1PCSA

The 2.15 a crystal structure of a triple mutant plastocyanin from the cyanobacterium synechocystis sp. pcc 6803
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFDADGVPADTAAKLSHKGLLFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.15 A crystal structure of a triple mutant plastocyanin from the cyanobacterium Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pcsA00
1BYPA 1GYCA 4P5RA 2YARA 5EHFA 2XV3A 3NSYA 1BQ5A 4E9YA 2XV0A 4E9XA 2H47C 2HLEB 1HAWA 1BEXA 3WIAA 3ABLB 4WKXA 3JT2A 2FJSA 1E67A 2E86A 1FWXA 3NT0A 2GIMA 3FQ2A 2XX0A 3ZX1A 3OM3B 1NIDA 4GP4B 4UF7C 4PAZA 1HFUA 1CYXA 2XXFA 3CDZB 1AZNA 5D4IA 2XVBA 1SDDA 3X1NA 4KO6A 4DPAX 4Q8BA 2QDWA 2BP0B 2UX7A 5FC9A 1GSKA 3AZUA 1L9OA 2HX9A 1NIFA 4JKNA 3WI9A 5I5IA 1TKWA 1IBZA 2HRHA 4M4RB 1MG2C 1ID2A 1WA1X 3N2JA 2I7OA 3UAAA 3L45A 4A2DA 2PLTA 4G72B 1GR7A 4KO7A 3T6XA 1GY2A 3H4HA 1X9UA 3X1FA 4YSSA 3X1GA 1GS8A 4AX3A 1PY0A 2BW5A 6PCYA 1GS7A 4W1TA 1VLXA 1A3ZA 3FQYA 4BXVA 4G7RB 3QJVB 2XXGA 1KCBA 3FYEB 2YXWA 1SFDA 2CCWA 5I6PA 3HEIB 1JERA 1PZAA 2IDFA 2J57A 1L9TA 4DPCX 2R7EA 1V54B 2OCCB 2VW6A 1AOZA 2CJ3A 3CZUB 4DP9X 3FT0A 1J9TA 2MRYA 3BQVA 1E65A 4HZ1A 2BWDA 4E9VA 1BQKA 2IWFA 5B7FA 1AACA 4KO5A 1RZPA 2HZHA 2BP8A 5I6OA 3GYRA 4A68A 2B3IA 2YAOA 5I28A 1MZYA 3ABGA 2ZWNA 2CUAA 4HCFA 1OE1A 1PAZA 1IKOP 4GP8B 3OMAB 2AANA 1BXAA 3QJUB 4GY4A 1A8ZA 3NJNA 8PAZA 3FS9A 3TBBA 1ADWA 2UXGA 1PZBA 9PCYA 2BZCA 4HCGA 2FTAA 4FA7B 1J9QA 2IAAC 3NJIA 1YLBB 4HAKA 4RH4A 1GW0A 3H56A 3WNJA 3S3CB 3FU7B 4E9TA 3FU9A 1JZGA 2UXTA 5B1KA 2XUWA 1QHQA 4ZK8A 4G70B 1N70A 4Q89A 4KNUA 2GC7C 2XX1A 5ANHA 3T6VA 2FQGA 2BO0A 2BP0A 3NJFA 3NSFA 3NYKA 1BYOA 1HAUA 3PPSA 4HHWA 2W8CA 4E9SA 2HRGA 2NRDA 2PPEA 2EINB 2BZ7A 4TXVB 5B1AB 1BAWA 1V10A 2JFCA 3MBWB 3WG7B 4AKQA 1NDTA 4YL4A 3UACA 1PLBA 3UABA 1AS6A 1SJMA 2YQBA 4G71B 1NZRA 4HALA 4FAAB 3CVBA 2RACA 2TSAA 2DWSA 2I85A 2Q5BA 2GSMB 2PP8A 1EZLA 2BP8B 4KO9A 4YSDA 1GY1A 4BK5C 3PXLA 2AFNA 3CVDA 4YVNA 3NJKA 2FNWA 1ZDSA 3AG4B 1OE2A 5D4JA 1ZPUA 3PLYA 3S3BB 2ZXWB 1JZFA 1L9PA 4A2HA 4JHUA 3FU8A 1JVLA 1AANA 1OF0A 1W8EA 4NERA 2VSMB 4JHVA 4BXSV 1R1CA 4CSZA 3MX0B 2GC4C 4GP5B 4YVUA 4HCIA 3S3DB 1OOWA 3T6WA 1X9RA 1KBVA 4KOCA 4DP6X 1AG0A 1FFTB 1SF3A 4DP1X 4QLWA 4DP8X 3OMNB 5F7AA 2YAQA 2QPEB 4AI7A 3D12B 1WS7A 3IE9A 1CURA 3NP4A 5I5JA 2Y69B 1PLAA 3TASA 3HB3B 4X4KA 1AIZA 1ASPA 4DP4X 2VSKB 1EHKB 1RZQA 2X87A 3FPXA 1MZZA 3U25A 1SNRA 4MFHA 1I53A 1JVOA 2UXVA 5B1JC 7PCYA 3CDZA 5D4HA 2EILB 1M9WA 4KOBA 2IDSA 7PAZA 3G5WA 4A66A 2JXMA 4YSRA 1KDJA 1AZCA 2QPDB 3BVDB 2P80D 1NIEA 3AG1B 3QQXA 1KBWA 3EH3B 4AKPA 2XLLA 3ASOB 2FQFA 6PAZA 3AG3B 1OE3A 2IWEA 3WNIA 1ZDQA 1J5DA 1NPJA 2BWIA 2FQEA 3ERXA 1JZJA 2FT8A 3NJLA 1SHXA 2H5UA 2VM4A 2DV6A 3TU6A 1ASQA 5PAZA 3C75A 5B1BB 3T9WA 3X1EA 2XWZA 4BDVB 1WS8A 2PCYA 4BWUA 3OQRA 2IDTA 2OJ1A 1NIAA 3TA4D 2PPFA 1AZRA 2WO3B 1IUZA 4YSOA 1AZUA 1UATA 1L9QA 1L9RA 3ASNB 2VM3A 1A4AA 4BWWA 2MTAA 3X1BA 2HXAA 2FT6A 5B3SB 2UXFA 3V9EA 5I6LA 1SF5A 2DWTA 5AKRA 1CYWA 5F7BA 1OCOB 3PAVA 1ASOA 1XB8A 1KV7A 1L9SA 5I5MA 3FU7A 3NSDA 2PPCA 1B3IA 1KCWA 1WAEA 3AW5A 3KW8A 1PZCA 1SDDB 1NTDA 4N8UA 2FT7A 1WA0X 3IN0A 3RYMA 1ILSA 1V55B 1AAJA 2IH9A 1WA2X 2EIKB 2HX8A 3WKQA 1IBYA 3FSVA 1MDAA 1M56B 4KNSA 5I26A 2IDUA 3TBCA 1SHWA 4W9ZA 1NINA 1J9RA 2HX7A 2EIMB 1F56A 1AZBA 1PLCA 4ENZA 3SBQA 1AS7A 4E9RA 1NICA 2YXVA 2XU9A 3DIVA 1ETJA 1JZIA 4DP0X 4F7KA 3IN2A 1J9SA 2TSBA 3FQ1A 4YSUA 2PPDA 2AVFA 4K9JA 1OCCB 3ZBMA 5B7EA 3CVCA 1ET7A 4A2GA 3QJRB 3FSWA 1ET5A 1SFHA 1PNCA 1XB3A 3WKPA 3AG2B 4F2FA 1AQ8A 2AZUA 1JXDA 1RCYA 1TEFA 3JTBA 3S8GB 1W6WA 4NAJA 2Q9OA 4G7QB 4DP7X 4DPBX 2FWLB 2FQDA 1NPNA 1A4CA 1ZIBA 1W6LA 2PCFA 2J5WA 1ZV2A 3NSCA 4E9QA 3SBRA 1ZIAA 2I7SA 3EH4B 2J56A 3AY2A 2AZAA 1PMYA 2BHFA 4M3HA 3GXUB 4BWTA 1JXGA 2CALA 4E9WA 2X88A 1OCZB 2ZOOA 3EHBB 4A2FA 2OV0A 4NB7A 5PCYA 3N55A 3KW7A 3S8FB 3T6ZA 2YAMA 4YSPA 5A7EA 2WO2B 5TK4A 3PCYA 2VN3A 1OCRB 4CSPA 3UGEA 3SQRA 4P5SA 2YAFA 1QNIA 3DKHA 1AR1B 1KGYE 2CAKA 4AZUA 2Y1AA 3NP3A 3FSAA 2PPAA 2YAPA 4YSEA 1JZEA 1JZHA 4KNTA 1PF3A 4WTQA 1QLEB 5I6NA 4AKOA 5LDUA 3QPKA 2PP9A 4QKTA 4BDVA 4YSQA 2R7EB 3H4FA 4DP5X 2GHZA 1NIBA 1NWPA 2GBAA 2PP7A 1E5ZA 1J5CA 1A65A 3QJQB 2YAHA 1ILUA 2DYSB 1BQRA 2GB2A 4A2EA 2WSDA 2BW4A 1OV8A 2GI0A 2DYRB 3ZDWA 1JOIA 1MG3C 3NJGA 3X2QB 4N4YB 3V9CA 4EF3A 3UAEA 3FPYA 3FSZA 1NWOA 2VMJA 1TU2A 1M57B 5TK2A 4GXFA 2QDVA 4UAHA 3QJSB 1FA4A 2XV2A 2XYBA 1BXUA 4YSTA 1XMEB 2EIJB 3IEAA 2QT6A 1BXVA 3QJTB 1KYAA 1E30A 5AZUA 3T71A 3CG8A 1T5KA 2VW4A 1E5YA 4YSAA 1A4BA 1TEGA 5IY5B 1CUOA 1ET8A 2IDQA 3ZIYA 1AG6A 2J55A 3ABKB 1GS6X 4HIPA 3EH5B 3EF4A 1KDIA 1DZ0A 5B1JA 3OMIB 1XB6A 2DY2A 5B7MA 1N68A 2N0MA 3GDCA 4GYBA 3DTUB 3PAUA 3ABMB 1DYZA 2YAEA 5E9NA 4YSCA 5I6MA 3UADA 3FYIB 1PCSA 2ZONA 3NJHA 3NJJA 3NJMA 4A67A 5AFAA 4PCYA 2IWKA 4HHGA 4DP2X 1RKRA 2LLNA 3OD3A 1PNDA 2W88A 2VW7A 2CBPA 2B08A 4UANA 2UX6A 1AS8A 4L0PB 2A3TA 3IBOA 4F2EA 2JKWA 5I6KA 1CC3A 4G7SB 1JXFA 2P80A 3PAZA 3SBPA 1IC0A 2IH8A 2H3XC 1URIA
chains in the Genus database with same CATH superfamily
2DOCA 1BYPA 2PW2A 1HC1A 2FHCA 3BGMA 4KAQH 4N85A 4XO3A 5C0BE 5SV4A 3VG9C 4U3CA 4M1DL 4R4BB 4FG4A 2W9EL 3P02A 2ZCHH 3QDGA 1U8JB 4ZAKA 4CN1A 3ABLB 4M6NL 4MCNA 3B9AA 2IQ9L 5B8CA 5I23A 3N9GL 1IU1A 5E51A 4ZS7L 2DLFH 5JYMA 4B60A 2EXYD 1BZ7A 4YC2B 3D8MA 1LLAA 4XMUA 1DQVA 1TZHA 1NAKH 3HS9A 3U4KA 3UG5A 4PVMA 1RZKC 2MOQA 4YPJA 4N8VA 3FCTB 1I1AD 4MJIA 3S96A 5C7XL 1A3RL 1CDYA 3ZZLA 2XN9B 4IHOA 3EOAB 4YE0A 3HE7B 4R2GC 5JDSB 1MFNA 4D0DB 3L13A 5SWSB 1Q0EA 2KQMA 4TOYL 1RV6X 3QI9B 5TJWK 4A7QA 5C92A 1FZJA 1JZ6A 1WBYB 3EBHA 1LMIA 3HFML 1K5NA 1S7WA 1YY9C 2EEAA 5KSAC 1F4XL 1JJUA 4OLVL 1E4WH 1PYWA 2VOTA 1IEAA 4OLUH 4FQQA 1A3ZA 4JPKH 2XZAL 3CFQA 5DRXA 3HBZA 1RUQH 3U6RB 1YMMB 1VESA 3RU8H 3R4RA 5I73C 2LV4A 2C5DC 3G5ZB 3NACL 4WUUB 1OGTB 1TNMA 2IDFA 3OB8A 4TUJB 1L9TA 4GKZA 4WNJA 4MJ6B 5EIIA 3G9VA 2EXWD 3TPKA 2CJ3A 2XVGA 2Y5TB 1EEQA 1VADA 4XNQA 4C56D 2JELL 4HT1L 4NHUA 3ZOAA 2IWFA 2DAVA 3NIDF 4GNKB 3CFCL 1RK0A 2ZXAA 4FHBD 2DQCH 3T0ED 1BOYA 1IGJA 3PABB 3SDXF 1CE6B 3HS0A 1UJ3C 5I1CH 5I28A 4H88L 1AC0A 3PGFL 4MAYD 5HHME 4KVNL 1PLGL 3LS5H 1ODUA 3QWOB 4A2MA 1PZ3A 3STLB 2HJKA 2HPTA 4YXKH 4F33B 1IGCL 4WI7A 4Y4FD 4LVOC 4JFEE 5CP7B 4BKSC 2OXHB 4JDTL 2BZCA 1VGEL 2QPFA 4XVSL 1OPGH 2JWYA 2FTAA 2L04A 3O3UN 5C3TA 1PW3A 2BOCB 3FHAA 1IBGL 3R1GH 4KBPA 5HHVH 3NIGF 2NYZA 2XJKA 4CKVX 3S3CB 1E2WA 3BGAA 5CZVH 3FU9A 2MQ0A 2ZSVA 4JM4H 1HIML 4ZRGA 4J28A 5F70A 1OP5K 4ZK8A 3D0AA 1E40A 3MV8B 2GC7C 3QUYB 3S2CA 4CVUA 4OV6F 3FUIA 4GUCA 1ETB1 5D7LE 4MZ3A 2CR0A 2EO9A 2VC2L 5JTWA 5AW4B 4QRRE 3QNXB 4N8CH 1ED3A 3LH9A 3NCYP 2XACC 1JFQH 5DUML 5AFAA 1CLZL 2UY7A 3QAZB 4JFQA 2IXQB 4JVUA 1VACB 1OARL 2CSPA 2R2HA 3BAJA 4GO8A 4FZEH 3B2VH 4QWWD 3WENA 3RA7H 5KYUA 1V3KA 1E5CA 1HEJC 2IPUG 1Y0LB 3Q2LA 5ESQB 3U0PB 2ICEB 1AKJA 1DVFC 3FO1B 3G6JE 3QIBA 4KXDA 4PM1A 2BSSA 4ZO6A 1YEJL 5TF1L 4TLSA 4JFEA 1KYUA 4G8EB 1INQB 1T83A 4X98A 3V4VB 4HIIA 2QADC 4A6YL 1DBMH 2FX9L 3S8WA 1KN4L 1F4WL 2JB5H 25C8L 4CC4A 3ZYZA 2VUKA 4ONOA 3O6ML 1IEHA 2WVVB 3I2CL 3T6WA 5D70H 4MMXB 4TVPL 5DVKA 1IZKA 4FLQA 4FQXD 1QPXA 3RDTC 3T0WA 4AQ1A 3FTUA 5GXBB 4L0ZA 1SF3A 3VXMB 4DP1X 3D4GA 5ESAA 5FM8A 4PUBL 5JYLA 1I82A 3I6SA 3C87A 2HTLD 4OM1L 5DCCA 1J0JA 3DOHA 3L7EA 1FH5H 2ZCLH 3TYFB 2NYKA 3FC8A 2C34A 2CGYA 3TASA 4WEUD 5GRJH 2O5NA 2B59A 2Y4SA 2UY6B 4DGYH 2YHGA 2YPKB 2BVPA 4ZPVB 5C0BD 1SNRA 3U1SL 2G9HB 3LEYH 2I9LA 1U92A 3K1DA 3TBYA 3CSGA 5AOKA 1HHHA 4TSCL 3A4EA 1NGZB 1AOHA 2NT0A 3VFUB 4ES8A 4M1CD 3D6GA 3HNSL 4LHUD 3PJLA 1FG2A 3GMNB 5DK2A 3HNVL 5AYUL 4L5FL 4OM0L 2B9AA 1RQ5A 2CHDA 1XIWC 2QFPA 3DO7A 4FG2A 5SWZD 2H0FA 5DI8A 1XDTT 1MW0A 3GD1C 2IWEA 4PJ5E 2YD2A 4JDVA 3G5VA 2K7PA 1J5DA 3ARXA 3CWGA 1RZGA 1TUPA 2K1MA 5GGUB 4ODSL 1JZ2A 1THAA 1EZUA 2Y1VA 4XOCA 2YD8A 3NIFF 1RUKL 5LGKA 2XN9D 4JLRA 4DHLA 1B6DA 4JRWA 3FQWA 1H8NA 4LQFL 4PJCF 3UPRA 5LHDA 2PCYA 4HKBB 4WEBL 1WCBA 5HGBB 4PGEA 3WE1A 3GKZA 4EN3D 1DEDA 3QXUA 4NQEA 1FNHA 4G6FB 1P7QA 4D9LL 3P77B 1C08B 2L7EA 4K94H 4AXWA 5G4MA 4MA8H 4NZUL 2BNRD 1PVHA 4OIBA 3KPOA 4IM8A 1OCOB 4B5ZA 4NDMB 5I5MA 4U6HA 1M7IA 3GMMA 3C2SA 4PJBF 5DURB 3IWVA 4F7MB 5T5FH 4PY8J 3OL2A 2VDOH 1OANA 5DMGC 5A2KH 2JCWA 2IANA 4WW1A 2IH9A 2EIKB 3HZYA 2OI9B 3MLRL 1YPZA 3H2WA 2A6DA 1DJIA 4XC3L 5I26A 3BVXA 3SKNA 5EUOE 4C56B 1ED3B 5F6IB 2J21A 4MB4A 3DSNB 1A7PL 1U33A 5FGRA 3L9RB 4K3DH 3T0EB 1P7KA 2AQPA 5CLYA 5IT2H 4KITB 2LU5A 4GRWE 2VR5A 3ILDA 1ZK9A 1GZQA 5CR8A 4EXKA 5C6PB 5IEKB 1BMWA 1OB1B 5HHMB 1L7TL 2OCJA 2X0WA 1U42A 3LEVL 2CG9X 2OR9L 2KLRA 2ZXQA 3IN2A 1J9SA 2TSBA 5KANG 1XH2A 3UPAA 2F8OA 4GRMA 3TOPA 3FFOA 4BKLB 4J3OG 3BOVA 2K4WA 3RILA 5DYOB 3L5XL 4A2GA 5JW5B 1LMKA 2DWDA 4WVRA 1QWHA 1CQKA 3I50L 1BM3H 4BH7B 1CT8B 2VZTA 2APTA 2DD8H 4ONHB 3HE6C 4FQHA 1HOCB 3HN8A 1AQKL 4KK6C 1P1ZB 4JHWH 4PGDA 2LW3A 5HHOB 1I8KA 1X5AA 4WU5B 2M8XA 5C09E 1YY9D 3MCG1 4U1JA 3FQTB 1LO5B 5KSAD 3RWHA 3PDDA 1F4HA 1WTLA 1ZLWH 4JVWA 4NC2B 1FE8L 1A1MB 4PJEF 1N5YH 4RIRA 1NEZG 5E8OA 2A77H 5ENWA 2R2HB 4BEIA 5T3ZL 4TYUA 4OLZL 2B5IC 5E8EA 5GRWA 3MCLL 2GJ6A 3AXIA 5F1NB 2AABH 3CFNA 3J7HA 2DQJH 3WIIH 2Y3NA 4KMQA 5JQ6L 2XVLA 5FDWA 3N55A 5IQ9A 4LE8A 3QQ4A 3EDDA 3L3HB 2Q7AA 1MVYA 3QO1B 5F7LB 3CFEB 3CSYA 4GRLA 1OCWL 2ZUQC 1GOGA 3S37X 1RFDH 5DI8B 2YAFA 1UURA 5E99L 3TCXA 3RA7L 4J3OF 1U6AH 3GRWH 3DKHA 4KHTL 1MSPA 4I5BB 4OZIA 4JQVC 1K8DB 1CD1B 4FQXB 4YZFF 2XNAB 1TF4A 3NP3A 3SYAA 2FJGB 2YC1B 1LGVA 2E46A 1FO0H 1AP2A 4K4KA 1YEIH 3ZDYE 2V2WA 1KTKE 4H0HB 2HMIC 3ZUNC 4PG9A 4UM9D 4OZ4B 4MNQB 1PF3A 3NFNB 2JTDA 5I6NA 4NQXB 4ZPTB 4AVIA 1MHHB 1TQBC 4HU2A 5D7LD 2WLJA 5KYWB 4FNLL 1HS6A 1LK2B 3V0AC 5F9WB 1EVUA 4HWZA 1HWGB 1WF5A 3FB6B 1AMXA 2PP7A 4PJ9B 3TEUA 4Z95H 5C0BB 4WHYH 2DQJL 4Q4IA 1N8ZA 3BFOA 2RR3A 1AD0B 5DQJA 1T1YB 2BW4A 4AM0A 4ANUA 4PJHB 1IV8A 1A5FH 5HGHB 1KLFB 1W80A 2GJPA 3LKSA 1GSMA 3BAWA 2ERJC 2ZKMX 3BW9B 4NOFA 5AW7B 1NWOA 1MRDH 1N8OE 3DIFA 1CR9L 1FRGH 3PHOB 4LLVB 4G8GB 1FA4A 2BY1A 5FS5A 3UXFA 5DS8A 1GGIH 3GBDA 4OM0H 3EOTL 3GK8L 3HG0A 4L3AA 1NM4A 1IM9A 3WTXA 1E5YA 2Z4TA 3RLSA 2JB6A 1H0DA 1B4RA 3QQDA 2J88H 2QVMA 3CDCA 3CUPB 5CD3A 2OK0L 5E1AA 1KIPA 2I69A 4W9CC 2QSQA 4KZDH 5F9OL 2E0PA 1W72H 3BUBA 1PKQB 2XXCB 1Y1DA 4HIPA 1DVQA 5B1JA 1F6AA 4JDEA 1YYMH 1O6SA 2QL1A 2YFNA 2P5WA 1A0QH 2APSA 2BC4A 2OSYA 4I9WE 4YHZH 5D2LF 1ZVSB 5I76A 3UBHA 2AAVA 3I02A 5LGJA 2O30A 2HT3D 3FYIB 4PSPA 4WUKL 1TVBB 3NJHA 4MXQD 1MDTA 3B43A 1T2QL 1JWUA 1S7UA 1FIEA 1HZLA 4PV8B 4AZ8A 1F4YL 3JV6A 3H9HA 4K8RL 2WWNA 2F19H 2XQBH 1W8OA 1FC1A 1ZRUA 3B3BA 3KL5A 4PJDE 4RWYL 3CAFA 1NL0H 3CFIC 3UGXA 4JLRB 5C1MB 4R83A 3SDCA 1WUNT 2UYLB 3SIKA 4ZXBA 5FWRA 4YFLF 3DI2B 1W0VA 3DJTA 2IH8A 1DQDL 3Q8FA 3RAJH 5B3JE 4NC0B 3NSYA 3U0TB 2A4EA 3PWVA 2EVHA 1PQZB 4LFHG 3W37A 1UD3A 3II3A 4LSTL 4NKDB 3ETSA 3PWNB 4X8JB 5KSBE 1NBQA 3S5LB 2IFFL 5IQ7H 4X9FA 3QO0A 3FO9B 3TZVD 2NX5E 3T04D 3U30B 5JA8B 2BPBA 2V9UA 1JYVA 4L4VA 2XRAL 5HHMD 3NJVA 1KENH 4N3TA 1UKSA 3PL6D 5KYNA 1O75A 3MRJA 3VXME 2MNJB 3VFNB 15C8H 4E68A 1KIRA 3FRPA 2EJ1A 1KYFA 5B3JF 3HPJA 4BYHA 3AT0A 1WC7A 2C4FU 3P0YL 4K3DL 4ZW3A 1WVZA 4ZUWA 2X09A 4H40A 4PW3A 2FWOA 1GMEA 1B4JL 1IKFH 2AK1H 4K3EH 5I8EB 4BSVB 3N2JA 3V0IA 2MTPA 4LARL 2EIDA 5I1IH 1Y1UA 4XP5H 3QZOA 5DJXB 5J6GA 4JK0D 1K8DA 2QHLA 2CR3A 2WLHA 4KO7A 5EU6B 4OSUL 4U7SA 4GT7A 4YHNA 3ETTA 4QXVA 3N42F 1X9UA 4Z7UF 4L3EA 4OZGA 3JWDH 4X50A 5CKGA 3CXFA 3L3DA 1IZJA 1RD6A 1G0YR 3QFDA 2JIXB 2AV7B 4RISL 3QJVB 3VD7A 5CJ5A 1TCRB 4P46B 1L0PA 1UM5H 4PCTA 2DYPB 5HTSA 4XVJH 3GBMH 5DJ8A 3T3PE 3UAFA 3JSSA 4XMKL 1FSKC 2FBRA 1CDCA 3IDUA 1CI5A 1K5NB 3A22A 1S7WB 3LEVH 5JOEA 2VW6A 1P69B 3A6CH 2E7BA 2XJLA 3NCYS 4WFHE 3VTTA 2JKNA 2WUBL 3WNKA 1CDHA 2DWDB 3FT0A 2Q86A 1CD8A 4AYGA 5MERB 1WAAE 1HSAB 4HV8A 1U8CB 4MSWA 3X17A 5AG8A 5I15H 4OCRL 5I1KL 4X8GA 2WMPA 2BNUB 2HFTA 2J8UB 3GYRA 4KTDH 4YC2C 4A68A 2K6YA 1KXQA 4B0MM 4Z5RB 4OLUL 3IMVA 4ZS6C 3DJSA 5C0FB 3L5HA 1OTTD 2YD1A 4BCZA 2EVGA 2HH0H 4OLEA 4Y9GA 1YSOA 4KKRA 2E8YA 4TQEH 3SPCA 1A8ZA 4NP4L 4YL9A 3TYGL 1R5VB 2AP2A 2XN1A 3EGDB 4FRWA 4JQIA 3EYVA 4JG1L 3VYPA 4A7UA 4PG9B 2Y6SC 4HCGA 2DTML 2PR4L 4MNQD 2FLMA 4MS6A 3W39A 2XZCL 1YLBB 4JANA 1F42A 1GW0A 2X41A 3NGBC 4TNWF 3QVAA 3FU7B 4HMEA 1DJYA 4JDEB 2DICA 4NAQA 2CU9A 2Z31C 1TQWA 1C7TA 4OV5B 1ZJAA 1BPVA 5DD0H 1LEIB 3QNZB 4W4OA 4BA0A 1KLUB 3RQ3A 3VXSE 1CXHA 3KPSD 4N9GA 5EPMB 2Y36H 1J8HE 2ICWB 2GITA 5TDNA 1NCAL 1S5IL 4HH9A 4L4TB 4B3EA 1GIGL 1JGDB 4LNRA 1VFAB 1JL8A 2DQMA 1MXGA 2VDML 4L1TA 2A6KA 2Y22A 5E4AA 4F20A 5IB1B 4GG6E 2K3HA 3C6LB 3MR9B 2YOCA 4ATWA 1ETZB 2WIIB 3MLSH 4FYTA 1ZTMA 3BRDA 4N1HB 1JPSL 4RMBA 5DUJA 3FQRA 1LP9A 1TZIB 3BDYH 3SPVB 1KTLA 4O9HH 4YHLL 3CNKA 5DJZB 4TUUA 3BSHA 4DKTA 3IRPX 3IU4L 4G9DA 4TNVF 3ZSSA 3EHBD 1AGDB 1S8DA 1S7SB 4IOIB 3QH3B 3OR7A 3V5KB 3W5MA 1AANA 5K9JL 3P11H 1HXKA 4FG0A 2KDYA 1E90A 4WWKC 2D2OA 4WI8A 1P4UA 1XIWD 3NZSA 5DSCB 1Z9NA 4ISVA 3V0GA 4YXHH 2CKBH 2VR3A 5FPIA 4PRHB 4JY5L 4IOSA 4D0BA 2OP4H 5C0DA 3OHXB 2NY5C 4DGWC 1CZ8L 1OTSC 3GSNA 1OZTG 2VJ8A 5I5JA 4P3CL 4GQQA 4CKQA 3WAKA 4JFXA 3VI4F 2J44A 2K8QA 3ULVH 4DTGH 2OXGB 2ZUTA 5C71A 1GTFA 5I30H 1R0AH 4GB9A 4JM2B 4RNRB 3B6SB 4MFHA 4AC4A 1DVUA 2CD0A 3KWWA 4J27A 4O58L 3PWJA 3ECQA 7PCYA 3W56A 5DFAA 2ZQKA 2B4CC 4P46A 4DKAA 3CHOA 1GGBH 3U4BH 1FAIH 1FL6B 1OQXA 2NCMA 5IMMB 5AW6B 2NY1C 1MREL 4LEXL 5E1IA 4UTCA 2I9LB 2AS5M 4GKSA 4Z0BL 3O4LE 3UEZA 2BWQA 1MHPH 4WU7B 3Q7JA 1ERNA 4C59B 4HLZH 3D08A 4K8RH 3OLEA 3RPIB 1QFUL 1JMXA 3BP6A 2Y2WA 4FNSA 3CVIH 1AO7E 1AXSB 1DBAL 3HR6A 4DH2A 4UQ3A 3W9EB 3V4UH 4TQPA 1MHEB 3FTGA 5JPNB 4UUJA 3IDGB 1A2YB 4YHML 1GYVA 1SUJA 1SN2A 5TDPB 4W93A 4XBPA 4ELME 2WW8A 1IAIL 3COOA 3C2AH 5INCA 2XWRA 2VM3A 4Q0XL 1EHNA 4HU8A 1DSYA 1INDH 4RFEB 4DK3A 2JIXD 5F7BA 2VUOA 4PRPA 5AVRB 2V8MA 2RHEA 1RUQL 3VDAA 3TBWB 3FU7A 1HHIA 2BFVH 2P8MA 3AW5A 1COBA 2OYMA 4W9KC 2X10A 3BUTA 3MJ7B 1BVLB 1YHPA 3WN6A 3IGFA 3N43B 5C0JB 4AITA 4F27A 2QKSA 4PJHF 3FB5B 1NAMA 3DUUB 4XMXA 2DBLL 4KK5C 3LZRA 2PTTA 3MUGB 5DD3H 1UH4A 3BUYA 1PZ5A 2B1AL 1ZA3A 1J5HA 3P3TA 3CV5A 4PJXA 3ZKND 1X4XA 3HUJB 4WW1B 4ENZA 5T3XE 1OY3B 3G6DH 3SBQA 3SPVA 2ITCA 2Y9RT 3QR2A 1QABA 3RWGA 1JZIA 2Z65C 4J8RA 3QUYA 5FK9A 3BGMB 3N06B 5F96H 4Z3IA 4JPSA 4NENB 3GSXA 5J1AB 1KCVL 4ZO8A 3MNDA 1OCCB 5GGVY 5B7EA 5BQ7B 1NUNB 2N1TE 2BERA 5ADPL 3FAXA 4XXDA 3K2IA 4HOXA 1BM7A 3ZE1E 5HYSG 2ESVD 3IDJB 1R4XA 3A4DA 3C5ZB 4Y1AD 1ROWA 3L1FA 5IFHH 3QXDA 2VZVA 1AQ8A 1FL5B 2DLEA 3JTBA 4RGOH 2XWEA 4UTAA 5F7UA 5CD5D 3NIGE 1S3RA 4M29A 3U82B 3L5IA 3O4LA 2F7PA 4FFVC 4L4TA 2HMID 3QNYA 3LQZA 4M56A 4MD0A 2F5BH 1A4CA 1HHGB 4JCWA 1ZIBA 1E3ZA 1PTZA 3EGDA 2CRMA 4ACPA 4DGIL 1CT8A 1Z3GL 1I9JH 1CWVA 3E6FA 4P4RA 3BSZL 2I7SA 1ZLVK 1IC7L 2HG5A 1DSFL 1IIKA 4XVTL 3ZDXB 2A6IB 3PY9A 3BIBX 4XCEA 5BCAA 1PMYA 1ZHKA 4G6KH 4HKJB 3GXUB 1FFPB 2Z31A 4NCDA 2CALA 3QUKA 5DJ2A 1HH6B 4ADJA 3WY1A 3QEQA 1MN4A 1FVCA 1IC4L 1EMTL 2X4SA 4PS8A 1CLYH 2BZDA 4XHJC 5KW9L 5C70A 1I3VA 3PQYB 3IXAB 1JDAA 1UB5A 3FUMA 3SQRA 3KGSA 3OAYH 1F0LA 5T3ZH 4DUXA 4JO1H 5CO1A 4E9LA 3Q9PA 4FJZA 3OKMA 4K23L 4NNPL 3MRGA 5A2LH 3VU1A 1O7DC 1OVZA 3SQBB 4AQEA 3K7UA 3UBXG 3C5ZA 2VSCA 2FECL 2L0DA 3AY4C 2Y7QB 3TNNB 5A43C 3TURA 5MERA 2VRAA 3K72B 4Z9KB 5JHLL 4U6VL 3ETBF 5B4MC 4NRZB 3CDGB 4FQJH 3BZFA 3RIAF 3C08L 4ENEC 2AJVH 3DWTA 1MHHA 5HXMA 1K4CB 4RCAA 2AXGB 4FP8L 4RAUA 2Z6FA 3VFSB 4P49A 1F3DH 2QPSA 2OMVA 1CCZA 5GISL 3WXWH 2QVIA 3P4MB 2HT3C 1KLGB 1PDKB 3S34L 2R2EB 3GIVB 4MXQC 2CLZB 4ODTL 2EYRB 4L0YA 1K5WA 1D5RA 4UT6L 2Y72A 4OW6A 1X5ZA 1LM8V 1Z3RA 2GSIB 4MAUH 3U79A 1N12A 4ADGA 4NZ8A 1VPOL 3QJSB 1UT1A 4FTVE 5EF0A 4HKBA 1VFBB 4YSTA 1V7NL 1BVOA 5AOIA 2XWXA 3MJ9A 3VQLA 4JN1L 3HI5H 5FGSA 5KVDL 3GM8A 3DX6A 3BN9D 4BH7A 3P77A 4EOWH 2EVIA 5KYWA 1T5KA 1UD4A 5IKCA 3U9PL 3L3JB 4HETA 5TE6H 4N9GB 4RAVA 4RFOH 5DUBB 1WIPA 3IGUA 5C6TL 3K3QA 4XPHH 1JHTA 2WQUA 4AYSA 2QTEA 3HMXL 4YQXH 1FZKA 1ZSDB 2RBLA 1U0QA 2NCEA 3DYPA 3FQUA 3O9WD 3UO8B 1EHAA 1WWAX 3TFKC 2P5EB 3P73A 3TVMD 1A4KB 2WQRA 5IV2A 5JW4N 3VH8A 1C7SA 6FABL 1F90H 4JFPB 3UG4A 4EQ3A 2DS4A 2IWKA 1UGNA 5IREA 4UMSA 3B7UX 3QFJA 2CH8A 4EKJA 3VFTB 2EC9T 4FMVA 2HA1A 2MWCA 3DOSB 3GXFA 3TIDB 4ZTPL 3EO1A 1UCBL 3FFCD 2ZUWA 3NSXA 1TTBA 3IKKA 4NQED 2X3AA 3WHE0 4KJQC 4GEJA 4MMZA 3AWGA 3I3DA 3QDMD 4M5ZL 1CFSA 3TEYA 2WLLA 1JWUB 4NQUA 4RFNB 5D70L 4B9PA 3KYKL 1DFXA 5FHAH 1YCSA 1NC4A 4PTUA 3GKWL 5AVVB 4HIQA 5LXVA 1U8KA 4DZ8B 2DBLH 1ZVSA 3JT2A 2XCMC 2E86A 3TIEB 5G4NA 1T6VN 5GGSA 3Q43A 4K9EH 4TUOA 1B2WH 1BXXA 3FOMB 2YEZA 1EERB 1CU4L 2YN5A 1U8MB 2C9AA 3VNYA 2WWMC 3TWCH 1N6VA 3FZUD 2OX5B 3LXBA 4HJUA 3H7BB 3ZKXB 1FDLL 1J87A 1JZ3A 2NY1D 4OR1A 1U8PA 2CGZA 5F96L 1B88A 4OLWL 3AZUA 2CDFA 5FB8B 1KB9K 32C2A 2JKTM 2VGLM 5HGHA 5I5IA 4DQOL 5I8OH 5ITFA 1FZJB 4BK8A 4BSVA 3N3EA 4R0LA 3U2JA 5GRJL 4Z7WA 2IQAB 4LZKA 2MQCA 3F3HA 1R3KA 3ARSA 4ZQKB 2W60A 3FU5A 4NGHH 4MDJB 4ZFFB 1ML0A 5I8KL 3EO1B 3HUJA 3WNNA 1WPCA 3OTTA 4MD5A 1UEMA 1J11A 12E8L 4Z7UE 4ANKA 1PY0A 1KZQA 2P24A 4FFYH 2OAAA 3DV4A 2PYEB 3FQYA 5LCVL 1FH2A 4UIKH 1KCBA 5E70A 1OT4A 4KH2A 1RI8A 1G1OA 3AU1B 3ZE0F 3BUIA 3IJEB 3MRQA 3W82A 2WC7A 2EDYA 3EJYD 3QULB 1V54B 2J20A 3EYUL 4PJXF 4IEFA 2F53E 4XCEB 1NFDE 3OKNB 4HIEA 4PRIE 1Z5LA 4WENB 4I8DA 5DD1L 4TOYH 2IAMB 2VN6A 5HPMA 2G75A 3UERA 4XCYA 2AQ3A 4JFDA 3GTNA 4HV8B 1OCWH 4Y19D 4QOKA 3MBEC 1KGUA 3T2OA 3UC0L 4U6HB 2BDNL 4UOQA 3PQYD 4Q74A 4XR8C 1T66D 2VXQH 4B97A 3HTLX 1ZLSH 4TS6A 4BZ1H 5JIKA 2H0JA 1G9ML 1J5IA 5F7MC 2OZNA 1JPGA 2BY2A 3IJHA 3ZTJG 1AYOA 1E9PB 2CO6B 1RZ8A 4L8DB 3L9BA 3TNMB 4JGUA 4JO2H 4N8CL 5I75C 4N6RB 3GSOA 4ZPVA 3LRLA 5EO0B 2VLJE 2GIYA 1K4DA 5DA0B 2UZYA 2OULB 4Q6IA 4O2EB 4JDTH 4FXLA 4XVSH 5E08H 1HTYA 5IVZA 3FB8B 5MEOB 4Y2DA 2YQGA 1YNTF 1KIUA 3FCGA 4GUOA 3RX7A 1CF8L 3TJHD 1KBGL 1E3XA 1BYOA 1IL1B 4QHUA 5FO2A 2QSCL 3RG1C 3G04A 3GIVA 4EIUA 1EZVY 2ICWA 3DX3A 3VD2A 4HGMA 4FZ8L 5JHLH 2GUOA 1XBDA 1MXDA 1QSFD 1AHWB 2EO7A 5F7WC 1OTSD 3WG7B 2BRQA 4U4BA 4XAKE 3X3GL 2BHYA 3SO3C 2ZJSL 4PW9A 1AS6A 3JWOL 1OT2A 1EZLA 2OMTA 1TQCB 3LVTA 2R4RH 3M7OA 4ZUVA 1ULVA 1XGRA 1SY6A 3KPRA 5D4JA 1REIA 5E6IC 1KCSH 2Y6TE 3GBNL 4DO5A 1YUHB 3OR6A 4GUPA 2IQ9H 1DO5A 1NJ9B 2M83A 3Q9QA 4IU2B 3FQXB 1R1CA 4WFGE 3W81A 2AV7A 3FO2B 2FSDA 2BY3A 3FH8A 3ABZA 3TEZA 1RZFL 5TQ2L 4CN4A 2LE9A 1PKOA 2WZ0A 1T20A 3TVMB 2VXVH 5FYKU 4NIKB 3K6FA 1QRNE 2F7RA 3HNVH 1FJ1A 3RWFB 1E50A 3QA3A 1AHKA 4JDZB 2C3XA 3Q5OA 1A4JB 5L9DH 1JTOA 3QUXD 1URLA 5DDHB 2X4PB 2BNUA 1D5XA 1EHKB 2CLRA 4W68A 3SDAB 4XH2B 2FB4H 4ZT1A 2NSMA 4BH8A 4KTEH 4CN6A 2WWKT 4JFFD 4Z3GA 2EECA 5D4HA 3CVHL 4YDZA 1R6VA 2LLLA 1KBKA 1SGKA 2ENYA 4KKLD 3SE9L 3N85H 3T3PF 3WS6A 2Z35B 5IFAL 1RZ7L 2DQHL 3G5WA 4DO4A 1CGXA 4J4PD 1EX0A 3PXJA 4MBRA 2A9DA 3T0DA 3T8VA 3U7AA 3IS0X 3C5JB 4FQIL 1XH3B 4QRQB 1KBWA 1E4XI 4WNQB 3MRNB 3PREA 3QEUA 1YECL 2H0PA 4MD4A 4PTUB 1VIWA 4LHUB 3VGAC 1A9EB 4BINA 4W9FC 5B38A 3DSFH 3F83A 1JF1A 2VLJD 3LYRA 1XGQB 4JPQA 4M5SA 5BVPH 5L2KE 4UZGA 4XBMA 4EZMA 5DGQA 5ICUA 5AW5B 5HDQL 2O61B 1S7TB 4PWHA 2GBTA 3X1EA 5D55A 5AZ2H 3IAQA 1SYVB 1WS8A 2X89D 3QUXA 4S1SH 5F44A 1PSKH 1JRHL 1NIAA 3GSNL 4M7JH 5I1EH 2P5WD 3TJPA 2PPFA 4YFEA 3RP1A 1AZRA 1NBZA 2RFXB 4MDJA 5I0XA 1UATA 5AAMA 3SDDB 2G5RA 3IFPA 4Y16D 4BWWA 2FGZA 4RISH 1LDPH 2HXAA 5FGCE 3FN0H 1KXVA 2VAAB 3L7EB 2CA3A 3SOBL 3I3EA 4GLRI 3EBGA 1L9SA 5D7JC 5EIIG 1RU9H 1IM9D 4EN3B 4G9DB 2J6EH 1RIUH 2Q8AH 3NJXA 4BQ8A 1B0RA 4RGND 4Y4HC 2X70B 1JHTB 1RERA 2EUWA 1HYRC 2BNRB 5CEYA 3S96B 4NGHL 4OI7A 3CFEA 1F1AA 1H19A 4WQOA 5MI0B 1UM5L 4X4XB 2G60H 3SGJA 3HR5B 4FI6A 3TZVC 2GUOB 4TNGA 1ZT7B 3EO0B 2J12B 4GAYB 4KJQD 2GJRA 1UXSA 1MCCA 1J9RA 3EG9A 1PSKL 2EIMB 5E24E 1F56A 2NOYA 2YPVA 3H9SD 1I8LC 4FERA 3S3JA 2YPLB 4A55A 1QNZH 5HYQB 4IBTA 4MMYB 4OV5A 2YXVA 4JN2B 4PVBA 3K0WA 1FFOB 3CMOL 4OY9A 4XMPL 4XNYL 4GT0A 5EOCJ 5DA4A 2AQ2A 2H26A 4PJ9A 2PPDA 2IPTH 3MLWL 4QHMA 5E7BA 1SDYA 5EO1A 1DQDH 3RAJL 1QSEB 2D9CA 3US1A 1T2QH 2X2YA 2DI8A 5SWZE 5AAWC 3ZL2A 3MBEA 4G2AA 4JRFA 4YR6A 3S98A 3U6RA 3GDBA 1TXKA 3QI9D 1WRFA 3PHQA 2J1YA 5D4QA 3CZKA 4X0KA 4DP7X 1UXWA 4DPBX 1KELH 3S36H 1U8MA 3RY5A 2WVTA 1F8TL 3O81A 2UWEA 2P9RA 3D50A 5DS8B 1FNEB 1K8IB 1NBVL 4NM8H 1S9WB 2X4OB 3KLAB 4DWHA 3EF7A 3S88L 1AGBB 1KCUL 3M1BA 2BVQB 5ERWB 1CDBA 1MLBA 5HHOD 5DSCA 1M2VA 4NKMA 5F88B 4FABH 2VDQL 1C12B 3GEWB 1JXGA 2O26U 3HC4L 4WHDA 2HKFH 4WLCA 1AHWA 1TZHB 4NPYB 2XFGB 5ES4B 4AMXA 1SJHA 3OBAA 2BFGA 4H7VA 4IBQA 1TTGA 4LNVA 3L1OL 1KXTA 5AUMA 1T1ZB 3GQFA 1DUYB 6TAAA 4HEPG 1NLDL 4WNQA 3BVNB 4GMTH 4MAYB 5CIPB 4P5TC 5B39A 3TBWA 1QACA 2OMWA 3LRMA 4W9HC 3H6JA 4X9IA 4FA6A 4P2OB 1VSCA 5CHNA 4Z7VE 4Q97A 2O93L 3SKMA 4JGMA 4OJAA 1QSFE 5BJTB 5JQHC 2HVJA 4R26H 5L8LB 4P5MA 3QPQD 3TLRA 2O5YL 2NXYC 4KNTA 4XMWA 5IHZB 2JF1A 1KCKA 2JK5B 3A3YB 3BXNA 4MNHB 4AE1A 4UB0H 4GG8B 3HC2A 2IV9A 2DL9A 2K45A 3H4FA 2WP3O 4Y19A 4Y7MA 3MRGB 3JVGA 3QJQB 5CBEA 3TFKD 4Z6AT 1G94A 4X98B 3V4VA 1SEQH 3EBAA 1G9MC 2EABA 3AQDA 3NIDB 3GNML 4H8HA 4MB1A 3ZDWA 4NM8L 4BQ6A 1UB5B 1ZS8A 3GJFK 3V9CA 2YEQA 3ZDYF 4FQJL 1HKFA 4WTXA 3MQIA 4WUUE 2GSIA 1TU2A 3L3OC 2DLTA 3P2BA 5EBGA 4JFQB 4KK8C 1KN2H 1JE6A 2ITDA 3EHBC 4JDZA 1P53A 1UJTA 4FNLH 3X11A 4IBSA 1KB3A 1IBHA 2VZSA 2VLJB 5B8CB 5LQBH 2VW4A 1U3NA 4FLHA 2IBBA 2X9YA 4G8GD 3MO1B 1I31A 2W9LA 2CMRH 1FQ9C 2V6HA 3UZQB 5I0ZA 4J3BA 3SYCA 3WXWL 1B6UA 2V7NB 1SLXA 5IBUG 1G7MB 1MI5B 1GS6X 3ML8A 2P5WB 4PJ7B 3TYFA 4IS6A 5JMOC 2OSXA 2EYSA 3AREA 1TOXA 2LU7A 4Y16B 5AB1A 4YSCA 3NRQA 3NCFB 1E7UA 1M3IA 4Q9QH 4TKWA 3Q1SH 3SB3A 4DP2X 4L2YA 2NY2C 1R34A 1F3DJ 3LZQA 5J1TC 3O8XD 3OSVA 1O7VA 4LRIC 4AG4L 2A0LC 3M8OH 3VGEA 4FG6C 2QADB 4YR6B 1I8AA 4I13B 3ZRFC 4RGNB 2X05A 3IVKB 1D6VH 1U8OB 3MLVL 3GSNH 4IRSD 4M7JL 5GSRB 5I1EL 1VF5C 5IB4B 1G4MA 5CMAB 4U1KA 1WG3A 3TCLB 4MLIA 2FWOB 3LZPA 1FCGA 3MXVL 3QUXC 1OF2A 4XMTA 5DMIH 4ODWA 3W38A 1YQVL 1ORQB 4BUHA 3BZ5A 1EDQA 5IW3A 1BQ5A 2IH3A 2Y7OA 5GGQL 3O11A 4JKPH 3DROB 1E8ZA 3LIZH 3JV0A 2OZ4A 1E4HA 1BEXA 1JPTL 5BV7C 2VR7A 5LDSA 4QRSB 5DK2B 2AHIA 1I1FB 3BHBB 3LKOA 2FX8H 3FQWB 2W9DL 4OB5H 3ZDZF 4N0FB 4JB9L 4QF1B 3PP3K 5J6HB 1KCRL 1HZHL 4LHUG 2PKDA 2I9TB 5E2VH 4KO6A 1KY6A 2PWHA 4AK2A 1AQHA 3V79C 3LVEA 2FZ3A 4ZAKC 1CFVH 4QCIA 3LD8B 5D7EA 1CLCA 4R9HA 5I1DB 3PL6B 3D0VA 4XP4H 3BIAX 3MUUA 2ODIA 5DO2C 1QFWI 4O00A 2CUIA 3T6XA 2ICWI 1M7DA 1L5GA 3H4HA 1MCRA 5JXEA 1XAKA 4PJAE 1NMAL 1FNEA 4N2BA 5MP6L 1ZS2A 2A1WL 3PP4H 4I18B 2P24B 1VKXB 1AFVH 4C57C 2I27N 1XR8B 4KNQA 4UQ3B 3FYEB 2BIPA 2J1ZA 4NT6B 1U8LA 4Z7QE 5EO1B 1JERA 4ZQTA 3RVUD 1XHHA 3MBWA 5HI5D 2NUTA 4HX1B 4WEEA 1IGMH 4F57H 3IRCA 1B4LA 5AAWA 3DVFA 4QRSA 3BRFA 4GUQA 1AGFB 3FW6A 4DQOH 3H85A 1J0ZA 1PBYA 2EDDA 1BQKA 1Q9KB 4ZZKA 1OD9A 4K94C 2A74B 4I3SH 5CILH 5CZKA 3KGTA 3WN5A 1M53A 1TETH 1S46A 3OXRB 3NRFA 2UZXA 4H8WC 4FQCH 4M7LH 5F8QC 1IC1A 3Q3GB 4D0CB 2XN2A 4L3CA 3N44B 5ICZA 1IKOP 2PMZA 4GP8B 1KV3A 1EXHA 3PWUA 1BXAA 3RY6A 4XOEA 2VMFA 2VR9A 4D3CH 4IOFD 3L4YA 5IOPA 5A1AA 5BJTA 5E6ID 1MY5A 1PPIA 3G6AB 5EN2B 1J9QA 4GAFB 5FYJL 4P99A 3K74B 5J06A 5EEVA 4TPRH 2Y5EA 1BZ9A 5HDBF 3UTSB 4PJ7A 5EA0L 1KWGA 3US9A 3N85L 1KEGL 2V2XA 4GKNA 1HXYB 2XN0A 2HFGH 5D1XD 4NZDA 4UM9A 5E0FA 4HUXA 4WI5A 3LKNB 4R7VA 4I4WA 3GJFA 3NSFA 1Y6NR 2PXYD 5HYQA 2E4TA 2KZKA 3ZK0A 3QUZD 3OXSA 1C1EH 5KS9A 2NRDA 2QMJA 4NC1C 3HLKA 4ZMYA 3UTZA 5B1AB 3W11C 2I60L 4KFZC 4IRJA 1FLTX 4ODXB 1ZHLB 1I8LA 4NKOB 1SM3H 2R69H 1WT5A 1M6OB 5C86A 5EORH 3HZYB 3B83A 2K9FB 4YXHL 2FHBA 4Y5XB 4YDLC 1K6QH 3K6NA 4NN6B 1U8HA 1RZJL 5EUOB 5KSVA 4AC2A 1TG8A 2AEQL 1H8SA 1RL1A 4HUUB 5HJGA 3RL1A 4BUGA 3HIZA 3WJLC 5EOCL 3S3BB 2WSPA 1OAYL 4AYFA 4JHUA 4WJKB 2X40A 1JVLA 1HCZA 3L17A 3G5XA 4JFUA 3R7RA 2FO4B 3HI5L 5KVDH 2GC4C 2DZEA 1AYRA 4HS6B 2JELH 2YMOA 3GI8H 3M88A 4G1MB 4EI5B 1I8MB 5EOQH 1CFNB 1JPSH 4Y2OB 4PJDF 4L8BB 2QVKA 2H32B 1N6UA 3VSVA 1Q38A 4UM9B 4I3RL 3CZEA 2Q20A 1P1VA 4DW2L 4EO5A 3DPDA 4NRXB 1DANU 3QA3B 3MZGB 3WNPA 1CURA 4KTYA 1QHPA 3GFUA 5GIRB 1MREH 4LEXH 3SDXB 3TBSB 1MH5B 1R17A 1QEWB 1XIWA 3U4EA 1QFHA 3FXIC 1CBVL 4XNDA 3N1MC 3Q6FA 4CRPA 5FYKE 1XGTA 3CUPA 1TO4A 2XC8A 3LN4B 5F93C 3JWDL 1AHWC 3MUY1 3UL4A 2WBKA 5D1ZC 3H7BA 2AMGA 2C9UA 1YMHA 5GQBA 2O6CA 2Y7QA 1OHQA 5KZCD 5GSRA 3WFHB 2JXMA 2F5AH 4RSYA 1K4CA 4FFZL 3AG1B 3SE4A 3DGGA 3BP4A 5IG7A 2GEQA 1T7WA 3V5DB 1T4WA 1DE4A 4K3GA 1XCWA 5HVGB 1A3LL 4LPXA 3LB6C 1HDMB 4HMCA 5DDHA 4JAMA 2E27H 2P45B 4JHAH 5L4IA 2VM4A 4LLAA 1RZ7H 3FCUB 4KTDL 5AB2A 3NBNA 4WFHD 2V17H 3EYSL 3CFJA 1L3NA 2IOMA 4XXWC 4QYOB 2YJLA 4ISVB 2JLPA 4X7SH 4JMXA 3ESVF 4MDIB 2I5YH 5TDPA 3R8BB 2R1WB 5MENE 4CL7A 5AL0A 4DKFH 5HDQH 1SQMA 4WW2C 3KGUA 2MTAA 2CJSA 3RGVB 2VDNL 3V9EA 4HUWB 5KBMA 5JW4R 1P4IL 1CI3M 1HL8A 2D03L 4G8FA 1KV7A 4F9LA 5CIPH 3RZCD 3UTSA 3LPWA 1E28A 2F19L 2XQBL 4DN3H 3UEQA 5DJAB 1NTDA 1F4YH 1ILSA 4CBPA 4FFYL 1AAJA 1G7LB 1RIHH 2W0KA 4HSQA 4LMQE 3IJHB 5IB2A 3LH2L 3UAJA 4FG6D 4GBXD 4P2RB 3SJVE 5IFJB 1UA3A 1SYSB 5C07E 4WAFA 4AMWA 1U3ZA 3TBCA 4DT2A 5IQNA 3W3BA 2VLRA 1FL5A 4K55A 1F90L 1FNLA 3SYPA 1NGYB 4Q9RH 5B39G 5D72H 2R69A 4JPVL 2O6PA 3IBEA 5DWUH 3Q6GH 2Z7WA 4MCYB 2E9JA 2MCAA 5DMGD 3AREC 1BQLH 2EIZA 2J6WA 3QQ3B 3S4SB 4GPVA 5SV3A 4RGMB 3V0EA 5LNEA 3PV7A 5DHVA 1ZLUH 3ZBMA 3ILQD 1QNZL 3CVCA 4LRIA 4UOZA 4L1LA 2H32H 5E6UB 3QJRB 1AQKH 4PV8A 1EEUA 1A6ZB 2HWZL 3UTSD 4JGNA 2OS7A 3OC5A 3PJNA 4N0YH 1MQ8A 1VAHA 3AG2B 4K8RC 1VFMA 1OP5H 1X5GA 3SBWC 4XBEH 4P5TD 4UU9A 3LN9A 4MNQA 4W6WB 1IKFL 3VNZA 4CMMB 2AK4D 4FCHA 2PXYB 3VXUA 4HK0B 5A3IC 4EDXA 4Z7OB 3D25A 5DMKB 5K69A 3RBGA 4LARH 2O61A 1HINL 1XH0A 5BS0E 5E08L 1KJ2L 3CCHA 1Y18B 4B6ZA 4U1HA 1A9EA 4MXVE 4L8SC 2PCFA 3Q05A 1MWAL 1N0XH 1RUMH 2VZ1A 3KG5A 3RFZA 2X4QA 1VZGA 3GZOA 3ZE1F 1MFAL 1YEWA 5E4IA 1K3IA 3C09C 5E1QA 3GBML 2EXSA 4RAVB 1DLFH 1XF5B 3L9RA 4R8WH 5A2BA 5F9JB 2UWEB 4BWTA 5BOZG 4JFDD 1MFEH 1OCZB 2VO5A 2ZP9A 4KK6D 4EI6B 2WCSA 1UWXH 1T2XA 1R24B 3OV6A 3PHQB 4N0CC 2XG4B 3VI3A 1KT2B 3EXLA 1OW0C 3N0AA 4QDGA 5EOCH 2DBJA 4ZFQA 4ZMLA 4NBYB 4ANWA 2EE2A 4NNPH 4R90H 4ICWA 1I3GL 2XKNA 5ETUA 5D7LA 5FM4A 4DGIH 3ZMRA 4X5PA 5B39B 4PY8I 1AR1B 1SQ2N 4G8EA 5KSUA 1UXSB 2AVGA 3GSQB 1WJ3A 2BRRH 2D7TH 4UNTA 5JORB 1A02N 2NDGA 2OMVB 2G30A 3DURB 1WC7B 2P8PA 1X5JA 4I87A 2EE0A 4OI8A 2APFA 5T33H 3CN0A 4XCFL 1JZEA 3BKMH 1FORL 4X9YA 4AKOA 4G1MA 4LLDA 5I74B 4MNGE 3ORJA 2V5SA 1UWEL 1L7IL 1UACL 2FH6A 1DN0A 1B2YA 5LBSH 1U36A 4X80H 2B39A 4MRBA 1J1PH 3L5JA 1UHVA 5IB3A 1FN4A 1ILUA 4Q0XH 5FFLA 2O5YH 1KB5B 1AR2A 3JZ7A 2HLFC 1IKNA 5TE4H 3VXTA 4EVNA 2GAZB 4KXCA 4ES9A 5EEWA 1BLIA 2WINB 3UJIL 4L4TD 4DVRL 1IM3A 5CIPA 1QSFA 2TRHA 3BQUB 3CQPA 3FOLA 3HN3A 2X4TA 2VMJA 1Q9WB 1WFOA 1ZE3H 2G4EA 2JQZA 4IRSC 5HVHC 3T6QC 1NDGB 4JFFA 3T4AB 2YGPA 3LHAA 3RVVC 1FVCB 4PS4L 4GSRA 5I0WA 3AUWB 1OTUC 5CJQL 4OKDA 3IU3B 2BOBA 1N6QL 5JIMA 4X99A 4YK4C 1RHFA 3L4ZA 3LN4A 4QXUL 1A6TA 4P5KB 5D7SL 5F89B 5CAYB 4DK5A 2YGVA 5DVNA 1WITA 1KFAH 1AG6A 3FONA 4UV7L 5JLZB 4FMFA 3T3MB 2YXFA 5CSZB 5A6MA 4ONGL 4WGVB 1K8IA 5ITBH 2GTZA 4PJAB 1ZS8B 4RDBA 3PAUA 4ZXBC 2ZICA 2NXYB 1XTMA 2IIJA 2J8HA 4H8QA 3UJIH 4DVRH 2WBJC 2A38A 1FORH 3D2UB 1KN2L 5I1LB 3K2KA 2DM4A 3ZL4L 1LJMA 2LLNA 4FEIA 3RNQA 2OX5A 2ZYIA 5HGBA 1PNDA 2P5ED 4LO9A 4MQ7A 5CLTA 1NC2B 2VLKE 1KFGA 3HCVA 3UTTA 3X3GH 3GWJA 3ES6B 4Z3JA 5BNXD 1U8OA 1LO4L 4Y16A 5D93B 4H1LG 4DKEL 4HXAH 5GGSB 2MQ3A 4JM2D 1VZHA 3K0YA 3GKWH 4AV5A 5CLZA 1Q9WA 2X1WL 2NY0D 2GITB 1BFSA 3PAZA 1URIA 3SSGA 2D4DA 4LGPB 4WDIA 3D33A 4XNUH 3VUAA 4OJCA 4YHPA 4H13C 4L9LB 4P2QD 3PWPA 3WIAA 4PJ8C 3HC3H 4LLWB 1C8PA 1BFTA 3WKYA 3F7YA 1G7JB 1WZ1H 4HH8A 4LQFH 4R7XA 1FL6A 3RVUC 1CICD 3HMWH 3KJ6L 4AT6B 2C3VB 5FCUL 1PEZA 2VR6A 2XG5B 4XTRC 3IMTA 4G9FE 1OSZB 4AYEC 3Q6FB 3CN3A 4ZNCD 1UWXK 4BIKA 2EDEA 4MCZB 2XVBA 1SDDA 4H2AA 3BAXA 4HD5A 4PWIA 4B27A 1MJUH 5CEZD 1JBJA 3WFCL 2ALAA 3MJ7A 2GVYA 4PV9A 1SXZA 3CMOH 4J6IA 1OPGL 5IFAH 1IBZA 1KPUA 2P5EA 4HFUH 2G3NA 2LT9A 3PQYE 4AL8L 1QFWL 4JFYA 2NT1A 3V4UL 4GRMB 3ISYA 3QEUB 4EQ2A 4N0YL 2ARJQ 3E3QE 5F7NC 4XMKH 7TAAA 1ZGLA 3ARDC 4JPIB 4EKXA 4OD2B 2EE6A 2OMYB 4HXBH 1VB9A 2EYTA 3FL7A 1X5YA 3ZW3A 2NW3B 3AABA 4CJ1A 4Z78B 2HFEA 2OCCB 4MGXA 4TL4A 1MWAH 2C1PA 2R1YA 4I85A 2Z4QA 3IAPA 4O2EA 2R0ZL 3GBEA 3L3GA 5AWNL 1A7QH 3OAUL 2YLKA 3QUZC 3F5WB 1Z9SB 4JGJA 3LKSB 1BG1A 1UWFA 2HZHA 4KI5E 3KLKA 4JY6A 3JWNC 3W11D 4NUGL 3D34A 1P1ZA 3SZ6A 4BHUI 4MJ6A 4HX1A 4XO5A 4TQHA 1QLFB 1BM3L 4F57L 2J3SA 2WLIB 3NCCB 4S1SL 4Z7UA 4LOUC 1OE1A 3G3LA 1CD0A 3MRKA 2WVUA 4WW2A 2QLYA 4OCLC 2NUPB 3S4SG 3W1ZA 1T0MA 5H8DA 2BOBB 3LD8C 3BKJH 4RRPA 1BJ1H 2LFEA 4MWFA 1PX4A 2OMBA 2ZKHL 4DESA 4KY1H 1P2CB 1NCAH 1Z6JT 3VFRA 4XH2A 4F9LC 4HPYL 2WUCH 3HZ3A 2FGWH 4WJ5A 5T1DH 3MRHB 3F7KA 2I32A 3RWIB 1NCWL 2D8KA 3H56A 2FIRT 3KPRB 3VGGA 2M26A 1V8HA 4MDRA 1DQQA 3ZYJA 4WK2B 4B9YA 3C5ZD 3ILQC 5I6XB 4FNUA 5INCB 4RGOL 4ZFZB 4TRPL 4U1MB 3GHBH 3KR3H 2FQGA 2BO0A 1QKZL 1XH3A 4AW7A 5IKCB 1S9KC 4PGCA 2GAZA 1MCOL 5E5LA 4S2SB 3IU4H 4ZYKA 1V27A 3S35H 1Q72H 5M7QA 4JFED 2DQDL 3IWUA 5DJ2B 1PD6A 1J0YA 1J86A 5ID1A 1UCBH 3FUFA 4HJTA 1UWEH 2ZF8A 3MHZA 3QZLA 4I48B 3O2WL 2TSAA 4Z7NE 3EYQC 4L5FH 1WEJH 3QJHA 4ZMNA 2EXTA 1F4AA 2C1OA 5ISZE 3GRWA 4KDWA 1H3XA 2W1NA 4FTDA 1EAPA 2IPKB 2R29L 3ASWA 1ZLDA 4A2HA 4GKNB 5HP5A 1L4IA 3PGFH 3BJLA 3FH7A 3KYMB 5E99H 1NANI 2CO7B 2PWGA 2ZNXA 3ZKMC 4GP5B 5FO8B 2WXMA 3NFSH 1G0DA 3U9WA 5KBDA 2NTFB 5AYUH 5SWSE 5DEFA 3S5LG 2MNUA 2GKIA 1M3JA 3W5NA 2WK2A 4HDIB 3QPQC 4N8PA 5K1VA 1KBVA 1KTRL 3K4DA 2MCMA 4GW1B 2Y7NA 3OJ2C 2DJSA 4S1DC 2EIEA 5IHWA 1FGNL 3WY4A 4QRRA 2XBTA 4QD2E 5DC4B 1DUZA 3Q1SL 3QT2A 5F7AA 3WL9A 5CCKH 4X4XA 5BS0D 1WS7A 2HH0L 4OGXL 4X0NA 2VZ3A 2E74C 4C4KO 2D4FA 5K59F 1T1XA 3PNRB 1AIZA 3OKLA 4J1UA 1RZQA 4BQBA 1NUFA 3BT0A 4NNXB 5M95B 3FTZA 1ZTXL 4XE5B 3MGTB 2OL3B 2DWXA 1NBCA 3HG1A 3TJEL 4DGVL 5HI3D 3KVQA 1QWNA 1C5DA 3QXAB 4YS4A 2APVA 3OKEA 4TV3A 1QHOA 3DJRA 1RK0B 4WW2F 1F02I 5AOZA 3WIHH 1DANT 3HBGA 4HPOH 3CXHJ 4KKNA 3QARA 1P5UC 2BVPB 2ENSA 3BH8A 3LHPH 1BHGA 3EH3B 4IKIA 3QNFA 4U1GB 5JPMA 2EE9A 2R2CA 3V0VA 1MJ7H 1NCCL 1Q4NX 4YHPB 1BZDA 1UOWA 4IDJH 1L5GB 1NFDB 2FJGA 2YC1A 3INUL 4LU5H 1XGQA 4XNUL 1ZVYA 1KC5L 3CFBA 1KB5A 2EEFA 1IFRA 2CK0L 2WQ8A 3RWDA 4UTBA 2FEDD 2WOYA 5I1JL 3SPJA 2EACA 1YMMA 3BZ4B 3DX1A 3POCA 1OTUD 5AG9A 3CHXA 1HEZB 4KDVA 1I1YB 2AJUL 2CRZA 3QDJB 4PRPD 1UM4H 3WFCH 4DKEH 3OQRA 3O9WB 1MCIA 2XWJB 2IG2H 5I19L 3QJZA 4PJ8A 1QBAA 4YSOA 3VXRB 3H42H 4CMHB 1D5IL 3IMRA 2VZUA 2FYYA 3C12A 3NZHH 1A25A 1TNNA 3X1BA 2EO1A 4Z3FA 3G5XB 1OGAD 2UXFA 1T7YA 2J6EL 3TIEA 1XGPB 1CE1H 2Q76A 2X9ZA 4XNMB 1P6WA 4M03A 3NZ8B 3V7AG 4RRPG 1SXNA 5E1GA 3TCTA 3GUTB 1WZ1L 5DRZB 4ZXBD 4IMLB 1JWSA 4HAFA 1N7ML 1PGRB 2BX5A 5HSFA 4MX7B 1KCWA 1SDDB 5CP3H 3SKUD 3DTXB 3FFCB 4F8PA 3OJVC 1FIGH 3QEQE 4HUKB 4RETB 3IFNH 5M94B 4EIBA 5J11C 4ZFOL 1KBGH 1BVNP 2ZWZA 3INUH 3MSPA 2IEPA 4F1ZA 5L2JA 4OSUH 1IM9B 2J73A 4Z7QF 2HLAA 4GQZA 5DRWB 2R0KH 5CN3A 1JHLL 3SCMB 2R9HD 2WKGA 2GSGB 4LKXA 2QQKL 2YMTA 4Z0XB 5H35A 1M9SA 3KYKH 3TP4A 3FQ4A 5IMOB 2W0FB 4NPKA 5ABAA 3IK2A 1NKOA 4LQ1A 1B2WL 3MROA 4NNYB 3SY0B 4LK4A 1HXYA 5FKPB 3UJJL 1E8XA 3V6OA 3O45B 4JNXA 3GSVA 3B7SA 2X0VA 4CW1B 5D72L 3O3EB 3WFHA 4KQ3H 1NBVH 1YEEH 4B7IA 1DFBL 3Q5TA 4KRLB 2EZ0C 1S6NA 1U95A 1MFCH 1TFPA 1IGCH 2MIZA 4IEFB 5A2JH 4OCRH 5I1KH 5FLUA 4P2CG 1J8KA 3MLXL 4WW2B 4OBSA 4EN2A 4PJFE 3UTQB 3MLRH 1D6EA 4ZMAT 1CL7H 4UBDD 1SEBB 1ONQA 4HOZA 2O72A 1RMFL 3PGCB 5DHVB 3T3MF 1TZ8A 4JFEB 4KKCD 1NPNA 3IFOB 1QW9A 1QWUA 4ETYA 4PYGA 1EO7A 2LTQB 3L2NA 4URTB 1ZV2A 1S5HB 1T1ZA 1JGUL 3ZTDC 4B9JA 3L4TA 2EC9U 5E03A 2ZYSA 1MRDL 1LTXA 3TXAA 4UQDA 3FHQA 4NDMA 1C12A 1PG7X 2OQJA 5IMLA 4XCCL 2GW5A 3FT2B 5HHXH 4FKEA 3VO0A 4CC0A 4Y19B 1AI1L 1NPUA 2WLNA 3LAFA 3QEGH 1GTNA 5E1HB 4GQ9L 1P9MC 4HWEH 4G3YL 3HLAB 1UKQA 3MACH 3TS8A 5DZPA 5KS9E 1BQHB 2K8MA 1CGSL 3BSGA 5BQ7A 4E36A 2EAEA 2GPZA 5FA3B 1XZWA 1KNOB 1CDGA 1BVKA 5BRZA 1W72B 4X6DE 3L6FB 3CIAA 2IAMC 1MFMA 4GSQA 4KV5F 2Z8WC 4E41D 5AVWB 3VFUA 3MBEB 3H9SE 1WTGT 3BH9A 4JN1H 1IVTA 5ESVB 1UT2A 1I3GH 2K7QA 2GHZA 5IIEB 2GBAA 4ZQKA 3RURA 1CBVH 1WCQA 3I9GH 2WP3T 2HSIA 2EEBA 5EZIL 3IYLW 1J48A 1NANH 2WSDA 3CZLA 4OGAC 2R0LH 4UILL 1KIQA 2PW1A 1JOIA 3KD4A 3NJGA 2QQQA 3U36A 4PUBH 3G6AA 5EN2A 3UYRL 3VVVA 1A1OB 1N10A 3EFDH 3C09B 1A6WL 1IAKA 3F7VA 4NNXA 5B4MD 4OLZH 3FRUB 1JCKA 3PP3H 3DYMA 2XV2A 3U0WH 1V7MH 2ORBH 2BVOB 4N2NA 4WZ9A 3EJZC 4P4KC 3QJTB 5FO9B 5LAPA 1C9SA 4WI0A 2X1QA 4HEPA 2HLAB 3JWDC 3T71A 1CLVA 4FFYA 1EFXA 1WFTA 3APCA 1CL7I 4RGNE 4JL2A 1FPTH 3BVUA 3Q13A 5AB9A 4Q7DA 2ICES 2HN7A 1R3IH 2W92A 5BXFB 2ZCZA 5D8JL 1CXEA 1T3FA 3FB7A 3FQTA 4IS6B 5J89A 4CNIB 3LRKA 4Y4FA 3IMUA 4JO8A 4XTRD 3V95A 2OTWA 5I0VA 3H7LA 4F93B 1U8LB 4LSRL 1MF2H 4YDJB 4M9OA 4PJ5B 5GRUH 2NPLX 1MI5D 2H6PA 1P4IH 2CXKA 4I0PD 1U8QB 5EZJA 1X5LA 3RWJB 3EGSB 3FUKA 5C09B 2VXVL 1CGVA 2N3JA 2XWJA 3H2PA 2CBPA 4PRAA 1RULH 4HS6A 3W2DH 1F1DA 1GVIA 1PL3A 3MRRA 4V1DA 5BZDA 1U8NB 1BFVH 3MRDB 1FP5A 1VCBC 4HIXL 4YDVB 2F54A 4UILH 5C0EA 3HJEA 5D71H 4NKQB 1Z9MA 3V5HB 2P80A 3HOGA 3D0VB 1MCQA 1KGWA 3APMA 4N8VG 3I75A 4B95C 1XGRB 4NZJA 3SCMD 5CGTA 1YO4A 5CFAA 4E9XA 1RZIB 2XNAA 1J18A 1NGXA 5K1NA 1FWXA 2O4EA 2R8SL 3LEXB 3GSNB 2F7OA 1MHCB 3GK8H 5I1DA 4LCIL 2ZE0A 3CMGA 4MMZC 4RX4D 2YOAA 4CMMA 4APXB 5A40E 1CYXA 2F8VA 3NPZB 1DJXA 3DVGA 1M1SA 1NGWB 3UCQA 1UZ6F 4XPFH 1R5WB 1U91B 2NLJA 3M07A 3GJFB 2WXOA 3CE1A 2AK4A 4GXVH 3VMOA 1PD1A 2FIKB 4PREB 3SJVA 5FECA 2VDPH 4R4ND 4BK4A 2VMEA 2E6PA 4ZS7H 5HDRA 3DVNA 3TT3H 5MEPA 2F1AA 1M4KA 3QXVA 2XA3A 1NFIB 2DM7A 3A6OA 4KKZA 5EC1A 1D5MA 2O1AA 1K4DB 1JNHB 2ENQA 2WWMD 3DV6A 4D9QE 4OQTL 3BEVB 3V6FA 1OWRM 3WDHA 2ZZUT 5F89A 4WNSA 5D2LB 4E0RA 3D07A 2Y5TA 4MKMA 2HAZA 2X44D 2YMXL 1AZZC 2FX7H 1NLDH 3QDAA 4Y5YA 3UPRB 1ONQB 1MOEA 3AAZA 3ARYA 1NUDA 4FFZH 3S9DB 3QDGE 1U41A 5DJCB 2AJ3B 4G8GA 3U9UB 1INQA 2A6JA 2OQJB 1EBPA 4EUPG 5IROA 1J9TA 2IOIA 3BQVA 1YMMD 4JPIA 1MW1A 4HZ1A 4ODHH 4PD4K 3HZKB 2VB5A 4LPCA 3VAEA 4DKFL 2BIIA 4H44C 4OJEH 4TUKH 4KXZI 3L5XH 3ME0B 3ZHFA 2P26A 4K5OA 4M6MH 1CFTB 1J10A 2A2QT 2G5BB 5AW0B 2YBRA 5DMYA 3BLKA 4PVLA 2XZQL 5T8IA 1UXWB 1MWAB 1XR9B 1ACYL 4HWZB 2JJWA 4LCYB 3RZCA 5I1GH 1YPZB 1PAZA 2ID5A 1GPOL 1CDUA 3OR6B 2AANA 2F54E 3FCTA 2EH7H 4J3WA 3E6FB 2WMPB 2C9PA 3U4EB 5BZZA 1M05A 1TVBA 1EPFA 4KY2A 1GW6A 2XTJB 1X5IA 1Q1JL 1T66C 4X4YA 1U4EA 3HAEA 1PFCA 2WXQA 4PIRF 2DJ4A 2KPNA 1LEGB 4NQDD 1OSPH 1EDHA 2MPAL 2W07B 4X5QA 2AQTA 2DMKA 3JTSB 3WNMA 3WIHL 3HLAA 1MIEL 5FFGA 5HHVL 1OAYH 5I1CL 2I60H 4APQA 3PJSA 5DD5L 5CEZL 2X7LB 3DGGB 3RX5A 2CKBL 4UMGA 2DKSA 4D3CL 3WU1A 1D2OA 1BAWA 5BPPA 1JWMA 1SXCA 3T0BA 4YL4A 3OX8B 3M45A 2VQ4A 1P0SE 3MA9L 3SYQA 2F74B 5IW6B 5DQDH 1KLUA 2PP8A 4Z7NF 1DLHA 2VDKL 1DL7H 2CKBA 5EA0H 5TQ2H 3SO5A 3CLEL 5A7BA 5C2BH 2BSSB 1BF5A 3AG4B 3G6JF 3RE0A 5J1AA 3C5XA 1Y18A 1QSZA 3CPUA 2N7SA 2DIJA 2WLZA 3FRPB 3L4VA 1FYTE 5TFSL 4EIZC 3FU8A 4UTBH 1M1XB 1OF0A 1RZ8B 4L8DA 1UA6H 4BRJA 4XE0A 2GCYA 2MJWA 1JHKH 5I2IB 1D2PA 5IJDC 3L4WA 5CUSL 4AH2B 1QFUH 5SWQA 5HYIA 3KBHE 5DEJA 3NDZE 3RX9A 4O4YH 4PJCA 4UT7H 3TV3L 1OOWA 2CE6A 2X42A 4FLOA 1HH9B 3O6KH 1HOEA 4PGEB 2VDOL 1GIGH 4P9HC 3WLWC 1BBJA 1EA9C 5F71A 1F97A 4WFED 3HG1E 2GTWA 1VZIA 4DZBA 3QORB 5C09D 1TKWB 1UB6B 3UZVB 3WL9B 1YECH 3QZWB 5EZLB 2Y69B 2Z7YA 3H3KA 5DD0L 2ESVA 3M6DA 4EI5D 5CD5C 3PDOA 1T6BX 4HWBA 4FQIH 4OF3A 4J4PA 3VXMD 5BVPL 3OGCA 3BAYA 2YN3A 5AAPA 1P7KB 2GQHA 4BRVA 2UXVA 5IVNA 3RWJA 4OCYL 3KYOA 3ISWA 1M9WA 4Y4FC 1AFVL 2MKLC 1N9PA 3BUPA 2EDNA 1SMAA 4C56A 5GGVL 5SX4I 1U8NA 3H0TB 5CS7A 1N3NA 1JXJA 2O5ZL 2DLIA 4PB9H 5EZJB 4R5TA 3B3IA 1T2JA 5DJXA 3HC0B 1OE3A 1OAJA 3G6DL 1DJHA 1KGIA 1NPJA 2FQEA 2UY7B 5IUSA 1J88A 1JZJA 4NO0D 1OAKL 1NKGA 1W91A 4AXWB 3WS6C 3ECVA 4HUWA 4NRZA 3TU6A 4F58L 4U1KB 4JN2A 2G5UA 2ICEA 2EQDA 1EJOH 2GY5A 2DQTL 4LXFA 4P2RE 5D2NE 5DJ8B 3VQ1C 2XWZA 3D39E 3PHSA 3PWJB 3L3OB 4PJBA 4EI5A 1VFAA 4XNXH 2F53A 1BZQK 1F13A 1JPGB 2H2PD 1A3RH 3OHXC 3OG4B 3I9AA 1OAZL 2PCFB 3PDOB 5I6LA 5FO9A 3BPNB 5B8CC 1IIIA 5I0YA 2JCCE 2JQMA 4ILDA 2V7HA 1PZUB 4HF5H 2BNRE 4OLXH 3TH3T 2QADD 2ZD0A 4JKMA 1B3IA 1QI5A 3MBXH 1G87A 2RCSH 3QC5X 1OKEA 4JKPL 1WA0X 4L8CA 1SZNA 3ATBA 4G8IA 1H3GA 4UBDC 2CPCA 1MWOA 4IKLA 2YSTA 3FSVA 1BREA 3H53A 4MA3B 5AAMC 1M56B 2AXHA 4KNSA 5DURD 2VXTL 1I1FA 3BHBA 1MAJA 3LKOB 2Y7MA 4S0HA 1GC1H 4JJ5A 3UBXB 1AKJD 1DBAH 3QIBD 2VLLB 1AO7D 2ADFH 1NINA 1EUTA 4I5BA 2G9HA 2H6PB 3NAAL 4TM9A 1NOFA 4OZIB 5D2LA 3JUYA 5FX3A 4E0RB 4GRWF 4XP5L 5JO5A 2OR7A 2DQEH 4RGNC 4Y4HA 5TH2B 3WEMA 1NICA 3SYOA 5IESH 4OTXH 1IGYA 3BSZH 2XU9A 4GRWH 1PLGH 2ADGB 3LS5L 4Y1AA 5CNHA 5DT1L 1QSEE 4IMLA 2WGNB 3SGJC 4WTZG 4YSUA 5IW1B 1IGFH 4OB5L 4K23H 5JIDA 1IE5A 3EH1A 1IE4A 1YEKH 4K9JA 4YH6A 2FJFB 3NA9L 3VQ2C 4YZFE 5IB3B 4Y8AA 4F3FA 5J7CC 5IJKC 5DHXB 3LMJH 4D7PA 3FSWA 2HG0A 4CMHC 1YRKA 5BV7B 3WFEL 1MFBL 3JTSA 4DFIA 3B9VA 3VX0A 4F2FA 2J1WA 4QGTA 1MEXL 1TEFA 4P5MB 5FUOH 4TUOB 4AW4A 1UD2A 1MHCA 3S8GB 4NAJA 1H6FA 4JQIH 2N1KA 3EO9L 3V6OE 4DF9A 1TSRA 3P4OB 3PHOA 1P84J 4LLVA 3GS0A 1T0NB 4ORGA 1NM9A 4DCQA 1UWGH 3HS0C 4FI8A 3K6OA 3VG0H 2QJDA 1AO7A 3WUWG 4WHTB 3RWGB 3ULSA 3WMSA 4UYQA 5INDA 5I8EA 1NCBH 1WFUA 4NS0A 2QEJA 3NSCA 2YR3A 5DXWA 1H8LA 2FIKA 5D5MF 4JFYB 1A6TB 4P5KA 3QI9C 3TT1L 2JE8A 1MLCA 3DUSA 2BHFA 3PFQA 4JO3H 5AVYB 2AAAA 1JXKA 3RGVC 3INOA 3TN0B 5KSAB 1LP9E 1BCIA 3DECA 3J27A 5DJ0A 4PY7B 3UOAB 1YJDH 3VFVA 4XWOD 4DEWA 4XCNA 1KPVA 5E8NB 3X12B 4DPRA 3O3BB 1VENA 5I73B 3ENEA 3IJSA 4M7ZC 4H20L 3Q1EA 2JI1A 3QUMA 1BZ7B 1MAKA 4NP9A 3WEXA 1CXLA 2IQAA 4RAHA 4F5CA 1HHIB 1WH0A 1QUNB 4GH7B 5IUCA 4YBQD 3U6XS 4HZAA 4JE0A 3J2PA 1A3LH 3CIQA 2AW2A 4LDEB 3NCMA 2YAPA 4NQDE 2HFGL 3ZN6A 2RTTA 3QORD 2HUHA 4X0KB 4NBXB 1I9JL 2IOOA 4Q14A 5DWPA 2AI0L 2FJUB 4L05A 4N2MA 2DI7A 1SYVA 2AEPL 3H9HB 4PJIF 3WHE1 2WLIA 5E23A 2CBMA 4QMEA 3I6KA 3LRGA 4NENA 5FYJU 1UZ8B 5F0LB 4LDOB 5F6HJ 2GCYB 2DYSB 3T2NL 4KVCL 5KBPA 1G1YA 3GXIA 4G9FD 1T83C 4GG6F 1DBBH 5CSZA 4AT6A 2QR0B 3ELQA 4XGZB 2K0RA 1SY6H 1G6VK 3BT2L 4NWTL 4ZUSB 4ZDHA 4CA4A 1FHGA 5CN2A 4DGYL 4I1PA 4N6RA 4PJ9D 4OD3L 1H3VA 3EYQD 4TLUA 1SVZA 4LCWD 3WE6B 2XT1B 4P48A 1AE6H 4GXFA 4UAHA 2BHZA 5EIIB 4OJYA 1ESOA 2FBJH 2FJHA 2XYBA 5DJDA 2ZUUA 3QNYB 4HQQL 3ZQ9A 2XI9A 2L7QA 4GSDH 4Y0GA 1RPQA 4TN9A 3EDJA 3LQAL 1AJ7L 2OFQA 3DX7A 3CG8A 3TT3L 1UCTA 5ESVA 3SGEI 4HH9B 2YD7A 5DJ6A 1TQSA 1CFNA 1SMOA 3FRPG 3NTCL 4LSUL 1NOAA 4Q6KA 3TTSA 2CGRH 4N0RA 4FGMA 4WCYL 1J1OL 3EF4A 3CVIL 4K2UL 2JCCF 5D2LE 3TA3D 1EXUB 1BEYL 1UUSA 4Y5XC 4P9HL 4YDLB 1CU4H 2DM2A 4B5EA 4QCIB 4ODTH 4PFEA 1OOAA 4QHLB 43C9B 1DVFB 3LKPB 1NKRA 1FPTL 1TVDA 3BDBA 2XZZA 4F7CA 2AI0H 4AZ8B 2ZXBA 3GXTA 3OAYK 2V2TB 1RKRA 2W59A 4L48A 4QIRA 3GXMA 3TWYA 1HH6A 2BCMA 2PUQT 3CSBA 3STLA 4LDLB 3TJHC 4XXCC 4H1LA 5EU4B 1BJMA 4V1DB 3D2UD 5AVXB 3FQXA 2H9GB 4F2EA 2YKLH 2RCSL 3MKGA 2J8UA 3EYFA 2ZCHL 3WFZA 1K3ZA 1TU2B 4GI8A 4EI5C 5CU9A 1U92B 2VJXA 1GYUA 2XV3A 3ZE0B 1AO7B 2E7CA 2KS0A 3P9WB 4EZKA 5KZCB 3AITA 4PLJC 3SE6A 4K7FA 5BZXA 1RU9L 2VMCA 3IJ7A 3SE3C 5ILTH 3WLBA 4N0UE 2V7HB 3U7YL 1JRHH 2X4UA 2WCPA 4OF8A 1OAQL 2EYTB 2OMXB 3PNWA 4BZ1L 4P2QB 2AEIT 2MCPL 2ZWKA 3CDZB 3OGCB 4PRBB 2D31A 3BGFC 1IBBA 1U8KB 3UO1H 3KYAA 5AL8A 3DMMA 4FL4B 2IGFH 4P2QE 1JZ4A 4J5VA 2QVTA 4L3CB 4YUEL 2HX9A 3HG1D 3HJ0A 4N2KA 5E5RB 3NOIA 5GIRA 4A04A 4A2DA 3GMMB 4R6UA 3ECBA 2X28A 1RUPH 2W94A 1KGXA 1MJ8L 4G72B 4PJEB 4ZUUB 4Y4KC 1KOAA 5EULV 3OKKA 1C5CL 3MV7A 1A66A 1EIBA 1ITBB 2VXUL 3X1GA 4AIOA 1GS7A 4W1TA 4WFEE 5C08A 3EYOB 3WN5C 2WB7A 4K9EC 4DNLA 3F2LA 2EDHA 2NNRA 2YUVA 3AS0A 1JRHI 3QDGD 1ZGLP 2NNXA 5EU6D 4ZAKD 3PXHA 4UQ2B 2DQ6A 3HEIB 2F0CA 2DW5A 2B9BA 1S7SA 1S8DB 4IOIA 4L37B 5FHBL 5K33A 3EUUA 1HU8A 4KKLC 3HG4A 4PV1C 4WO0A 3G08B 1NMBH 3WGUB 1DBKL 1FZKB 1I8IB 3R06B 1KCVH 3QWNA 4P46D 4L9LA 1LP9B 4AQZA 1U8CA 4MSWB 3ULSB 1JV2B 2CKNA 3LH2H 5HGAA 5B7FA 5I6OA 2XXMB 4JR9H 1LL1A 2XWDA 4AJYV 2IBZY 2VRKA 4MJHA 5DJCA 2OTPA 5CSGA 3ZKXC 4KGLA 2Z3FA 4X6BA 3SGKA 3WJJC 4IRZL 1JGVH 4Z23A 1LE9B 5EBWA 1B0GB 2OI9C 3V0JA 4NKIH 3QUMH 3BPOB 4QKXB 3GIZL 5DJ6B 5H37H 1W16A 5FR3A 5EU3B 9PCYA 1G7HA 3LSOA 4YFLI 3MACL 3RKDC 3MGTA 4YHIB 2PCXA 1YJDC 1OEZW 1JFQL 2AF2A 5F6IC 1RJLB 2IAAC 4LOEA 4KJPC 1SUHA 1XV8A 4RH4A 1E8YA 1SJVA 2V9QA 4QTHB 4WEMB 1TYJA 3RWCB 5J6GB 1A7PH 2YSSB 2X89A 1S9YB 1JZGA 1N7MH 1V3MA 2APBA 2BNQB 4NO3B 1GXEA 1KACB 5KJRL 4Q89A 3S35L 3JTTA 2R0WH 4RMVA 5D7JD 5DLMH 3UYRH 2AK4B 1ADQH 3GSOB 1INEH 1YJDL 1TZGH 1YAIA 3QJFA 4M6OH 3ZTCC 3DX2A 4XGZA 2R0LL 4V2BA 3WLWD 4ZW5A 4IOFC 3KPRD 2NY7L 5HHOA 3EO0A 1A7BA 5J13C 1CFQA 1WCBB 3TO4C 4KPHL 4NUJB 5FOBA 3CH8A 5J1SC 2OJZH 4Z78A 4AKQA 4LCWB 1UZ8A 1MIEH 3DX8B 3UACA 5T3ZD 4F91B 2EUZA 3IVKA 1SJMA 2WAHA 4G71B 3KYMA 4JZJA 1ZVHA 5HI4D 4FAAB 1CS6A 1BW8A 5CEZH 2PR4H 4FXKB 3REVB 4KO9A 2LABA 4KKBD 4P2RA 3HS8A 3VXPA 4NQVA 2FNWA 2PXYC 5F1OB 4OJFL 3TEXA 1SN0A 1OSPL 3FK3A 3WXVL 4F7TB 1LEGA 5IJKA 3NCEB 2DIBA 1N64L 2VQUA 1V3JA 1DE4B 4LASL 1MJJB 1ITCA 2Z7UA 4L8SB 4BXSV 1RSFA 5BO0D 2GK2A 2BVEA 5LG1A 2RIKA 3ILEA 4H25A 3KLLA 4HW6A 4OFQA 2P3YA 3FN9A 5DUMH 3X14A 4LLDB 1A2YA 5C2BL 4IK7A 1YEHL 4P0DA 3VWKB 2EDRA 3MLSL 3LPPA 2BNQA 3VXQB 2A4ZA 4JFOB 4IJTA 1S7RB 3IB4A 1AP2B 3AJ7A 4NN5B 3DURA 4GSXA 3X11B 2YAQA 2QPEB 1JI2A 2ZJSH 4LL1A 1L6ZA 4BFJA