1PCSA

The 2.15 a crystal structure of a triple mutant plastocyanin from the cyanobacterium synechocystis sp. pcc 6803
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFDADGVPADTAAKLSHKGLLFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.15 A crystal structure of a triple mutant plastocyanin from the cyanobacterium Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1997-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pcsA00
4UF7C 1ASQA 1ID2A 4N8UA 2P80D 3QJSB 1ZPUA 1ZIAA 4AI7A 5I5MA 1GS7A 1GYCA 2FQEA 2IWKA 4E9XA 4L0PB 2P80A 1WA0X 2XV0A 3UAEA 3V9EA 1J5DA 4E9YA 1AS8A 1NDTA 4GY4A 1JZJA 3OMAB 1WS8A 1XMEB 3WIAA 1ZDQA 4G70B 3SQRA 4HALA 1ASOA 3NJKA 1ILSA 1OCCB 4W9ZA 2XX1A 5AKRA 4BDVB 2EILB 2WO3B 1L9RA 3T9WA 4HHGA 3CVDA 1L9QA 1N68A 4P5RA 2MRYA 3NJFA 2OV0A 3WG7B 1KBVA 1EZLA 1JZGA 2BP0A 1FFTB 3NT0A 4DP1X 3UADA 2BHFA 1PY0A 4HZ1A 1AACA 1ZDSA 2TSBA 5I6LA 3S8FB 1PZCA 1PNDA 4AX3A 2IAAC 2EIKB 3X1NA 3AZUA 5I6KA 2FT6A 2B08A 1ZV2A 5I26A 3TA4D 1DZ0A 3ZDWA 5I6NA 2XU9A 1X9RA 3QJUB 2VSMB 1W8EA 3H4HA 2I7SA 4YSCA 4PCYA 4G71B 4A67A 3NP4A 2XWZA 4AKQA 2ZXWB 3RYMA 4E9SA 3T6XA 1NIEA 1GY2A 3ABLB 1BYOA 1PF3A 4HCFA 3WI9A 1AZCA 5B1JC 4DP0X 2AVFA 1SDDA 5PAZA 1AZNA 5LDUA 2J5WA 2ZONA 1AS7A 5D4JA 2AFNA 3EF4A 2DV6A 3SBPA 1TEGA 3TASA 2I85A 2N0MA 2VSKB 4GP8B 1UATA 3FU7B 2UXFA 1L9SA 1IKOP 2ZOOA 1OE3A 2H5UA 2PCFA 1GS8A 1M9WA 2DY2A 2BP0B 2BZCA 3SBQA 3X1EA 1JXFA 5D4HA 4KOBA 3AY2A 2PP7A 1B3IA 1JVLA 2CUAA 2OJ1A 5IY5B 1L9OA 1HAWA 1TKWA 5B7FA 3QJQB 2PPDA 1KDJA 2XV2A 1RCYA 4KO9A 3S8GB 1NIFA 1NWPA 2VW4A 3WKPA 1ET7A 3FYIB 3IN2A 3V9CA 5I6OA 2BWIA 3N2JA 1MZYA 5E9NA 4DP9X 1WAEA 2BW4A 2HLEB 4DP5X 2GBAA 4BWTA 4JHUA 1SFDA 3CDZA 1SF3A 2H3XC 2J56A 2YAMA 2PPFA 1ADWA 2X87A 2IDSA 2YAQA 2VMJA 3BVDB 1YLBB 2YARA 1NZRA 4KOCA 2FT8A 1OE1A 4P5SA 1AQ8A 1XB8A 1BQ5A 1MZZA 2BW5A 3FPXA 2FJSA 1M57B 8PAZA 1DYZA 2YXVA 4WTQA 4FAAB 2EIJB 4KO5A 2BWDA 4WKXA 3CG8A 1JZEA 3OMIB 2Q9OA 2YAFA 1JERA 3QPKA 1ET5A 4N4YB 1SNRA 3FYEB 1OOWA 5B3SB 1J5CA 1E67A 2JFCA 1JZIA 2UXTA 3C75A 1IC0A 1AG0A 1ILUA 2PPCA 2QPDB 2XXGA 3NJJA 4A2EA 1X9UA 3FQ2A 3IN0A 1GR7A 4YSAA 1AG6A 3WNIA 2QDVA 4YSUA 2BP8B 3KW8A 3AG3B 4KO6A 1V54B 5B7EA 1KBWA 2FNWA 1WA2X 1SHWA 1F56A 2XUWA 3AG1B 5I6PA 1NICA 5B7MA 5I5IA 1A4BA 1AZUA 2J55A 5EHFA 3NJLA 5B1AB 4GXFA 1J9SA 1JZHA 4DP8X 2PPAA 3T6ZA 2VM4A 3UAAA 1OV8A 2JXMA 1NIBA 1L9PA 1KCBA 1N70A 1SJMA 1AANA 1JXDA 3GYRA 4E9TA 2DYSB 3HB3B 4RH4A 4A2GA 1TU2A 1NPNA 3CVBA 1V55B 2EIMB 3WKQA 1E65A 3FPYA 1CYXA 1SHXA 2IDQA 2VN3A 3FU8A 5I5JA 3S3CB 3H4FA 2UX7A 3UACA 4YSSA 1MG2C 1CURA 3ZIYA 3L45A 6PCYA 1NIAA 4YL4A 1E5YA 4DP7X 4BDVA 4JKNA 1J9TA 2UXGA 3QQXA 3X1BA 3U25A 4G7SB 2UX6A 3OM3B 1NINA 1JXGA 1QLEB 2YAOA 4GYBA 1SFHA 4UAHA 1OCRB 3EH4B 5B1KA 2AANA 2GHZA 4DPAX 2EINB 2QPEB 1RKRA 5TK2A 1EHKB 4FA7B 2BO0A 4HAKA 1A65A 3PAZA 2R7EB 3ABKB 5FC9A 3WNJA 1VLXA 7PAZA 1J9QA 2PP8A 3NJMA 1PZAA 1AAJA 4BXVA 1NIDA 4EF3A 2AZAA 2WO2B 3NJIA 4E9QA 4ENZA 1A8ZA 1KCWA 3QJRB 3ZBMA 3AG2B 4AKPA 2YAEA 3T71A 1V10A 2H47C 4NERA 4YSPA 1ASPA 1URIA 1XB3A 1RZPA 1E5ZA 2MTAA 3S3BB 2GSMB 4KO7A 4GP4B 5B1JA 2GIMA 1BXUA 4JHVA 3NSCA 5PCYA 1ET8A 3OD3A 1JOIA 1OE2A 2YQBA 1CYWA 3MX0B 1MDAA 2W88A 4M4RB 1AOZA 1NWOA 1MG3C 2PP9A 1L9TA 5AFAA 2FQDA 4DP6X 4M3HA 4HCGA 2OCCB 1KGYE 1KDIA 3PAUA 3X1FA 1WS7A 2Y1AA 2YXWA 2PCYA 4K9JA 4F2FA 2XX0A 3NP3A 3NSYA 1PZBA 3GXUB 1IBYA 4YSQA 4A2HA 1M56B 1KV7A 3PXLA 1PLCA 2HZHA 2FQGA 4G7QB 4W1TA 3NJNA 2FQFA 2I7OA 1BYPA 3JT2A 3DTUB 3H56A 3IEAA 2PLTA 2WSDA 4KNUA 5I28A 4F7KA 1A4AA 3NJGA 3OMNB 4GP5B 7PCYA 3FSAA 2VM3A 1AS6A 1W6WA 4CSPA 3G5WA 1PNCA 4DPCX 3FT0A 2CBPA 3AW5A 2IDTA 3FQYA 3PCYA 3ASNB 3T6WA 3N55A 3GDCA 1PAZA 3UGEA 2FTAA 3ABGA 2E86A 1IUZA 2GC7C 2B3IA 1PMYA 4KNTA 2FT7A 2A3TA 2NRDA 5B1BB 2DWTA 1XB6A 4G72B 3FSZA 4UANA 3ERXA 5A7EA 4HIPA 4CSZA 1AZBA 2IDFA 3QJVB 4ZK8A 2XYBA 2GB2A 1ZIBA 3UABA 4NAJA 1FA4A 4E9VA 3CDZB 3ZX1A 3KW7A 1FWXA 1GSKA 1I53A 2J57A 4Q89A 1BQKA 3TBCA 1JZFA 5I6MA 3FS9A 3QJTB 3DIVA 3TU6A 2HX8A 2JKWA 5F7BA 1CC3A 2XV3A 2BP8A 4Q8BA 5ANHA 2GI0A 1GY1A 4YSTA 1BXVA 1BAWA 2CCWA 3HEIB 4NB7A 4QLWA 2VW7A 2R7EA 4E9WA 2XVBA 1BQRA 2BZ7A 1AR1B 3S3DB 4BXSV 2HRGA 4DPBX 1PCSA 1GS6X 1A4CA 2W8CA 2IWFA 3AG4B 6PAZA 2HXAA 4YSRA 4A2DA 3NYKA 4AZUA 3EHBB 4E9RA 2TSAA 1RZQA 3NSFA 2PPEA 2IDUA 2DYRB 3FU7A 2IWEA 2XXFA 4YSDA 2HX7A 1NPJA 3ASOB 2IH9A 4BWUA 3IE9A 3FSWA 1W6LA 1T5KA 2IH8A 2AZUA 3PLYA 5D4IA 3NJHA 2CJ3A 4PAZA 1PLAA 3T6VA 2Q5BA 4F2EA 2YAPA 3D12B 4BWWA 3FU9A 4QKTA 3MBWB 4DP4X 3PAVA 1OCZB 9PCYA 4AKOA 1QHQA 1IBZA 3SBRA 2HX9A 3CVCA 3PPSA 4MFHA 2ZWNA 4BK5C 4G7RB 1HAUA 4YSOA 3EH3B 2RACA 3TBBA 3X1GA 1ETJA 1TEFA 4HCIA 2Y69B 3OQRA 3NSDA 3BQVA 4A68A 2DWSA 1E30A 4X4KA 4DP2X 1OCOB 2HRHA 3X2QB 3JTBA 3IBOA 1SF5A 2VW6A 1JVOA 1SDDB 1KYAA 2CAKA 4YSEA 4YVNA 4A66A 2FWLB 1WA1X 2CALA 1A3ZA 4A2FA 1HFUA 1AZRA 1BEXA 5F7AA 3FSVA 5AZUA 2X88A 3FQ1A 1R1CA 1QNIA 3CZUB 4HHWA 4TXVB 2YAHA 2GC4C 2XLLA 5TK4A 1AIZA 1NTDA 1PLBA 1GW0A 1CUOA 3DKHA 4YVUA 4KNSA 3ABMB 2QT6A 1J9RA 2QDWA 3EH5B 1OF0A 2UXVA 1BXAA 2LLNA
chains in the Genus database with same CATH superfamily
2Q3ZA 4CA4A 2A9MH 2A77H 2XWDA 1E3ZA 5DZOA 1KWGA 4JY6B 4N8CH 1FL3A 5BV7C 1JSYA 1J5DA 1P0SE 1IRAY 1WT5C 3GSRA 4NZRL 2APWA 3QB7C 4RMTA 4GRLA 3ALWA 1UD8A 4I9XA 1KIPA 2X0VA 3CPUA 1CTMA 4P46C 5F8QC 2ICEB 3DRTB 4JRYB 3MJ7B 1NKOA 1UEMA 5FYJE 1BXXA 5JPNC 2MRYA 4JY6A 2BP0A 1JZGA 1IM3D 1FFTB 1AIFA 1MHPH 1UEYA 3VFMA 2JQMA 1WFNA 1DSWA 3IRCA 3D25A 2I9LA 2TSBA 4NZTH 2HKHL 2IQAB 4Y19B 2XWCA 1HESA 1PNDA 3KPSB 3S0PA 1RZKC 1A7NL 4LP8A 1NGYA 1FDLH 4U1JB 4HBCL 2CK0L 1FH5L 3SKNB 3ULSA 4AX3A 5HDLA 4N86A 3HR5B 3UBHA 1U30A 2EDJA 3D52A 5LGJA 1RIVH 1RZIA 1MJ7L 1RZKH 3F7PC 4LCUB 1VIWA 5CN2A 4UT6L 2NTFB 2XU9A 1X9RA 2J5LB 3PGDB 5A2AA 4J3SA 2PO6A 1JGEA 2V2WA 1T83A 3GMNA 3RWEB 1A6TA 3ESMA 3GMMB 3VD7A 1UUSA 1YYML 2XFXA 2C1OA 1N8ZA 3QORD 3V4PA 3IYLW 4WK4B 5DD5L 4ZMXA 4ZDHA 3QWRA 4H5SA 1S9VB 4JFDD 4GG8A 2V5SA 3R18A 4DP0X 1BQSA 5BO1H 5FO9B 3MLRL 4NO5A 4PLKD 1MF2H 1BMWA 3AAZA 1YEIL 1Z3GL 3DK0A 5IOPB 3TT1H 4WFGD 3EOAA 1E2WA 1KT2A 2DIBA 4G1MB 3HLAB 4HK3N 3L6FB 4XMPH 2E7LC 4OY9A 3W0WA 1T0NA 3ZO9A 1YJDL 3FU7B 3GBMH 3GO1H 5E2UL 4X4XA 1VKXB 3O0LA 5DU7A 1G7IB 1L7TL 4M7JL 4D9LH 3RY4A 1XO8A 4P2YA 1I3GL 2JJTC 3QZWA 4XZUB 4Y2OB 1OP4A 1MFUA 5GXBB 2APSA 5D4HA 3UZQB 2GEQA 1PG7X 1DVSA 3C8DA 3C5SA 1LO0L 3G08A 3OPZL 1JVLA 1DJGA 4P4KC 1JZ7A 1MJUL 2YC1B 4QRSB 3W9EA 3CZFA 5T1JA 3EDKA 3REWB 1R0AL 3PHOB 4JFSA 3J7HA 1AXSB 1IFGA 3FUNA 4UAOB 1KYOK 2WXJA 3BKJL 3RDTD 3GUTB 3P73B 5ICXA 3QUXD 1CK0L 2HMIC 1CU4L 2LTQB 4UIKH 5L7XH 4QGTA 4FNPA 4Z7UE 2Q20A 4PGEB 4OZHA 3VXQA 1USQA 4HJ0C 4JCWA 4K94C 4YHKL 4KKBD 1BMGA 1IC5H 2E5EA 3LH9A 3ZDZB 4AQ8A 3ILQC 5E2TH 4N6RB 2F0CA 4F57L 3NZSA 4PTTA 2BVPA 2H1PL 4KI5D 4X9YA 1WBXA 5D5MF 4M6ML 1JPFA 2APVA 3HMWL 5LN4A 1UJTA 4OGAC 3OPUA 4ZUUB 5E5UB 8PAZA 2AXFB 1LO4L 3L4VA 2AQPA 1R34A 2EIJB 3ZL4L 2DEWX 3CVHB 4GUPB 4KROB 1HQ4B 2ED6A 3A23A 4PRDB 1S78C 4MXWL 1T20B 1ND0B 1EGJL 4N4YB 3QPKA 4WEBH 4J3OG 1B4JH 4AYMC 1SY6L 2H4EA 4PJ9A 1AG0A 5CP7A 2AITA 4OD3L 4CC4C 3IFLH 4YSAA 2L04A 3KXFA 3WTWA 3FO1A 2R15A 3U7WL 4UZSA 5IHUH 3MV7A 3KW8A 1HHHB 1QEXA 4N0RA 2XFXB 4LLUA 4HJJH 3MNZA 5B7EA 4OLWH 1KBWA 3NUKA 4WFFE 3MA7A 3TZVC 2FJFA 3CZSA 5B7MA 3QEHB 3MV9B 2ZJSL 4QHKJ 2OKMA 4YDZA 3UTZA 2WXFA 4RQQB 2K3TA 3MCYA 2F15A 1M3JA 5INDA 4YPJA 4JFYA 4RMRA 3ZTEA 4R26L 5CCGE 1XH1A 2VM4A 3QFGA 4KROD 2NY4D 3E80A 1L9PA 4M1DL 3NGBC 3U4KA 2BDNH 1T2QH 3QQ9C 2DYSB 2HT4C 5JYMA 3E38A 5DFAA 2GABA 3ARQA 2FYVA 2C9PA 1V55B 4MCYA 5JMRA 4LZKA 3ARDB 3HZMA 1YNLH 1FZOB 1CURA 1LEKB 4L9DA 4LVHB 4JKNA 4IHOA 4XTRC 4XRCB 4KROC 5IWLA 5MHSD 3VA6A 3H7LA 3OM3B 4L5FL 2VWEE 1QABA 3QULB 2JXMB 1VERA 1F4YL 4J6IA 4IJ3B 3C08H 3POHA 4JHWH 2EINB 4UILL 5EZJB 1A65A 3X3FL 1DVYA 2OMUB 3T77B 2BNRE 5E2WH 3W39A 4BSJA 4X7SH 4MD4B 4X9HA 5LGHL 4HK0A 2ADJB 4HP5A 3D18B 3D08A 3FUIA 1CYGA 3NJMA 5L4FA 2LLLA 4PBWD 2V9RA 4XP9H 4NO3B 4PGZA 1CL7H 3VSTA 1FSKB 1AE6L 4WWKA 3SYOA 4Z77A 1JF6A 4RAUA 1XZ0B 5IB4B 1XGRB 5D1ZC 1XF3A 2YAEA 4W6WB 1V3JA 1WISA 4JPVL 2AKRA 2R0WL 1TETH 5FB8A 4YLBA 2J8HA 3TNMB 4RWYL 1KJMB 1XIWC 2RTTA 3DURB 2HLAB 2G3XA 2X2JA 2OJZH 3DTDA 4JY5L 2QPUA 3FRPB 5BZDB 2VYRE 1LP9A 1H6UA 4EZLA 2NZ9D 5JOPE 3OZLA 3BVVA 1VADA 2HP4A 1NDMA 1TVHB 3SYCA 3QNZB 1KGUA 5F3HA 1QBAA 2OBGA 5FYJU 5DFWH 3EO9H 3ZE2B 1Q0EA 2EYRA 3OKLB 3VNYA 4RAVB 3X13B 4RMQA 4YAQB 3V52H 2D9CA 2C9XA 4XX1G 1SVBA 1OAQL 4JKLA 2ORBH 5CCJA 1YJDH 2FRGP 2WLJA 1LLAA 2JB6B 5CAYB 3WLWC 1O9VA 2J1YA 3CDGA 3JTTA 4FXKB 4PHXA 1PYWB 2KUTA 3BAWA 3JTTB 5J5EA 3MGOB 4ENEC 4P9ML 4PRIA 4LPWA 1L5GB 2J12B 2FJGA 3VD5A 1VACA 1JPSL 3H3KA 3OMNB 5CILL 5BMFH 2P28B 4MJ6B 5I8CA 2WBJC 4KK5C 1IAIL 4GSDH 4L1LA 4ZXBD 3L9EA 5L8JB 1VADB 3KHOA 2FX7H 4B7LA 1AMYA 5LAXA 2KC0A 3WE6A 3KZ8A 2NY6C 3FRPA 2WKOA 1DFBH 2GTWB 1XSKA 3DRQB 5BXFB 3NPSC 3VXMB 3AS3A 3VYPA 1J8KA 5BCAA 2HTKC 3ECWA 4F8LA 2Z4QA 3L8QA 4I0KA 1BFOA 4DZBA 4ZUVB 2BMKA 4M7KH 5HPMB 4MMZC 5D7KE 2R2CA 4AEHH 2OJEB 3COOA 3IDMA 1AKPA 4OT1H 4Z7QF 1T0OA 4DGWC 2DKUA 1OK0A 1R33A 2J2ZB 2P8PA 2X6AA 4HIPA 1MY7A 2CO6A 3BAEL 1CTNA 3CXHK 4LCYB 2P42B 2A7BA 5I1CH 2GY5A 4KJYB 4PN6A 4TNFA 3BZEA 1ZA3B 3ILPB 1TZHA 4X98B 4Y4FC 3RPBA 1FFPA 3UTQB 2EH7H 4XWOD 1DQIA 3PU7A 3BP6A 4FQ1L 3T5WA 4DUWA 4LSUL 3FN3A 4LPYA 5I71B 5L2KE 5I8KH 2FAUA 4HOXA 3MLUL 4PJGA 4MA3B 3O3BA 4KKCD 5AWNH 1OOAA 3CAFA 5FUOH 5GGQH 1NCIA 5EZPA 2NR6C 3NGBB 4HXAL 3BP7A 4IW4C 1Y07A 4IM8A 4DPBX 2EVHA 3DVNB 3UP1A 2ZOTA 1QPKA 5DJAA 3PWPA 1ADQL 4BKLA 2R0KH 2XC8A 2ZJSH 4O9HL 1Z1WA 4FYRA 4EZKA 2B39A 3BH9B 3B2UD 3BUDA 1HI6B 4A2DA 2IPTL 1FRGH 4LSRL 1BIHA 2FYYB 5M95B 3GEWB 5DLMH 1IX2A 1CVRA 1JGVL 2VR9A 3MRLA 3D1MC 4XE0A 3WXWH 2IDUA 5KJRL 3ATEA 2Z7YA 4G8IB 2YJLA 4HU8A 4KK6C 2ED8A 5BUGA 5BJTA 4IS6B 5EO9A 4IBQA 2WXLA 1CPUA 3FH8A 3EJQA 3MUUA 2IH9A 1E4XI 1JRHI 1BBJA 5CZVH 4BWUA 5INDB 4OD2A 1U4EA 5GSVB 1FO0H 1NOAA 3MRJA 1PZSA 4ZFGL 4OZFH 3FB7A 5LB1A 5IG7B 2YAPA 2ICES 4H8WH 4BWWA 3FU9A 1WO2A 1KGCE 2XYCA 2YN5A 3TYFA 1NFDE 1OCZB 9PCYA 4K0OA 3L9BA 4IK7A 3MLXH 4LLDA 2MWCA 4O2CB 4ONHA 1TEYA 2O26U 3K6SB 3V0GA 4AMKH 4WJ5A 4JN1H 4QT5B 4HPHA 1XWVA 1RH8A 2JKJA 2LR4A 2ZCKL 1ETJA 1UA7A 3VD1A 1QEWA 4PWJA 4X7SL 4EE2A 5CS7A 4A68A 1QKZL 2DWSA 2IALA 5EU6A 1XSJA 3LVEA 3PJSB 3VQLA 3G6DL 1CI3M 1JK9B 4S0SD 1QBLH 2J1WA 3KJ4C 1B0RA 4YSEA 3OXRB 3MRMB 3QJOA 4LGRB 5AQ0A 3AUVA 3K0WA 5FYJH 2YBRA 3HG3A 2DH3A 4LGPB 4DGVL 3QR1A 1FO0L 3G6JF 4I18C 4G8GD 4JDZB 3WHE1 4FLQA 3FQWB 2VR4A 1MAJA 1QNIA 1IJ9A 1WE5A 1BQHG 1G7PB 1U58A 1E9QB 2DI9A 3S97C 5FV1L 5CR1A 4OD3H 3HG0A 3TF4A 1GC1L 2YPKA 2IFFH 1LO2H 4MSWB 3U9PH 1IT9H 5ALBH 3BWZA 1ASQA 3RAJH 3W0WD 2X09A 4PS4L 1YEDA 3L3DB 4OFYA 3HFFA 1OP3H 5HBBA 1O6VA 5CEYB 2UZIL 3D48R 3FFCB 1V7NL 4Z7VB 2RIKA 1XMWA 3HR6A 2ZOKA 3H55A 2KLTA 1Q9WB 2ZG1A 1XMEB 3VI4E 3D33A 4BFIA 2EIZA 3O3AA 2FWSA 1IGJB 4XMKL 1OCCB 5IK3B 3U0WL 1KMGA 4HZLB 3CN0A 5HJGA 43C9B 5D4QA 1VKXA 1L9QA 3SPVA 1CG9A 4Y7OC 1HKLH 4JVWA 4OCRH 1CIDA 4PJIB 4DGIL 3AB0C 3MQIA 3VXTB 3NT0A 5IOPA 2BHFA 4FF9A 4RMSA 1MI5D 4OI7A 4GXVL 4M4PA 5E1AB 3Q8BA 4POZC 3QPXH 2FHFA 3KEHA 1P4BL 4QHNB 4XI5D 3VXNB 1LE9B 1FO0A 4KKAC 1ZVNA 1L0XA 3STZB 4ZPVA 3OHXA 4K7FA 2AP2A 5I74C 3PDOA 5JXAL 1AQKL 2WUCH 3IJSB 1LDPL 4KHTH 2VLKE 4ANKA 2PO6B 1QVOB 2VSMB 1W8EA 3H4HA 4CVWA 1UA6H 4YSCA 3B34A 1G7JA 1ODAA 4ZAKC 1B90A 4HKBA 12E8L 5LGKA 4AV0A 2Z7UA 4FMKA 3VXRB 1ZJAA 2HUHA 4FNTA 1RK0B 1NAKL 2G4GA 3DROB 4XNMA 1NGYB 3EFOB 3V5HB 4Y2DD 4KKAD 1FLTX 2C9QA 3RNKA 1LDSA 3DPBA 5KS9F 1KN4H 1TTGA 3EF4A 2DV6A 1BG1A 5E99L 5FEBA 1L3NA 5D7KD 3C60B 2X4SB 4LSPL 5C8JA 1UADC 1YN7B 4I2XB 4DZ8B 5DI8A 1JWUB 4X9IA 3VFUB 1IGCL 3KBEA 4JO5A 5T1MB 4X6FB 5BQDA 2RQ8A 1C8PA 1TIUA 3IJHB 1TFHA 4MAYD 1FH2A 2EO9A 3D9AH 3BIBX 5E6IA 5LNEA 3OX8A 3T4AC 4P48A 1G7HB 2JCWA 1MPAL 4NXSA 1AD0B 2MHAA 4Z7AA 1QFHA 4Z7WB 2GIXA 1TT6A 1TYJA 3ESNA 3OKMA 4Z7NE 5KG9B 2H2PD 1IGYA 3VFNB 3GZOA 2AVGA 4Y2DB 5HD8D 1RZKL 2E27L 2R23B 2HVJB 3LXUX 3OTTA 5E9DA 4BCYA 1F4XL 3KPSE 4M61B 4FE9A 2QFPA 4MTMA 5TH2A 4LNVA 3LKOA 3WKPA 4XN5A 1NCAH 3U1QA 4AT6B 3DBSA 1UC6A 4PWFA 2VN5A 3GBDA 4LDOB 5D72H 2NYKA 3UYPB 4LCWA 3IDXH 3NIDE 5AW4B 1EZVX 5IREA 2ALAA 4JDTH 2FR4A 5IMKA 5DHVB 4AWJC 3QRGH 1JK8A 5HVHC 2YOCA 5C0BD 2HUEA 3QS2A 4ZFGH 5C0ND 5J1TC 3QYCA 2PWFA 2YXVA 3V55A 1A7PL 1KJ2L 3V4VL 4GUQA 3MLZH 1WZ1H 1N0LB 3HC3H 1KXTB 2YRZA 4JO8A 4LBAA 1UXWA 3ENEA 3ZYJA 4UQ3A 3GKZA 3SGEH 2AQRA 3DV6A 3AXHA 3C75A 2E27H 3CSPA 3UDWC 3HC0A 2P5WB 4FQJH 5ESAB 3NBNA 4Z0XA 3FUMA 1EFQA 1A1OB 4HUNB 1DN0A 4FJ6A 2V5RA 4TVPL 1CBVL 4LSSH 3GSUB 4WUUD 4NSKB 3ABZA 3TBWA 1MCSA 4AQEA 3T0VA 1U3HD 3GHPA 4MASA 5IW6A 3PQYD 1OSEA 3MCLH 3F01A 2WBKA 2XQ0A 1DZBA 3EJJX 3J2PA 3BVTA 1WC7A 1B9KA 3ARTA 1RQ5A 1COBA 4OGYL 4OZFB 3SE4A 3RVVC 1A6UL 2HJKA 5INCB 2Y06L 1U41A 4MCZB 5SX5H 1WQVT 2V7NB 1TO5A 1UFUA 4HS6A 3VRLF 2WANA 4GRMB 1WWAX 1AZZC 4UNVA 3VGGA 3HE7C 5CJXA 5EZOL 2DD8L 4KK6D 3GYRA 4JVUA 2P5WD 1RUAH 4PV8A 4YFLF 1NPNA 2O72A 5BS0E 1JI1A 5LQBL 3DUHA 2DLEA 2W0FA 3QEUA 4C56A 3S35H 3QCTL 5KYYA 3LPGA 4DP7X 2G4EA 4G9FE 1IAIM 1LILA 4Z3FA 4UDTB 4MNQD 2EDFA 3VWJC 4NKOA 5F21B 4LLWA 1MHEB 3G6AA 3DX1A 3ASWA 4UV7H 2EE2A 3UMNA 3MI6A 5E8NB 3ELQA 1EHKB 4ZW3A 4QJ3B 1MCPL 5EUKA 3CH1B 1XGPB 4YN3A 3PJNA 1A64A 3ZHKA 1UM5L 3ME0B 5GGVL 3IGLA 3AABA 4XNZC 3RJQB 4EUPB 1Q72H 2EDEA 3JYCA 3TF7C 4YHML 1YEGL 4RZCB 5DRNB 1L0YA 1HXYB 1PKQA 3O6KL 1FGNH 5IBLC 4J39A 1XX9C 2WO4A 1EXGA 1TQCB 1MQ8A 4MAZA 4V33A 5DMJB 1OSZB 3VA2C 1JYWA 4M5ZL 1P69B 4IBZA 1JZ2A 4F58H 4QHMB 5I1HL 4P5KA 4JFOA 4CC4A 2NY0B 1KYUA 2VQ1A 4E5XB 1ET8A 1LWRA 3L1FA 1UA6L 5E2JA 4UINL 5IUSA 3V0JA 2ZXEB 4G8EA 1YMMB 2XKNB 4R90L 5IBTH 4KVNL 1R3JB 1VEMA 3EW3B 5EZIL 4M62L 1T66D 2NUTA 4JREC 1LK2A 2ZCLH 3PWVB 2VSDA 1SYSB 1MFCL 5ICUA 2EEBA 1X5ZA 2P8MA 3OAYH 4WUUA 3SGEI 4ZNEE 4H8HA 2Z93A 3KWUA 2WYTA 5IW1A 3TA3C 3NP3A 4HF5H 4QKXB 5CHNB 3A4FA 1A9BA 2H9GA 5IMLA 3QH3A 3QUZB 5AENA 4XPBH 4PJBF 3QRFM 2F8VA 5IR1B 2P24B 2A9AA 1A1MB 4QRPD 4CADA 3FO2B 2WBJB 2FBJH 1INDL 2VN4A 3AWEA 3BUBA 3RE0A 3GMQB 4GFTB 1WFOA 1CE1L 5ACZB 5F3BB 3L3KB 3DDGA 2B0SH 4YBQC 5F6IB 1AS6A 1DQML 1FYTB 5FS5A 2FATH 4AIZB 5I1EL 5IVOA 2YMOA 4JLRA 4HQQL 3FT0A 3H42L 4OGQC 3X11A 4PRAB 2YPVA 4NFBA 3BZ5A 1VENA 1BX2B 1I7RB 2OL3A 2QKIB 5T1DL 4PVBA 4HMDA 2QKSA 2Y2YA 4A2MA 3MUGA 1FVEA 2EEFA 1PAZA 3GNML 5K9KB 3A3YB 2IBZY 1NBZB 3UGEA 3RL1A 1DBBL 5GS2H 5E6YA 5FYKE 5A3IC 5I75C 4ZAKD 4FKHA 4Y4HB 2BIIA 5D5ME 2W81C 2D7PA 4H44C 3ALXA 3UCRA 5HHMD 1AGEA 2YLKA 4TOYH 3DYPA 3FQUA 4KTGA 1C7SA 4APQB 4LASL 4LQFL 2DOCA 2EDNA 4CDHA 1CR9L 3B2VH 4UYPA 3Q01A 1JPST 3GS0A 3H0TA 3UO8B 4HAFA 2F6AA 5D1ZB 3WL9B 3K1DA 1TTRA 1JZFA 3HRZA 4NZUH 3OGCB 2OXGB 1RK1A 2ZXCA 3TA3B 3GIZL 4GSXA 1P84K 3P4OA 1IILE 1QBMH 4HWZA 5E08L 3W9DB 1NA8A 4DIXA 3BKYL 5HYJD 4HK3J 3CQQA 3W56A 3WEMA 1I8UA 2ZXGA 4OSUH 5IJVB 1FJ1A 2HRGA 4P2RB 4JO4H 1DEEB 5ID0A 2GK0B 2YJQA 4APQD 1G5AA 2AV7A 4MMZA 2I9TB 2YPLD 1P5UC 2HJFB 4OCLC 2HSIA 4L8CA 5AKSA 5FM5O 3NYKA 1CGSH 3UAJC 2AEQL 1C16A 2VXUH 3HG1D 2ADIA 2Z0BA 4P2OC 4ORZC 4DEWA 4IRZA 3RA7L 3SKOA 5JYLA 2IWEA 3GO1L 4P5TA 5ADPL 4XPGH 4KK8D 4AV4A 4YSDA 1G1OA 3PWJB 4M9OA 4BQ6A 1PZUB 3OKEA 1CD9B 3FSWA 3PLYA 4LHQB 2CDFA 4OF7A 4L4TB 2CO1A 4JHBA 4JZOB 4NQUA 1YNTF 3FQRB 3KNBB 2XIDA 1S8DA 2H6OA 4FLSA 3UBFA 2BNUA 5BW7C 3T4AB 2RR3A 3D6GA 4DP4X 3QDAA 5AL0A 1ZHKA 4H1LG 5E94B 5BS0D 3MCKB 1FC2D 3RIFF 5EU3B 5I82A 3DO3A 2Q8BL 3QUXA 5AVUB 4M9PA 1CICD 1MCRA 3M17B 4AV5A 4HCIA 4NJAL 1GCFA 3DYMA 1EFXB 4BGLA 5KW9L 4OFYD 5EZLB 5F9OH 4GQRA 3EADA 3X2QB 4EN3D 3IBOA 1JVOA 4H40A 5DD0H 1OB0A 5DVNA 1MVFA 1NUDA 3I3BA 4GO8A 4PTUB 4U1LA 3HI6L 5BRQA 4PJDA 1JFHA 4TSBH 4P46B 4PW9A 2ATPA 3MLUH 1JZ3A 4H88H 4YXHL 2AMGA 2NY0C 2YS4A 3MV8E 4BYHA 4TULL 2CBOA 3LN4B 4L3CB 3LD8B 1IAOA 1CDUA 1THCA 3ZW3A 4GKSB 4JFTA 3ECVA 4NGHH 3UPAA 3FTZA 4BQ9A 3CZUB 2A9ML 4XO3A 1EWHA 3GI8H 2H6PB 5DS8A 1BD2B 5EFIB 3O6FB 1SOQA 5C0CE 3E1F1 4UQBA 3PWPE 4N8CL 3DVFA 3CX5K 5EEWA 1MW3A 1NC4A 1VFBB 3G5YA 3C60D 3L5XL 4KVNH 4L9LA 4KNQA 2W88A 3UZEC 1ID2A 3OWEA 1JGVH 4N8UA 3V9FA 1UA3A 2ED9A 2KI6A 4A63A 1JZ8A 1YPZB 1BA9A 1CLCA 2F54B 2F53D 5CLWA 1FZKA 2GUOA 2QGCA 1F2QA 1AJ7H 4X4ME 1T21A 2GFBA 3D7PA 2JNZA 1O7DC 5LBSA 4ZTEA 4KKRA 4K8RD 4RGMB 4PG9A 4U1KA 5FLVA 4TMPA 3HI6H 1ASOA 5JUEL 2ROYA 2CLZB 5MENE 2ODHA 4P4KB 4KY1H 1KOAA 3T2QA 4QXTA 4G1EA 2VDOH 1TJGL 3L9RA 1KPRA 3LRLA 3RKDC 3PJLA 3O6FD 3JTSB 4R96A 5KUKA 1T2QL 3KWVA 3CZKA 5AL8A 3SQBB 1UENA 4U1KB 3WHE0 5J0BA 4AZ8A 3FOLA 1MFEL 4X6DF 4LLYA 1UUNA 4BJLA 1VFOA 3KR3L 5ERWB 4OLUL 4GMTH 3G04A 3BEWB 3F7RA 1WK0A 3HE6B 5F89A 5D5MB 1CFNB 1HXMA 1EZSA 2AJSL 3HTLX 2FT6A 2X44D 4MLIA 4QRAA 5ID1A 2JH2A 2VRAA 2YD9A 4A6YB 2QV2A 4WO4D 3GBEA 4P9HL 4Y1TA 1A6VL 1ZT4B 4WGWB 2PCPA 3VI3E 5T33L 2R39A 5BRZD 2VXTL 3L3IA 4QMEA 5JMOC 4OW6A 5C0FA 2QFRA 3SQOL 3P9WB 4UM8B 1IAOB 4L1TA 1X5IA 4IGBA 3QXAA 3L7EB 3LN4A 2RHEA 4L3CA 3HFMH 2YSSB 3ARGD 5GIRB 1FAIH 1GPOH 2J5LC 4JFPA 5AW9B 5FYKD 3RFZC 9CGTA 2AFNA 2EVIA 1CFMA 1PEWA 3WBDA 4JO3H 3MJ8B 2WLKA 3DX6B 3PV6A 4F8TA 3WFCL 4P5MB 3FW6A 1LO2L 2ZYIA 3NIDF 1HOEA 4XAKD 1MJUH 4MXQD 2R0WH 5CM1A 1MCCA 1U3HB 2VDQL 4LOEA 1ZSHA 1S9XA 3RZCB 3UBXA 5I0ZA 1I8MA 1F1DA 4F7TB 1P5UA 4V11A 4L1HA 1OTSD 2PYED 3BSZL 2D3JA 4JG1H 3HKZA 4TSAH 2UWEB 1AGBA 5DHEA 5HGHB 2B5IB 3BJLA 43CAB 3KNBA 2QMJA 1H8SA 3HHMA 3IPFA 4QLRA 2FIKB 3B2XA 1ET7A 1RZ8B 5I6OA 3N2JA 1JDCA 2E9BA 5E9NA 3MOAL 1WAEA 2BW4A 1TO4A 3PFQA 5KANI 4YDKL 2HPTA 5LBSH 4LQ1A 1J0IA 1DR9A 3V2AR 5KJ7E 1RZFH 4JDVA 4AENA 3NOIA 1SYVA 2R69A 3H9HB 4IBWA 3LKRA 4Y5XC 1QRND 5HY9B 3H2PA 2NSMA 2XWJB 1A02N 3ARRA 3RVTC 3WO4C 1RUMH 5I1LA 3BPOC 1F1GA 1SUJA 2MNWA 4Y5VB 1Z32X 4QYOA 3B5HA 4N9GB 4HWEL 3RU8L 1ZLVH 3KJ6L 5EBMB 5FGCE 3HBPA 4HQQH 3Q6FA 4NFCA 4UOW0 5FDWA 4OUUA 4ICXA 1O5DT 4HLEA 5HDRA 3N3EA 4BCXA 1MHCB 2NR6A 1LDPH 4ZO6A 2UXTA 1DVQA 1QYGH 3I3DA 2DLFH 3ZDXE 2XXGA 1P2CB 3IFNH 4S2SA 4UM9D 4XBMA 5FUCC 1KY7A 3K5RA 5EBGA 5KEZA 1ORSB 2CKBA 3EDEA 3KPRE 2EE6A 3U30C 2BCMA 3C6EA 2DQTL 1OLLA 3S5LG 5F7EL 4RMBA 3C6LB 15C8H 1QA9A 3QIUD 4KTEL 1T83C 1VZIA 1FL5B 4XNDA 3IJYA 1J9SA 1U8CA 3LQAC 1J0HA 2QVMA 5TPWH 4LSPH 2HN7A 1HL4A 2Q7YA 3HZVA 3MLTA 3U1PA 5C7XH 1IAMA 1K72A 1OSPH 2VWEC 4XPTH 1AANA 1EA9C 1AGCA 4MJIB 2C3VB 1A22B 1E8WA 3EO0B 1AHKA 5EEVA 3MV8D 2Y2TA 2WMPA 4G9DA 4OI8A 1XBRA 4C4KT 1FN4A 3BRDA 4GI6A 3VFVB 2DM3A 1WFIA 1K2DA 2ZWKA 2EDTA 5DRWB 5F9AC 4JFEB 5FUCE 2R2BA 4QRPB 3F7LA 3DC0A 1S7WA 2WVVB 1EO8H 2BIMA 3FJTA 4N0UB 4ZTOH 4B96A 3IETB 3BUQA 3PWPD 3VDAA 2YAOA 5K59F 3IWUA 4HPYH 1J0YA 1SVZA 4XOBA 3EGSA 3NZ8B 3RRQA 3BDYH 1GSMA 1HHIA 2ZXDA 1QI3A 2D2CC 3ESUF 1X7QB 4FG0A 4HMEA 4LSSL 3ZN6A 1J8SA 3T09A 3UTTB 4TTGA 1SZNA 4UI2A 1DVXA 1U3NA 3QUML 1VLXA 2NY7H 4M1GH 3JZYA 4B60A 4MBRA 4FNSA 5TQ0L 2EECA 2N0KA 2I27N 4Z7QB 5CHNA 4X7DC 2IBZX 4ZYKA 3VI3B 2E9GA 1NFDA 4YFLI 4AQZA 5MEND 1NL0L 3O3DB 1N6UA 2EIDA 4TQIA 2V3FA 4Y4HD 3T71A 2FO1A 4R7NB 3WD5L 3ILDA 1M9SA 1WAAF 2NOYA 1DVZA 1JPEA 1MUJA 2ZAHA 5LKNA 4AVIA 1E5ZA 4OUUB 1BLNA 4HU2A 5J1AA 2GSMB 5L8LB 4FXGB 3OJVC 4GP4B 4WV1A 2HG5A 4P9HH 5K69A 4L0YA 1PKOA 4DQOL 2AJXH 3MX0B 3NRFA 3VWJA 1PGRB 3SE8H 4NQQA 2WSPA 3L4XA 1D7BA 5DWPA 3PWLA 5AFAA 1BIIB 2W80C 1F13A 1QQDA 2WKOF 5HY9A 3LKRB 3B1TA 5KUMA 4JX0A 2FJHA 2YA0A 4F2FA 1ZAGA 2QQNL 3L95B 2EJ1A 2FLRT 4IYKA 1U8LB 2WPGA 1A6UH 3MROA 5BVJA 2ZG3A 3U2SB 1PZBA 3GXUB 4DN4L 2NX5B 4A2HA 5C9KA 4Y9BA 1FP5A 3UJTL 1PLCA 2OMXA 2HZHA 3MO1B 1YA5A 2WK2A 2OMTA 3KBPA 2X4PB 1R5WB 1X6NA 2X05A 1HTYA 2I07A 4P2RD 5DJ6A 3WIHA 3DTUB 4Z7NF 3F6JA 3IDIA 1I3GH 4F7KA 4B7IA 4EDXB 1A3QA 2YD4A 1NEUA 2OMTB 2R4SL 4QEGA 1S46A 1YMHB 2YEZA 5E00B 3S37H 2BVQB 2OMXB 1TSRA 3VXUB 2KHAA 1BREA 2DICA 4LCWE 4N5EC 2BCKB 3FCUB 4Q9BA 4WK0B 5JIHA 3SPIA 1E5UI 3CPLB 5K1VA 4YWGL 1J1XH 1U8LA 1KBBA 4LL9A 4NM4H 3HPJB 4YO0B 5GGVH 4C56B 2HRPH 2PYFB 2PYEE 2AJUH 3TONA 3L2MA 3IB4A 3MJ8A 3PV6B 4OFKA 1AD9B 1BBDH 2OR9H 1LXMA 4QWWC 2NXZC 3V6OE 3BPCB 4KDTC 3TBVB 4HUVA 4IU2B 3W37A 3DJTA 2VUYA 5CCKH 5GS0C 5I19H 2DN7A 1M7DB 3QDGD 3APFA 1LO4H 3CH8A 3DO4A 4UANA 3CBRA 3SYPA 1V7MH 3QFDA 2XZCL 1MUJB 3C8KB 1R5IB 4IIQC 3VGDA 3O3UN 4U6XA 2E59A 1YYCA 2YXFA 2XXCB 4WWKD 1H5BC 3IKCB 3T0EA 2E7CA 3APMA 1NCNA 2DWDB 2JB5L 3CXFA 3BMWA 4N2IA 1SBBA 3K46A 2I60L 3DIVA 1IM9A 3JSSA 4TM9A 5F7BA 1CC3A 2F58L 4N2MA 5CJ5A 4OLXH 3BAIA 3OKDB 1AQKH 3FCSA 3LKPB 1MAMH 5DUML 4G80B 1QO3A 1HHJA 1RIUH 5HGGS 3UTTA 2PR9A 2VLMD 2WUBL 5E6UB 2XVBA 3GI9L 1NCUA 2LV4A 5E6ZA 4QTHA 2E8ZA 1BBDL 3U4AA 4NBYB 5T1LB 3OB8A 2DL2A 4Z3GA 5F7EH 5FYLH 4DTGL 4G7YH 4XNUL 3VXSB 4HW6A 1II4E 4LSVL 4E41B 4GI8A 4AZUA 3L1OH 5F9WC 1J10A 5F7HA 3FF8A 5CZVL 4J3UA 4DCQB 1SJEA 1WRFA 3OKNB 1RAMA 3U0TA 3BQUB 5C3LD 4XO9A 3D34A 1ZA6A 4Q6YA 4HPOH 1DLFL 5EC1B 4KKLC 3T0XA 5I66B 4LLQA 2XWBA 4UMGA 4UOZA 4GW4B 3RB7A 4NQSB 2HX7A 3S7GA 1GYUA 2N4IA 2C8NA 4G2AA 2F19L 1U8NA 4LRNH 4H4NA 3WIHH 4WEUD 1HE8A 4L0ZA 3CN1A 2QADB 3HZVB 2AEPH 3MLTB 1GC1H 1FIGH 1DQMH 4UTBL 3U9PL 2OZNA 3L16A 4EI5B 1Z3RA 4Y2DA 4NENB 1E2ZA 5D1XD 2ENJA 4AMWA 4JFEA 5E2WL 2E9IA 4AKOA 4ELME 1KLFB 4LESA 4YXLL 2ZKYA 3RGVC 3I50H 4QTIH 1MDTA 4IMLB 1EO5A 2ATPB 4C4KO 2X1OA 1AHMA 4XPHH 3TEYA 4NUQA 3TBBA 4RSVA 5F7DA 4AQAA 1TTCA 1SY6A 3QUMH 2ITCA 4JFWA 3SDDC 1SF5A 1D3CA 2AXJA 1MVUA 1I9RH 2ICWB 3S5ZA 4RWYH 1T3FB 1RL1A 3ETBJ 3O9WD 4K5OA 2PXYA 3MBXH 4JY4A 5EU3A 4N26A 2WLIB 5A6IA 3E0GA 4NP4H 2AEPL 2JF1A 3FQ1A 4FDWA 1HSAA 3DHMA 3SDXA 3KYKH 2JV6A 4PBVC 1T2JA 3D4YA 2BNUB 5C97A 3TZVB 4MA8L 3I9GH 4FQJL 5EOQH 3VFWB 5D9SB 2ITEA 3VFTB 3V5DA 5JW4Q 4RZKA 3FB6A 1O9WA 1I1FA 3FU3A 1HE7A 1UGNA 2XTJD 4S1SH 3RUGE 1LK3L 2WJ7A 1SXCA 5FDWB 1RZJC 4W9LC 4A7GF 3AY4A 3OR6B 3CLFL 4L1BA 5EN2A 1DQJB 3DXAA 4FZEH 3UAEA 1QNZL 4OGXH 3UERA 3MBEC 4OGYH 3GLEA 4HHAA 4KQ4H 3EO9L 2A83A 2UWEA 1DCLA 1SUHA 1D9KB 2P7TA 2VLRE 1ILSA 4W9ZA 1PSKH 1DFXA 3BRGC 3WFZA 4NUJA 4AIOA 3VXPA 4NHCH 5T5NF 2AV7B 3L3OC 4K7PL 3GRGA 4MJJA 5IK3A 1SGKA 1CFTB 4R4FL 3RL2B 2NYYD 5E1QA 3RDTA 3B7TA 1RUPL 1P1VA 3BKCH 4TYUA 4K5MA 3EYSH 2PTVA 1Y18B 3WLBB 3WO3B 4WFGE 4Y5VC 3RPIA 1F6AB 1NMBH 4K3JH 3UPCA 3H9SA 5HGBB 3WNOA 1YEDB 5HD8C 3L7FB 3MYJA 4LIQH 4CC0A 5LG6A 3AZUA 1JP5A 1S7XB 3ALPA 5GZNC 2G5RA 1A6ZA 2OTUA 2CPUA 4L3AA 4K3DH 4UTBA 5I1IH 5I6NA 5FO8B 3ZDZE 5D7IA 4QRRB 2GHWB 2I7SA 4PSPA 1XTLA 4JCLA 4LCWD 1P7QD 4HJTA 1E90A 1EHAA 4KRPD 2K78A 5D1QA 1HH6B 4NENA 2L8AA 3BAEH 3M45A 1E6OL 4Z7UA 3FQUB 3IGKA 3GLDA 3MYZA 1UFGA 1X4YA 1KLUB 1H6TA 1AQDB 4PJEE 4HWBL 2YBRB 2YFOA 4LSTH 3S6CA 3E9UA 1M2VA 5AW5B 4F9LA 3ILEA 2DIEA 3S5YA 3EZ8A 4GW4A 4NT6A 3E6FB 3AM8A 4K3HA 5HHOE 2L0DA 2NZ9C 5I1CL 3GMPB 2G5BB 4H0GA 4U0RC 5JA8B 1OE3A 1XGYH 1Z0MA 5LBGA 4ZMYA 2V0AA 4QI3A 2EO1A 5CJBA 4LHUD 1TPXB 4JHZA 1CXEA 4I5BB 4KVPA 4XCFH 3IDNA 3EOYG 3A4AA 1JN6B 4BH8A 5JHLA 1QPXA 4OLUH 3U46A 2WVSA 3PL6C 3AT0A 2A0LC 4X4MA 3OJMB 5FA3B 2J8UB 1SXBA 3ETTA 5C0DA 3MC0A 4FQXD 5C2BL 1T21B 2GFBB 4KY1L 1WSST 1J1OH 2ARJQ 2OMWB 2PPDA 3HZYA 1QO3B 2I25N 1X9LA 2YQ2A 4KVCH 1PZ3A 1UCBH 3PNWB 3L5JA 3MV8B 1UVQA 2R1WB 3UH8A 3MUJA 2H9GB 3UTSE 5ERWA 2WQSA 2BWIA 4FQ2H 2PWHA 4Z95L 3L4CA 2D3LA 2KZWA 4DCQA 1DBJL 1FV1A 3DSNB 3KHQA 5I1KH 2UVFA 4KK9C 3EGDB 2VDOL 4I0PC 5DUBB 5IHWA 3FFDA 1YLBB 5E9AA 4FCAA 3C09B 5AVXB 2FT8A 3HC4H 1R3JA 1R5VB 1AO7D 3MMEA 5DHYB 2BW5A 4KQ3L 3KS0J 1CE1H 2NQDA 3BH9A 3GSNB 4FAAB 5GS0D 3F12B 5T1LA 3ZO0A 2BWDA 4PRIE 3CFJB 4PGDA 1O0VA 1RZ7H 4R8WH 3SDDA 3NCCB 4GSUA 1GZPB 4OCMC 5I8OH 1NM4A 1N12A 3DA0A 4H20L 1ET5A 2JFCA 2PWGA 3KD4A 4CW1B 3MUZ1 1ILUA 5KVDL 4FFZH 2JCCF 3V0IA 2RFXB 4H1LB 3BSZH 2OTPA 4YDMA 1KBPA 1RU9L 1QFUL 2BOCA 5I16A 4JVPA 1TDQA 1A21A 1OT4A 1V54B 2QMKA 4X99A 2FNWA 1OGAA 3AG1B 5SWZD 5D7IB 4GAYA 3D3VE 1RP9A 4JPSA 4PRNA 2LVEA 4MVBC 1JZDC 1R5IA 2BRRL 5B1AB 4BK5A 2W07A 2WZ6A 3MA9H 4MHHG 3UAAA 4BE5A 4FG6D 4UB0L 2X2HA 1X5JA 3GPEA 4LGSB 2LOEA 2XZAL 3L3OB 4YPGA 1FC1A 3OPZH 2CJTA 4RH4A 2C5DC 4OQTL 1EFXA 1F3RB 3KLSA 2CH8A 5GS1A 2J72A 4UZUA 5F72S 3BE1H 1SBSH 2A9DA 1QPPA 4G42A 5K1JA 3VXMA 4HUKB 4UINH 3MLSH 3ZE1F 1TJIL 2GTQA 1NIAA 1OZUA 1E5YA 2W0PA 4KFMA 4N2AA 1N5YL 3RBSA 3PWUA 4AVJA 3L3OA 4M4RA 4NAMA 5C6PB 5B4MC 1R6VA 1I3UA 5I1JH 2QHRH 1ANUA 2PF6A 3T4AA 4MMZB 2I9TA 1A2YB 5A43C 3JXAA 1T4WA 2ZSWB 1FVCB 4NXKA 4OH2A 1I7ZA 2VMFA 3KPTA 3OR6A 1OCRB 3WEOA 4WEMB 2IOOA 1RKRA 1NCJA 4NQEE 3S48A 4G3YL 3QIWB 3B56A 3IDIB 4DVRL 5EWIL 4K2UL 2IC2A 3VXUD 3LH2L 3CFEA 3A24A 5B39B 3V7AE 1XGQB 2V2XA 2ROXA 3EBHA 1MNUH 2YRLA 2IGLA 1EO7A 4GSQA 3ZDXB 3RFZB 2VZ3A 1N18A 3VI3A 3DIFA 5I24A 2IXQA 1X5KA 5KBNC 5LHDA 1RK1B 1PZAA 1UM6L 4KXBA 3ZMNA 4PRPD 5DWUL 1SLUA 2WZPD 1JTTA 3OKLA 3GSWB 4PJBA 3QJRB 1QACA 5HXMA 3BHBA 2IPUG 2QL1A 1FVDB 4CW1A 2CJUH 2KMWA 3WUWA 3CBKB 1Q4NX 2HG5B 3X17A 3H9YA 2F1AA 1PIGA 1T7WA 4WV1B 4ZW5A 1SPDA 2MTAA 3CFJA 3SDDB 5T5FA 4HUMB 3OD3A 3MX0A 1OE2A 3K0YA 2YGOA 3C5ZD 4PG2A 5AOMA 4D0CA 1N26A 1VFMA 3RFRA 4Y4HA 5IQ7H 1S78D 1MG3C 3QO0A 1L9TA 1EAPB 2OYMA 3W9DA 4JDEA 1OAZH 1M7UA 1Y7VA 1EJ6A 3NESA 5IMKB 3ULVH 3RILA 5JHDA 2XPZA 1AY1H 2HTLC 4LPTA 4HG4K 1RK7A 2ZCZA 4PRPB 5IESL 2UV3A 3DSNA 1QLFA 1HYSC 2VNCA 2FBJL 1DQDL 3ARDD 1IBYA 3BZ4A 1U95A 5TH2B 5L2KB 3F2LA 4H88L 4AM0B 4OLWL 5EO0B 3V0FA 4ZPTB 3U7AA 1EJOH 4AUJA 3BT2H 4URKA 1ETA1 1GRWA 4X0NA 4IHBA 4N0UA 5TQ2H 4AYDC 1DQKA 2WSDA 5L2KA 1UT9A 1XXDC 2Q10A 4I85A 4LARH 5C09D 3FO2A 3NJGA 5HHOD 3VXSD 5KG9A 1NAKH 5CSBA 4PI2A 4ZPTA 5I30H 1JE6A 5EC1A 5KYUB 4X83A 3KYNB 3FH5A 4HBQA 3BP5A 2WINA 3JV4A 3ZK0A 4R0LC 4H1LH 4BUHA 3LQMA 1SJEB 1FUNA 3NABL 3TJEH 2R9HC 1BM3L 1EAPA 1WGOA 3FDWA 4UQEA 1E7VA 2A9CA 1NGWB 4NQVA 3X11B 5IM7A 3MREB 3F7KA 2VR8A 1GGYA 2G0KA 3T08A 5KYUA 4C56E 5JHDB 5KSAC 4KQ4L 3A67H 4OJDH 4MCYB 1KGIA 4CSSA 2OLDA 3HAEA 4WFHD 5C08E 3POCA 3TWCH 5CZXD 5A16B 2YLHA 4U0RB 1IUZA 1SN5A 4QTHB 5KVFH 4AG4L 1CF1A 5I1KL 3CDCA 2VDLH 4G6JL 4GLRI 3ZE0E 5CEZD 1O7DE 3B3BA 4IBUA 3SJVD 1VCAA 1CXIA 2ENSA 2QPSA 2VN6A 5I1LB 5C0NC 1BZ8A 4Z7UB 3VGHA 1HWGB 3P0YL 4FG2A 2XN9E 4ZK8A 3ARDC 3STBA 1G7JB 3RIAK 3F83A 1A9VA 4NAJA 4PH8A 2DQEH 1PPIA 2VO8A 1QLFB 4W9HC 2BC4A 3WLWD 3WTVA 2RBLA 1SM3H 2IGFH 2IAMB 3PGCB 3TU6A 5IHZB 2JKWA 4AYEC 1RULH 3LXCA 2FIKA 3RNQA 2HLFD 2NX5E 2C4FT 5C92A 2E6JA 2AXGB 5E8DL 5K9OB 3IU4H 3DVGB 1UTDA 4G6ML 2ZXQA 1BXVA 1GGIL 1U8OB 2CCWA 1IU1A 1WZAA 3O2VL 2BSEA 3DI3B 4QLWA 4PRID 1M4KA 1DUZA 1SEQL 2BZ7A 4HV8A 1AR1B 1QSED 2BRQA 1HHKB 3RVVD 3UG3A 4W9GC 1DBKL 4IKLA 5GHWL 4QRTB 3SCMA 4ADJA 3OZKA 3QZNA 2HRPL 4N9GA 5G5DB 4ILDA 4R5XA 1YPZF 1W0VB 5I71C 1FDLL 4LLVB 2N1KA 2OR9L 3O0RH 2FUTA 1PKQB 2H0PA 4GMSH 5EN2B 4N0CD 5F70A 1X5GA 2OMZA 2C9AA 3B4NA 4Y16A 3SDCA 1T5KA 3BPLB 4ODVH 5B3NA 1Z5HA 4NBZB 2R4SH 1UWGH 4UT6A 2A5UA 4UV7L 4HS6B 4DT2A 1RV6X 2PYEA 3LS5L 1NGPL 4PVMA 2XTSA 4XX1E 3L3IB 3CZFB 3F8UB 4PV1C 2OL3L 1IGIL 1SEQH 2V17H 3PV7A 1RUKH 3PWUB 3T2LA 4AE0A 4JDZA 2A74A 2CRIA 1OAXL 1URZA 3PY9A 3PPSA 2HFGH 4LFHD 4MFHA 4GEIA 3DTXB 3ZPDA 2VMDA 1V7ML 2WSKA 1PS3A 3IDJB 4U2ZA 4XWGH 2RACA 1SOXA 3SE9H 3X1GA 3D50A 3LH8A 1S9XB 2QELA 4NNPH 2ENQA 5EG6C 5KANG 4FABH 3W0WE 3MTXA 3CXDL 1E4XL 3DV6B 3OR7B 4L4VA 1KIQB 3EOAB 1YEEL 2Y1VA 4UZGA 3FUDA 1K4DB 1HEHC 3EHBC 1QLRB 5J7CC 4JFPB 3U7YH 4P49A 4TL5A 4Y4HC 1FGNL 1D2OA 4ZUSB 5DGQA 3VWKA 1AR2A 1D6EB 4ZMVA 4MZ2A 4Z5RA 2OW7A 4HHWA 5FGRA 2A6IB 1IKFL 3ATDA 4K8RC 3T2OA 2JKXA 5FYLL 1NTDA 1ZT4A 1IGIH 4TKWA 1THAA 4JMXA 4TPRH 5CSZA 1FV1B 5KWYC 4CMMB 2Y7LA 3TYGH 1N19A 1TLMA 5LCVH 5E24E 1HYRC 3G5VA 2R59A 5DD1H 1ZPUA 2MOVA 3PNWA 5KYWA 4L9LB 4WNJA 4XZ4A 4PY7A 4LLQB 5AG9A 2GSGB 2P80A 1WA0X 2XJLA 4L0PB 4ZBJA 4XNUH 1IC7L 1TFPA 2O61B 4NX0A 3U0TB 5EOCH 4GY4A 3IETA 3OAUL 3U0PA 2HJLB 5C0DB 4BZ2H 2WQUA 1R75A 5IMOB 3K8LA 1RHFA 4RNRA 5DHVA 1YEEH 1U91B 3MA9L 4LRIC 4R96B 2XX1A 2N7BA 5DRWA 3BT2L 3M07A 4Y1AB 2DAVA 2FE0A 1P6WA 3CVDA 3GMPA 4TLUA 3V4LA 2CLZA 1UWEL 3NJFA 3A5VA 3BCDA 5IT2H 5AVZB 4YNYA 3KXFD 5DZPA 1FORL 3QAQA 4L3ED 3KH3A 3QDHA 4NQCA 5IHLB 1IC4H 4ES9A 3QXVA 4YXLH 2A9NL 3LKOB 3U6XS 1T7VA 2P3YA 3MLSL 5ABAA 4HJJL 3EF7A 1O9ZA 2X2UA 3V7AG 3P30L 3FCSB 3LKPA 3Q7JA 3C60A 1BZEA 2IBBA 1E8YA 3IU3B 1PG7L 3WNPA 1F5WA 1CLOH 3GHBH 2AERT 1DZ0A 1BEYH 3MV11 3DHJA 2VABB 5DZNA 1MFBL 4KWUA 3LY6A 2VZUA 4QRRE 2IMNA 4ZT1A 3TIDA 2EYTB 5D71H 3U82B 2NXZD 1O7VA 3QHTC 2XWZA 4AC4A 1GY2A 4LCCB 2FD6H 3PUUA 1GH7A 4JZOA 4PTUA 4MB5A 1IKNA 1IM3B 5CBEA 1F6AA 3CLFH 3U9UB 2HT3D 3IJSA 3B9DA 5FV2A 2FEEL 2K9UA 3SDCB 1B4TA 4WFHE 5C08D 4XX5A 1UD3A 4Y19D 4OQ1A 3KPSD 1AI1H 3TASA 2C1PA 2YUXA 2HT3C 5E08H 3QUXB 1S3RA 1TMCB 3Q6FB 3ARZA 5EBMA 4M5SA 1QHOA 1TCMA 3PG2A 4YO0A 1IKOP 2GTWA 3DV4B 3DROA 3WE1A 2ESVE 1SMAA 2PCFA 3WD5H 3R8BB 3FFCD 2DY2A 1S7SB 3NCYS 4F33B 5KAQG 4GBXA 5DJXB 3TT3L 4OZHE 3AREB 4MRBA 3ARPA 4D8PB 4AH2B 1BF5A 4NUPA 3O2VH 1S4IA 4AENB 4QHPA 2Z4TA 4EDXA 2P7TB 4Z3HA 3FAXA 1RI8A 1SXSA 4J27A 5IIEA 4LIQL 4P2OD 4TSCH 4A6YH 4D7BA 5KOVC 1VPOH 2AQ2A 1NBCA 3GXMA 5ALCH 1RZFL 3VFWA 2X89D 4HCRA 1H3PL 4ABWA 3FB8B 2HCZX 3SYQA 5GGRB 4Y16C 4U1HB 3UMTA 2A1WL 5KYXB 2FL5A 5C08A 1ZK5A 3WTSA 3BKCL 2WLLB 2H7WA 3PWJA 4Y0GA 4YHOL 3GSQB 2QVKA 5IIEB 1SFDA 3VE0B 1VCBC 4L8CB 2J56A 1JWSA 1W2KT 4WUUE 5DD3H 4PB0L 4GXVH 1R47A 1G7PA 1U58B 1PCXA 1QX1A 5FCUH 1RERA 4JQVA 4OI9A 2BIOA 2OM5A 2PO6D 4P5SA 3PWLB 3BPNB 4RX4D 7FABH 3UBGA 5JXAH 1MIML 2Y7QA 3A6BH 4L3FA 4L8DA 3VTAA 2YGQA 1MIEL 5J3HC 5AW1B 3DURA 4KO5A 3AB0B 5CEYA 2G2NA 1KJMA 3TJEL 5BOZG 1BZ7B 2R0KL 5JHAA 3W11D 3FYEB 5I1IL 1SQMA 3SOBH 1T6WA 5T1KD 1QSFA 1XF3B 3DX3A 1FHNA 1CGYA 3ZHLA 4KXDA 4U1MB 4XBPA 5FFLA 3TV3L 3VSUA 2VLLA 2QDVA 4YXKL 2GPZA 1YY9C 3OF6D 4RMVA 3VXOA 3QQ3B 4F2MA 3OGCA 2JJUA 3S36L 2MOGA 1WA2X 1BVNP 4CGTA 3MCG1 1A4BA 1ZVHA 4XXWC 1R9FA 1T04B 5EHFA 4EI5A 2VDKB 3X12A 4BM7A 1JPTL 1QHPA 3NCEB 1P1ZA 2QVFB 2XKUA 1GGTA 1WWWX 1N3NB 3NDZE 1HJBC 1SLVA 1UJ3C 4OM1H 2GY7B 1BBJB 2W9DL 4YHPB 3L54A 2DBLL 4M6OH 4A2GA 3HMXH 1O6TA 2UUDH 3KPLB 2XWBB 2MIZA 2OK0H 4D3CH 3FPYA 1SHXA 2EDHA 2WINB 3GDBA 3JV4B 3S3CB 1FZOA 1G0DA 1TZIA 2F7OA 5FHBH 2ENYA 4AEHL 4AMKL 3CU1A 4DQOH 3ZL1A 3BQUA 4UT7H 3T65B 4G9DB 3S3SA 1H9VA 4HAGA 4RWHA 5IF0B 1NBVH 2RA1A 2WWMD 3CFNA 4JFUA 5DEZA 3SPGA 3NIGE 4PGBA 3DPDA 3K6NA 4U6VL 4XC1H 1F58H 4Q9CA 4G7SB 5CO1A 1MRFH 2YD6A 4POYA 3N91A 3SY6A 4NZFA 3GRWA 4S0TD 3F7VA 3T2NL 1JNJA 3WMQA 5EF2A 2VQ4A 4UOJA 2EH7L 3MR9A 4DO4A 2CRYA 5F1IB 3GPSA 4B41A 4K7PX 3G5VB 2Q2LA 3UPRB 5AVVB 2EABA 2X4RA 3G7TA 3RWHB 4EI0A 5EU7E 3GB7A 1EXHA 1ZLEA 5A7BA 3K6DA 1WAAE 3LX9A 4PFEA 3QK0A 1DLFH 5AVQB 2WXGA 5EUOA 1TJGH 4HZAA 4CUCA 4HMCA 2H6PA 1OL0A 1TVBA 3MLZL 4TLTA 4YHNA 3HC3L 3HZKA 3NJVA 2E4TA 3CSTA 5HJDA 4U4BA 1TQVA 4ZW6A 1AHWA 2VAAB 4YHIA 1XGPA 1JCVA 1V10A 4QOKE 2J88L 4WWNA 3TTSA 4N25A 3LNGA 3KXFE 5DVMA 4PV9A 4JDTL 5CSGA 2LHAA 2MCMA 3K4DA 3VD9A 3P02A 4FNLH 4KJPC 4U1LB 2R29H 3UG5A 4BZ1L 5D7LB 5BOPA 1KB5L 1DN2A 2OA9A 4ZUUA 1MRFL 4C55A 1L7IH 1QFOA 1AOZA 1LO3H 2N1TE 5CGBA 2P49B 2QGBA 4QHMA 2FBRA 2OCCB 3WTYA 3NRPA 1T1XB 2HH0L 3SGKA 3DSFL 3QS3A 3X1FA 5J11C 2W0FB 3QEUB 1KTRL 5DT1L 4MQXC 4OZHB 2XX0A 3MTRA 1NANI 1XGQA 1U36A 2V2XB 4EQ2A 4H8WL 1RP8A 2VMCA 5CD5C 3PXLA 4HS8H 2FQGA 1RURL 1AR1D 2CIIA 4W68A 3P4NB 3FQRA 2F8XC 1HNYA 3N85H 4MMYB 3ZTJH 4HUXB 1RIHH 3STLA 3T04D 4EKJA 5HHME 3NQKA 3BVXA 3BPCA 4OZFA 5DJ6B 1RZJH 1MFVA 3NZHL 4Y4FB 3C12A 3CDGB 1YO4A 1MHEA 3G6AB 1T5WB 4IKIA 4PD4K 1LWJA 4LB8A 3UG4A 3TBWB 2ESVD 4HD9A 4IRJC 2DMBA 1KC5L 2OR8A 4LFHG 3FRPG 4NSKA 3X3GL 3ULUC 1GAFL 4JQIL 5BNXD 5GS1B 3AFLA 4RDQG 5TDPB 4NKIH 2J3SA 2WNXA 4YS4A 2O5YL 3EUDA 3UBXG 3NMEA 2M8XA 4EN2A 4UQ3B 1OCWH 1XH2A 1A1NA 2O6PA 2VDRH 1DEEA 1AKJA 3IXAB 3LEYL 5EWIH 1VACB 1BLNB 5J1AB 1CXFA 5FIEA 3D2TA 3CQPA 3JWNH 1NMAL 2DYPA 1PMYA 3E8UH 3BDBA 2WYHA 2HJKB 3RVTD 2YSSA 5FGSA 4BQ8A 4ZFOB 3RU8H 2CR3A 4U3HA 5AAWC 1ZOXA 5K9OA 2LT9A 3PQYA 2YPLE 4IRSB 3DGDA 1NMCC 1TJHL 4RCAA 4UIKL 1A6TB 1AC6A 1P53A 4IOFD 4LDEB 4KRMB 3P30H 3NPZB 4TTDC 2XZQH 2BC4B 3EHBD 3ZX1A 1EJOL 3HG1E 4TQ8A 4B0MM 2QSCH 4JGNA 2WOBA 2J57A 3LYRA 4FTVD 4QO1A 3FS9A 2VLKB 1NDMB 5H35B 2X40A 4DPRA 3KL5A 1N2RB 2A6JB 2H1XA 3MOAH 3P3TA 4RGOL 5LNGA 3UP6A 5F89B 1XZWA 4FQCL 1MOEA 4G6AD 2KZ1B 3GSNA 3BIKB 5HGDA 1IVLA 1DDHA 1X7QA 4QRFA 1HKFA 4OZIF 3PREA 2IGTA 2BSSA 4K94H 4BXSV 3ULVL 3MMEB 1JV2B 5DHYA 2H2PC 1KTCA 1QFPA 2FR4B 1KPUA 3BSZA 2X9XA 1UD4A 2SEBA 4ANWA 4WO0A 3KDPB 5IBTL 4N1CA 5KN5B 1DQDH 2MTPA 3WNNA 3QPXL 5I1AA 3EHBB 1FNLA 2F19H 4LRNL 2EC9U 2F7RA 2VRKA 3EO0A 3LXBA 5I0VA 5A3ID 5I17A 2PPEA 4Z7NB 3MBXL 1JWUA 4OLZL 3VACA 3IFNL 2J71A 1M2OA 4RGNE 3BUPA 3LMJL 3Q5YA 5HHVH 1OAJA 3FUEA 4BA0A 2HN7B 5AW6B 5C6TH 3AMKA 1USZA 5DJ8B 3X12B 5I1EH 1LWHA 5HI4D 3OVUB 5DZAA 4UMSA 4XBGB 5EU6E 1P4UA 5FHBL 1CB4A 3NSJA 2AK1L 1M1SA 4CGUB 4P23C 4GW1A 4L3EA 1FSKC 5EOQL 2CO4A 3OXSB 4D7PA 2ORBL 2BDNL 1HH6A 3VFNA 3LKQB 5EO1B 1YDPA 1BM3H 1G87A 4ELMA 3ZDYB 1J1OL 3FT3A 1CBJA 5FDYA 3IMWA 1LEKA 3G5ZA 4WI2A 1MF2L 1G7HA 3EH3B 1MJ7H 3FT1A 4LOFA 1TEFA 3N40P 4FQ2L 4WENB 4Z95H 1XV8A 1YY9D 4YBLB 4K5NA 4U1IA 1EJFA 3BQVA 5KVEL 1SN0A 3PDDA 3DPBB 2OI9B 5F8RC 2XKNA 5T1KA 5JLZB 4CU8A 2AQSA 1XF2A 3WFEL 4LSQL 5AVYB 3MRKA 5AUMB 5MI0B 3ZJAA 3LMJH 3QHFH 3WOVA 4JFOB 4HDIA 3W82A 1TVDA 3DX9B 5JPNA 2AEOA 4CBPA 2J88H 4BD4A 1FPTL 1C5BH 2AJXL 4RFEB 3HG4A 3RJOA 3U2JA 2BNQD 4BIKA 1BECA 4JN2B 2C34A 3LKSB 1MNNA 2YAHA 4AYGA 3F58L 4HKBB 2WWKT 3OHXB 2VL5B 4K7FB 2TRHA 2FL5B 5C08B 1AIZA 4U1HA 1GW0A 3UYRL 2AK4D 1DBML 4GEJA 3I3EA 4FFZL 3C5XA 1E4WH 1DL7L 2CLVB 4KH2A 3GJFH 3FO0H 5FHAL 5FOBA 4BHUA 4OBSA 3OKEB 1RZ8A 5HGHA 5D2LE 1QFUH 4Q58C 1PAMA 1PSKL 1AGFA 3O6LH 1GJUA 2NT0A 4WIQA 4RX4A 4PJIA 5K9QI 3RA7H 5F7KC 3PHOA 5IZ7A 3SE9L 1UB6B 4ZZKA 2K8MA 3TPUA 1C16B 3QDMA 4N8VA 4JFDA 4UU9B 4WWPA 1WZ1L 1S7SA 5E56A 4F33A 4JQVC 3QEQE 2WNKA 3QORA 4DK6A 4P2OB 3T9WA 1T1ZB 3M8OH 2EXYD 1FPTH 5BS0B 4P5MA 2XZAH 1ZS8A 4PGEA 5CEZH 4M6NL 4OQTH 3I6KA 3MKGA 4PV8B 3BO8A 4UQDA 3ZDZF 3MLYL 4I77H 1B4JL 2ZUWA 4J2QA 5M7QA 1A7OL 5FKPA 1ZVYA 2DMCA 2JJTA 2ZX7A 3LQZA 5DVLA 1F3JB 2X6UA 3W0WB 1MEXL 1G5GA 5G4NA 3T1FB 3WNMA 1YQVH 2W5PA 1IBGL 2AQQA 3CVIL 3K2IA 3WXVH 5C2BH 2BS9A 5BUPA 1W8NA 3QXAB 1NH6A 3AQDA 4YR6A 1LO5A 4H25B 1PX3A 3CZLA 2BNQA 3RKPA 4D9RD 4A67A 3NP4A 4XXWA 3CVHL 4E9SA 1HDMA 3ZKQD 1EHXA 5GQBA 4PJFF 3WI9A 2X7LB 3IFLL 1XEUA 3QUKB 1SDDA 4LEOA 2E7BA 5F7YC 2Q8BH 3NK4A 5LDUA 4W4NA 2OMVB 1T0NB 4CC1A 4JPKL 4ZS7L 5HDBE 2XVLA 3VU2A 3ORJA 2E7LA 1TEGA 4IS6A 1KXTA 1V3LA 2CUIA 3RL1B 3SO3B 4AQOA 1OAYH 1UATA 1ZANH 2FATL 3PJSA 5GGSB 5C0AD 4O51A 4Y1AA 1I7RA 5D55A 5I75B 1N0XL 4ZFZB 1FGVH 3QBTB 4ODHL 1XFPA 3GZPA 2APFA 2BP0B 5IVXB 2W9EH 3KPRB 1HI6A 3TYFB 2ZOLB 4NM8L 2Y5TA 4XNYH 1F6LL 4G8AC 4XVOA 3WY1A 4QXTB 1JHLL 3GMMA 4TRPH 3NCWA 5EIVA 1WZLA 2QQLH 4KFZC 5SWSA 3G3LA 3GS7A 5JW5B 4PY7B 4A6YA 4PG9B 3LPPA 1SDAB 3BP7B 1EVUA 5FKAA 3D5OF 3VI4A 3KM1A 3GI9H 4UQAA 2ED7A 1IMHC 5LGJB 4OJFH 3ZQXA 4HCRH 4GIOA 1KDJA 1ACYL 3MODL 3EYQC 5CSZB 3N5AA 2ADGB 4FQLL 2V5TA 1XBDA 2OMWA 1A0QL 4PMFA 3O41B 2E46A 3U2IA 2GVYA 2COVD 5C0AB 1A9BB 3VG0L 4LLYB 4I8DA 3NVQA 2VH5H 2HLEB 5AAMA 1IBHA 4KQ3H 2YBGA 4AK2A 3EDJA 4GKSA 1Q9KA 2YGPA 2NY5H 1JGIA 4WQOA 4GNKB 3VWKB 3L9RB 5HYEA 4BK4A 2C9SA 2P5PA 3BMVA 4TUJA 2DZEA 1BD2A 2ICEA 5D1QD 4J8RB 1JN6A 4D0DA 1CS6A 1JNHA 1ERNA 1G7QB 1JNNH 1F97A 3K6OA 1BCIA 2FJSA 4Z0BL 5GISL 4LPVA 5IVXF 4X5XB 4BA8A 3WGUB 1OT1A 2WGNB 3KS0H 2AHIA 4ETYA 3ULUH 4JQXA 2BY2A 4E5XA 3MRCB 4LSVH 3RURA 4IDLA 4WTWA 1HWHB 5DS2A 3H9SD 2Z35A 3ZKND 5IGXH 4JEGB 1JZEA 1XR9B 3OMIB 3N1PC 1B88A 3KR3H 5J3HD 3EJRA 5GS1C 3IDJA 4WAFA 1YCSA 1RLWA 1ZEAH 3HB3D 4OAWA 4X8XA 4B3EA 3SGKC 2V8MA 4FTVA 1E27A 3WEAA 3CPLA 1AI1L 3WE6B 3D8MA 3M17A 2XNAB 3NACL 4G3YH 4LVNC 4YBLC 2F5BH 2XN9A 2OJZL 3DOIA 3I9IA 5D1QB 1EHLL 1M6UA 3OZ9H 3HBZA 2AQNA 4HWBA 3F62A 4JCMA 5TTRA 5AVSB 8FABB 4WGVB 1VFAA 5C0BB 2EDWA 4MB4A 4IU2A 5FCSH 3FQTA 1TXKA 5IVZB 3UBXI 3ISRA 4NCC1 2X10A 2J6WA 4NQDE 4PUBL 2IVFC 2BVOA 5SWQA 2QBWA 1GXEA 3H9SB 3AACA 1SJHB 3F65A 3VFSA 3VW3H 3T4YB 2Z91A 4DAGL 1B4RA 5GPRA 2LFEA 1GGCH 2GBVA 2ADIB 4G5ZH 3HB3B 4CJ0A 4BE6A 2WYIA 3CVBA 4LLVA 5L88L 3JWNG 1W0VA 3H4FA 5ACLA 5LN8A 1WBZB 2BNQE 3QEQB 5T3ZL 1NKGA 3O4OC 3S4SB 4X6CB 3HRPA 1OAZL 5KVGH 1EMTL 1FJ1B 5C0JB 5IBUG 2VO5A 3V4PH 1OM3H 4LPCA 3SOBL 1WGVA 1JXGA 1QLEB 1U8OA 1KIUB 4N2KA 1F3DJ 4ORGB 4EXKA 4L4TE 4PP2A 3AMLA 4FA7B 3KWWB 3EOTL 4QXWA 5JO5A 2R7EB 4X6DA 3RAJL 4TULH 4BQCA 2ESVB 5BVJB 1ZWIB 3EO1A 3ZL2A 4NIYE 4HIIA 4JM0A 5D9SA 3VRJA 4F9PA 3UEQA 3MLWL 5TD4A 1BYNA 4PJXA 3OKKB 4H8UA 2FJHB 1PBYA 4D9QE 3VXMD 4EF3A 2WO2B 1LL1A 2C9UA 3RTQC 4MMXC 3Q3GB 4ODVL 2MNUA 1ZJBA 4J3OC 4RESB 3QNZA 5I30L 3JT0A 3HNVH 4BZYA 5GRVL 1XB3A 4L5FE 1RZPA 4CAGA 2B59A 2GIMA 1UZGA 2JI2A 2DEYX 4OIAA 3RIFK 1B0RB 4FABL 3KAAA 4JKWA 1FVEB 3I74A 4OCWH 2YSTA 1IL1A 1ZTXL 3LVTA 3TTYA 3V0HA 4WU7B 4MMXB 3PABB 5FW6A 2NCMA 3LRSB 3UO1H 1QEWB 2YXMA 3P4OB 4XC1L 3N1QC 3D85D 2HKFH 2DPKA 5EMYA 5HJ3A 5KBLA 4JM4L 1VRSA 4RISL 3ZQWA 3LRGA 4MNGE 2K6ZA 2G3ZA 4K8RH 3K6SA 3W81A 2VXQL 3NSYA 2DIAA 2EXTA 1OAUH 2GJZB 2IQ9L 3S98A 5H4ZA 1OAYL 4TQHA 4BCZA 2YQGA 1H3UA 3DHUA 4WWOA 1XVSA 4MD4A 2X0WA 1CJYA 1S5IL 5DQJB 1UYWH 5HHMB 1DBAL 2WVVA 5IMLB 5I28A 4O2EB 3TCXA 3UYRH 5DEJA 3TBTB 3Q2CA 2OXHB 2FJFB 5C0AE 7PCYA 2DQFB 3ESVF 3GBNH 3ZTJG 4YK4B 1W6WA 5JOPD 3VH8A 3HZMB 4OCWL 5K59E 4ZMTA 2HTKD 2CBPA 5JPMA 1A4JA 4ODXB 4G82A 4S2SB 3ASNB 2AJ3A 1DBJH 3QNXA 4I1PA 2C3VA 4I3GA 3TO4C 4NPYA 3TNNA 2AXWA 2F68X 1FYTA 2LAAA 4FYTA 1K6QH 5KSUA 5EOCL 2WD0A 1C5CH 4YHZH 1OP3K 2E9WA 3MLVH 4HWNA 5ISZD 2OZ4L 1MLCA 2WBJD 2DQEL 4KNTA 3WS6C 3E2HC 2WKLA 2VIRB 4YQXH 3MV9A 2Q7AA 4P06A 5GGVY 1IVTA 2VQ1B 1KXHA 3JV6A 3M7FB 2X0UA 5CLXA 4XPAL 4PJBB 3VXRA 5A7EA 1LM8V 5IT2L 1LD9B 1J9CT 3ELAT 3AY4C 5K5YA 1G94A 1IIKA 3QUMB 5IQOA 3UYOD 5C0RL 4PJ8D 3CFCH 5ECJE 3BP6B 3UABA 1R24A 4M43H 4PJ7B 4G43A 3RVWD 5IHBA 3HS0A 2DW5A 25C8H 3KWTA 1S7QA 3IKCA 3DX7A 3T0EB 1P2CA 3L4ZA 4Q89A 4X98A 4BEIA 5TDOB 2P8MB 4R4NC 5F6HI 1DQVA 2XV3A 3RIAF 3ARBC 3C8KA 5HI5C 4R3SA 3BW9A 4I89A 2XA3A 4YSTA 2J2ZA 4RA0C 1BAWA 1I7ZB 2ZWYA 5IJKA 4JAMB 1SMOA 1UXSA 4TF4A 3H9SE 1L0PA 1E28A 1MCWW 5IFHL 3T1WA 3VXTA 1RHHB 3LZFL 5LBSL 1GS6X 1U92B 4GMSL 2B9AA 1ETZB 1YEFL 3MJGX 4FI8A 3WFHB 2PTTA 3FCTA 1G9NC 2G3NA 1LO0H 3QE5A 1DQTA 4JFFB 3PL6D 2DTMH 3CFQA 5AOLA 3GSNL 3GMRA 1VEOA 4F8NA 3BFOA 4HS8L 1Q90A 2VDPB 2X6BA 4NI6A 3VXUA 1MJJA 4NYLA 2YEZB 1ADQA 5CZKA 2CE6A 2D7NA 3L6FA 5AZ2H 1IEHA 3P3UA 1BJ1H 5DD6B 2F5AL 1VGEH 1ZK9A 1IKFH 2EC8A 1UD6A 4JM2A 1W6LA 3TT3H 2GI7A 4MSWA 2DQGH 4PY8J 2ZSVB 4IRJD 3RGVB 4EPSA 1G0XA 1JNLL 1A9EA 3MO1A 4QY8A 3DK2A 3SDAB 5L4IA 2H1PH 3HCVB 4MA1B 4DVRH 1JYVA 4UDTA 3PAVA 2ICCA 5IFHH 4XN1A 3Q9QA 3RWDA 3UBXB 1I8MB 1U3HA 3ZIMA 1E4XH 1X4XA 1J86A 4WNSA 3O4LB 4TV3A 4KTEH 3QR2A 5JR1L 1CFVL 4JKMA 4L23A 4Y2OA 5L9DH 3FU0A 4ZI8A 4C83B 3V4UH 4PYHA 1UACH 4TUUA 1OSPL 4XPTL 1MCDA 2ZXBA 1YNLL 2EE3A 3Q6GL 4EJ1C 1TJIH 4EXPX 4GG6B 2P44B 4L4TD 4J3XA 4BQBA 3CDFA 2MOQA 5D2LA 4WGKA 2F53B 3NFSH 1FNAA 3QIUC 3EGXB 1R3KB 4TSAL 2VXVL 1N8ZB 1OLZA 1JAEA 4U1GB 5DUBA 1E4KA 1SLWA 3FHEA 4RRPG 5F7AA 1EV2E 4QRQA 4BZ1A 4CNIB 2B77A 4JO2H 4JHWL 1R1CA 3VYNA 2EADA 2XN2A 4GXUM 3GGWA 4KJPD 5EF0A 3V4VA 2XHNA 3RVXC 4F2ME 2D7QA 2EDQA 2PW2A 1XEDA 3O9WA 3GQFA 4R26H 1JGEB 3HR5A 1FL3B 4O5LL 1TQSA 2FH8A 4KNSA 5DURB 4Z0XB 1FL6A 3OAWA 3I85A 5GRZA 1UM6H 2P80D 1G7MB 3L1OL 4Z7OF 5IEKA 3EYVB 1FNHA 3WUWG 1KB9K 3FO9B 4AIEA 5FR3A 5JNYA 1K5WA 4MAYB 3JTSA 4YDVA 3QYNA 4LVOC 2Z0UA 3NFPA 1AS8A 3U46B 1WS8A 5BRZA 5KSBB 1HNFA 4G70B 2AJZA 5FA4A 1MCBA 1OGTB 2JK5B 2DWEA 3GSXA 3APNA 1D5IL 4ZMPA 2CR6A 2EILB 2V8LA 3LZNA 4G59C 4NCDA 2KT6A 1L9RA 4FERA 3D0AA 3V10A 4G5ZL 5DUJA 1OP5K 4OJAA 4N0UE 1MELA 4JO4L 4XO8A 3D0VB 3EJTA 5DURD 1OW0A 2QR0A 3F6IA 4F5CE 2EDXA 2XXMB 1E42A 5BZXA 3VDCA 4AW7A 1E5CA 2VR5A 1AACA 4LARL 2PKDA 4QXVA 4PWKA 3B2MA 1YEKH 3D0LB 4HX1B 1TETL 1FZMA 5CFAA 3OHXC 3IFPA 5HI3C 2UZYB 2R23A 5HYQB 4BFKA 5LGYA 4DVBB 4Z7OB 5BZWB 5CGTA 1UZ8B 4XXDA 4KGJA 1T2XA 4ZUTB 3V4VB 1I8KB 2Y06H 3H7BB 1A66A 4MAYC 4EMZA 2FO4B 3W1ZA 5LNDA 2OW6A 3ARFA 1PF3A 5CILH 4HCFA 1AZCA 3PHQA 4YGVA 4YUEH 2N7AA 3HLKA 1ZE3C 3DUSB 4P3DA 2K45A 5FCUL 3X14B 5DI8B 3LN5A 1I9JH 3ZUCA 4RGNC 5D2LB 4XB3A 2A6KA 4X50A 1CFTA 2CXGA 5F1NB 1MI5A 3AU0A 5CEXA 3RWCA 4OCSH 43C9A 4JFXB 4R0LB 4GQZA 2WLHA 2R1YA 5HDQH 4Z6AT 3FRUB 5HGAA 5GGUA 3O3AB 1S7RA 4XMPL 4NC2B 1VPOL 5ALCL 3CFIC 1CR9H 4YIQB 5J9PB 2Z92B 3D3VB 4KK5D 3RWDB 3VTTA 4MWFA 3S9DB 3VWKC 1KCVH 4LLMA 1G4MA 1KENH 1OAKH 2CO2A 4PS8A 2ZOKB 5CCKL 3S35L 2ZG2A 1XCTA 3V6ZB 4JM2C 2XWTB 1BZOA 4JGUA 4AJ0A 3CNKA 2A99A 3IN2A 1E9QA 4FNQA 4MYWB 2ITFA 3IDYB 4PJ5E 3WJMB 2HB0A 3M1BA 3DX8A 1SF3A 4PJHA 3MBED 1LJMA 2UVEA 3T0WA 1CXLA 5MEPA 4DW2H 4FXLA 4HZLA 4NN7C 4G8FA 4DKAA 5JOFA 2VMJA 5DA0B 1E0OB 1LP9B 4M6NH 2IO5A 2APBA 1OE1A 1JGUL 3D87B 1IQDA 5IQMA 1CF8L 1RZJL 3HUJE 1L9NA 3QFJE 3Q8EA 3QJFA 1MVUB 1M57B 4FNRA 1HSBB 4GAJH 4KX9A 5FGBA 5KS9E 4M1CC 4FQ1H 1PW3A 4WTQA 1FNEB 4NKDB 3DETD 5F6IC 1NGZB 1KC5H 4WKXA 5FF6B 4PR5B 1KYOJ 1X6LA 5F7DB 1MLBB 1SNRA 5HDOA 1PQZB 1BVLA 4PI0A 2O5YH 5FO9A 5BO0D 1OK8A 2CGRL 3K6FA 4HF5L 4HKJA 4UM8A 2Q3AA 5DYOB 3ZSSA 3QUZC 3V4PB 3B6SB 5DEFB 2B2XL 3OC5A 2GCYB 3AG3B 3I02A 3ULVD 1QRNB 4J3VA 4O2CA 1QI5A 4ONHB 4DFIA 3LRHA 5I5IA 2XUWA 2NY2C 3BWUF 2NY0D 5ACZA 4HKXA 5CJQH 1AZUA 3W39B 2NTFA 3I9PA 4I48B