1UJCA 4ECEA 1C9YA 3M6XA 1UC9A 5JXGA 5GVRA 3RABA 2ZUBA 1A8SA 2WYIA 4QVGA 4BYMA 2B94A 4KFUA 5HKKA 1PS9A 1IHXA 1H9BA 1KDRA 1KYYA 2IZZA 4UEKA 3A2KA 3CW9A 5BURA 1Y8QB 3WICA 1PZMA 3AOGA 4CFYA 4MRNA 4YPOA 1N0UA 3C6ZA 1U3GA 1N57A 1ZIOA 1ZM7A 2G09A 3JZFA 4D56A 2XE7A 1WBDA 2ZSJA 4UBIA 3K9HA 4D9MA 4OV6B 4F2HA 1HDYA 3EDRA 2BFWA 3T1OA 5CP8A 2QX6A 5AKYA 2QD4A 5AICA 5L6MB 3OC0A 4JJZA 1EUCB 2PSSA 1TQDA 1GN9A 3PB3A 2BHLA 3IQIX 1J0CA 4A8JA 1JZTA 1KXZA 5FPHA 3VOSA 4KXUA 2HLDA 4IIUA 2DERA 4ERXA 2BMEA 1YBAA 2CBZA 2ZRNA 4FE4A 5JLAA 5BSGA 1BVHA 1P3JA 3MJHA 2JJMA 1I13A 3QKTA 4TT3D 4UNNA 4AS2A 4G81A 1A4IA 3A6LA 3FHLA 4J0CA 3TUJC 2KS6A 3JQ8B 2LKDA 3P94A 3WHIA 1H2RS 3ZBQA 2A3NA 4OQDA 5DCUA 4A26A 1IBLB 1X1BA 3SBOA 1DRUA 4IWXA 4UHHA 1XCPA 3IJPA 3HJBA 2VDVE 3D6TB 3Q6NA 5NULA 1J1ZA 3RR2A 5B1IA 2WKSA 2J07A 1Z4LA 2C82A 1Y6QA 1VLJA 3MC1A 4ZT2A 2VCHA 2G25A 3K5IA 4P4SA 1QGUB 3WAJA 1GL7A 1BIFA 1YJQA 3LT5A 4H0FA 4ZANA 2W0MA 2QTFA 2KPOA 3G9UA 4JYZA 1A2KC 1N2GA 1IZ9A 2BBSA 2JFUA 3Q11A 3EVZA 1O8CA 2IF0A 4RVUA 2DCMA 1W581 2PGNA 4UCQA 5DEIA 3TW4A 5LB4A 2Y0CA 2JAOA 2Q0HA 3OEYA 1WV1A 3EUAA 2I3ZA 4KXLA 5FT9A 1A3CA 4IGFA 5CDFA 4AJ4A 1M76A 2OHJA 2VKTA 1HZJA 2QJWA 3FLEA 1UFQA 3OIYA 3TKLA 4RKYA 3LWZA 4M0MA 3CF2A 4C0BA 2HA4A 2PD3A 1ZGAA 1DQPA 3A70A 3CSDA 3O3NB 4O08A 3T6KA 4DSUA 4ENVA 4IKEA 3IP1A 2GZRA 2R7KA 2VHTA 4RK1A 3ZWKA 1P1BA 1YRBA 4F5DA 1TPYA 2HNKA 5SYMA 4I50A 4TZKA 3DKVA 2ZUDA 4R3WA 3QLVA 3TLXA 3FNEA 2WC1A 1FYWA 1N7IA 1QE0A 2WT8A 1V4NA 4HGPA 1W2HA 1XAGA 4P3PA 5DEOA 2OXIA 4BY9E 4ZCQA 4O4IF 2MDTA 2G88A 1R8SA 2WHPA 4OX9Y 2ID7A 1TJPB 4QHSA 1IPHA 4HLDA 1JU9A 1W8DA 3C5EA 4R8VA 2P6OA 3VJKA 3T0IA 4EEXA 4E7PA 1ID8A 5JASA 1XYGA 1CY8A 1DELA 2JA1A 3L7IA 5IVPA 3R44A 3W06A 3WI7A 5AK3A 4A0HA 4HYTA 4P81A 1MABA 3C3WA 1QTQA 3HJFA 4X90A 1VB3A 3KLPX 1ZOIA 2EFCB 2BZGA 3M2PA 5DHPA 1ZNQO 3HCAA 3Q7IA 4MWEA 1JHOA 4RL4A 3RVOA 2QRVB 4K9KA 4DCMA 3AR2A 1JKJB 3ZN2A 2OENG 3EEBA 2J5RA 2CDCA 4NECA 1E7SA 1QCCA 1D6MA 1X80A 1P2TA 2PJDA 4M36A 4NSNA 3P2IA 5F5XA 4HD8A 2AT1A 2VYND 2DWOA 5C8XA 4TV9F 4XM1A 3OF2A 5B2EA 4JODA 4WADA 4JEHA 2VOJA 4CR6A 3AHCA 3GLHE 2NVWA 2PH5A 4RD0A 3X1DA 1GKLA 4XRGA 1RW4A 3N2GB 1M2VB 3M70A 2ZAGA 4NJEB 3KVNA 4O0MA 2GM4A 1U80A 4GPZA 3NYIA 3T3IA 1R88A 4A0SA 2AJLI 2FEPA 3SSMA 1A5BB 2CY0A 2WB4A 1NVFA 3X3HA 3I39X 5FBQB 2BI7A 4GICA 1DXOA 5AW4A 3NZEA 1UWKA 3IEXA 1KYIA 2HPVA 2OCAA 3O4IA 4CPDA 3KQMA 5HIIA 5JC8A 3D6UA 3GYBA 4HNAB 4PYNA 4ZQHA 4PGFA 3ZCXA 5KNCA 4YRPA 4DCSA 1LC3A 4S3MA 4UBLA 5TVKA 4BRWA 5BXQC 2AZXA 4Z0TA 3LUBA 3LOPA 1TVKA 7AT1A 4BATA 3B6JA 5BRAA 2EX1A 3PC4A 3PJFA 1J24A 1PV2A 2VPTA 3OPYA 3TI7A 3IDOA 3UYKA 4XTCS 4XW2A 3EXHA 1FXSA 1P73A 2WAMA 1BFUA 4REQA 3RS5A 4EI7A 1SURA 3QVLA 3Q85A 3DE0X 1ESDA 1OIWA 3AIOA 2P67A 5C4MA 5DI9A 5ALVA 4D46A 4KLRA 5CXUA 3S28A 3W04A 3ZDEA 4AFNA 3TTXA 3FRIA 4RKRA 2XUQA 3N70A 4FNOA 5J4HA 4ZVQA 2QUZA 4OQNA 2O8BA 2IY9A 4MV5A 1QH8A 2IOFK 3TTVA 3U5TA 3IVAA 4PPGA 2P69A 4LDZA 3CSSA 1ADFA 1GAEO 3ZIUA 1LK5A 1QJ4A 3ABIA 1U2ZA 1WF6A 5KTOA 1WA5A 3MQ4A 2FWPA 2NVUB 1Q16A 3BJMA 3HBMA 2KJQA 1FLNA 2VA9A 4OKSA 3LVBA 2JIDA 4QDUA 3GUVA 3JZAA 3RC9A 2VTEA 1T8YA 1CUGA 5KPDA 4A3SA 1ILEA 5JDCC 2Y8EA 3JS5A 5EZ6B 1UP4A 3WRVA 1JJIA 1H85A 1GNTA 2NO9A 2ZB4A 3EWSA 3VPDA 4JT4A 4YJ3A 2RJNA 3G6WA 1J2TA 3STYA 2WJWA 1ZDMA 1VLMA 5EAIA 3MERA 1QIFA 3H1FA 4K88A 3TLCA 1VKNA 3ZNQA 3OF5A 4Q4AB 3UVEA 4BNVA 4H7FA 5AFSA 1Y3HA 5GM2A 3RJ9A 4JLPA 3ANXA 4J1NA 5DX1A 1M1NA 1FP4A 1MC1A 3LSYA 1FLVA 2BELA 3AUYA 2QLFA 3W77A 1ZIDA 4IQGA 3GLFA 2KMLA 3B8HA 4BP1A 2JLUA 4II3A 3SYRA 4H9GA 2C4MA 3EULA 3KZ1E 2ECFA 3T1YB 1G63A 3HYNA 4V03A 1SN7A 2Q3LA 2Y67A 3DMHA 3CNBA 3M6LA 1QP4A 3CUWA 3GG9A 4X64B 3ZHUA 4GX1A 3P7MA 3ZHZA 1EFCA 1XLVA 3VISA 4LY3A 5ANRB 3GR6A 4Z8XA 2RHTA 3PPWA 4B48A 1N33B 4WZ6A 3ETDA 1CB7A 3TTUA 4YRNA 2OORA 4JWKA 2ZR9A 2XY4A 4TWIA 1KGDA 4H4CA 4GDFA 1I6KA 2ISQA 2OGUA 2VSYA 3BD8A 3GIDA 5H9VA 1TPZA 3TD6A 2NZUG 2PD4A 2ZS9A 2JKZA 1SXJD 1E4VA 2C59A 2R4QA 1BGVA 3HM9A 4BU0A 2GEVA 4DIBA 1E9BA 1ZS9A 1DX9A 4JA2A 4OYLA 1I36A 3I5AA 1J2UA 3OE4A 1GTZA 1M7BA 2B37A 3ROPA 1K88A 1RTTA 1YB6A 3V42A 4BMDA 4QOJA 3RWBA 3UENA 2OQRA 4IIGA 4YJFA 4IHQA 5ILQA 3UV6A 3MMSA 2ALJA 1MVNA 1OWNA 4JI5B 4A6EA 1SCDA 2QL6A 3B1FA 3AY6A 2VRWA 3CISA 4UVHA 3C1OA 3JATB 4HRVA 1E1YA 3MBOA 4I0WB 1MO6A 1YDGA 5REQA 4RD3A 3E35A 3QENA 1JV2B 2W4MA 3K0CA 3T7DA 5J9FA 2ZUVA 1NIPA 4JT8A 1JNXX 1AUVA 1T5SA 5DLYA 3FRHA 3K73O 5KJEA 1IXZA 3VPCA 4R7TA 1NBOA 1GTSA 1FFYA 3JARB 1S8NA 3LLSA 4JVOA 4NIMA 4AZ0B 3C16C 1UQRA 1VA4A 1HNXB 2GJ9A 1PZGA 1BKYA 4Y9DA 4NCXA 4P4TA 3FPJA 4IDBA 3D31A 1X1CA 2BEKA 1HT2E 5BV0A 3HKBA 2WG0A 2ZIGA 2QNRA 2OO3A 2R25B 2DBYA 2SHKA 1ECCA 5I9BA 4EY5A 1XTUA 4P5EA 3AFMA 3PIDA 4B3MB 2ZKIA 1H2BA 2CMFA 5HJEA 1MR3F 3PTAA 1AS2A 2I65A 4L27A 5A2QA 3KOZA 1TEVA 4DGSA 5BNIA 3EGOA 3MXOA 721PA 4RF4A 4AROA 4B9EA 1UL1X 2QAIA 1RHQA 2O4UX 2OFPA 3EGVA 5HMLA 1UT6A 1JHVA 1EK6A 2DFKB 4DQKA 1I4OA 2G71A 3ADOA 4JN6B 4RTQA 5AW1A 1M1UA 1IOLA 3GQBA 2VIIA 1ONNA 4ZD6A 4PLYA 1RP1A 2OB2A 3UBMA 4DRXA 3O21A 4G0NA 3UJ9A 1KBQA 2XWBF 4M0DA 4QREA 3NONA 1BJRE 3HJAA 1LFDB 2SKDA 3F2VA 1H6CA 5ITVA 4F72A 2HKIA 4GOOD 5HFNA 5JDIA 5HPYB 3V1UA 1MQAA 1ZHHA 1BU5A 2ZI4A 3OLWA 4OG2A 2W83A 2ZYDA 1ZC4A 3AF2A 2Q3EA 4NY1A 2P9QA 5IM5A 1FK8A 2DF8A 2PVPA 4D74A 3O3CA 2BEVA 4FMCF 3FPCA 2BHSA 2FEKA 4S1PA 4J4HA 2XODA 1N8NA 5E7JA 4XD7D 3OJXA 1YHYA 4I1VA 3IB6A 4EYOA 3KS9A 3PGXA 4M8IA 4XB1A 3S2IA 3H5NA 2H29A 2QU7A 4G0UA 2KX7A 2ZB7A 1P1FA 2HXGA 2HY7A 2YFYA 4KQGA 4WCFC 1XVIA 3HMKA 1DRVA 1CQZA 2XYQA 1JAZA 1YQWA 4ZU1X 2O54A 3NALA 1RYDA 1WKVA 2I7CA 3DE7X 1M2HA 4Q1DA 3SIXA 3ZK8A 1ELOA 2WVJA 2GAJA 5TQ2A 3PEYA 4BO0A 1XYVA 3U3XA 4WUVA 4Y1RA 4B7AA 3CKLA 2WU1A 3MWEA 2O2IA 1I6MA 2COEA 1M6NA 1EVZA 5C80A 2F1KA 1M5UA 3HL0A 2JK1A 3ZLUA 1CE8A 1LS6A 3TXXA 1QF9A 1YC2A 4B3CA 4B4OA 3X1XA 4DQ0A 1LPPA 2BKEA 2WYHA 2Y9MB 1XEXB 1KIMA 4YAUA 1GNPA 2Z4TA 2C2OA 1KI6B 2Y0BA 4M46A 1RP7A 4NU6A 3TX6A 4B2LA 4YT8A 3FHTA 2UZ3A 3PX3A 2Y68A 1SEVA 4MHTA 4NF2A 1RR6A 2VT3A 2ZT5A 1P33A 4MB2A 3H0CA 5EP4A 3SKYA 1YE8A 3SC2B 4EPRA 3EHDA 4HX2A 3EEFA 1UAGA 4JLJA 2DT5A 1NSTA 3GAMA 1J0XO 1J39A 1GFZA 1KFBB 2OT3B 3GT3A 1T24A 5J4LA 1D5CA 1Z4KA 3C8MA 3G2PA 5HZGA 4JL6A 1LKZA 3QVTA 4N4AA 1KOGA 1J90A 3N3BC 1FNMA 4BQPA 3Q41A 4CXMA 1CDOA 5TJ9A 4KMRA 1QO7A 5K6TA 1BHSA 3THYB 1HYBA 3FFTA 2V6IA 5GV7A 3VUFA 4HNRA 1U0JA 4PSVA 5D5PA 1FRQA 1G5IA 3LW7A 2V0NA 3LHFA 2J6HA 2QMYA 2CD7A 2QVGA 4FHFA 3EGCA 2ZSIA 4KQJA 2VWHA 3QE9Y 1SKMA 1DCFA 1TA9A 4J0HA 4U8GA 4D3YA 5D86A 4ZVMA 1VHLA 4X95A 4DM4A 4GRAA 3FNRA 4HS4A 4BXOA 1NQUA 2RC6A 1EXWA 3DQZA 3FX2A 5F35A 4CWAA 2R1UA 3UHAA 3OECA 1ODCA 2B83A 3C48A 3DMFA 4WJKB 5D5HA 2FEAA 1ML4A 3L8FA 3TFWA 4MYDA 2FMUA 2JFQA 4BB6A 1Y3DE 2FFQA 4PTLA 3ESZA 1NW4A 3AP3A 2PX3A 1RQGA 3N86A 5AM4A 2HLDD 5ECYA 3WWEA 4RTMA 4AO6A 1AQNA 4N9WA 5GJWC 2EGHA 4L0DA 4RADA 2B8JA 4I9NA 4W5JA 2X1MA 4ZQEA 3CB4A 4P53A 5DM4A 5JZ9A 2X3FA 1WSWA 3H42B 2GAOA 2ONZA 1R0SA 3ED1A 3LDFA 3Q12A 5ALDA 2W90A 4CDGA 5K9ZA 1CZOA 3I6YA 2EDAA 3D64A 3OCVA 5K51A 3KPUA 4XQ9A 4YJGA 3PC3A 3MLBA 1RI1A 3O9MA 5B7QA 4QTTB 4QOEA 3HEMA 3FDIA 4D9BA 2G6BA 1E3WA 4ISBA 3V7NA 3VZQA 4LWPA 4G0ZA 3P9KA 3W78A 4AJ2A 4NCHA 1CIPA 3GLFE 3GPBA 3AHFA 1M67A 4HDRA 4MIKA 1WQ4A 4OF4A 2PT9A 4X91A 2CJWA 3SQDA 4IJQA 4YT2A 3F9RA 4MTCA 4WY8A 5CLHA 5K4AA 5JDCA 4BFLA 1DKOA 5ILGA 2C0QA 3V8QA 5TGTA 1POXA 3KEMA 2IEAA 3C74A 2YY6A 3PXEA 1WE2A 4MGKR 4Q48A 4AECA 3P45A 3C7TA 1P5HA 2L17A 4P4LA 3JR3A 5J40A 4ARCA 4CMKA 1HLGA 2PBRA 4KXXA 3DVQX 1YZLA 3IULA 3DDSA 3SWWA 2Z09A 1W2GA 2F8LA 4LJRA 3PDJA 1IFXA 2IS1A 2VPZA 2XT6A 3FIUA 2ONYA 1W4AA 3DAFA 2I87A 4K9LA 4BC0A 4FFWA 4EB6A 1J5PA 1FZTA 4RSMA 3QVSA 2Z95A 1HG0A 2ZWOA 1R0KA 3QPVA 5AJYA 3VHXA 4DA8A 3ELUA 4GMXA 4M37A 2AJDA 1KSJA 1XTJA 4QQRA 1XZMA 1HTWA 3FJYA 3PC7A 1N2EA 2TRSB 3P27A 3NVDA 5EXEA 5IUKC 2ECOA 2PPVA 4PN7A 2BYTA 1ZEMA 2C5BA 4GGMX 4EG3A 1R0ZA 4UM5A 4AWAA 5JVDA 1V5WA 3FNGA 4HWGA 4BWGA 5K6AC 3RT1A 1K5GA 5G4KA 1T8RA 4QYTA 5KI6A 3MTEA 1G38A 4JI4B 5IS2A 1GG8A 2CL6X 3BIXA 2FR8C 2FW8A 3SXJA 5IJ9B 4CM3A 4X6LA 4UDNA 4JEUA 4BNUA 3WGLA 2Q07A 5A5EA 3HSYA 3ZC3A 2F8MA 1HXHA 4O1IA 2HN9A 2QTRA 3A0UA 3V7WA 2C7VA 4RKEA 5KKNB 3OTOB 3O9VA 4RMJA 1G21B 1JG6A 5IT5A 1WU7A 1W35A 3CG0A 4XEUA 3I76A 4RL6A 4U02A 2PUFA 4NOKA 3DF7A 4ZI7A 4UHJA 1LNZA 2VAXA 2X19A 1DHTA 1FQOA 2JATA 3II6X 4PICA 3GXBA 2N75A 2CSUA 2XMDA 4WKPA 3STWA 1ZJWA 1JEYB 2HBYA 3R9XB 1T9CA 1JR3E 2UUPA 3OZAA 4K46A 3DO6A 1PR6A 1Z18A 2RGNC 1DDOA 2BIFA 3BEOA 3NBAA 1GTL1 1UP6A 3WL5A 4CIXA 5EJEA 1EESA 1NBMD 4BLWA 4LNHA 4GMGA 3H3JA 1Y7PA 2O9JA 2WSLA 1THGA 2OBBA 2SKCA 2BEUA 1HDIA 2G5TA 2QTAA 1JG1A 1CW2B 3HDYA 3KLNA 4URZR 1MO5A 1W8IA 1Z6QA 3HXTA 4ATNA 1V45E 1ONOA 4PLVA 1G1MA 1ABFA 2H59A 4DCVA 4E33A 1DXHA 1TKRA 4UUQA 1P80A 3F4KA 1IN4A 1N2JA 2ZATA 3DTVD 1BZYA 1UQTA 3PUWA 4HFRA 4Q4JB 5BNFA 3KYDB 4JP5A 2FDCA 1GCIA 1UCFA 2ZYTX 3MTGA 1Y9ZA 3ZI7A 1KH3A 1C2YA 1RPNA 1ZFNA 3HJRA 4EA8A 4CEIA 4MQEB 2Z83A 1UFOA 2QT1A 4HFJA 3BSSA 4GD3Q 3D0KA 1GNSA 2JI9A 5ITSA 2UDPA 3H86A 4G2TA 4AKTA 1EJ0A 1DUVG 1RYHA 2HA3A 3QYJA 1Y5NA 5E6SB 2FFAA 4EL0A 5L7YA 1FDOA 3OOWA 1OTYA 3QHPA 2QX8A 3D3WA 2C98A 3L4SO 3U26A 2BRUA 3AR4A 4P0PB 4FGZA 4EI2A 1AN9A 1F4VA 3DAPA 2UXCB 3ZI4A 3RFXA 1NVWQ 2GVDC 3FMPB 5BUQA 2ZUEA 4TVOA 2FDXA 3VR6D 2BISA 2NO6A 4NX2A 5M7EA 3O4JA 3DE2X 5LP1A 2VK4A 3AM5A 3TZBA 3IO3A 2W6MA 1YFZA 1UJ6A 2MYPA 4S12A 4PSKA 5JAPA 2HDOA 2JDIA 4YJ3F 1C30A 1XI2A 3BFJA 4X71A 1Y42X 2JI8A 4PNPA 1WKBA 4PQFA 5HUHA 4FDTA 4QHYA 5B64A 4O4HF 2C4KA 4EYSA 2XYHA 5F64A 2O50A 4Z1MA 2Q6OA 2GBPA 3AV0B 5CBPB 3K4HA 4KX5A 3AZQA 2CVPA 4J3FA 5JALA 2GXSA 1WPXA 4TWAA 1EHYA 1AKQA 2ZE8A 3OEHA 4H7HA 4ZVLA 4ENWA 1E62A 5KYYA 2VXYA 1WP4A 1I2MA 5EPUA 3VYTB 3PFKA 2H7CA 2RGNA 3R5HA 4N3AA 4BGIA 4MKHA 2QUKA 2OK8A 3UMRA 3RLIA 1NXOA 1JIIA 2GYWA 5B1DA 5F1YA 4I8IA 1KP2A 4UTVA 3REQA 3AI1A 5LJLA 2COKA 2I55A 3JX9A 4X7RA 2JGFA 2O7SA 4PYMA 1IPEA 4DREA 1LBHA 4XTRA 3SI7A 3FOEC 1DXYA 2X15A 2V9CA 3CX3A 3N74A 3MTBA 2NVUA 4QTUB 3GLKA 3Q3JB 1DEXA 1ZLYA 2ES4A 3ERCA 2GM3A 5ED0A 2IXFA 3CHYA 2ZBGA 3F7MA 1DRJA 2IEBA 2V7UA 3AP2A 3GLHA 1BMDA 3KVVA 1N2XA 4K8RB 3SNHA 2RMKA 4FCVA 4YFVA 1PQPA 2H1LA 2Q2QA 3ZDCA 4Q05A 4YJ3B 5ICEA 4ZYWA 1RE1A 3IMKA 2RHLA 4MNTA 2YJTD 3GELA 1PG0A 2GZ3A 2VF4X 4E12A 4XVHA 4OQYA 5CD9A 4GVXA 4RESA 5C0OE 2QX7A 1YS7A 1YR1A 3FKJA 4BE4A 4C4XA 5LP6B 1ZHOA 1BW9B 2B2NA 1EQ2A 3HM2A 5F76A 3VUEA 1OV6A 5CDHA 3QE4A 4XGNA 3R5SA 2FXIA 3KX2A 2OM6A 2AD5A 2XGOA 3BE8A 3L8ZA 1RC0A 1UEIA 4IXWA 3T5AA 5JI3E 1R3DA 2VTKA 2WQZA 3T4UA 1JQDA 3V48A 1EXMA 1JR3D 2ZZKA 3H1PA 3HMQA 1EWTA 4PBTA 2QGNA 2D54A 2VRNA 1Q0RA 3CUTA 5HVNA 1LDGA 2ZJ4A 4GPD1 3M6WA 4IDEA 1ESEA 4LA4A 3CWQA 4MZDA 4G1MB 4OHPA 2O8VA 3F6EX 2NZ8A 4LF4B 1COZA 2EZ4A 1JHDA 1UBOS 2D3WA 1TZJA 5CAEA 2P77A 1BXZA 2AFRA 2BBOA 4JB2A 4OQMA 2OGTA 4I50F 5KQGA 2YXLA 1U9CA 3G8CA 4DT1B 1JEEA 1J0BA 2Z3ZA 3O2QB 1JQJC 5C35A 4BBPA 4S04A 3R0IA 1OB5A 4E09A 5K0GA 1EM8A 1VJTA 5B6PA 1PCXA 1L4MA 3ETCA 4F2WA 3R5KA 3OH8A 3D8RA 4II2A 3P9PA 3NC1C 1A7JA 3H0EA 2V6GA 3QUTA 2CV0A 2ZZMA 1P5FA 3DFUA 3N3AC 3PXCX 2K6GA 2WZCA 3O9ZA 3FPLA 3N2ZB 5DLQC 3N53A 4AKIA 2AMVA 2VFAA 4ZC8A 4C0AC 1DJOA 4OJYA 1AC5A 3MRXA 1LDYA 4IXMA 3OTIA 5JV5A 1AZLA 3ER8A 2HYDA 4PLWA 1R00A 4UNIA 5FRDA 4ITVA 3RU2A 1E7QA 3C4QA 1R8YA 1Q22A 1S7GA 1T5DX 3E70C 4LRUA 4UC0A 5T64A 4B2PA 1GUAA 4G86A 4UATA 2PNFA 3W1VA 3D59A 3COSA 3TINA 4ZDIA 4C4PA 1SCUB 1Y4DE 5AUNB 2BDUA 4W8OA 1M2NA 3G49A 2C3YA 4U7FA 4QBIA 4C30A 2FY8A 3M3DA 1DUSA 1HC7A 1JRLA 2E1PA 1I4WA 1QCZA 1LD3A 2F1OA 3P9YA 3F0TA 3QVOA 4F45A 2IXGA 2PUCA 2CSXA 1XC7A 2Y1KA 3WJ7A 3M0EA 4YK7A 5F98A 3IEUA 2JLAA 3W7VA 3NBKA 3ONVA 1XTSA 4BX3A 4LCEA 4ZO4A 3PSAA 4UPDA 2C7OA 1UDAA 2B1GA 1Z75A 3GGDA 2O5VA 3DFZA 3OFNA 3I9NA 4RD4A 3VOAA 1CU1A 5TDHA 3FB4A 1H5QA 5TJHA 3DDNA 3ROQA 1MLDA 2QRHA 3GPCA 4Y9TA 1K5HA 1A76A 1BU8A 4RIFA 2VZ8A 2C9CA 3L4BC 1JSXA 4B4UA 2HFJA 4KVFA 4BNDA 1CUIA 1OZ0A 2W6PA 2AE2A 2YVUA 3H3FA 3JAWA 4JI8B 1PEYA 3GAAA 1XCJA 1MW8X 3H84A 1BFKA 1O5OA 5LOVF 1UDWA 1UK7A 2HIGA 1NSYA 1XZKA 3I8XA 3OEWA 2W4IA 4C2TA 3K0BA 4HB4A 4PC2A 3BHMA 3LFHA 3PJRA 5KOJA 1L7XA 2VJLA 2Z98A 1YZKA 4CTKA 5JCPA 1NP7A 3Q40A 5B6JA 1EB8A 4JC8A 4NQZA 5G2OA 1MC5A 3I0NA 2V59A 1OXUA 3AUXA 4L4ZA 4NH0A 1KRWA 8ATCA 4PF1A 4RZHA 3SNKA 3KLMX 4JXKA 4INPA 1DAGA 3DP9A 5J2TF 3WB9A 1B6SA 5LBTA 2PX4A 3HB7A 4Q18A 4MVJF 4A0FA 2Q1YA 1SC4A 1T4BA 3QKUA 3I6BA 3ET4A 2GAAA 2RCYA 2ZTMA 1Q0SA 2GZ2A 4IIJF 2XB9A 3K9CA 4RWZA 3WGUA 2OV1A 6CHYA 3FRJA 1GDTA 1FLAA 1EX9A 5EYPA 4F8YA 3AF1A 1OXXK 1KHHA 3PIRA 3SM9A 1G5PA 2F3UA 2HLNA 3MGAA 5IH3A 1A4RA 5IDWA 1TZ2A 4XPIB 3BFXA 2YQ5A 4MR7B 5EWLA 4HB0A 3HZRA 3TJZA 4EUFA 2H2WA 2OV6A 2IZ5A 5AM2A 2W8BA 3ZU4A 4ZOEA 3FPSA 2BFDB 3FM9A 4HQ0A 1LI7A 4H1VA 4NLLA 2VOEA 1JHRA 4AZTA 3TMAA 5EN4A 2O8FA 4JB3A 4JLDA 1JXAA 1X9GA 3GCZA 2WWRA 4GZMA 1IN1A 5CEEA 1PJAA 5EIWA 3GUHA 3WLKX 3FTDA 2ISSD 5E6UA 1N5IA 1VPLA 4DHWA 3D7LA 3D0RA 2GQ0A 4D0NA 1JDVA 2C9BA 3THRA 1DC8A 1N75A 1U7WA 3KKMA 3TNLA 4EF4A 4EG4A 5F3RA 1ADYA 4K0RA 5BMVF 5BSKA 4G0QA 1RYBA 1Z0KA 3RHTA 1Z5VA 5I7RA 4KR3A 4Q01A 1RYYA 1XE3A 1QO0A 4CKCB 1QZ3A 2AWOA 2B6NA 2RG7A 5EY5B 5K3CA 3PI6A 4F92B 1GZ5A 1PJQA 3OP4A 3CR7A 3MJEA 2AUMA 4NK5A 2YOHA 1MO3A 2AOXA 3AVYA 5CXQA 1FXUA 4BFYA 3CC8A 2YDXA 1DAKA 3CLUC 4WCDA 1X42A 2RJOA 3TD2A 3T12A 2R60A 4DNQA 4FNMA 5CFMA 4A0GA 3SFZA 3FSJX 4KQHA 3AESB 3E9ZA 4GZ3A 2F4NA 3BXPA 4U7HA 4FEEA 3ZCUA 4CZ2A 2C95A 3GK3A 1TO2E 3E22A 1LPOA 3NUZA 4HDKB 5AUQA 2QIOA 3T99A 3SBXA 3N2KB 2XRMA 4ZXPA 3GRRA 4TV8F 5JPIA 5T8KA 4O29A 2YZMA 4GZ6A 4NMLA 1CDEA 1DXQA 1VSVA 2B7LA 3O95A 1EZ1A 3S2YA 3TQFA 1SU7A 3IMGA 3IP5A 3N8KA 3ZXXA 4L9SA 5BORA 1UMDB 2V3VA 5FFMA 3NKLA 5LKRA 2A78A 1JYSA 1I5RA 2OBMA 1C7IA 4JR0A 4M0PA 2OAGA 3PU6A 1ST2A 4Z9FA 4DGQA 1JSRA 1UPBA 4AMVA 3RSHA 3W2TA 1PR0A 5EUBA 3H6HA 4EJMA 4R8RA 5DE3A 2E85A 1WTCA 2J3MA 2OGZA 3ORYA 3D3KA 5FORA 3ZH2A 2UVQA 5K0EA 3KJEA 1L1FA 4DV5B 2AOVA 1KNXA 2YVLA 1U1DA 1I0LA 5D3QA 3TOVA 1QK3A 2XDWA 2HW8A 3ZE9A 2ERCA 2VBFA 3R09A 1PLKA 4L8LA 1ZUD1 4N47A 5L51A 1ZESA 5J3JA 4IZOA 5LQUA 1GLVA 4JQOA 3TG8A 1O77A 4HH4A 3AL0C 2PZBA 2IYNA 1L7DA 3RBAA 2ZR0A 4RIHA 1IY0A 4QM6A 4W7IA 1W4RA 1OLXB 1A8UA 4DNXA 3VPHA 3WDSA 5JNUA 4RAOA 1KJYA 2HZBA 4Y6QA 2JAWA 5D1NA 3L1VA 5EMLA 4WFIA 2YWHA 1L9KA 1XMPA 3IBYA 1KZ7B 4C2BA 2ZRFA 3JYPA 4FS3A 4AP9A 3E9CA 5AHWA 5FIUA 2PO5A 2Y27A 3TTWA 4ZVVA 2ZBVA 3L7KA 5EJ6A 1SIOA 1KH2A 4NEQA 4O8ZA 4EB8A 1XTZA 1XZAA 3TGPA 2QTVB 2HEIA 3VTFA 1Q7GA 2R65A 1A77A 1VYHA 5EMHA 1ZRNA 1Z2DA 1VKOA 1PRYA 5LLSA 1WSDA 1ISJA 1WCIB 4XFJA 3L7DA 3Q8WA 3JQCA 5AI8A 4YHBA 2BTQB 3E5RA 5ALPA 4IVNA 1EFPB 4D8YA 3CX7A 1MMFB 2X1LA 3WJ1A 3N0WA 5FWYB 1J49A 1R66A 3SX2A 1XSEA 2FV8A 4JXZA 1ZIYA 1FMLA 3BREA 3QPBA 3TPFA 2H5EA 2W2XA 1TA0A 1O0CA 1BKSB 2JIBA 5SZKB 2AC2A 3PNBA 4TXHA 1R7RA 2J9ZB 1LLUA 1BCRA 4F6RB 3TECE 4N3CA 3L3BA 4XWYA 4BLVA 4MIYA 4MLPA 4U7GA 1ECBA 2Q3JA 1Z47A 2HK7A 3OPQA 4R2XA 4BO1A 3G7NA 3MIZA 4RJJA 2B61A 3NX4A 2ZRBA 1G21A 2QP3A 2X8JA 4J0GA 5JYEA 5LDDC 4L6IA 3OPNA 7ABPA 2GRAA 2I4LA 1IUOA 1ADCA 2FUCA 4M8KA 4TS1A 1QRUA 3RCBA 2D06A 1GR0A 3D2BA 1N5JA 4KRXA 2I1WA 1YZUA 3EPPA 1KZYC 2HI0A 4S0ZA 1XHFA 1T1RA 2NYUA 3FYTA 3N7UA 2P27A 1RCFA 2GO7A 3F96A 2JVJA 2VPQA 221PA 2FN8A 3FVRA 4MV6A 4MW5A 4L9WA 2BONA 4NYMQ 1KZGB 2ZVQX 1E6WA 1O9HA 4G4SP 4PLGA 4OIFA 2O8DA 2Q3BA 3RDPA 4TTPA 2J3QA 3A11A 3M9LA 4QUDA 4DN6A 3RIHA 1I3KA 3DHYA 4FCWA 4GG1A 3UK0A 4BVJA 3UXEA 1NXSA 2XUKA 4ZT6A 2X4IA 4POAA 3FFAA 4U1RA 2X3YA 2YZ2A 4OGLA 4OTZA 2LP4Y 3ZZTA 4CN8A 4KJXA 4RZSA 3QXSA 3SYNA 3UPTA 1XZPA 1A2BA 1EK5A 4Q4JA 2CFRA 3Q2KA 4INAA 3SQOA 1A5ZA 1OAOC 1RFGE 1F2TB 3DDZX 1ABBA 4NR0A 4QQKA 4L5BA 3UM9A 3BG5A 1OXVA 1OWOA 2HHCA 2A9OA 4IMIB 4UFPA 1UR5A 2FF5A 4JZKA 4K9MA 1N78A 1GNQA 5JAOA 1XVAA 1XK6A 4MQFA 3IIIA 2HRBA 1U2EA 4NH4A 2ZJ6A 3DZKA 5E6SA 1W0JD 3WOHA 3UQZA 4EEKA 4OXYA 3VGPA 1Q12A 1JS1X 4MITA 1TECE 2J3IA 3OQIB 4DC9A 3UJ6A 1H5NA 1Q7EA 4UJ5A 2EKQA 3IVCA 2OGSA 1ZMRA 2V6MA 4F4FA 2ZJ5A 4C7MA 4F3KA 3RWMB 4XGIA 1TMOA 1ZMBA 4R41A 4MV9A 4LF8B 5LA6F 1OAOA 2QPTA 1SCJA 2CLCX 2D2FA 2XUZA 4RV9A 4CV1A 3IUNA 3RSOA 3VV2A 3MA0A 1AZTA 3BK7A 2IU3A 3B8EA 2FA9A 2W37A 1QG4A 3CEAA 3FY4A 5DX0A 2BW0A 4TRMA 1RWXA 3VSAA 1ZD9A 3RVQA 1TLLA 1CNEA 4RPCA 1ORVA 4I9UA 3A6KA 4KYTA 1NX6A 2C4UA 3D7KA 4GUAA 4JSYA 2XNKA 1GQRA 2B36A 5FR1A 1VC2A 5F33A 2IS4A 2D4AA 3BD9A 4URXR 3CBQA 2GWHA 4HPXB 3X1ZA 2PGAA 2OR3A 4P34A 3WGHA 3FDJA 4RQBA 5KYYB 1G3QA 4OHFA 1P7VA 3DBRB 5CUQA 5HFJA 1FU8A 1R64A 1U8UA 4DZZA 2BR5A 5E3IA 2C5HA 1R2QA 4OXNA 4P22A 2QXUA 4WKOA 2IEDA 3DNMA 3DDHA 3HXMA 1NE7A 2GM9A 4HAVA 3IL2A 2QZ4A 3IILA 4XDZA 4YP6A 1GLGA 2J30A 1GSOA 1CUHA 4Q1BA 5MGBA 2PANA 4DIEA 2FP4B 5E1MA 1CJMA 2NU9B 2REQA 1ESCA 1RAFA 2M6SA 3IAM1 3IPAA 1EJ2A 1X15A 4B31A 3I62A 2VPXA 2Q7OE 2QAGC 1X7XB 1ZMOA 1JHYA 2NTVA 5H7XA 1TQ4A 4L9RA 5I8ZA 3V4FA 5BSRA 2M6KA 2FMXA 2AG6A 3LHDA 2C1XA 4RM3A 4WFKA 5KVVA 3TKYA 4CQLA 3EXAA 1SKQA 4LVNA 4IVRA 2ENWA 4LXHA 1DO8A 1KY5A 3KP1A 1QH1A 2B4RO 3Q8LA 2BUAA 4JGBA 4Z4IA 2WSMA 3AUTA 3MZ0A 3EVFA 3INNA 3HCFA 2FYTA 3L07A 3JRWA 1J99A 3L0IB 3UMVA 3ZV3A 5C9ZA 1B7GO 1P4AA 2XA1A 3SZRA 1AUXA 3ESXA 3VR3D 1HR0B <