1PBJA

Cbs domain protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
120
Chain Sequence
RVEDVMVTDVDTIDITASLEDVLRNYVENAKGSSVVVKEGVRVGIVTTWDVLEAIAEGDDLAEVKVWEVMERDLVTISPRATIKEAAEKMVKNVVWRLLVEEDDEIIGVISATDILRAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a hypothetical protein from M. thermautotrophicus reveals a novel fold and a pseudo 2-fold axis of symmetry
rcsb
molecule keywords hypothetical protein
molecule tags Structural genomics, unknown function
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 35
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 1pbjA00
4COOA 3LV9A 2EF7A 2RC3A 5K25C 5LXQA 2ZY9A 3TE5C 2YVXA 1O50A 3FHMA 3OI8A 1Y5HA 3KPCA 2PFIA 2D4ZA 4L0DA 4ESYA 3PC4A 3K2VA 3I8NA 4GQWA 4GQYA 2QH1A 2NYEA 4FRYA 3KXRA 3DDJA 2QREE 4NOCA 2YVZA 2UV5A 2P9MA 4IY0A 4UUUA 3OCOA 5MMZA 3LQNA 4IY3A 2OUXA 2UV7A 3GBYA 4P1OA 1YAVA 2QRDE 5K24C 3FWSA 3TDHC 2UV4A 3L31A 2QLVC 4FXSA 2YZIA 2EMQA 2QRCE 3T4NC 2RIFA 4ESYB 5K22B 2YVYA 3K6EA 4PCUA 3LFZA 5K23C 3SL7A 4HG0A 3KH5A 4IY4A 3OCMA 3FNAA 3LHHA 4IY2A 3PC2A 2NYCA 4L27A 2O16A 3L2BA 4GQVA 2UV6A 3HF7A 4P1GA 4IYSA 2OOYE 3FWRA 5IIPA 3KPBA 4O9KA 2OOXE 3ORGA 2QR1E 3FV6A 2RIHA 3KPDA 3PC3A 5KS7A 4DQWA 1XKFA 4L3VA 4L28A 1PBJA 2YZQA 1PVMA
chains in the Genus database with same CATH superfamily
4COOA 3LV9A 2EF7A 2RC3A 5K25C 5LXQA 2ZY9A 3TE5C 2YVXA 1O50A 3FHMA 3OI8A 1Y5HA 3KPCA 2PFIA 2D4ZA 4L0DA 4ESYA 3PC4A 3K2VA 3I8NA 4GQWA 4GQYA 2QH1A 2NYEA 4FRYA 3KXRA 3DDJA 2QREE 4NOCA 2YVZA 2UV5A 2P9MA 4IY0A 4UUUA 3OCOA 5MMZA 3LQNA 4IY3A 2OUXA 2UV7A 3GBYA 4P1OA 1YAVA 2QRDE 5K24C 3FWSA 3TDHC 2JA3A 2UV4A 3L31A 2QLVC 4FXSA 2YZIA 2EMQA 2QRCE 3T4NC 2RIFA 4ESYB 5K22B 2YVYA 3K6EA 4PCUA 3LFZA 5K23C 3SL7A 4HG0A 3KH5A 4IY4A 3OCMA 3FNAA 3LHHA 4IY2A 3PC2A 2NYCA 4L27A 2O16A 3L2BA 4GQVA 2UV6A 3HF7A 4P1GA 4IYSA 2OOYE 3FWRA 5IIPA 3KPBA 2J9LA 4O9KA 2OOXE 3ORGA 2QR1E 3FV6A 2RIHA 3KPDA 3PC3A 5KS7A 4DQWA 1XKFA 4L3VA 4L28A 1PBJA 2YZQA 1PVMA
chains in the Genus database with same CATH topology
4COOA 3LV9A 2EF7A 2RC3A 5K25C 5LXQA 2ZY9A 3TE5C 2YVXA 1O50A 3FHMA 3OI8A 1Y5HA 3KPCA 2PFIA 2D4ZA 4L0DA 4ESYA 3PC4A 3K2VA 3I8NA 4GQWA 4GQYA 2QH1A 2NYEA 4FRYA 3KXRA 3DDJA 2QREE 4NOCA 2YVZA 2UV5A 2P9MA 4IY0A 4UUUA 3OCOA 5MMZA 3LQNA 4IY3A 2OUXA 2UV7A 3GBYA 4P1OA 1YAVA 2QRDE 5K24C 3FWSA 3TDHC 2JA3A 2UV4A 3L31A 2QLVC 4FXSA 2YZIA 2EMQA 2QRCE 3T4NC 2RIFA 4ESYB 5K22B 2YVYA 3K6EA 4PCUA 3LFZA 5K23C 3SL7A 4HG0A 3KH5A 4IY4A 3OCMA 3FNAA 3LHHA 4IY2A 3PC2A 2NYCA 4L27A 2O16A 3L2BA 4GQVA 2UV6A 3HF7A 4P1GA 4IYSA 2OOYE 3FWRA 5IIPA 3KPBA 2J9LA 4O9KA 2OOXE 3ORGA 2QR1E 3FV6A 2RIHA 3KPDA 3PC3A 5KS7A 4DQWA 1XKFA 4L3VA 4L28A 1PBJA 2YZQA 1PVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COO A;  3LV9 A;  2EF7 A;  2RC3 A;  5K25 C;  5LXQ A;  2ZY9 A;  3TE5 C;  2YVX A;  1O50 A;  3FHM A;  3OI8 A;  1Y5H A;  3KPC A;  2PFI A;  2D4Z A;  4L0D A;  4ESY A;  3PC4 A;  3K2V A;  3I8N A;  4GQW A;  4GQY A;  2QH1 A;  2NYE A;  4FRY A;  3KXR A;  3DDJ A;  2QRE E;  4NOC A;  2YVZ A;  2UV5 A;  2P9M A;  4IY0 A;  4UUU A;  3OCO A;  5MMZ A;  3LQN A;  4IY3 A;  2OUX A;  2UV7 A;  3GBY A;  4P1O A;  1YAV A;  2QRD E;  5K24 C;  3FWS A;  3TDH C;  2UV4 A;  3L31 A;  2QLV C;  4FXS A;  2YZI A;  2EMQ A;  2QRC E;  3T4N C;  2RIF A;  4ESY B;  5K22 B;  2YVY A;  3K6E A;  4PCU A;  3LFZ A;  5K23 C;  3SL7 A;  4HG0 A;  3KH5 A;  4IY4 A;  3OCM A;  3FNA A;  3LHH A;  4IY2 A;  3PC2 A;  2NYC A;  4L27 A;  2O16 A;  3L2B A;  4GQV A;  2UV6 A;  3HF7 A;  4P1G A;  4IYS A;  2OOY E;  3FWR A;  5IIP A;  3KPB A;  4O9K A;  2OOX E;  3ORG A;  2QR1 E;  3FV6 A;  2RIH A;  3KPD A;  3PC3 A;  5KS7 A;  4DQW A;  1XKF A;  4L3V A;  4L28 A;  1PBJ A;  2YZQ A;  1PVM A; 
#chains in the Genus database with same CATH topology
 4COO A;  3LV9 A;  2EF7 A;  2RC3 A;  5K25 C;  5LXQ A;  2ZY9 A;  3TE5 C;  2YVX A;  1O50 A;  3FHM A;  3OI8 A;  1Y5H A;  3KPC A;  2PFI A;  2D4Z A;  4L0D A;  4ESY A;  3PC4 A;  3K2V A;  3I8N A;  4GQW A;  4GQY A;  2QH1 A;  2NYE A;  4FRY A;  3KXR A;  3DDJ A;  2QRE E;  4NOC A;  2YVZ A;  2UV5 A;  2P9M A;  4IY0 A;  4UUU A;  3OCO A;  5MMZ A;  3LQN A;  4IY3 A;  2OUX A;  2UV7 A;  3GBY A;  4P1O A;  1YAV A;  2QRD E;  5K24 C;  3FWS A;  3TDH C;  2JA3 A;  2UV4 A;  3L31 A;  2QLV C;  4FXS A;  2YZI A;  2EMQ A;  2QRC E;  3T4N C;  2RIF A;  4ESY B;  5K22 B;  2YVY A;  3K6E A;  4PCU A;  3LFZ A;  5K23 C;  3SL7 A;  4HG0 A;  3KH5 A;  4IY4 A;  3OCM A;  3FNA A;  3LHH A;  4IY2 A;  3PC2 A;  2NYC A;  4L27 A;  2O16 A;  3L2B A;  4GQV A;  2UV6 A;  3HF7 A;  4P1G A;  4IYS A;  2OOY E;  3FWR A;  5IIP A;  3KPB A;  2J9L A;  4O9K A;  2OOX E;  3ORG A;  2QR1 E;  3FV6 A;  2RIH A;  3KPD A;  3PC3 A;  5KS7 A;  4DQW A;  1XKF A;  4L3V A;  4L28 A;  1PBJ A;  2YZQ A;  1PVM A; 
#chains in the Genus database with same CATH homology
 4COO A;  3LV9 A;  2EF7 A;  2RC3 A;  5K25 C;  5LXQ A;  2ZY9 A;  3TE5 C;  2YVX A;  1O50 A;  3FHM A;  3OI8 A;  1Y5H A;  3KPC A;  2PFI A;  2D4Z A;  4L0D A;  4ESY A;  3PC4 A;  3K2V A;  3I8N A;  4GQW A;  4GQY A;  2QH1 A;  2NYE A;  4FRY A;  3KXR A;  3DDJ A;  2QRE E;  4NOC A;  2YVZ A;  2UV5 A;  2P9M A;  4IY0 A;  4UUU A;  3OCO A;  5MMZ A;  3LQN A;  4IY3 A;  2OUX A;  2UV7 A;  3GBY A;  4P1O A;  1YAV A;  2QRD E;  5K24 C;  3FWS A;  3TDH C;  2JA3 A;  2UV4 A;  3L31 A;  2QLV C;  4FXS A;  2YZI A;  2EMQ A;  2QRC E;  3T4N C;  2RIF A;  4ESY B;  5K22 B;  2YVY A;  3K6E A;  4PCU A;  3LFZ A;  5K23 C;  3SL7 A;  4HG0 A;  3KH5 A;  4IY4 A;  3OCM A;  3FNA A;  3LHH A;  4IY2 A;  3PC2 A;  2NYC A;  4L27 A;  2O16 A;  3L2B A;  4GQV A;  2UV6 A;  3HF7 A;  4P1G A;  4IYS A;  2OOY E;  3FWR A;  5IIP A;  3KPB A;  2J9L A;  4O9K A;  2OOX E;  3ORG A;  2QR1 E;  3FV6 A;  2RIH A;  3KPD A;  3PC3 A;  5KS7 A;  4DQW A;  1XKF A;  4L3V A;  4L28 A;  1PBJ A;  2YZQ A;  1PVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...