1PBYC

Structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
79
structure length
78
Chain Sequence
MNALVGCTTSFDPGWEVDAFGAVSNLCQPMEADLYGCADPCWPAQVADTLNTYPNWSAGADDVMQDWRKLQSVFPETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from Paracoccus denitrificans at 1.7 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
molecule keywords quinohemoprotein amine dehydrogenase 60 kDa subunit
total genus 11
structure length 78
sequence length 79
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08992 QH-AmDH_gamma Quinohemoprotein amine dehydrogenase, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.940.10 Few Secondary Structures Irregular Quinohemoprotein amine dehydrogenase Quinohemoprotein amine dehydrogenase, gamma subunit structural domain 1pbyC00
1JJUC 1PBYC 1JMZG 1JMXG
chains in the Genus database with same CATH superfamily
1JJUC 1PBYC 1JMZG 1JMXG
chains in the Genus database with same CATH topology
1JJUC 1PBYC 1JMZG 1JMXG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJU C;  1PBY C;  1JMZ G;  1JMX G; 
#chains in the Genus database with same CATH topology
 1JJU C;  1PBY C;  1JMZ G;  1JMX G; 
#chains in the Genus database with same CATH homology
 1JJU C;  1PBY C;  1JMZ G;  1JMX G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...