1PCSA

The 2.15 a crystal structure of a triple mutant plastocyanin from the cyanobacterium synechocystis sp. pcc 6803
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFDADGVPADTAAKLSHKGLLFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title The 2.15 A crystal structure of a triple mutant plastocyanin from the cyanobacterium Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pcsA00
1EHKB 3ABLB 3WG7B 4YSOA 4BDVA 4BXVA 1SHXA 4Q89A 3OM3B 1NZRA 1SDDB 2HX7A 3FQ2A 1AZRA 1WA1X 4G7QB 4AKOA 1A4CA 2PPFA 1JZIA 3NJLA 5I6OA 3DKHA 4FA7B 1URIA 1NPJA 1WS8A 2FQGA 3T6WA 2DWTA 5AKRA 1ILSA 2NRDA 2VMJA 1BXAA 2EIKB 5I5JA 2PCYA 3BVDB 4KNTA 2PLTA 2E86A 5B1KA 2TSBA 4AI7A 1NPNA 2IDQA 2W8CA 2PPEA 2Y1AA 1CURA 1ET5A 6PAZA 1ID2A 2PPCA 2XLLA 4HZ1A 2GSMB 1KDIA 3PCYA 3V9CA 2DV6A 1JVLA 1ETJA 1JZGA 3AG2B 2IWEA 1ILUA 2WO2B 1GS6X 4G71B 1NWOA 2AZUA 1ASQA 4HHWA 2UX6A 3OMIB 4KOBA 5I6MA 1PCSA 4CSPA 2XV2A 3X1EA 3WNIA 4F2EA 1ZV2A 5EHFA 3NJIA 3T6VA 2OV0A 4YSTA 3WNJA 3H56A 1BQ5A 2H5UA 1JERA 4E9VA 4YSUA 1QNIA 3NSYA 5PAZA 1I53A 4DPAX 1L9OA 4ZK8A 1JZFA 3T6XA 1N70A 2HZHA 5B1AB 2QPDB 2DYSB 3SQRA 4KO9A 1MDAA 2YAHA 1PZCA 1NIEA 2HX8A 3DTUB 4GYBA 1DZ0A 2IH8A 2VSMB 2N0MA 1KYAA 2IH9A 2FT7A 4KNUA 3UGEA 3HB3B 3CG8A 5E9NA 4MFHA 3NJFA 2MTAA 1ET7A 1TEFA 1OE2A 4E9RA 2J55A 3FU7A 4WKXA 3WIAA 5ANHA 1M9WA 2GC4C 2IDUA 4DP4X 1CUOA 5LDUA 4DP2X 2XYBA 1HAWA 4YSDA 3FSWA 3ABMB 2Q5BA 4E9SA 4KOCA 2BHFA 3CZUB 3S3CB 3EH3B 3S8FB 4HCGA 3D12B 2PP7A 2R7EA 3KW7A 1X9RA 4YSPA 1GYCA 3NJJA 4DP7X 2UXGA 3CDZA 5I5IA 4EF3A 1SFDA 2AFNA 3NSFA 3NSCA 1NICA 1A8ZA 2XXFA 2EINB 1OV8A 4M4RB 4YSEA 3QJSB 2ZOOA 2UX7A 4A67A 3S3BB 1PMYA 1QHQA 1AAJA 2QDVA 1TKWA 3H4HA 4BK5C 2BWDA 1MG3C 4PAZA 3AY2A 1IBYA 3HEIB 1FA4A 1W6WA 4E9WA 2HLEB 3T71A 4A66A 4FAAB 3NP3A 1GY1A 3IE9A 3ERXA 3QJQB 2VM4A 5B7EA 1XMEB 3X1NA 1TU2A 2B08A 3X2QB 4YSQA 1V55B 2AVFA 2AZAA 4TXVB 1OCOB 3ABGA 4AKQA 2XUWA 2J56A 1CYWA 1B3IA 3S3DB 1E30A 4UF7C 3WI9A 5I28A 5IY5B 2EIMB 1JXFA 5B7FA 3NJHA 3V9EA 1BQKA 1GSKA 1F56A 1W8EA 2YAFA 2CJ3A 3X1GA 3KW8A 3L45A 4KO6A 5PCYA 4GP4B 4CSZA 3ASOB 2RACA 2A3TA 2JKWA 1JZHA 2I85A 1KDJA 2J5WA 1IBZA 2GIMA 2Y69B 2BZCA 1HFUA 4N8UA 1JVOA 4JHUA 1PLBA 3JTBA 1MZYA 3FU7B 2BP8A 3QPKA 4NB7A 2HRGA 3FT0A 1V54B 2HX9A 2IDTA 3FU9A 2JFCA 1KBWA 5D4JA 5F7AA 4GP5B 3ABKB 4BWWA 3NSDA 2UXFA 1BYOA 3NJKA 2H3XC 5FC9A 4QLWA 1A3ZA 1L9RA 3NT0A 1ZPUA 1AS8A 3T6ZA 1XB3A 4DP9X 1NWPA 1DYZA 4A2EA 4A2GA 3PAZA 1AOZA 3QJVB 1E65A 2R7EB 3OQRA 4G72B 1ZDQA 2CAKA 4GY4A 3CDZB 1AZCA 1PZAA 2YAMA 1X9UA 3UACA 1AACA 3FS9A 1FFTB 4KO7A 1W6LA 2Q9OA 2CCWA 2PP9A 3OD3A 3BQVA 1J9TA 1GS8A 5I6NA 2QPEB 4UANA 3NYKA 1ET8A 1L9QA 1NTDA 2UXTA 1NDTA 1AANA 4PCYA 2IDFA 2WO3B 4M3HA 4YL4A 3TA4D 7PCYA 1AZUA 5I5MA 5AFAA 2XU9A 3NJGA 1SF5A 3PPSA 2OCCB 2AANA 3FYEB 3PAVA 1NIBA 1PF3A 1GW0A 2P80A 1GR7A 1JZEA 2XV3A 1E5ZA 1GY2A 4W9ZA 5B1BB 1J9RA 1QLEB 2BO0A 2YAPA 3EHBB 3AZUA 2GB2A 3U25A 2ZONA 2IWFA 1L9TA 2BW4A 2VW4A 3C75A 3DIVA 2FQDA 2XWZA 1CC3A 1AQ8A 1NIDA 3PLYA 1J9SA 2BP0B 2X88A 2XX0A 1AS6A 3PXLA 4KO5A 4AX3A 1VLXA 1JOIA 5D4IA 4YSCA 2PCFA 1XB8A 1OE1A 6PCYA 4HALA 1L9PA 1OE3A 4P5SA 2BP8B 1MZZA 1NINA 3N55A 3FQ1A 1JXGA 2YXWA 4JHVA 1OCRB 4YSRA 2DY2A 3FSVA 2PP8A 5A7EA 4HCIA 3SBPA 1J5DA 5B1JC 4P5RA 1RZPA 4AZUA 1EZLA 2EIJB 3FYIB 4HHGA 1RZQA 2VW7A 3QJUB 2P80D 2FQFA 1RKRA 2XV0A 1WS7A 2PPAA 1PZBA 3FPXA 3GDCA 2VW6A 4YVUA 1UATA 4JKNA 2X87A 3FPYA 1PY0A 2ZXWB 4AKPA 4E9YA 2FWLB 4Q8BA 3AG1B 2GC7C 7PAZA 1XB6A 1A65A 2YQBA 3N2JA 1BQRA 1SF3A 1AR1B 4UAHA 3WKPA 3NP4A 5I26A 2FQEA 1BXVA 3X1BA 1IC0A 1ADWA 2YAQA 2BP0A 2CBPA 4WTQA 2CALA 3PAUA 1WAEA 2WSDA 2DYRB 3GXUB 1IUZA 1T5KA 4DP0X 1N68A 4E9TA 3ZBMA 1KCBA 3CVCA 4GXFA 3FU8A 2EILB 3TASA 3ZIYA 3UAAA 4HIPA 3T9WA 2MRYA 4A2HA 5TK2A 1A4AA 3IN0A 1PNCA 5I6KA 2GI0A 3QJTB 4GP8B 2XX1A 1KCWA 3G5WA 3NJNA 2IWKA 2FNWA 2FTAA 5D4HA 1AZNA 4F7KA 2GBAA 1E67A 4NERA 2BZ7A 2BW5A 1SFHA 1KV7A 1OCZB 1ASPA 2I7SA 4G70B 4A2DA 2IAAC 2FJSA 1M56B 1WA2X 2BWIA 4K9JA 3MX0B 3FSZA 4W1TA 1A4BA 1JXDA 3AG3B 3EH4B 4G7SB 1AIZA 4BXSV 1RCYA 1WA0X 2W88A 9PCYA 1AZBA 3TU6A 4BWTA 3EH5B 2B3IA 1ASOA 1M57B 2LLNA 2XVBA 3UABA 1NIAA 3JT2A 1IKOP 2OJ1A 1KBVA 4E9XA 2FT8A 4DP1X 5B7MA 4A68A 1TEGA 4DP8X 1SHWA 2DWSA 5AZUA 1ZIBA 2QT6A 1SDDA 1HAUA 4QKTA 2VM3A 2PPDA 2YXVA 5F7BA 1PLCA 5TK4A 1ZIAA 2QDWA 3ZX1A 1BEXA 1FWXA 4ENZA 2XXGA 4A2FA 4DPBX 1ZDSA 1BAWA 4YVNA 4G7RB 3FSAA 3CVBA 4BWUA 1AG0A 3ZDWA 2ZWNA 4KNSA 3TBBA 4N4YB 5I6PA 1L9SA 3SBQA 1YLBB 5B1JA 2TSAA 2VN3A 3QJRB 1GS7A 3TBCA 3QQXA 4YSSA 3AW5A 2GHZA 4X4KA 3UAEA 2FT6A 1AG6A 3EF4A 3WKQA 4DP5X 4RH4A 2J57A 2UXVA 2YARA 4BDVB 3H4FA 1SJMA 1PNDA 1J5CA 1PAZA 1SNRA 4L0PB 1JZJA 2JXMA 1AS7A 4HAKA 5B3SB 2YAEA 1J9QA 3AG4B 2IDSA 4DP6X 3IBOA 2I7OA 1R1CA 3GYRA 4E9QA 1V10A 1KGYE 2HXAA 4NAJA 3NJMA 3X1FA 3OMNB 1OF0A 1E5YA 1CYXA 3IEAA 1PLAA 3ASNB 3CVDA 3OMAB 1MG2C 1OOWA 3S8GB 3MBWB 3RYMA 1BXUA 3FQYA 4HCFA 5I6LA 3IN2A 2VSKB 4DPCX 1OCCB 3SBRA 1NIFA 2CUAA 2H47C 2HRHA 4YSAA 2YAOA 8PAZA 3UADA 1BYPA 4F2FA
chains in the Genus database with same CATH superfamily
5J6SA 3GSVA 2IGLA 1MFNA 5DRNA 4UAOB 3OM3B 1TJGL 4XMPL 4UYPA 4ORGB 3S3JA 5C8JA 1EANA 3HVNA 3QDJD 1KJVB 3AQXA 5KVDE 3E8UL 4Y5XB 4FA7B 2FGWL 1PAMA 3L3IB 2HKFH 5BZWB 3WLWD 2BSCA 4HWBH 3MLSH 4MB4A 4X80L 4HUUB 5HHMD 4CMMB 2QVTA 3MODL 3PV6A 4N0YL 5JDSB 2B8OT 3JWDC 4R3SA 2FEJA 3ET9F 4YHNB 3KPRA 5BO0D 1N3NB 1RUQL 4QYAA 5GXBB 2BERA 2XBZA 3OC5A 4ATTA 2AK1L 4PGZA 4MZIA 3RFZB 4BM7A 3ROLB 4WU5B 3ETBF 3I75A 1U95B 4LSSH 4BFOA 5LAXA 5C0DB 1YDPB 3PCYA 1E0OB 3TBVA 3BXNB 5GS2D 3VTMA 2AI0H 4N8PA 5JHDD 1UYWH 3P2DA 3TF4A 5D1QB 3ZKSD 1OAXL 1XGPA 4J3XA 5I8CA 3MBEB 3I02B 3AT9A 6TAAA 5F70A 4WF7A 4LSUH 4OIIH 1WT5A 3HG1B 4A7QA 4PRID 2VXUH 2Y72A 5ICXA 3WNMA 4KITB 1QHOA 2FYYA 4D2NA 3AREC 4JJHA 2IIJA 3JWOC 1EXUB 4JQVC 5EEXA 4NCC1 4A7UA 3QXUA 1P7HL 3ARUA 3VXME 1JTTA 2CA4A 3I9GL 1T6BX 3GIVA 1XH1A 1MFDL 2DYSB 4XO8A 4CILA 1T03H 1XTLA 2HX8A 1RULH 4GMTH 4F7CA 4FHBD 4JO5A 2IOOA 1RJZB 3D0VA 3P0YL 4G7YL 5DURB 3MV7D 5EPMB 3UTZA 4IJ3C 3MYJB 3GUFA 1R24A 4B7IA 4GRLA 3QZPA 4OB5L 2FJHA 3LIZL 3FU7A 4Q6IC 1OD7A 5HHNA 3GMOA 1SGKA 4OGXH 5GZNA 5C92A 1IAOB 2CPCA 1PEZA 3L3OA 2A9DA 1JZ5A 4ALAH 1UM6L 3IF1B 1K8IB 2IV9A 1N0LA 1QSFB 5LDUA 4DP2X 3WTWA 1YAIA 2ERJB 4MDJA 1B0GB 4XP5L 2A1WL 1DJXA 1K85A 3U30C 2X44D 5DJXA 3RY6A 2ZXGA 2D7QA 3HRPA 3W56A 2ZUUA 2RAMA 1QFHA 4LBEA 3BDXA 1XR9A 3CDZA 5EIIA 1BLNA 1I8IA 4JR9L 5KSVB 4ENED 1TZIA 3ZDXF 1Q9WA 5DFVC 1A8ZA 1ZAGA 4YSEA 1DE4A 3KJ4C 3NZUA 1XO8A 4HFUL 1MPAH 1XIWA 2WVVA 4M7JL 4PJ9D 1PY4A 5FO7B 4QF1A 1FE8H 5A2JH 1LE5B 3CBJB 4Z7IA 2P47B 4XN1A 2AQRA 4ADGA 2E6PA 2Z7UA 3MGAA 4Y1AB 3DUSA 3HEIB 5E6ID 2WLMA 4GXUN 4FXKC 4QCIB 3TO2A 5B39B 4JFPA 1K8DB 4HIHB 2IH1A 2HLEB 3H9ZA 3NPSC 2W60B 1QUNA 3RBGA 1AGBB 1IGJA 2OTPA 3BAKA 3HUJB 1DQMH 3NP3A 5GGTL 3QT2A 3MV01 3DPBB 2K4AA 4MA1C 4AL8C 1UH2A 3KYKL 5CN3A 1DVFA 2AVGA 5IQ9B 1I8MB 2J21A 4L29A 2M2DA 2VMCA 3AY4C 5EF3A 3P30H 4O9HH 5EU5B 1CDCA 2R56H 5GRVK 3L48A 4TTDD 4FZEL 5BS0D 1IVLA 3QNZA 1LEKB 2ZSWA 4J6RL 4UF7C 1QBLH 4HWZB 4MQ7B 5T1KB 5MEOA 2BJMH 3HNTL 4U1KA 1JZ2A 4APQA 3FT9A 4XZ4A 5DHVB 2AAAA 1TQWA 1CFSB 3IBEA 9CGTA 3QXTA 1FH5H 1RSFA 4RFOH 1JUFA 4M7KH 1U91A 4DJMA 4XN2A 2JKWA 4R4NC 3HS0A 2XN1A 4UQAA 3GMNB 4MYWB 1KDJA 4K3DL 1CTMA 1OZUA 4FFYA 4N86A 1S46A 4OBSA 4IBQA 1IGYA 5CP3A 4LOUC 3CLFH 3Q6GL 4XPFH 2Q3ZA 2WSKA 1QFPA 3GHBL 2JELH 1TENA 3L3GB 4NB7A 2BRRL 1I1AD 4XOAA 3M8OL 5E94A 1IRAY 4HLJA 1Q9LA 4L23A 5DMGC 3ZDZE 3KH4A 3DX0A 2RR3A 5T3XE 2WZPA 5LKNA 1EZVX 2VLLA 2OMZA 3D3VB 5EOTA 4QJ3B 1DQKA 4KUZL 1FG9C 1CCZA 5AKTA 4JJ5A 3UTPE 3GF8A 2MCPH 1UWFA 2B77A 1U8HB 2GK0A 1ND0A 3DX9A 1FO0A 4YWGH 5C1MB 4OZGB 4MNQA 2YBGA 3WNNA 4NQEB 5DEJA 3TLRA 5KG9B 4YHYC 1J5HA 5F7WC 2CO6B 2KS0A 1XL6A 3CX2A 4MMXB 3OAWA 4R7VA 4XAWH 5I15H 3V4UH 5CN1A 2DWEA 3DVNB 3P40A 1U4EA 1C5DB 2C1OB 4G1EA 4R97C 1J88A 1RIUL 4WCYH 1MF2L 1U6AH 2QPEB 1A4KA 3BUIA 2ISDA 1DHKA 1SPDA 1MWAB 1WH0A 4HIXH 3HG4A 5IJKA 1PBYA 1UQSA 4NFDA 3TA4D 3V0FA 4J8RA 3WD5H 4W9EC 5TTRA 4L9LC 3TO4A 2W9DH 3E9UA 4XNZB 1LD9A 4CA4A 2EIZB 3CVHL 4XP1H 3H7LA 1GR7A 2WO4A 4TLKA 2Z35A 2W59A 2OLDA 2R8SL 2BO0A 3K6FA 1VZIA 5IHBA 5HGDA 1AR1D 3D06A 1FCGA 1JHLL 2FIRT 1J1XL 1QW8A 4IOSD 3PLYA 4M7LH 5I1HH 1GGTA 2PW2A 3T8MA 4AWJC 2RD0A 4LLWB 4HVBA 2GSIA 3QDMD 3VB8A 4CVZB 1OAUL 1FSKC 3CDCA 1KJ2H 4QAWA 1WC7B 3JWNH 2VIRA 2P43B 3ALWA 3QS2A 4FNLL 1EGJL 2YQ2A 2VOTA 5FYLD 2ZXCA 4LE8A 3OKLB 4P5RA 4RMSA 5L8KB 3QHZH 5EO9A 3GMQB 2H6PA 3HBPA 3ILQC 5E1HB 1UM5H 3RVUD 1QR1B 2HSIA 1I7UB 1WS7A 2YWYA 3X14B 2HLAB 4EDXB 2Y6SC 2AABL 2ADJA 2IXQB 4I77L 4KXZI 5GSRB 4ANVA 1Z1WA 2G5RA 1KXVA 1UB5A 2ZYSA 1O6VA 4G9FB 4AKPA 4RCAA 2J1WA 2QVMA 3TM6A 32C2A 4O58H 4NJAL 2KDYA 4D7PA 4Z7OE 4QOKA 2DIBA 5LDSA 1NCAH 4QXVA 1U8CA 4KXZH 5I26A 2H3KA 2EYRB 2VDPL 3W38A 2CU9A 1X5FA 3HZVA 1HESA 1R33A 5DUPH 4FTVA 5TGBA 4PU2A 2CIIA 2VDLB 3CVIH 4J4PD 3SQOL 2P8PA 1OTTC 3SKNA 1N68A 3BE1H 3O6ML 4X2UA 4WEMB 5FGCB 3P77A 1RQ5A 4QEGA 3RILA 3DJTA 4KKCD 4FJ6A 3QRGL 1UOKA 2F58L 3B5TA 1NKGA 5K69A 2PO6D 3TT3H 5EF2A 1CVSC 1HWWA 2ID5A 1NDMA 2DBLH 1ETB1 1N5AB 4K3JH 1HJCA 4PBWD 4NRYA 5EWIL 1KIPB 3RDJA 1GAFH 1RLWA 2Z7ZA 3DETC 3H7BA 3L4TA 3VXPA 1MH5B 4EUPH 4YHPB 1AQDB 4HUVB 5D4HA 3O9WC 4F91B 4PJCB 2H32H 3JQOB 3HE6B 4P99A 2C9PA 2EXWD 4DNLA 3ELQA 1BEYL 3GS0A 4N0UE 3FO2B 3QXDA 1Z3GH 1DANT 1OARL 1JXDA 3GZOA 5HHOE 1LO5A 4BXSV 5DD6B 5BVPL 3G08A 1E4KC 1EPFA 1IGTA 2M1KA 3EH5B 1BVZA 1Z9NA 4JDVB 1MCKA 1TQBC 3ARZA 2GBVA 2OI9B 4P3WA 1A9EB 3CU1A 4XAKD 1EO8H 5DEFA 5HI4D 2QSVA 1RJLB 3CMOL 5JW5B 3HPJA 1BMZA 3GBNL 5FM5O 5HYEA 1AO7A 4QHLA 3E9TA 3FFCD 1BP3B 4X6CA 5EORH 3BH8B 4KK8C 5LNEA 4ZDHB 1MIEH 1SBSL 3O2DA 1BEXA 3EJZD 1F4XL 3TA3D 2F19H 3BO8A 3UYRH 1RJCA 2VXTH 4NS0A 1BAWA 4ZMZA 2BHZA 1NCOA 3FTGA 5F1NB 4XC1L 4FFYL 2ZWNA 2C4FT 3C09C 3MLVH 3GNML 1CL7L 1L7TH 2EDLA 3TVMA 3BIKB 4N8CL 3WFZA 3LN4A 3RIFK 1WLHA 4NNYB 3BH9B 2LU7A 1PX4A 5D7JD 4FQQA 4RNRB 1ZV9A 5K93A 3PWPA 5B8CA 1SMDA 2LABA 2B2XH 1PNDA 3VWKD 1E3ZA 4HC1A 4ZNCD 2X0WA 1BJ8A 2WNKA 3CPLB 4M61A 3KWVA 4E5XB 2IAMA 1Q0EA 5KVFH 2BNUA 1O7SA 2Y06H 5JTWA 1KELH 4FC3E 4TULL 4Y2DA 3T4YB 2ZUVA 3LMJH 4H8VA 3WJJA 1Z9MA 3QFJE 2B16A 4OW6A 1DSWA 1JK9B 3C6LC 1S8DB 3IPEA 3P4MA 4ZAKA 4WKZB 5MENE 3QUYD 3RIAK 1OF0A 5C0FA 2ZCLL 4JDEA 4MVBD 4Z7UA 5ABAA 1UADC 1XVSA 2DKMA 2J25A 4X4MA 3ES6A 4J1UA 2AQNA 5KSUA 3ULUC 2VLJD 3S8GB 4YBLB 4JFFE 2OCFD 3IGFA 3LRSA 4HPYH 4ZNEE 2CRYA 3HI5H 1HT6A 5FM5M 4UZUA 4N22A 5AOMA 3S96A 5KSBF 1Z3RA 4L3AA 1E40A 2PXYB 1KJMB 3UTSB 1BWWA 4PQXA 2BOCB 4KVCH 5BZDA 4WO4D 3VX1A 1MW0A 3EOTH 3CQQA 2GAZB 1BJMA 1EHLL 4FQ1H 4HWNA 3ZR5A 3WN5B 1Y18A 3H53A 1SHXA 3BVTA 5ESAB 4JY6A 2FD6H 4G8IA 1C1EH 1X5XA 4JAMB 5GS1B 3FAXA 2R1WB 2Y7NA 5L4MA 5HDQL 3MRJB 2HWZH 3M1OA 1NPJA 4MD5A 4TRPH 3EJYD 1ILSA 1I7TA 4ES8A 4UT7H 2EIKB 3MOBH 3EDFA 3IK2A 3U1QA 3GUTA 5DYFA 4PFEA 3IXTB 3L08A 5DLML 2J7LA 4HMCA 3OKMA 1IEBB 3B2VL 3ILPA 1KDIA 3BJ91 5MHSE 3QEGL 5KJ7E 1EDYA 4UMGA 3WS6A 5C0CB 5FOBA 3GMPA 4HIQA 3U82B 5TFSH 3BZ4B 2JSFA 3K74B 2F7OA 2FIKA 1PG7L 2UX6A 2Z31D 1RFDH 4FYQA 5K1JA 5I6MA 1KBGH 4EBQH 3SGJC 4XE0A 4AYFB 4IIQC 3WNIA 4YXKH 4YFLI 5JIMA 2NNFA 4NP9A 4KRNA 3V6FA 4UM9A 5LB1A 3S35L 1XGYL 2VN4A 3UTSE 3LQAH 3NQKA 4E41D 4B7LA 4ZK8A 3P9LA 3PQYB 2EQDA 3KAAA 4AIOA 4ZFGH 4UDUB 5IMLB 4BFRA 5K9OA 4KO9A 2YAHA 3RQ3A 5AB9A 3RZCD 2Q2EB 3U2JA 4AVHA 5CD5C 4EI5B 3FCGA 3F7YB 1AKJD 3BPOB 2DWXA 4NHUA 3FT2A 3IJEB 1JCVA 5FECA 1R3JA 4WKXA 2XCMC 4L8SB 2WN3A 3AITA 1MHCA 1MCLA 2BNRA 3UC0H 1NCTA 2P45B 3Q8FA 2E9BA 3ZGIA 3GBML 4I2XB 1SY6A 3W9EA 4N2FA 4M7ZC 1HKLL 4M1DH 1CE6B 2ZPKH 3DXAB 2D03L 1LEGB 3FSWA 1KXQE 4X5RA 3L2LA 5D1QE 2Z4QA 2BHFA 5J8OA 4ELDA 3S8FB 4HCGA 1QVOA 1INDH 5DHYA 5T3ZE 1Q9KB 4M9OA 2EC9T 1JPFB 3HG1E 5FW8A 4X0KB 3RVXD 1F3DJ 4OCYH 3OV6A 2ZKMX 3MCLH 4KKBD 1INEH 1U41A 3IFPA 4Q52A 3CUPA 4M4RB 3V4PB 1OO2A 2AJXL 1QWNA 1KPVA 3FQRA 2OSWA 1CD1A 2NT0A 4XPBL 1EEYB 1JYNA 3H4HA 1ZHLA 4WJ5A 1HKFA 1BD2D 5A2AA 4BQCA 3MRDB 3GIZH 3D33A 5ICZA 1C08A 3DSNB 3MJ7A 2BY3A 4JG0H 2PYFA 4WFEE 1DP0A 2JJVA 4PBVC 4M02A 2WZAA 3AU1B 3BSHA 1IAMA 2GJ6B 2M26A 3QJQB 3PP4L 1NAMH 2E76C 1AFVL 3MOAH 5HXMA 4CDGC 2V6HA 2EKJA 3SPVB 3MUGB 1QSFE 1XGZA 4DFIA 5DU7A 2VXVH 3QULA 2DDQL 1PFCA 3PHQA 1ITCA 4OCXH 4Z78A 1AY1H 1YEGL 3VRIB 2ZOKB 5IY5B 4P04A 2PN5A 5GZOA 1MJ8H 4UQIM 2OYLA 5L2KD 1XGQB 3F01A 4G8EB 5IFAL 3LH9A 3IVKA 3QUMH 4IIZA 1WFIA 1AE6L 3CHQA 2E7LA 1GGIL 2Q8BL 3B37A 1OW0A 3RVVC 4HBCH 4YO0A 2UWEB 1XGRB 4JQIA 3QVAA 4P2YA 1HFUA 5GJSL 3VFMB 2WXHA 3V6OA 3LEXA 3MUY1 1LO4L 1QP1A 3FT0A 2W0FB 4JW3A 2ORBH 4NWUH 4Q74A 4A7TA 4GUCA 3SYQA 1CB4A 3TNMA 4Q0XH 4XN4A 4LSSL 4OIAA 3V7MA 2CLVB 2NYZA 4Y1AE 2Y2YA 1CQKA 4W4OA 2H3XC 2PTTA 5CGYD 5CWSB 5DGQA 3TIDA 1QYGH 3NT0A 3DUUB 4KTEH 1N19A 3VXNA 4PV1C 4ZSOA 2Q76B 2DJUA 3HUJE 1LWHA 3US1A 5LGKA 1H3GA 4D3CH 5BMFL 3KS0J 4QLRA 1UM4L 1MCEA 3BGFB 4MJJA 4A2GA 5FR3A 5HYIA 1AOZA 2D31A 1SEQL 3QUZD 3MA9H 2XA3A 3KXFD 2CBTA 4OIIL 5HHPA 1ZDQA 1TTBA 4Z8FH 1VKXB 4KK6D 3JUYA 4OU3A 2E9JA 3EYUL 3I9PA 4JRXD 1G6RH 2P5EB 5HYSB 3B7UX 3D52A 5ICUA 2WMPB 1I7RA 1TQSA 4U2YA 2JJWA 1BZ8A 2BVQB 2VC2L 3IETB 3H6JA 3QDGD 3NCJH 3BUTA 1B4RA 1KTRL 4N9OB 4XMWA 2CRMA 1UXLA 4G8GD 4W9LC 2YA1A 3I2CH 2NY1D 3FF8A 3FKUS 2V4LA 1ET8A 1L9QA 2F8IA 3NYKA 4XVTH 5ERWB 4CC4C 5AD0B 4JREC 3SPIA 4LDEB 1CLOH 4QKXB 2V9QA 4O02H 4H8QA 4KX7A 1IX2A 2IG2L 1SF5A 3AVEA 1F4AA 2G2PA 4OGXL 5JHDB 2AANA 3T0WA 4MS8C 4KMTH 4GLRI 4Y19A 4YHKL 4Y4HA 2P80A 3OKYA 3EJTA 4OI9A 4HS3A 1IILE 3CWGA 3D3VE 1NJ9A 2X70B 4JM2D 2VAJA 3AZUA 4RFEA 3MCKA 2IWFA 3LN5B 3GMLA 2VW4A 4GLRH 4YDLB 5L9DL 2H2PD 3TZVA 2NSQA 4EOWH 4NFBA 3BCFA 4OKVB 3GI8H 5KVDH 4G6KH 2XX0A 4OZGE 2QADD 2MNWA 5I73B 3EKCA 5DI8A 4WWKA 2Y3AA 1JPSL 3DC0A 3Q1SH 4NQEE 3QYMA 1UD8A 1GIGH 1OSYA 5HYJD 1L9PA 1LK2A 1OE3A 1QEWA 3KCWA 3NFNA 4TTGA 3ZVVA 3DGGB 3MV7B 1MPAL 2J8UA 4FL4C 1NBVL 3QAZC 1FE8L 4M5YH 1NSNH 3PGDA 1CMOA 3REVA 1UUSA 3SO3B 3MA7A 1RZPA 2XZAH 4I4WA 2WQAA 1MFEH 2RFXA 4TVPD 2X7LA 4NX0A 4XVUC 3QJUB 4ABWA 1XSJA 3CFEA 3F00A 1LK3L 2MKWA 2VDNL 3P73A 5BW7C 1IB5A 4TUJB 1O9WA 1PY0A 3IT8D 3AQZA 1VEMA 3GGWB 5E51A 2BOBA 3FQNB 4BRVA 3G6JB 2XQ0A 3EFDL 3JV5A 5CJXC 3P30L 2AEPL 2R56L 2ZIDA 3N85L 3HG3A 3C12A 4S1RH 5H37H 3WXWH 3S34L 1USZA 1Y1UA 3FW6A 1F3DH 2VITA 5T5NF 3VDAA 3UH8A 1G1CA 4FHKA 2EABA 4L4TB 5GGUB 4HUXA 2CDEB 1CF8H 4G7VL 3MXWL 4NQXA 5CGBA 3CXDH 3I6LE 3KPOB 4UT9A 4HIJB 3MV9D 4KTGA 4FFVC 5F9WC 4IK7A 5H35A 1F11A 4N8VA 3OJMB 2VLKE 3RNKA 4XPFL 4YDZA 4HIPA 2Y7OA 4LVHC 2AXHA 3KPPB 1E9PB 1JMXA 4OLZL 3IN0A 5E0QA 3SYAA 4OLYH 3IAPA 3KEHA 4JQVA 3JTTA 4OGZA 3KGSA 3O8XD 4IMKC 4JZNB 1EV2E 5AW0B 3C08L 2FNWA 3NIDF 5BZXA 4K71C 4KGJA 2MMXA 5JHLH 4M62H 2BP5M 5AOKA 2BVOA 1F1DA 4UT6A 4F7KA 1VCAA 3FQWB 4NERA 5BS0B 1KB3A 1K5WA 4G9FE 1OCZB 3ARFD 2MCPL 2K6ZA 4DW2H 5E08L 4OD3H 3FCBA 4OTXH 2WWKO 4L3CB 5IK3A 1T22B 3VFOA 4UQ3A 1E7VA 3T2QA 5EU6A 3B7YA 1S7XB 5D7LA 4PWEA 4X6FA 4KRPB 4Y5VA 5GGSB 5JIIA 3A24A 3ULVD 3GSNH 5IF0A 2FT8A 4AM0A 3EXJA 4DP1X 1FNEB 2Z8SA 5CKGA 1X7TA 1ZLWK 5KJRH 3WIIH 5A1AA 1VADB 2CWRA 1BFOB 5K9JH 2MWCA 4B9CA 2VLRA 3TEUA 5FGCE 1K5NB 2WQ8A 3U1SH 5ID1B 2CK2A 4U0RB 1FDLL 3WEBA 5DS2A 3EYOA 2WHVA 5IMMB 4XNMB 1P5UC 1CFVL 3KPRD 5K39B 1DUYA 2MPVA 1ZIAA 3TPUA 4PJGA 4FMFA 1COBA 4NKMA 2K70A 2W9DL 4IRJC 4BZ2H 5D6CA 1BLIA 4DUWA 1MW1A 1WQVT 1SXCA 5L8JB 2HG5A 1QOKA 3VUAA 4YVNA 1XBRA 5J13C 2C9SA 3KS0H 4H1LA 4CVXA 3K4DA 3OWEA 1HQ4B 3C5JB 1P7QB 2CDGB 4KJQD 4PJCE 5FYJH 5IB3A 3HHMA 1QUPA 4DGYL 1P5VB 4S11A 3EUDA 2NNAB 2MOGA 3CN1A 2VN3A 5CD3B 3WUZA 1C5CH 4M7LL 1XH3B 1LP9F 1I3UA 3C5SA 5DS1A 3SY6A 4PJFB 2VZVA 5CJOH 5LWYH 1CD8A 4F1SA 2VDQH 1AQKL 1ZT1B 3IJYB 1WIUA 4C4KT 5H94B 1KJ2L 3G5XA 2JKTM 4JM4H 1AGFB 3A6CL 4M93C 2BMKA 1DL7L 4Z3HA 4L8DB 3L9BA 1NGPH 4QY8B 5KANI 3LNFA 2LU3A 2V8MA 4ELMB 5G4OA 4J28A 4GRLD 1S7TB 2H1PL 3IEAA 4HP5A 3O45A 5C2UB 3FXIC 2V3FA 3UEQA 2BOLA 4JO1H 2NXZC 3N43B 4Q9CA 1PZUB 3NCBB 1IM9B 1BREA 3RYMA 3OR6A 1BSIA 4H44C 1MQKH 1WP6A 1UA6H 3MRNA 1O6TA 1MHPL 1AGEA 5F7EH 1NCAL 5DJ2B 3WL9B 2HFGL 4X98A 5LVEA 1DEEB 4DPCX 4HISA 4PJBE 4UDTA 4I88A 1RZ8B 5JOFB 1HC1A 3SKUD 2LAGB 3LCYA 4KROC 5EIVA 1TTFA 3EBIA 2VLME 4TLTA 4AYBA 3MHZA 5DDHA 2HX7A 1CDJA 5D7KE 2TRYA 3LZFH 4ZS7H 3RUGB 2HVKB 4MNHB 3TBSB 2C7UB 4WFFD 5I6OA 1MJJA 2GJZA 2N3JA 3LSOB 4N2BA 4AIXA 4MJ5A 2DQTL 3TT3L 3S4SB 5CF3A 2ALWA 2A6KA 1LJMA 1ML0A 3GJFA 2A4CA 4M5TA 3HB3D 4ALAC 3H2QA 5C0EA 2VABB 3CN2A 1HSAA 2W8CA 4W9KC 4OD2B 2AV7A 2W94A 2F53E 5HYQB 2PPCA 3PJSB 2XFXB 3DYPA 3LNHA 4OLXL 2IH3B 2EYTA 3GLZA 1DVFD 1SM3L 1BFTA 5DHMC 1ZLVK 4F2MA 4CNIB 1M3IA 3CFKB 2X4NA 2WOYA 1I3RA 5I75C 4RLDA 5AZEL 1Q94A 3X1EA 4N2GA 2R23B 1ZV2A 3OGOE 1ZLUH 2ZAHA 4AQ1B 1CG9A 4DZBB 3VQ1C 4ZFZA 4DGIH 4YSTA 3L95A 4JL2A 3WLBA 4X6DF 5IB2A 4BFFA 4DEPC 2HVBA 4Y4KB 2ZOLA 1TZHB 4QO1B 3PG2A 5ESVB 5CR1A 1JZFA 4K94L 3G5VA 1F3JB 4ANKA 3WJMB 4FMKA 5F21B 3DTUB 4P2QA 4GYBA 3I50L 1D5XA 1FFNB 2QQLL 1NFDB 3G5ZA 2HJLB 4BKSC 2IH9A 1I8KA 3IB4A 3DRQB 4KJWD 1S7RB 2C3GA 3SZKC 1E2VA 3NJFA 3H3KA 4CW1B 3L16A 3D1MC 3UYRL 5F3BB 4OT1L 1QRNB 1OE2A 4XC3L 2WLNA 2WZPD 3L3KA 2WTRA 4AEHH 43CAA 2C9UA 5DZAA 2RA1A 3FQTA 3MLVL 4YSDA 1U2HA 1SEBB 3IDYB 5IFHH 5C0CE 3ABMB 3OHXC 3WIFB 3GZQA 3OVUB 1ZGLA 1MIMH 4MNQD 5FIEA 2K4WA 1E90A 5CJ5A 1ZLSL 3BGMB 4LEOA 5DR5H 5IJVA 4GI6A 4EN3C 2B2XL 3IJHA 5AYQA 2UZYA 2FEDD 2OMXA 2UXGA 4GSUA 5EBMA 1KENL 3SDXF 1Y7VA 3CFBB 1HOCA 3W2DH 2Y06L 3QJSB 4QTFA 2AK4B 2D73A 3MRIA 1SUJA 3NZHL 3PQYE 2DQJH 3LMJL 3TA3B 4F1ZA 1A22B 1I9JL 2VL5B 4R5VA 2GT9B 4PAZA 5L0QC 4OZHB 3BAJA 1FA4A 4JO2L 2X3CA 3BSGA 4L1DA 3QFDB 4BIKA 3O11B 2OA9A 3T71A 3SKMB 4DIXA 2TRHA 5IEKB 4KK5D 1N18A 1DFBL 2OMNA 1G7JB 4N2OA 3HI5L 3ECVA 4R96A 3X1NA 1K9TA 3TN0C 5CAYB 4XCNA 5E6UB 4GOSA 3LKQA 4IMLA 2X4RA 4RFNC 3RHWF 2HLFD 1F6LL 2DWDA 4I2XE 4PWKA 2AMGA 1F1GA 5DQDH 5I1DB 4FFZL 3VWKB 4M48H 3WI9A 1RVFL 3O9WA 2WWMD 2HA1A 3ASWA 4CAGA 5B7FA 4FQ1L 4LASH 2Y0SA 1CIDA 4NZ8A 3AXHA 2EJ1A 3X1GA 2QFRA 4ZFQA 3ZL1A 1KIQB 4CSZA 5EU7C 2OYMA 5EIIG 2OMTB 3IJ7A 1NCJA 1UXWB 3THMH 1L7IH 1T83C 2DH2A 1E4KA 3PHAA 4I0PA 2XY2A 4TRPL 4LKXA 3O0RH 2EYSA 2JK5A 2QJDA 5AW5B 1AIFB 1OAKH 1PLBA 4RZCA 4N9GA 4P3DA 3MOBL 4CKVX 3JV6B 1C7TA 2VLJB 5DMIH 3VFNB 1OB0A 3VYPA 2E6JA 1MCQA 4PJIB 3NSDA 5AW7B 3TEZA 3RI5F 1KFAL 3D2UB 3T3MB 4IKJA 1DO5A 4Y16C 2WQXA 4P5TC 1VSCA 4JPIB 3GSRA 5DA0B 1XB3A 2GJ6E 3V95A 4HFWB 3ULAB 5HGGS 2NY2D 4WO4B 3AS3A 5TD4A 5DEZA 4N0CC 2Q6WA 1OSEA 2A2QT 2W65B 5DQJA 2BS8A 1BZQK 2ARJA 2BSDA 4IEFA 2JF1A 4K7PH 4KI5E 3JBG7 1HIMH 1HWHB 4FTVD 3STLB 4PP1D 1TTCA 1CYGA 5EUOA 4Z7QB 5I17B 4NC0B 3ARBC 4RGMB 5TE7H 2IQ9L 3JWNC 2NY6D 3KPMA 4HJUA 4C83A 2B20A 2J71A 1W6LA 1WWCA 1TSRA 4HHAA 4B97A 4YR6B 2Z91B 2DQDH 1MNUH 4P4KA 1QQDA 3U7YH 2FWSA 5C09A 2F18A 1W0VA 2UWEE 5KSAC 1BJ1J 2OJZH 4P9HL 1AZUA 2Y07H 3GS7A 4WEUD 3FO1A 5IHZA 3IU4H 2D3NA 4J6IA 3ESUF 5EA0L 3ZYJA 3BZEA 1Q1JL 3V4LA 2WWNA 3NABH 3F64A 3BPCA 3UC0L 2CKBA 3ZDYB 2BY2A 3L7FB 3W0WA 4PJ8C 1TMQA 1L0XA 3EJRA 4NN7C 1OM3L 4ZTOH 4KQ3H 5C7XH 4HIEA 3U25A 4NT6B 5E9DA 2QMJA 4L3FA 3PWVA 3QQ3A 1AQ8A 5JXEC 4OIBA 1NLDH 4TN9A 4E41B 1HDMB 4YDKH 4AX3A 5E23A 4ZPVB 2ADGA 4LCVA 2H8PB 3LD8B 5AW3B 3QZBA 2P5EE 3REWB 1PGRB 2PCFA 1OLLA 2WLYA 3H3PH 3KWTA 6PCYA 3GSUA 3D87B 5HDWA 5J3HD 3GPEA 4P2OB 1MELA 4X99B 3ZZQA 3T04D 1AO7D 1SN0A 4PRHB 1R0AH 4Q9QH 1G7IA 1H8LA 1FL6A 2OX5A 3VI4F 4UTCA 3SKJH 1W72H 1E4WL 1OQOA 3IDNB 4FYSA 5AVVB 5JIPA 2G60L 4NQDB 4DQAA 4I48A 3CDYA 4Z7NF 3QUXA 5JPNB 4YGAB 3GDCA 5IFJA 1F00I 1HHGA 3AWFA 5JHDE 3G6AA 5TJWK 4N85A 2KT6A 1U8NA 1YZZA 4P2CG 4PN6A 2WB1A 1UH4A 4PV9B 5HPMB 4R8WL 5FGBC 3MR9B 3WTYA 1XTMA 1A65A 4LF3A 7CGTA 1WAAF 4PCKA 3BWSA 5AWNH 3L9RA 3NIFB 2WAQA 3TVMD 2VTFA 1AY1L 3PWJA 5DXWA 5F9OH 4RIRA 5ID0A 1REIA 2ZKXA 1MJ8L 3IMTA 3OXSA 1D5ZB 3BCDA 3PWPD 3D69B 5D5MB 3KWUA 3BHBB 1KZQA 4S1DD 3HG2A 2FSDA 3ZTEA 1CDHA 4H8UA 3MLXH 4HOZA 4LCIH 3QUML 3T4AC 1OHZA 2E6QA 1KEMH 3U2IA 1HHKA 3T65B 3ZBMA 1HEZB 4AE0A 1T2QL 4PB0H 2CIKA 4XBGB 3H9HA 4HBCL 2WLJA 5T1MA 1BZ7B 2DLFL 4IIQA 3BP7B 4X6BA 4Y2DD 1L4IA 4MNGB 1ZSHA 3ZIYA 5FUZL 3MV7E 4PJHB 2MRYA 5AAMC 4BFKA 3NACH 1JGDA 2I60H 4ZAKD 1RH8A 1GJIA 3SGKA 1HHIB 5HGBA 1RZJH 2GSGA 2BNQD 2D8KA 1L9NA 4LKCB 5EO0B 4KTEL 3NOIA 5FO9A 4MKTA 2R1YA 2VE6A 4DEUA 5T3ZH 1OT1A 4K7PX 5CSZB 2KH2B 2WZ5A 4UIKH 2RQ8A 5HBBA 4AG4L 4XTRC 1KLFA 1UURA 4K07A 3G6JE 3P3SA 5L2KB 1EZVY 4Z8FL 4HOXA 2FYVA 4LSQL 5EF1A 4MCMA 1U3HB 2V8LA 5E99L 1G6RL 1RK1A 2X4OB 4NN6B 5GPRA 1L5GA 2Z8WC 5CJ8A 3SDDB 5L4JA 1MHHB 2I27N 4L4TE 1FN4B 4OF7A 1DQIA 2QSTA 4B9FA 2WINA 4KJYA 1K4CA 4I89A 4F5CA 4IU2A 2PKDA 4GT7A 2R69A 3UC2A 3GEWB 1B3JA 1S9XB 2HKHH 2XACC 1GHFL 1H3PH 5ALBH 4UIMA 5GJTL 5HHQA 4S0HA 3HIZA 4NUGH 1E4HA 3X12B 4O02L 2CM5A 4LSDA 4M5ZH 5DJDA 1KB5B 3HLAA 3VG0L 4QNPE 1ECZA 5AB2A 1TQTA 4R0LC 5IMKB 2J6EA 3ZXAC 3CC1A 3QCVH 4BH7B 5D7IB 2AQ3A 2QKIB 4JFYA 4KMTL 4MJ6B 5JZ7D 1T0NA 1YPZB 3ECBA 2ICEB 5DFWH 3FSAA 4ES9A 2AC0A 1VFBA 3DX6B 2XVKA 3Q8AA 4GW1A 1QBBA 5ITFB 2EEDA 3KXFB 2BXYA 2XG4B 1VRSA 1IE4A 1MCWM 4ZFFB 5BS0E 3NIGF 2AXFA 3MJ6A 4OGQC 2AJUL 3QJRB 2CCLA 4P2RD 3U4EB 3VQMA 5KN5B 4YSSA 4GG6F 3BP6A 3VJ6A 5IOPA 3K6SB 1NGQH 3H1ZA 1FP5A 4RH4A 2JI1A 2H4EA 4UM9D 2GFBA 3Q1SL 4U1JB 2BP3A 4G8GB 4UZGA 4F15C 4K2UL 4PJ7B 5IHLB 12E8H 2EDJA 4U6XA 1BZDA 1FFOB 2QSQA 1RSYA 1AS7A 3LS4L 3NCXA 5EZIH 4MWFA 3LN9A 4U1LA 3EGSA 4M5YL 4EZKA 1BJ1H 3VFUA 3PWLA 2X5PA 1KIRB 1KTDB 1P4UA 5TDPB 4HJGB 2XZAL 3FUFA 4K23H 4L05A 1LILA 1OGTB 4ZQKA 1YEEL 4MJIB 1EXHA 2YSSA 4TUKH 2JJUA 1RUPH 1BAFH 1LO3H 1TZ8A 2NY0C 2AJVH 2CHWA 2X53A 1OOWA 4MSWA 1BX2B 2L7JA 1LM8V 4P05A 4I3RH 2ZICA 3SE8L 3RY4A 2APFA 4LGRB 1Z32X 2E59A 5EEVA 4XGZB 3WXWL 5EULV 4B9GA 2GY7B 1KPRA 2H47C 3DRTA 2EIEA 2NNRA 4MAUH 1N59A 1ZHNA 3LQAC 2JWYA 3QH3B 4YBQC 1TZGL 4MA7L 5HYJB 2XQBL 3WG7B 3MRPB 4JKLA 2EDHA 3CXDL 4AEFA 4BXVA 4PJFE 5DVLA 5I66A 2HN7B 5L4IA 2CKBL 2Q7YB 1SLXA 1AZRA 2CJTA 2G3MA 3BP4B 1RU9H 1XBDA 4JM2F 2ZUQB 2V5RA 4NSKB 3TWCH 4DKEH 2JQAA 4WK2B 5AKSA 2E7DA 2YPVA 5CNHA 1WS8A 5TQ0L 4Y4FC 2XA8L 2DWTA 2NY3C 5DT1H 2V5MA 2UY7B 3OKNB 5FB8B 5FUOH 4F92B 2DMKA 1AOHA 4U1SA 2BVEA 3EZ8A 5LAPA 3UZEA 1G6VK 2NZ9D 3LRMA 4FI8A 4ELME 3K8LA 4M62L 5FX3A 6PAZA 3NFPB 4X5WA 1C8PA 4AT6B 2ZUWA 3FB6B 4CC4A 4H8WL 4G80A 2I32A 5GGQH 4KTDH 1J5OH 1GS6X 3HAEB 1H3WM 2XN9B 1PDKB 3O3AA 3OL2A 4JN2A 4ZI8A 5KS9F 3DHMA 5F3HB 3SY0A 2NMSA 4YDVA 1BVOA 2CE6A 4LB8A 3WY4A 4KFZC 5SWSA 2G9HA 2QELA 3RX8A 1QI4A 3MLYH 4I5BA 1I1RA 3UO1L 5CEXB 3MV9B 5GZOD 2F7IA 3T6VA 3GSNL 2RIKA 1VB9A 3Q7JA 4POZC 1YY8B 2VRQA 2CO7A 3ROOB 1HVXA 4M6OL 5GS0H 3A67L 3LOWA 1N70A 1MWAH 3LB6D 3QA3B 3U1SL 5DD0H 4WI0A 3RUGE 2B3RA 2HB0A 3BAWA 3VWJD 1I7ZA 3O6FA 4RSYA 5AW2B 2VSMB 2CNZA 1DLHB 1OCWH 4YIQB 3RL1A 1IGCL 3ARDA 4KKAD 5E9NA 3CG8A 4HUMB 1FI8C 4GG8B 4OQTL 1ET7A 4RWHA 3EFOB 1BZEA 1Y0LA 4M3JA 1HQRB 4UTBH 3ARFB 5HGAB 4AXWB 1DBKH 4OZIA 2XC8A 2J2ZA 4PVNA 5FFLA 1YUKB 3Q3GA 5C6PB 1Y6NR 2NR6A 3GSVB 2MFNA 3NQIA 4HV8B 4JO3H 1C5CL 5D71H 5BW7A 3N3EA 5DRNB 3WS3A 3WFEL 3X13B 3D12B 2FX8L 5CJOL 5CEZL 4W9CC 1PCXA 5KVEE 3ZMNA 3SE6A 4PRPA 4EF3A 2OXHA 2AJ3B 3BLKA 5CJXA 2ADYA 5K9QI 3PV6B 4R83A 4PRNA 2DM3A 3M7FB 4XODA 2BVTA 3KM1A 4R3SB 2EINB 5DRZA 5CSGA 3RTQC 1HSBB 1NGPL 2AEOA 5T3XL 2NTSP 4TSBL 2ZOOA 1I9EA 2ZXDA 3I75B 5IVXA 4R4FH 4XXWC 1DJIA 3A6OA 1A1OA 1NFDE 4JJOA 1XF4B 4L18A 2XZQH 2EEAA 4E9WA 1T3FA 4OCRL 5CLZA 4CVUA 1PZ2A 2P46B 3WDHA 2EH8H 1QRNE 4Y19D 1OB1A 5JOPD 5B7EA 4Y4HD 1TFPA 2P8MA 2XPZA 5ACMA 3WAJA 1JPTH 4ODWB 4S2SA 3UFIA 1E4XI 2ZCKL 2FX7H 3N44F 5ICXB 4TNEA 1RXLA 2VDLH 1ZRUA 2FYYB 4AUJA 3O3DA 3KJ6L 3EYVA 1E30A 1E4XH 2O5ZH 4G82A 3LHPL 4A7SA 2BC4A 4J2XA 3V9EA 1RAMA 2MNJB 2YAFA 3GIVB 2UY6A 2MSPA 2QQKH 2VJ8A 4ZO6A 3ZE1B 2B4CH 4KJPD 3V7AG 1ADQL 4ZS7L 1RUKL 3EYFB 4ZW3A 1Q9OB 4JGJA 4L37A 2GPZA 5KYNA 2VDPB 3GRWH 5D1ZA 3ULSB 1EXGA 2XV6B 3MLRH 4EVNB 3UTZB 5ENWA 3ZTNL 4AH2A 1R24B 5DWUL 1W15A 3VSQA 4O4YH 4NO0B 4JHUA 4E42B 2AK4E 2ZJSH 2CGRH 3CPUA 3FU7B 3TTYA 3IDUA 5FA3B 5HDBB 3S48A 3VFTB 3L3OB 2IDTA 3DHPA 3MNWA 4F3FA 2Y22A 5L7XH 1OTUC 4QRPA 3A0OA 4OZHE 1J18A 3DX8A 3IRPX 4MDJB 2ZD0A 4QLWA 3MI6A 3RBSA 1A3ZA 1DVXA 2X09A 3BUPA 4FQLH 2PCPA 1H3XA 5ICYA 2Y2TA 1LO2H 1SLWA 4CU7A 1P5UA 3T0AA 3EGDB 5F8RC 1F58L 2RQEA 3ESVF 2P4AB 3U36A 4UTAA 1IC7L 4MCZA 4LBEB 3V52H 2B1AH 4PR5A 1XR9B 4RRPA 5HHXL 3CDZB 2BK8A 5E4EB 5AVXB 4E68A 3PP3K 3CX5J 1BLNB 1I8IB 3AM8A 5E1GA 1PZAA 2GBUA 2EH7H 7TAAA 1Q9WB 1A66A 3O81A 1DE4B 3S37H 2ADIA 5IEHB 1XIWB 2WVVB 4HLZH 1NGXA 4QF1B 2O5NA 1VGEH 3O2VH 4BKLA 2OMWA 2ZX5A 4M5SA 3ZE2F 5IG7A 25C8L 2B5IB 4MX7A 3QR2A 3UBXA 4OZ4A 1KSRA 5LXVA 3Q2WA 2O30A 3RDTA 3J2PA 5C0RL 1GYVA 4JFPB 1KN4L 1YNLH 2MJWA 2Z64C 3GKZA 1N6QH 1QUNB 4GAFB 4IGBC 1IGJB 3ARED 4M7LT 4XO9A 4JFDD 4HWBA 1NDGA 2VLJE 1IJNA 1CICA 4PJIE 4L29B 3KWWA 4PS8A 1X6LA 1NEUA 4D9LH 5I74B 3QNZB 4ONOA 2YPVL 1QO3A 3NFSH 3PGFL 1J9RA 1QLEB 3FT3A 2ZSWB 4Z7WA 5IFHL 1DQQA 4U1KB 4ATWA 1GCYA 4APQB 1P1ZA 3FTZA 1EUUA 1CC3A 3D25A 5EDSA 4JKWA 4O2EA 2VDKB 5EU6D 1JUFB 4FLHA 3K2KA 1J8HA 2WK2A 5F6HJ 3WE6A 3HS0B 5T1LA 3FQUA 2AQQA 4Z7QE 4U4IA 1J11A 3QEQA 3VGFA 3RLSA 1XB8A 5FYKL 2P48B 1RURH 5CR8A 1ORQB 1XCQA 4JG1H 1H5BA 4ONHB 3APMA 2OTWA 2VLRD 2VR5A 3HLKA 4OZFA 3VB9A 3W2DL 2WANA 3FQ1A 3ECWA 1PTZA 2E56A 2Z8VC 4ADIA 1IC4H 5E94B 4BA8A 3RU8H 1Q9LB 5ACZA 2FWOA 4D9RD 3OG6B 4HXBH 1GC1L 2OR8A 4YGVB 4Y8DC 4HEMA 1EZLA 2VLLB 2EIJB 2F68X 2OMZB 4YJZL 4FG6C 4MQXC 4ONGH 1RKRA 4LVOB 3BYYA 4GS7B 4H8WC 3EOAA 2BLFA 4HQQH 1JGLH 1NBYA 4XPGH 4JJ5B 1EVUA 2GTWA 1F6FB 5BRZB 3BW9B 4I13B 2DI8A 4XOBA 5CM1A 1TIUA 3DX9B 1F6AA 4DFHA 3Q06A 2OPCA 1XGTA 1TXKA 4OLVH 4LIQL 4PS4H 4BFNA 3L6FB 3KPQA 1OWRM 4M48L 3L1OH 4WU7A 3Q0HA 3CHPA 4B9PA 4DETA 5TF1L 4PWJA 1EEZA 2AXGB 2XTJB 4WI8A 5D72L 3HZYA 4G1EB 2VZSA 4E41E 3B9KC 1NCBL 3ISYA 4LQFL 1ZK9A 1A4KB 2APWA 3H42H 1M4KA 4CADB 1CFBA 4GW5A 3TJHC 1IBBA 2C9VA 1T21B 3HFMH 3MJ9L 2MEJB 2EILB 4KDTA 2OZ4A 1UQSB 1EK3A 1ZTMA 3TASA 4F33A 3TO4B 3V4VL 5LN8A 4A2MA 5DC2A 4PRHE 3MRHA 4BK8A 5TK2A 1LD9B 3UIZA 4BZYA 5FW7A 1A4AA 4RBPK 2IADA 4FA8A 1ONQA 3ZHLA 4R4ND 2Z35B 2ZCZA 4AVKA 4NQDE 1U8IB 3OLDA 1U8JA 5HGDB 1KN2H 3A4AA 2EDKA 4LOUD 1U93A 1AD0B 2BZ7A 4G70B 5HDRA 2PW2B 3MJ8A 3MREB 4LLQA 3HE7B 5DMGD 5CZXC 1KBBA 3S37X 1J0KA 4K7PL 3NIFE 3SCMC 1QBML 2J8HA 4YFEA 2W88A 3QG6A 1H6TA 1XAUA 1JNJA 1WCBA 1N64H 4F7PA 1ASOA 2XVBA 5FF6A 5BV7L 2VIRB 2ODHA 5D5ME 4I8DA 4ZO7A 3WE1A 4JFEA 4XB8A 2R27A 4CMHB 3CU7A 3OHXA 5KOVC 1NLBH 4OJCA 4R90L 4P5MA 4TQEH 1A5FL 4LSTH 1SDDA 2V5TA 4JG5A 2NSMA 3BAEL 4OJFH 4S0SD 2YXVA 4PGBB 1ZCRA 4JQXC 5IUCA 2GITA 1O5DT 2EUXA 4MNGE 2ADJB 4U1NA 4OIFA 2IDCA 5B3NA 1JBJA 2OJZL 4PJHE 1UB5B 5J4MA 4HUNB 5A43C 2UZIL 32C2B 3DO7B 4N25A 4U1IA 2LLLA 1R3IH 1PYWB 3NABL 4QOKB 1ZDSA 1NBQA 3QEUA 5FHAH 1S78C 3T0EC 3DI2B 3GHPA 5E5RB 1CLYH 5CLTA 4Y9EA 4U1MA 3MRKA 4KQ4H 3HZVB 1PIGA 1VDGA 1IJ9A 5C7XL 1IL1B 4JRWA 4H13C 4QRUA 15C8H 1T0OA 2P8PB 3FQXA 4OF5A 3U4BH 4W9DC 3J27A 2WBJA 5FW6A 4RWYH 3H9SA 1XF1A 3P77B 4YDKL 4CGUB 1ZT7A 2FJFA 4BDVB 4QRRB 2PYED 4TSCL 3IMVA 3V4PH 3TN0A 5CZVH 3IS1X 3I6KA 2A77H 4QHMA 4L0PB 1DJYA 1FYTD 3KD4A 1I9IH 1NDMB 4MMYA 4YUEL 4MHHG 4HAKA 5GISH 4NRYB 5MEQA 4P46C 3T3PB 4KKPA 3VXPB 1JI2A 4P2QD 3AG4B 1AH1A 2GCYA 3EYSH 5GSVA 1XAKA 2Y3NA 1FJ1A 4O2CA 3FAWA 3IE4A 1YEIH 5EZOL 4L3EA 3E6HA 4C57C 4QRSA 1HH9A 3GSQA 4ZRGA 5G55A 5DK0A 3QXDB 4HMEA 2BVUA 5F6HI 2X2YA 5GGRB 5D7IE 1NFAA 1IBHA 1Y6MR 3CZLA 4H1LG 5DUJA 1LO5B 1L0YA 1YPZE 3TNNA 3G08B 1IGTB 1FG2B 4ZMXA 5AWNL 3MN8A 3KXFE 5EZPA 3ILQD 4IBLT 1FVDA 2AEIT 3VCLB 2DL2A 1YQVH 1YEFL 3SDAC 2GUYA 2Y6SD 4C56A 5DEFB 2XNAA 5INCA 5SWQA 1CBVH 1BQLL 1NC2A 1CU4H 2XKSA 3B9DA 4JY5L 4F2FA 3TF7C 1HNYA 3MLXL 3CTTA 3D08A 3DSFH 4YBHA 2QHRL 5K59E 2B14A 2D4FA 3RL2A 3SBWA 4G8GE 2YRBA 4GAJL 4PJ7E 5DF0A 4Z7AA 4M8QA 5T33H 3V0HA 4WHCA 5TF0A 4OLWH 3PWUA 1G4RA 2DMHA 1H8NA 2LU4A 2G0LA 4ZW5A 4JY4A 2VMJA 1AC0A 4JKMA 4P3CH 4PY7B 2I60L 3II1A 3EHBC 1EAPA 2E75C 2GW5A 3BD4A 4X7EC 4ZUSA 4KKRA 5IKCA 3HR6A 3WSQH 3ZTJG 2NX5A 3QORC 3PRZA 2VO5A 1EAQA 1SHSA 4NCDA 4MJIE 4O5LL 3BLBA 3OBAA 2X9WA 4WV1C 5IB5A 2YN3A 3V5HB 1XEDA 2AQTA 4X6CF 2JJSC 3P11H 1IFRA 2C9RA 3CFMA 4DQOL 2FB4H 1S7WA 2R0ZH 2AZUA 3PWPB 3T3MF 3VMNA 2DM7A 5B8CB 3WUWA 1UXSA 3OMIB 3L4ZA 2Y25A 4GO8A 1AHKA 2BFVH 2DTMH 4GSDH 2JTYA 4ZXBC 3O9WD 4CSPA 4DKDC 3IMBA 5GRVL 3MUJA 4M61B 2IAMB 3W39A 1R3KB 4IYKA 4PJ8A 5HYJE 1P84J 3P3YA 3NSYA 1NCCH 3FQ4A 4B9YA 3K46A 5IMOA 2KPWA 1E6OH 3ARGA 4Y1TA 4AJ0A 3P4MB 3TURA 2WTOA 4EXKA 5C0FB 2OKMA 2CR3A 4JDEB 4BZ1L 4Z7UB 5GS2H 1J1OH 3K2MC 4KNUA 4M5ZL 3ES6B 4J1UB 3V6ZA 3FCSA 5I71C 3UGEA 4PGEB 5KSUB 3D05A 1BMWA 3QRLA 3B3IA 2VC2B 5J1AA 3SGEI 5C7ZA 2DMBA 4G3YH 3U1PA 3V0WH 1OAQL 1KTJA 1KNOB 4W9JC 5AALA 4B96A 3MMEB 4KK8D 1FAIH 5F97E 2Q3XA 5BZDB 3KPNA 3QDAA 3SGEH 1HAWA 4NZUH 5IREA 5L4FA 4OCWL 1UZ6F 3KWXA 1Y18B 1WUZA 4QXUH 2XN9E 2OR9L 4JY6B 1NGQL 1M2VB 2FUTA 1RZFH 4G8IB 3U9WA 3RPIA 1FCCA 2CO4A 4K7FA 1G94A 4TM9A 1GYCA 3QI9C 5JA9A 3MV9E 4D8OA 12E8L 3NSFA 1G5AA 3DVFA 1I7TB 4YC2C 1DVQA 4Z0BL 3FO9A 3M1BB 4P4KD 4WY7H 3GUTB 1TYRA 2DQGH 2NQCA 1ZLWH 4OCSL 5C09D 5F9AC 2PR4H 4YDJA 1QHQA 1VFMA 3GSXA 4HGWA 2CUMA 4FMVA 5G5DA 4MA3B 2X4SA 3ILPB 3PE9A 1YEKH 2OZNA 2W07B 3PHOA 4TUKL 3SDCA 1NCWL 3T4AA 2LTQB 3MACH 3S9DB 1D9KC 2EC8A 2J4WH 1KCVL 5FDYA 3RB5A 1CGTA 3JV0A 1NUGA 1G9NL 3K6NA 1BOYA 4DCQA 2FIKB 3GK8H 3RVWC 4A1RA 1WZ1L 3W0WD 1U0QA 1CD9B 2B08A 1E5AA 4FJYA 4HU8A 2ICWA 1OCOB 3L1GA 5E9DD 1DBAL 4GUQA 4XP6L 4ETQA 3V6FB 4HKZA 4MRCA 4UM9B 4WHYH 3D9AL 3VYOA 3ULVE 2WIIA 3ULUD 4BE6A 1M6OA 2FBJH 3P9LB 1FIEA 2QQNH 1MCNA 4LSPL 3WY2A 3MLUH 4K5OA 5K9OB 2Z0UA 1RU9L 4B53A 2G3NA 1V7NH 4ZPTA 3ZHFA 3L2MA 2GIMA 3IJ8A 1Z9LA 1QZ1A 1M7XA 5F7UA 3OAYH 3FT2B 5DT1L 1JVOA 5FECB 1G7PA 1ZWIA 2K8MA 4C4BA 2XT1B 3ELAT 3MGTB 2W38A 1FNAA 2IAND 2XDHA 1O6SA 1P7KA 2BNRB 2EDEA 2IALB 4ANUA 3B7TA 3JVGA 1FYHB 2UXFA 2JJTC 5KSBA 2MPAH 1GMIA 2FUQA 2V5YA 3QIBA 3F12A 5FC9A 3C60C 2JIXA 4YHOL 1KIUA 1BIIB 4FQCL 5HPOA 3C5ZC 4KTDL 4CDHA 1NKRA 1MXGA 4M8VA 5BQ7B 1A3QA 2XWCA 1ZANH 3H2PA 2ATAA 3OXRA 4NZRL 4R0LA 5FYKU 3K2UH 4NQCA 1SN2A 5LBSH 3FTWA 1A0QL 3BDBA 3WMPA 3IFPB 4K8RL 3QZWB 5DD5L 3EBHA 1PFOA 3CUPB 3I9AA 1AACA 3WFCL 3BWZA 3HI6H 3ZYIA 5FLVA 1ZOXA 1EEQA 4AVJA 1KPVB 1TZAA 2X2UA 3BSZL 4OFQA 3R18A 5I8EA 1CD1B 1LQSR 3OD3A 1MWAL 3ZE1E 4QAMB 5FK9A 4OCMC 1ZHLB 2HH0H 1U8QB 3CZJA 4LARL 4OUUA 4WJ5B 5IW6A 1NUFA 4QPEA 4XO4A 2H26A 1KTBA 1UACH 5ICZB 2W9EL 1C08B 3NPZB 1JCKA 3MJ7B 4ZTEA 2PYFB 1OCWL 3S5LA 1WTLA 3SDYH 1VCBC 4ZMWA 3O6KH 3WHE0 4HCRA 4JFQA 5HDBE 2HT2C 2BY1A 2ITCB 4Y5YC 2P26A 4NNPH 5LQBH 3X11A 3SJVA 3MCG1 3GB7B 3BQUB 1CK0H 2A4ZA 3QULB 5JW3H 1FZOA 1UJ3A 2WLKA 3OPZL 4Z78B 1E5ZA 3S5YA 5CD5D 3WKML 2YAPA 2PTUA 4UAOC 4ZUWA 2OMVB 4YH6A 4JO3L 3UJIH 3NK4A 4Y5XC 3IVKB 2YMXH 3CE1A 4UILH 5JW4M 1U30A 2WYZA 3TS8A 4CL7A 5C07B 5K5YA 2AEWA 4XN9A 2G2RB 2H2SC 3VXQA 4YO0B 3RWFB 1N4XL 3S8WA 3RFZC 3TFKC 2VJ0A 3ATAA 3EADA 1MFVA 1F0LA 1VAHA 1FGNH 3LEXB 1QWHA 3KNBA 1DQJA 3H85A 3LVEA 5SWZA 4RAVA 1LWRA 2RALA 3TNMB 1RK0A 1JGEA 1RZJC 5A7EA 4PJDF 4X4XB 1Q72H 4FKHA 2WJ5A 5D2LE 1M71B 4WGKA 5D1QC 3TIDB 1IQWL 1G9ML 2VXQL 5TE4L 3BRDA 3VXNB 2BM3A 3MBEC 4ZSOB 4WSKA 4LFHD 3L5JA 1Q1PA 3GTVA 4Z76A 4KRMB 2KQMA 3CXHK 2EH8L 1QFWM 4PJEA 1N6VA 4J3WA 5GRYA 4DKFH 2H0PA 5A2BA 3FUKA 2YKLH 2HKAA 4Y4FA 3DO4A 2D31B 1AQMA 2EXYC 4EDWH 2YQBA 4NDMB 1JPEA 3K7UA 5FA4A 3LYRA 2V3EA 2VDLL 2FHBA 1BXVA 3DDFA 5C0AB 5FXCH 3L3DA 2O5ZL 1MFUA 2Q8AH 1P4LA 5CILL 4DK5A 4JFXA 3HJEA 1MFMA 3PXHA 1UZ8B 3QO0A 2WSDA 1UXMA 2MQ0A 1ZXQA 2FLMA 4JHWL 5IOKA 1TVBB 3GRWL 1VPOH 1J10A 4QUOA 4Z6AT 1KGCD 1SOSA 2CGRL 4LHQB 1N67A 3PIQA 4MMZB 3UGXA 4ZQTA 3FK3A 3WJLC 1A7BA 1ITBB 1DSFL 1VACA 1QWUA 4Y4HB 5JW4Q 3IDIA 1XXFC 1SJVA 4HS3B 1RZKL 3CZGA 1KY7A 2V2TA 1EMTL 5F1IB 3U6RA 2F8VA 4OF3A 3RVVD 3MCKB 1F8TH 3GMLB 1JZ4A 1TCRB 4WUKH 4WWNA 2Y1ZA 5BRZE 3TZVB 1CFQA 3B4NA 4FP8L 4ZOCA 2UYLB 4RX4A 1E9OA 5KVEH 1KTKE 3DV4A 4MQSB 4NQSB 4PJAA 1NAMA 4JDZB 5DUML 1D7FA 5DI8B 4F27A 3LEVL 1YN7B 4WWKB 1GYWA 4H20H 3SE9H 4BWTA 5FM8A 3NFNB 1QEWB 1WGVA 4QRFA 3S37L 5AW8B 3K8MA 3LEYH 1M1XA 4FF9A 4GRWB 2J8UB 4XPAL 2XTJE 2O5XH 1R17A 3K81A 5IVZB 2EIDA 2JXMB 3O2VL 1KCKA 2BIPA 1TEGA 2HRPL 2KUTA 2WJ7A 3PF2A 1FNGA 2HYMA 4NUPA 2MQ3A 3DK2A 3QWNA 4I4WB 1ZVYA 4GMSH 1ZVSA 4OLUH 4A63A 1QNZL 3CFEB 3R19A 3N0PB 4FKKA 1YNLL 3P73B 5LO7A 4WW1A 2CUHA 3BAIA 4JDTH 5FGSA 2DMGA 3QP3A 4XP9L 2K1MA 1MCHA 4FQ2L 2FEEL 5EBWA 1A6UH 3VXUA 1U4FA 2BOBB 2GBTA 4H8PA 4APXB 5HDOA 1Y6KR 1EJ8A 5AVUB 1CR9L 4PD4K 1CGSH 3TL5A 4MAZA 2G3XA 4ICWA 4XXWA 2VITB 4AE1A 4HG4K 4J39A 2XG5B 4OGYL 4TNGA 4HUXB 3RNQB 4NLAA 4PSRA 4WNQA 5SWSD 4MS8D 1AHMA 1IZJA 1FC1A 5L6YH 2UXVA 2YARA 1WV7T 3C8HA 4XPTH 3C8KA 1TTRA 5H35B 3ZGHA 3X3FH 2FJGA 1EDHA 4N8VB 5DS8A 3RNKB 1H6FA 2WUBH 4F57H 2V5SA 4GAYA 2WXLA 3MNZB 4G6AC 5AVRB 4XHJC 2YJQA 3TEYA 1UA7A 5CFAA 1R9FA 1DJWA 3UCQA 1IGFH 3E1ZA 4C54A 4DAGH 5ADOL 3BVNA 4KXDA 4E9QA 1KGYE 3ARDD 5JNYA 1WDAA 2HPTA 4ONGL 3RWEB 5AG8A 1C5BH 3NAAL 4HQQL 1JGLL 1F90L 2WBKA 4K55A 4ILDA 5TPWH 4LFHG 5F7YC 5I0DA 3P4OA 3SO5A 2EZ0C 4HJSA 4LEXH 4OR1A 4QOKE 5IK3B 2QSCH 3VFOB 2D7TH 5MP6H 4MMXC 3F3HA 5D7LB 4X6FB 4XVUD 1XQ4A 4Y5VB 2FBOJ 1FLRH 2QV4A 4RGNB 5C97A 3CFDB 3L1OL 5IF0B 4J7RA 5HHVH 4AM0B 1UWXK 3T1FB 3C8DA 4M29A 1BYPA 5GS0C 1CLZH 5DJZA 2VLRB 1FIGH 2JB5L 4EMZA 4PRPD 1Q4NX 2K9FB 5F7MC 4NIYE 4QRRE 3EYOB 2KERA 4V33A 5EN3A 3NJLA 4XNZC 2Y7QB 3DJSA 1DUYB 3LH2L 1SXAA 1H8OA 2KZ1B 4PJGB 3TPUB 4AGNA 4NKMB 4ICXA 4XBEL 3T3PE 1J86A 3RGVB 1UWGH 1UGNA 3T0XA 4EEEA 3DHJA 4YE4L 4J2QA 4KNTA 4WDIA 2I9TA 3VD9A 2Y36L 3N9GH 5KTEL 4AI7A 1D7BA 3G7TA 4FFVD 5IB3B 4ODVL 5GHWL 4ZYKB 2N7BA 3FU6A 1G1KA 4JN1H 1T6WA 3MBWA 1ETJA 3M17A 3NPSB 1GZPA 4IGBA 2P44B 4M43L 3OKOA 3C5SB 1I3GH 1Z0MA 1AD9A 1P6FA 3QCTL 4CBPA 3UXFA 3TWYA 5E8OA 3L5XH 4IDJL 1IBGL 1A6PA 5EHFA 1ZEAH 3ECQA 4HU2A 4K7PY 5T1DH 3EH1A 5H37A 2Z6FA 3QNXB 3QQDB 3SN6N 1JF5A 1HTYA 1FZJA 1ICTA 1UCTA 4FE9A 4RSVA 1NLBL 4RESB 4HK0A 4B9IA 4LSTL 5FFOA 2QPDB 4M6ML 1XGUB 3L1EA 4OJFL 3B6SB 3B2PA 4XWGH 2JCCB 2PWGA 2YQGA 3O45B 2YD7A 2WWKT 4Z7VB 3DX7A 2GEQA 5JXAL 1BVNP 2O5YH 5F7DB 3OR6B 3SSGA 2X89A 4Y89A 3Q2LA 4QRPD 1TEFA 4Z3GA 1JGVH 4MDRA 3MRNB 2CBMA 5IBUG 1AGEB 4JZOA 4OFPA 1CLYL 5E1AB 5I2IA 2BPBA 3JV4A 1BBJB 3WYRA 5M94B 1D5IL 5HVGB 3A6BL 1RMFL 5B21A 5JHLA 1FNLA 3DURA 3UPRA 2DD8H 3ZY7A 4IRJD 5FO2A 2XPGA 4KOCA 5DDHB 2IFFH 5D6DA 3PWPE 4NYLA 3ZOAA 4RWYL 3PXJA 3WNKA 2B4CC 2PP7A 4KZEL 1HZLA 4N3TA 2K9UA 2PNDA 1KUMA 3V4PL 5CZVL 1MJJB 2GJZB 5I5IA 4MJ5B 4P4RA 3VH8A 3GKWH 1MAML 3ESOA 4TSAL 3NBNA 4YHYB 2YKKA 4CBZA 1EJOH 1OKEA 2A6KB 4PSPA 1OV8A 4Z5RB 3GJFB 1DVZA 3FU0A 3FZUC 2UX7A 3VGAB 5C0EB 3HE6C 1HSAB 1NFIB 1AAJA 1J0ZA 2BWDA 4OJYA 4Z7UE 1YEIL 1M7DA 3U7AA 2QVIA 3FBQA 1TUPA 4ODSH 4LNRA 2EYTB 5JQ6H 1I1AA 1CICD 1C8QA 3H54A 5DSCB 1IKFL 2D3LA 3HMXL 1S9VB 1TTAA 3F6JA 4WTZA 3V9FA 1LP9A 2OI9C 2X4NB 4BZ2A 1WIOA 3OAZK 3X2QB 3T2NH 2PF6A 1Q94B 2JKSA 4AC4A 5HGHB 4L8BB 2EVJA 1CG9B 1YQVL 4ZFZB 4LOVA 3GRGA 3L95B 3L13A 5C08D 4ZTPH 1JN6A 1RIVL 4OVVA 5KOMC 3WLBB 1VGKB 5J06A 2NXZD 3IFLH 4RISH 3LZOA 1J8HD 2ZOLB 3UG4A 3TCLB 1YN6A 5T1LD 4FXGC 1G1OA 3CHSA 3G5VB 3TV3L 5A2LH 5JUEH 3QEQD 1QI5A 3NZ8B 4P48A 3L54A 2BS71 1D5XB 5JMOC 3CDGA 3G5ZB 4TNVF 5T33L 5IV2A 2OJEB 2KYIA 2ZUXA 1I8KB 3SCMA 1B2WL 1YYCA 4KROD 1OZTG 4XMPH 4OSUL 4OM1L 5GRUL 3FTUA 3QPKA 4F37K 3L3KB 3E8UH 2WTRB 3MFGB 2CLZA 4X80H 4Q58C 3VM7A 4I18B 4QHUA 4V2CB 4HH9A 1FBIL 1WWAX 2D7NA 4N0YH 4OAWB 3FQTB 1A7NL 3ATEA 1IBDA 2AK1H 2HTLC 4KKLC 4NKIL 1RPKA 1PZ5B 4YHLL 1P9MC 3PV7A 2R0ZL 3K3QA 4HKXA 2KI6A 1I8LC 4LEOB 2ZWSA 3NTCL 1UD5A 3LAFA 4N2LA 3IJHB 1UEYA 5C3TA 2HMID 2UZYB 5D9SB 2OMXB 5EC2B 5EBMB 3GJFK 5HI5C 1PS3A 1BOGB 1OAXH 2Q1EA 2WBXA 4FNPA 3T0EA 1H0DB 1YC7A 3BYTA 2Y4SA 3N42F 2GIXA 1N6UA 3B1UA 4HSCX 4S1SH 3IGLA 1NCCL 4OM0H 1FFPA 2ICCA 4PGCB 5SX5K 4GEJA 4ETYA 2BCKA 4UU9B 3QDMA 3UGUA 3H55A 3OKKA 3CZEA 1BECA 4AQAB 1R5WA 4YBLC 1EHNA 1SZNA 1IGML 4TNVK 3SPGA 3I9GH 3KZ8A 3CCHA 3D34A 5CJBA 3UMNA 1MFDH 4HS8H 2X1OA 3BT2H 3D85A 3D0LB 2PXYC 4ANWA 5AFAA 3MZGB 4HD9A 3VMPA 2BNRE 4XCNB 3P0YH 4G7YH 3LKQB 4IMLB 2X4RB 3ZTDC 5IQ7L 2DWDB 4U1GB 4AW7A 1I3VA 1FAIL 1JV2A 3LIZH 3WN5C 2X0VA 2A38A 3I3BA 4NZUL 4BFIA 4OFDA 2VKXA 1MLBA 3F58H 2FO4A 1DQDL 4QXUL 2YA0A 4X6DA 4HGMA 1OQXA 4PG9B 4XP5H 5C0GA 3KHQA 3MX0A 3QJFB 4IHOB 1MAJA 1WHOA 2ZAGA 2A1WH 4UM8A 2FNBA 4I0PB 5EBLA 4YSCA 2EYSB 2JK5B 3GWJA 4FNSA 4RZCB 4N9GB 4NQVA 1NEZA 1TQBB 4WY7L 2DQGL 3FT4B 3ZR6A 2YXWA 4JHVA 1GGBH 3UBXG 2CH8A 5DC0A 4JR9H 5LCVL 5LG6A 4EN3D 1JWUA 1V5JA 3RJOA 1FNFA 4Z23A 4HHGA 1YEKL 3CFJA 4GJTB 4HFUH 2R83A 3KVDD 2PO6A 4M7JH 2BFGA 2WOBA 3U4KA 5I16A 2EXSA 1RY7B 1U2CA 3GSRB 3IKCB 4GKLA 3PJLA 3QXVA 1TMCB 4XCYA 3VQ2C 2Q6WB 5TDOA 3VU2A 1XDTT 3VFVA 1KC5L 2ARJB 4EQ3A 7PAZA 4IEFB 2APTA 2H0JA 3DIDA 1IAIL 5EUOB 4QRQA 1Q0YL 4LRNL 4PW9A 5T5FL 5AAWA 3KYKH 4KPHL 4NBZB 2FSEA 3V0JA 1X5KA 2X4UA 3KPMB 3BUYA 3LNEA 3SDXA 4C83B 4WV1A 2FBJL 2CALA 1O7VA 2P24A 1P4IH 3AU0A 1UWYA 2JJSA 3MLUL 4FZEH 5EU3A 4M1CC 1G0XA 4EI5C 4G9DA 3TN0D 4P4KB 1QQDB 2YD9A 2ZWLT 5C07E 2NW3A 1V7NL 3BPOC 5C09B 1WHPA 3HNTH 5LUMA 1R46A 2AXJA 1JZ8A 3UDWC 1OGSA 1DVTA 2X2HA 4L8SC 4OKDA 1QHPA 4OZFG 4ZXBA 2CXGA 4YLCA 4PP2A 3ZQ9A 3FO1B 4PUBL 5K1VA 3ESNA 3OTTA 3BI9X 3BZEB 3K6IA 4K3DH 1DEDA 5DHEA 3WHXA 3MRBB 3BPCB 3PABA 1YEDB 2CKBB 2WZ0A 2V17L 1FHNA 4L3ED 4PJ5B 4QRAA 3L3JA 3Q6GH 2YBRA 3W0WB 5E8NB 2MPAL 3B8SA 3GHBH 5FWRA 4ZSOE 3DA0A 2DQIH 2BRRH 3QPXL 5C71A 4HIEB 2APBA 5IQMA 1ZTXE 3HAEH 4NENB 2SODB 3M8OH 5E9DB 5FHBL 5J57B 3QQ3B 3FB8A 3BUBA 4FZ8H 2F74A 2WCSA 5HHOA 1NMCC 2V0AA 1YYLL 2F0CA 3FSZA 3HC0A 4X9BA 1WZAA 2Z92A 5LBSL 1NBZB 4IRZL 5IB1A 4C56D 2PCFB 5C0AE 3VFRB 4Y16D 2PCXA 4P5TD 1BWMA 3HG5A 1NIAA 1R5VA 2YC1A 2JLPA 2V2WB 4G2AA 2IBZY 1JWSA 4N0CD 2ZSVA 1FL3A 1FL6B 3VD1A 1MRCL 3UCRA 2DWSA 4BHUA 3V8CA 2YD2A 4IBVA 3DTXB 3FUJA 5ISZB 4PPTA 3MNVA 3ULUF 4I48B 2A6JA 4NO2A 5IVOA 4HIIA 3QUXB 3WDIA 1GJWA 3QI9A 4D9QE 5IFJB 3O6KL 1RIUH 1T0MA 1IM3D 3G6AB 3U7WH 4KI5C 1U36A 2VR7A 4NKDB 5J9PB 5JOPE 2YXMA 4K3GA 4FQPA 2MHAB 3LNDA 3TP4A 3V0VA 1A3RL 2HTKC 1CGYA 3ZUNC 3L9RB 3PWJB 5KSAD 1DVUA 4LCWD 4NUQA 1LMKA 3OJ2C 3U79A 3OXSB 3CVHH 3DHUA 2W5PA 4LRIC 1D9KA 2AQSA 4PTTA 2R8SH 4FQIL 1T04A 4UILL 4BGLA 1UTDA 1EJ6A 3GMRA 3UAEA 3KBFA 1T1ZA 5E2VL 5I0YA 3H9HB 1JHLH 4PJ8D 3PP3H 1J1XH 5T1MB 3RGBA 4IIQB 2RTTA 4X6BB 3GLDA 1UWEL 1DBBL 4GRWE 2J8UE 2ED6A 3EYQC 1JGDB 3DOSB 3WTUA 4ZBJA 2KZKA 3MTXA 5AOJA 5HGBB 3S98A 2GSGB 1Q72L 5FGRA 3Q13A 4Y88A 5MENA 3KGRA 2E74C 4IBTA 2VO8A 4AITA 2HXAA 4FNLH 4WHTB 5FO9B 3BGFC 4XP4H 1EGJH 3BAXA 4WJG3 2VE6B 3CVDA 4EIZC 4DKFL 1NGZA 1WFJA 5F1KC 3EGXA 3U48A 1KLFB 4H88L 4ODBD 5DMKA 1NCGA 4HKBA 4EDWL 4V11A 1GXEA 3I84A 3ECUA 4K5NA 3ZE0F 1RK1B 5L8LB 4OLEA 2DZEA 2N0KA 5DUBB 1A3LL 1L5GB 3DPDA 2HJFA 4WEBL 1E27A 2JJTA 2YAOA 1UKSA 1VENA 5FYLL 3W9DA 2WINB 1EHKB 3OLIA 5A2KH 2VDPH 3C5ZA 4Q89A 3WKNA 2WLLA 4ECNA 4TYUA 1ZA6A 1DDTA 1XCWA 3D30A 3HNSL 3R8QA 3VI4A 5HHQB 4G7QB 4UIMB 3QWRD 1A4CA 2DYPD 5DMYA 3NEXA 3SQOH 3S88H 3BVUA 5DJDB 3HLAB 4R26H 4LPVA 2GG1A 3T6WA 4MKMA 2Q10A 4HT1L 2NRDA 2XRAH 4JK0D 3UZQB 4F9PC 2QR0B 2IQAB 3WN6A 5DVPA 4JFYB 2CQVA 1T0NB 1HCZA 1TJMA 3CFQA 2PCYA 3ECBB 4HX1A 3HN8A 4GW1B 3SDCD 2F58H 4FFTA 2YD0A 4NOFA 3W11C 1MCRA 1GKOA 4YDLC 1WAAA 1W72A 2VDMB 5J6HA 1U9KA 1AKJA 5EWIH 3UZVB 4WUKL 4X5XA 5I73C 2AXFB 1UENA 2YUVA 2B59A 3IDGA 1TLMA 3BP6B 5DD1L 1UUNA 3GZKA 3FFDB 2D9CA 3GSOA 3LQZA 3WBDA 5IOPB 5KVEL 1NOLA 2CLRA 5JORA 4Y5YA 2ATKA 2GFBB 2IJ0C 1HI6B 4IBYA 1BEYH 1SJEA 5D7LE 2WLZA 4H20L 1HH6B 1MCBA 2OULB 4RGNE 4L4VA 4U6XB 4XCFL 3NJIA 3TGXA 4YZFE 2ADFL 3UTSA 2OV0A 4MWFB 3SO3C 3H56A 4U1LB 3B9EA 5BVPH 1CI5A 2VQ1A 3VFUB 3PWLB 1RHHA 2NCEA 4UOW1 5FCUL 5PAZA 2FO8A 3Q1EA 4KI1A 4XTRD 5LXGL 3IJSA 4GMSL 4OLUL 4D9RE 2DTSA 4Y5XA 3OSVA 4LPTA 4HUUA 2YSSB 3NCMA 4G5AA 4PJGE 2WXOA 3CMOH 2FT7A 3GBNH 1T89C 4TNWF 5AVZB 2YPLB 4MSWB 3JWNG 3N6YA 4QMEA 1MJUL 4N2CA 3W5NA 3K80A 5BZZA 1U95A 1QLEH 4GQ9L 4RBPH 1BD2A 4R84A 2JIXD 2DIJA 1F4XH 3BXNA 4DP4X 1CUOA 1KPRB 3DRTB 2CJSA 3RJQB 2NY4B 2HG0A 4A6YL 1GMEA 1KXQA 3VD3A 2VDKH 1ZHNB 4P9ML 2X40A 3GHEH 4Y8AA 2E9IA 2A6DA 3T08A 4XC1H 2G2NA 5FDWB 5JIKA 4NQCD 3IXAB 4E9SA 1JL8A 4FFYH 3WUWG 5I66B 4F8NA 1DSYA 3GNMH 4NO3A 3GBEA 1F3RB 4N8CH 3VXOB 3MVSA 4MB5A 1EXUA 4ZMOA 2FVNA 4LCCB 1JYWA 1YEHL 4BQ8A 3M7OA 4IBWA 3PL6A 3B9VA 2JKNA 2YZ1A 1S7VB 2N1TE 3QXAB 2P7TA 4AIEA 4U1SB 5J6GA 1QLRA 5DQ9A 4PWIA 5CHNA 1RJZA 4RAUA 5CZKA 4X5WB 2JCCE 3AY2A 4Z7VE 5EPMA 2EUWA 2QHLA 4NBYB 3MYJA 2WVSA 2CGZA 4G80B 1A7PL 5JOEA 2YRPA 3LNGA 3QUKB 1CFNA 4NP4H 1IAOA 3DMMB 2DICA 3O3AB 4KRPC 2ZCLH 3QIWB 4GG6A 3SY0B 2YUZA 4YDVB 4WUUA 3X17A 2G9HB 3WJLA 4EUPG 2AZAA 1CJYA 4I5BB 4TXVB 1B0GA 4HAGA 5HHVL 2W81C 5CUSL 4NI6A 2NY0D 2CO7B 4U0RC 3P4NB 1U8PA 1EBAA 5AB0A 4LCUA 3SZ6A 2YGQA 2ITDA 3NJHA 3LRHA 4FDWA 2IWGA 2CJ3A 3KW8A 2X9YA 5F93C 5IROC 3ASOB 2I26N 2RACA 1I7ZB 3AXLA 3O6FB 4JRXA 4MA8L 1JZHA 3VRLF 1EHLH 5D55A 3BWAA 3RL1B 5IJBC 4KMQA 3ARDB 5SWZD 4XVOA 4YBQD 4N8UA 3T0DA 4BUGA 3QDGA 3N41F 1Y0LB 3FCTA 1E2ZA 2YLKA 4WEEA 3N9GL 3FU9A 2ZQKA 3MNDA 4OZIB 4B41A 3LPPA 1K2DA 1K8DA