1PD6A

The nmr structure of domain c2 of human cardiac myosin binding protein c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
DEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-binding protein C, cardiac-type, Domain C2
publication title Dissecting the N-terminal myosin binding site of human cardiac myosin-binding protein C. Structure and myosin binding of domain C2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pd6A00
4P3DA 4UT6L 2O5ZH 5JOFB 3HTLX 1B3JA 2NYYC 4JRWA 5D1XA 2VAJA 5ILTL 4YXLH 3MV8A 2BHYA 4JLRB 1Z9MA 4NM4L 1VB9A 4WUUA 2YN3A 3D1MC 1NGQH 1OGAE 3UYRH 4BQ9A 4F7CB 1NDMB 4BKLA 4U1IA 4IHOB 2HAZA 3TA3C 1HKFA 1QACA 3DARA 1OY3B 5GGRY 1NEUA 4RGNC 4O2FB 3HI1A 4YDVA 1UWEL 5FM5O 3VCLA 2NXYC 5FAAA 4IRSC 3C9NB 4DVRL 1BBJB 1ORQA 1HIMH 4QTIL 3SE3A 1RQ5A 1JFQH 1U8LB 5DO2D 3GMQA 3I84A 3O0RL 4XRCA 3SGEI 5GS1B 3D18B 5ITFA 3P9LA 3BW9A 2FJHA 4LSQL 1JV5A 2VQ1A 3PDOB 1RK1B 5MI0C 3GEWB 3U0WL 1KCSL 1CXIA 3RZCC 4PJAA 5DQJB 1IKFL 1R24B 2WBWB 4JO3H 4HT1H 5CGYD 4OLYL 2YUVA 1V3LA 3SDXB 3NPZB 1K8DB 3HAEH 1DCLA 3BD4A 1A6WH 3QZWG 4HS6B 1AY1L 4G6AD 3CFEB 1JPFA 3UBXI 1N6UA 3FFDA 4DN4H 3MRFB 1AI1H 1LDPH 2BVQA 3DTXB 4JZOB 4LRIC 5KW9H 1KJVB 4Y1AE 4NQVB 3K7UA 2DQTH 4LLQA 4NQDD 5KS9B 4N8VG 1VESA 1N6QL 1WZ1H 4HIEB 3CH1A 5GJTL 1EO5A 2GSGA 3MJ9H 1H5BC 1MI5D 1NDGB 3M1BA 1MAML 3PV6A 2PCPB 5EC1B 2R1YB 5DK0B 3HRZB 2RFXB 1DQLH 5DWUL 2J4WH 3HMWH 3RPKA 5L7XH 4PREA 3LKPB 4YGAB 1AGEA 3SE4C 3CFDA 1OVZA 4KHTL 3RUGB 5DHYB 4LPTA 5T5NG 4HS3B 3QWRD 3V4UH 4NQDB 3H6JA 2Z0BA 3UYPA 4NJAL 2X41A 2EE2A 3EYVB 1MRCL 1U91B 2EH7L 1DZBA 2GITB 5T5FL 1MI5B 3SGDH 1P4BL 1FZKB 2IBGA 7FABL 3WSQH 2W07A 1X5HA 4PTTA 2WLYA 1JPGB 5DRNA 4E9LA 3LPFA 4GUPB 3UTSA 2J8UB 4QHKJ 1A3RH 2C3VB 1HHJA 4GSDL 1SM3L 1FNGA 1NL0H 5E4EB 3U6RA 3ECBB 3QDAA 4U4BA 4I77H 5IG7B 4WO4C 3HFMH 1KJ2L 5I76A 1F02I 3VFUA 4JDVB 1XCQB 5HGDA 1JWSB 3I6GB 4KJWD 1JZ2A 5CJ5A 4D9QD 4H5SA 4M6NL 4HMCA 3W9EA 2QQKL 4OF6A 5BV7C 1A6ZB 5F7DB 2A73A 1JZ5A 4LF3A 4K3HA 4PLJD 1SJEB 1AC6A 5EA0H 4MQTB 5IVZA 1GIGL 4YZFE 4OM1L 3ZMRA 8FABA 4K3GA 3NA4A 1YDPA 1HXMB 4O5LH 1SY6H 5D7JB 1E4KC 3HI6H 1QFWL 4H0HB 1U8OA 2EDOA 2ATPB 4P3CH 4KKCD 4P5MB 4HS8L 3EYQC 4NRYA 3O2WL 5FYJU 1Y6NR 1AD0A 4K2UL 5EWIH 3MOAH 3MNZB 4N0YH 5GSRA 1MF2H 4PRNA 5AWNL 3QA3B 1VENA 5D6CA 3MOBL 1GC1L 4YX2L 2VDKH 4UU9B 3IFLL 2PNDA 3MLVH 5EZOH 4HK3J 5IT2H 3BDBA 3NFPA 1FVEB 2GK0B 2R1WB 4UAOB 5BZWA 3MZTA 1JTTA 2MSPA 2DKUA 3QEUA 1CG9A 1FHGA 4M43H 2VKWA 3TZVD 4AM0A 2AEQH 4KHXH 2VUYA 1NMCC 1QEWB 2FIKB 3L5XH 5J56B 2FJFA 1G0XA 5J06A 5FDYA 3T0XA 4EI5D 1HHHA 5INCB 5HD8C 5KZCB 2W91A 1WIPA 4OLEA 5ENWB 5GGTL 3KYKL 4HFUL 5FUCC 43CAA 1HOCA 2IAND 1PEWA 2QHRH 4AT6A 4GO6B 3OZ9H 4K8RD 5DTFA 5L9DL 5IEKB 3P40A 4L8BA 5CD3B 3TZVB 1MJUL 3JWOH 1Y0LB 5DRXB 1FL3A 5DJ0A 4PJCF 2VLRE 4MD5A 3W9DB 5GRZA 4EI5B 3ARBD 2APWA 5F6IC 1KEML 4MJ5B 5JHLL 1F8TH 1X5AA 4JE4B 4YE4L 2CRMA 3K80A 5BOZG 4MDIB 2IANB 4AIZB 3G9AB 2KPNA 4PJ9A 5J3HC 2P5WD 4ZNCD 2Y07L 2EC9T 3CAFA 3VFWA 1WCBB 3MRBA 4N8VA 5D2LE 2P24A 2XI9A 4M9OA 2VXSL 3L3KA 1OPGH 3BT2H 1BQHB 5T33H 1CVSC 3D39E 4RGMC 4OZGE 4NQEA 3ARBB 4JG0H 3HPLB 4O2CB 5C0DB 2Y6SC 1X7QB 1IILE 3Q6GH 4Y88A 1LEGB 4GW5B 3O3AB 3BGFB 3P9WB 3KXFA 2JB5H 4WW2F 4JHWL 1RUPL 3TBYA 2YPLE 2IEPA 3EO0B 2P5WB 1KPRA 1YYLL 4X4ME 3QHFL 1UWGL 1YC7A 3VD5A 4C56E 3HI5H 2V9TA 1CGTA 2Q8AL 4HKBB 4DW2L 4WCYH 1ZLSL 3AAZA 1D5IL 2BSSA 1CGSL 3TN0D 1YN7A 5ESAA 3ZKMC 4FQIL 4WV1C 1MQKL 4BSVB 1CLCA 4DKFH 3NCFB 4G7YH 2GTZA 2LU3A 3MRRB 5CIPH 1I7TB 2OL3L 1OL0A 4G9FE 4W4NA 1DUYA 1ZOXA 2VZOA 5T3XE 2FEDC 3CPLA 4M6OH 4D0DA 3P73A 5ICYA 2P1YA 3GSNA 3CVHH 4FABH 2B4CH 1G6RH 2A9MH 5D1XD 3MV8D 4O4YH 2BSRA 3IS0X 3D2UA 4X98B 1MFEH 3TBVB 4Z7VA 1NUFA 3DUSA 3EO1B 2V9RA 4NWTL 1KXVC 1NCTA 1BQUA 2AV1B 5IJKC 3M17B 4KV5F 1G0YR 4KTEL 25C8H 3F58L 3TN0B 1IM9A 5KSBB 3HE6D 3FO9B 3OJDA 3ZHKA 2R2CA 4P57A 3SKJL 3MRCB 3NOIA 5ALBL 4P3DB 2YMXL 4UT7H 1U42A 3NCJH 4S2SA 2Z31C 4I3RL 3FFCD 5D1XB 3DBXA 3MV8B 1OD7A 4NPYB 2P48B 1NFDA 1R3KB 4M7JH 4WUUB 2FH8A 2L7UA 3GM0A 1HI6A 1YNLH 1G7QA 3SCMC 4XWOD 3HE6B 3T3MF 3EYOA 5CP3H 1QBAA 4XP6L 4XC3L 2GQHA 3RWGA 3HI1B 4YDVB 3VCLB 1N64H 3OB0H 2V5RA 2IBZX 1ORQB 3ROOB 2XZQH 1CD0A 4MA7H 1ZVYA 4TTDC 3OGOE 3GMQB 4XRCB 1FCCA 5IW1A 5ITFB 3X14A 3P9LB 3BW9B 2FJHB 5TPWH 3UO1H 3MRMA 3DVGB 2VQ1B 3VRLE 2E9BA 1INDH 4X7FC 1YNTA 4GRWF 3GRWH 4N90D 3RNKA 4QNPE 5F7UA 5IVXB 1PGRB 4XNQA 1NUDA 3SBWA 2HT3C 2Z9TA 4M8QA 4Y4KD 5D71H 2VJXA 3B9KA 4WFGD 3QEQD 4Q2ZA 4JFDE 1YPZB 1WICA 3BMWA 4TSAH 4LIQE 4OLWH 1JPFB 3E6HA 5DGQA 2FX7L 3VRIA 4LKXA 4NUJA 5D8JL 2BVQB 4OI7A 2D3VA 3BPCA 3DO7A 1BM3H 3HS0B 2WWMC 1GZPB 3BSZH 4X8XA 4QRPE 5DMKA 4XNXH 4OGXL 4IRJA 2HH0L 4U7MA 3ESUF 1JN6A 2R4SH 4TULH 1CLOL 4HC1H 1UJ3A 1V5JA 1OTTC 5D9SA 1KG0B 1PX4A 4I0PD 4LARH 4Y4KB 3CH1B 3RVTD 4DGYL 1U36A 3VXNA 2NQCA 3M1BB 3PV6B 1UADC 3GIZH 3JV4B 4JPIA 5IB5A 4N5ED 2R9HC 2H2SC 2HT4C 2M8XA 4CW1A 4NM8L 3UTSD 1KGCD 2G75A 1DANT 4UILL 4PREB 3R1GH 5JHDD 4UIMA 2QHLA 2YC1A 1PKQB 3CFDB 4MHHG 1Q9KA 4QYOA 1TJIL 5B4MC 5DYOA 4K3DL 4ZS7H 5FGCE 3MQIA 2CH8A 2PO6A 4IIQC 1FE8L 4EOWH 4I0PB 3DMMA 3UTPE 2HVJB 3FB7B 3FZUD 5D7LE 1X44A 3MR9B 3DGGA 4PTTB 4QRSA 3TYGL 5EO9A 1A4KA 5EBLA 2SEBA 3C5SB 3R4DA 3UTSB 4JM4H 1YMHB 4R2GC 5IESL 5MEPA 4DUVA 1FNGB 5JHDB 3LEXA 2D4FA 3SKNA 4LDLB 1WV7T 2NCMA 3VFSA 5J11C 4MMZC 1KLFA 4ELMA 5I76B 5EU5A 3VFUB 1CWVA 4GG8A 4APQA 4FN0A 4R7NA 4JFPA 4Z8FH 2O5YL 4H5SB 4ZYKA 5LGHL 3WJLA 5A2LH 1JTOA 4EDWL 2B1AH 5I8CA 5BXFA 4JO2H 4LSPL 3MX0A 5D1ZC 4ENED 4YXKH 1Q38A 2CLVA 5HVGB 4Y2DA 3C5ZA 1I7RA 2YK1L 3BVNA 2A73B 3BKYH 1DBKH 4LF3B 1HINH 2NY3D 3BYYA 1BWWA 4KRMB 4QOKA 3W5MA 3PP3K 1IGFH 2FHCA 2VLJE 3PGDA 1XGQA 4LNVA 3LN5B 2PXYD 5BQ7A 4JN1L 3BPOC 5IVZB 3KR3H 1YDPB 3LKQA 2Q86A 3BP5B 2JK5A 1U8OB 3S5LA 4GAJL 5I0ZA 4G8IA 2AJZA 1F4WH 5I1KH 1M6OA 3SO3B 4R3SA 3V0WH 4BUHA 1AD0B 3QQ4A 5E8NA 3AUVA 4DAGL 2ZJSL 5D6CB 2X10A 2NY3B 4JHAH 2F8XC 3FCTA 5D5MF 1T03H 1KLGA 3ULVD 4X6CF 2PXYB 1YY8A 3NIDF 4L4TA 4FFWC 2CR3A 3NFPB 4EVNB 4F7EB 5AZ2L 5BZWB 5F1KC 5E5RB 3OF6A 3QEUB 1CG9B 1GOGA 1NCWL 4JHZA 2Q7YA 4YC2C 1QRNA 3GMLB 2E7LC 1MCJA 4LHQB 1FCGA 5I1LA 4OCRL 1YEEL 5C2UB 3K0WA 4UQ3A 2X4RA 4Y5YA 4ACPA 3C8HA 1ZLVK 1HHHB 5ANMA 5JW5A 2KQMA 4G3YL 4MA1B 3L7FB 43CAB 2DIBA 1NC4D 2WP3T 3ARGA 3VFOA 2F9BT 5CILL 5T1MA 4AT6B 1JGUL 5SWZD 1FGNH 4PJ9D 3DPBA 5DTFB 2BXZA 3MRKA 4NZUL 3GI8H 3UTQA 1RUMH 2Z91B 4L8BB 2QKIA 1UEMA 5E1AA 2MPAL 5I1GL 3QUML 1HSBA 1MHEB 2ORBH 2I9TB 3LB6C 2YD3A 1FL3B 5TF1H 1AXIB 3GSQB 1IQDB 1ZAGA 3WUWA 3G6JA 4MD5B 5GHWL 3L9RA 4NQED 3QZWB 1FL5A 1YNKL 2BRQA 2IF7A 1AO7E 2J3SA 5FF6B 4S11A 3FO0L 1NC4B 3D69A 5AD0A 3MLZH 4K9EH 3WIIL 3I3BA 3KXFD 4JEGB 1VSCA 3CFKA 4FQ1H 1CU4L 5SWZB 4PJ9B 2RGSA 5DHXB 2RBLA 4HHAB 3WFHA 3VFWB 3RTQC 4JG1H 3MRBB 4N8VB 3FO1B 3BKJH 3MLPA 2P24B 1IBGH 2OTUA 2Q76A 4KTDH 1A6VH 3L3KB 1UA6H 2F5AH 4OLXL 2HFEB 4NQEB 4F58L 1SHMA 1OP5K 4XPBL 4S1DD 4LLAA 1F3DH 4WHDA 1ACYH 5J1AA 4U2YA 1T0PB 2HTLD 4PJ8A 3KXFB 2LVEA 3TBYB 1YEDA 5HY9A 4XB8A 2X7LB 3D2UD 2R0KL 1H3UA 5IFHH 2NY2D 3QEGH 4FG6C 5DD1H 1U2HA 3AAZB 5D6DA 1IEBA 1FDLL 4MNQA 3QG6A 1IM9D 5E9DA 1YY9D 1R5WA 4POYA 3TH3T 1UCBL 1U8MA 2GTZB 4ORGA 5GRYA 3TO2A 1ZT4B 4Y0GA 4RAVA 1DUYB 2GHWB 4C58B 1CL7L 5GXBB 4GAYA 3CPLB 3ARRA 5ICYB 1IT9L 3PP4H 4XCCH 4WFHE 3MBXH 1IC7L 3T0BA 3S36H 1BFSA 4LAJH 1X5ZA 2BSRB 2YD7A 3D2UB 2Y9RT 4Z7VB 1MRDL 4ZAKD 5T3ZL 3DUSB 3FRUA 1WZMA 4PJ7F 3RA7L 5JQ6L 2NY2B 3ES6B 1EGJA 3WDIA 3A6CH 5I74C 4W6XB 1IM9B 5J89A 4HQQL 4J2XA 4Q9QL 1KB9J 1V7ML 3EJYD 3OJDB 1W72A 3P11H 4P57B 2OMBA 2HFFA 2IQ9H 2QSTA 1KCVH 4LPXA 4PRDA 3BH9B 4S2SB 1OP9A 5C0AE 3OAYK 4XC1H 3ZE2F 5IB2B 1P4LA 4LLWA 1KTKE 1U8NA 3DBXB 1NFDB 4ZAKB 3G5YB 1MREL 2NX5A 3FQRA 3LH2H 4OLVH 1BFVH 4HBCH 2ZUSA 4P49A 1MIEL 4LCWD 5SX5H 2I27N 4OQTA 5CJQL 4HCRA 1G7QB 3KPMA 2AJSL 3EYOB 4KVNL 3RWGB 4A6YH 1BD2A 5DZNA 3QQ9C 5CCKL 2XWTA 5FA4B 4NBXB 1R3LA 1T1YA 3NCYS 1MJ8L 1UH4A 3KPQB 5EDXA 4AIOA 4HMDA 4PJFA 5IW1B 3NIFF 1BAFL 2P49B 1B2WL 4NQCA 1LP9A 4Q0XL 2GFBA 1A3LH 5TDPA 4IRJD 2DMBA 4LCWB 1YNTB 2BX5A 3VXOB 3RNKB 5AEAA 3QXAB 4MJIA 3IDJA 4XNQB 1N6VA 4OM0H 1V8HA 4M8QB 5HGHA 1TXKA 1MCCA 3C6LC 2F54A 4Q2ZB 3QO1A 4ALAH 5C6PB 3RWCA 2WANA 1C5BL 1NSNL 1P7HL 1UXWB 4JRYA 3SDXE 3E6HB 3CFJA 4QHNA 1GGBL 1FZOB 1BZ9A 1DN2A 3EOAB 3VRIB 4LKXB 3HE7C 4NUJB 3DO7B 3L1OL 1JE6A 2FHBA 4FFYH 5SWQA 2CKBA 2WIMA 4D0BA 5F7YC 4UNTA 4KVCL 4LQFH 4IRJB 2WWKO 3T65A 2YZ8A 3X17A 3VWJC 1UJ3B 3I9GH 5KS9E 5D9SB 3DMMD 1ADQA 3CZFA 3GBML 4FMKA 1BWMA 2C3HA 2CMRL 4GXUN 3VXNB 3IKCA 4JPIB 1YUHA 4XHJC 5GRWA 2OJZL 5IB5B 4RIRB 2GI7A 4RFNC 4CW1B 5ALCH 2G75B 1JF1A 3N1QC 3AVEA 4S0TD 3L3IB 5JW4M 2R29L 4MYWB 4UIMB 2YC1B 3DHMA 1Q9KB 4QYOB 1KB5H 3MUY1 4NO3A 5DYOB 3IETB 3WHXA 3RIFK 4WUKL 2OJEA 4O2EA 2NY1D 2VE6A 4FNLH 3RUGE 2F74A 2PO6B 4NQDE 5DUMH 4F2MB 1QFUL 1VGKA 3DMMB 3TBTA 1ZTXH 4UOW0 5KAQG 4WHCA 4NNPH 3DGGB 4LRNH 4QRSB 4HJJH 1IGJA 5IBLC 3C5ZD 5EO9B 1A4KB 4XP4L 5EBLB 2SEBB 3QWQB 1MI5E 3IB4A 3D5OF 3RI5K 3LQAC 1TJHH 2A6JB 5MEPB 1UACL 5ADOL 2FJGA 5F8QC 5C0CA 3NTCH 1G9EA 2J8UE 3SKNB 4OCMC 4NP4L 3VFSB 2B2XH 2YPKA 3D0LA 5GGUA 4ELMB 5I1HH 2AABL 1M7DA 2NY1B 4GG8B 2NPLX 4BJLA 4BQCA 4R7NB 2K7QA 4JFPB 4ZD3H 1JMXA 2JJUA 4Y5XC 2AJUL 4HKZB 2LV4A 5I8CB 4HUNB 3BIKB 1KFAL 5MP6H 5BXFB 1LO4H 2AI0L 2CLVB 3FT2B 4XNYH 3MACH 3C5ZB 2DL9A 4UNVA 1I7RB 5ICZA 4MA3A 3NA9L 3BVNB 4H1LH 4QOKB 1IARB 4UTAL 2CUMA 3PGDB 1XGQB 4F7MB 3MYZA 1CT8A 5FA3A 5BQ7B 5ELIA 3T0EC 3WE6A 4R4FH 2MQ0A 4L4TD 1S78C 4HEPG 4XP5H 3LKQB 1FC1A 4KKBD 1RIVH 3BGMA 3AY4A 4HKJB 4G8IB 2AJZB 1M6OB 4R3SB 4XMLH 2CQVA 4LSVH 4WEUD 1XF4B 1P6FA 4NZDA 5A2IH 1QRND 4D9QE 3QQ3A 5E6IC 1N8ZA 3QQ4B 5E8NB 1UWEH 1KENH 4H20H 3GKZA 3FCTB 3IFOA 2OZ4A 4DVRH 4OF8A 1KLGB 4QTIH 5EIQA 3R06A 4NO0D 1YY8B 3QPXL 3GNML 1MCNA 4L4TB 4EQ2A 5B38A 5FUOL 1DEEA 3O0RH 4LFHG 3K4AA 1RUKH 5ECJE 3CUPA 1A6PA 2GAZB 4FQLH 2MCPL 3PP3H 2EDXA 3V52H 1IKNA 2IQAA 3SKMA 3SKUD 1KCSH 2Q7YB 4PY7B 1RUAL 4WHYH 3DVIA 1BP3B 1IKFH 1QRNB 3QIUD 2A74A 4EN3D 3MXWH 1MWAA 4PY8J 5I1LB 1AC0A 1M71A 3MV01 1GHFL 3MTRA 3QCVL 4D3CH 2YEZA 4UQ3B 2X4RB 5D96B 2H8PA 4Y5YB 4GRMB 1JGLH 1I9RL 5ANMB 5FHAH 3REVB 3RKDC 4GKOA 5JW5B 4NO0B 3VWKA 4QHKI 1B0GA 4PGDB 3MROA 2R0LL 5A3ID 4BZ2L 3VFOB 5BW7C 4Z7OF 1RJYA 2AKRA 3TV3L 4KJPC 2NLJA 3WNKA 3MRKB 4DTGL 3UTQB 1J5OL 1FYHB 4L8SB 2QKIB 3L5JA 4W4OC 3IDYB 1WCQA 5DVKA 1HSBB 2APXA 3QIUB 1YEIH 4EN3B 2PYFA 1AXSA 1KB9K 4AEEA 1CLYL 5K59E 5CZXC 3G6JB 4PGCA 1RZ7L 3L9RB 2CLRA 2GYSA 1FL5B 3GSRA 3BKCH 4R4ND 1B0WA 3EYFB 3IJHA 4YHZL 3IFNL 3D69B 4LDEB 5CZVL 4M6ML 4NKMB 5DMJB 3RVVD 5TE4L 3HZVA 4IRSA 3CFKB 3CU1A 4ODXA 5FYKD 1ZLVH 4NOBA 2IANE 3WFHB 1A7QH 1RU9L 2L7JA 1MRCH 5MEQA 1B6DA 2EH7H 1YC8A 2OTUB 2Q76B 2N56A 4M4PA 4OZ4A 1P84J 2ADJA 4MNQD 5E9DD 1P4BH 4IBLT 3KLDA 7FABH 1K9TA 5CD5C 5EU3A 4P5TC 3IJSA 5TJWK 3RZCA 4LLMB 1DANU 2P46B 3CLEL 4X5LA 5J1AB 1PG7L 4PJ8B 3WO3B 1KJ2H 1A21A 3SPVB 5HY9B 3ILPA 4KK5C 3KLSA 4Z6AT 4KRLB 2JELH 2DQCH 2VXQL 4LRIA 2I25N 2P5WE 4R26L 4HZAA 4M6NH 4MNQB 3FQNA 3QG6B 5E9DB 4XP9L 1R5WB 4G80A 3QRGL 4P46C 3QO0A 3KJ6L 4WTZG 2QQKH 3F12A 1U8MB 4M1CD 5AUMA 4Z95H 3TO2B 3WXWL 5B39G 3U30B 4RAVB 1ZHKA 4GAYB 1UM4L 4OD1L 1H5BA 2KDGA 4PYGA 2NW3A 4OM1H 3PWPA 3TP4A 2X1QA 1FQ9C 4BZ1L 1YJDH 3ZDXF 1QFWH 3QEHA 4IS6A 2AJXL 1IGCH 4OGYL 1WBXA 3SE4A 1WQVT 4FS0A 3KLHD 1GAFH 3GI9L 2X6MA 3ZT7A 4JFOA 1W72B 2C3XA 2DMKA 5KSBE 1BD2D 4GXVH 2OK0L 2X4NA 2HFFB 5HYQA 3EGSA 4L29A 3BPLB 4YX2H 1HHIA 2W59A 4G9DA 5ADPL 3NGBC 1P4LB 4L5FH 1U8NB 1LEKA 2DKSA 4MS8C 2NX5B 4NCDA 3GSVA 3MV8E 3GFUA 4ELKB 1CICC 5HYIA 4BH8A 2D7PA 3PL6C 1DL7L 3KPMB 4MJID 4WUUE 5I71B 4U3HA 2XG5A 4OZFG 4XBGB 3PXHA 1DQTA 3SDAD 1QFWM 1BD2B 1S7XA 1T1XA 2XWTB 5CS7A 5MHSD 1R3LB 1T1YB 4JRYD 4F7PA 1H3TA 3GSNL 4LLVA 3F7YB 1A7RL 2PTTB 5GGTH 4JKKA 3KYKH 4HFUH 5E8OA 2F8OA 3BMVA 2GFBB 1EZVY 3O41B 5TDPB 4XX1G 4XXCC 4HIHA 1IGYB 2CR6A 1J0KA 5HDBE 1MJUH 4MJIB 3IDJB 3K8LA 5HGHB 3RQ3A 5IVXE 3SDAB 1E4KA 5D5MB 1EFXD 1N7ML 4WWKD 1CDUA 3QO1B 3RWCB 4GKZB 4WI4A 4JRYB 3CFJB 2H9GA 4QHNB 5DJCA 1BZ9B 1YPZE 4YE4H 3OKMA 4DN3L 5EUOA 1SYSA 2VO5A 2E6PA 1AGDA 4JPKH 4D0BB 4OD3L 4NNXB 3EJZD 3T65B 2AK1L 2Y07H 2DQFA 3W0WA 1B4RA 3EO9L 5EU7E 3CZFB 5FUZH 1J88A 4EXPX 1NCUA 5C0BD 3IKCB 2VXSH 1YUHB 1D5BB 2ICEA 3WIHA 2QR0A 2XTJC 4WFGE 5DD3L 5CEZD 4PLOB 4NO5A 1JF1B 4GQ9L 1EEQA 1X3DA 5E7BA 5C0CD 2LVCA 1RZ8A 3RX5A 3Q1SH 2ARWA 2WUBH 4NO3B 1JYWA 2VZVA 3WHXB 4JHWH 8CGTA 1SBSH 2OJEB 2VR4A 1YYLH 3OG6B 1PKQE 4JREC 2VE6B 3UPRA 2C1PA 2F74B 2ESVA 5GRVK 4RDQG 5ABDE 4I2XA 2Q8AH 3TBTB 1VGKB 1HKLL 1D5IH 3F5WA 5C0BB 1CGSH 4ZPVB 2DBLL 4ZO7A 4FQIH 4ODVH 2Y1VA 1IGJB 4OCSL 5IHBA 2ZSWA 3CCHA 4HMEA 2OL3H 1RVFL 4PG9A 1QFWI 2QSCH 2FJGB 5C0CB 1EERB 1M7IA 3JWOC 3UTSE 1KGCE 1FJ1A 3D0LB 5GGUB 3W11C 1HXYA 4NN7B 4S1RL 3AREA 4DQOH 5JHDE 1IAIL 1M7DB 3ILQC 1TTGA 5HHOA 2ZCHL 5KVGL 4NWTH 4PJEF 5KSVA 2HTKC 3G5ZA 3L3GA 3MRHA 3KGRA 4XTRC 5E99L 4MA3B 4WTZA 1AXTL 3SKJH 2DICA 5I30L 1JNNL 4NN6B 5B39A 5EOCJ 1K3IA 4N0CC 4FFVD 1CT8B 4K07A 3RGVD 2YD8A 2CRYA 5DJ2A 3WE6B 5H2BA 5IBTL 5C6TL 4PP2A 1KCKA 3VFGL 3AGVA 1FNSH 1F90L 3BAEH 3L3OA 1I3UA 2ICWA 5D93C 4CVXA 2XFXA 5K9QG 4AEFA 1Q1JL 3DRQB 3QUKA 4HPYL 2R56H 4LSRL 5EN2A 3QQ3B 2NZ9D 4XP6H 1N8ZB 1P84K 4NSKB 5GS0L 1BOGB 2VC2L 3IFOB 3WKML 4IJ3B 1NGYA 3EYSL 1A6UH 3DX7A 1Z9LA 2XZAL 3VH8G 3I50H 1B6UA 1JYXA 4KAQL 5C0FA 1DEEB 5J13C 3FQXB 2YBRA 3BHBA 3CUPB 3SDCC 1JIBA 3ULUD 1T89C 5K9JH 4ONFL 1FH5L 1C8PA 1L9NA 2XKSA 3SKMB 2I60L 5F71A 3F65A 3J8F7 5INDB 2B5IB 2HJFA 4MAYC 1UXSA 2A74B 1MWAB 4S1SH 4OZFA 4PJGA 3EOTH 1M71B 3UAJC 5ITBL 5GGQH 1CDHA 2YEZB 1BQLL 1MFBL 3C8DA 4NC2B 1G7LA 5IJKA 3LKSA 1J10A 5IGXL 2AEPL 3ZT6A 1CK0L 4PBWD 1XF5A 2FX7H 3MROB 3JBG7 3ULVE 4RGND 1RJYB 3VE0A 4IRSD 2D9CA 1UCTA 2H2PC 1CLOH 2DQIL 4G6FD 4JANB 1CGYA 1IGIH 5DR5L 1H3GA 3ZKXC 4Y2OA 5C07D 4S0SD 5A40E 1NLDL 2FD6L 1AXSB 1DQQA 4LASL 2ADGA 4PGCB 3VXRA 1IGTA 3DWTA 2AVGA 2CLRB 3GSRB 2CPCA 4NM8H 5JORB 2A9NH 3SCMA 1YECL 3IJHB 2OI9C 3LCYA 5CLWA 5IM7A 4C55A 4RGNB 3QIWC 3ZSTA 4IRSB 1TJIH 4J12A 4K3DH 5AYQA 5IW6A 5LAXA 4HWEL 1UB6A 2FEEL 5MEQB 4G6FB 5SWZE 1EUTA 3T3PF 3C09C 1FLTX 1U3YA 3B3IA 1DVFC 2HJKA 2D0GA 2G9HB 4OZ4B 3FT4A 2ADJB 5C07B 4NWUL 5DJ6A 3WHE0 3GSUA 5EU3B 5F70A 3ZL4H 3QDGA 2KL6A 4FTVA 3TYGH 3V7AG 5DA4A 3IJSB 5MI0B 4JZNA 1OTSC 5IESH 4NQEE 2J5LC 3EHBC 5DRZA 3T77A 3O2VL 1CXHA 5KANI 3ILPB 2WMPA 4HWBA 5EOQL 3KXFE 5I19L 1KUMA 3GSOA 4WENB 3VGBA 3G5VA 4YPGB 1WZLA 4G80B 4LSPH 3QO0B 2EXYC 3F12B 4JQIL 5E7FA 1ZA6A 2YK1H 3LAFA 1RV6X 1S5HA 4LVOB 1ZHKB 5C2BH 5EB9A 1H5BB 3ARVA 4JN1H 2J6EL 2NW3B 2EIEA 4ZFGL 3U36A 3RWHA 1D9KC 4GAGL 4EXKA 1ZLUH 4IS6B 1S7VA 3UJIH 4PG2C 4Z7VE 4OUOA 2OM5A 3O6LH 1EA9C 1IL1A 4F3FA 5EZJB 1V7NL 3TNNA 3T09A 3OKLB 4OGZA 2HKFL 4V2BA 1EJOH 4JFOB 4D2NA 4Y4FC 1TETL 4HIXL 3UJTH 3LD8C 2X4NB 5B8CC 4YIQA 5HYQB 3EGSB 4L29B 2BZDA 1HHIB 4YZFF 2EDQA 4G9DB 4M6AA 1KXQE 1NAMA 1LEKB 3MZGB 2IH1B 5DA0B 4LFHD 4YFLI 5AG9A 2V9QA 3JUZA 1KC5L 3GJFH 5E2UL 2W0LA 3U82B 1NCWH 3CK0L 1NFDE 4BH8B 4NN5C 4LEXH 4OBRA 2R2BB 2V2WA 4KROC 1FNHA 1A6TA 1S7UA 3THML 4L4VA 1CTOA 1S7XB 1T1XB 1YEEH 4V2CB 4TYUA 1JK8A 4JR9H 4ZFOA 4DWHA 3UROR 1A2YA 2RQ8A 4F7PB 1MCEA 4LLVB 4G3YH 1RZKH 4PJDA 3VH8A 3Q5OA 3MRLA 2A77L 2P5EA 3TT1L 5E8OB 4RWHA 1K8IA 1UGNA 3TPUB 1NFIB 4XVUD 1JPSL 3GSWA 2Y36H 4HIHB 1XF1A 1EGJL 3T2NH 2D0HA 1CXLA 1C5DB 2MPAH 1ODAA 1X5YA 4NDMA 3W0WD 3V5DA 4LCWE 4FZEL 3SOBH 1W72L 1SVCP 4M8VA 3KWWA 2HLAA 1TPXB 1TZGH 1N59A 3L7EA 3VI3F 4H8WC 1YNKH 4YHLL 2H9GB 1DP0A 5DJCB 4FFZL 2X89D 2L0DA 1KBGL 3VW3L 1TNNA 3OKMB 3JTSA 1VACA 1MHPL 5EUOB 1SYSB 4KKNA 3FO0H 5DK3A 1EHLH 1FYTA 1AGDB 4BK4A 2EZ0C 3A6OA 3QXDA 5IROC 1R3HA 5HD8D 1T7WA 4HCRL 2ESVD 5FYLD 3W0WB 1X5IA 1LO2L 2XZZA 1WZKA 2J88L 2DTMH 1S9WB 2ICEB 5DMIL 1UYWL 4OLXH 2QR0B 1C5CL 4F58H 4F8QA 5ACMA 2VDPL 3E0GA 4NO5B 4R90H 5FCUL 4CMMB 1RFDH 3RY5A 2D2OA 1NMCB 1RZ8B 1JBJA 3VDCA 4YBHA 3VXUA 3PIQA 2LAGB 5GGRA 3ARED 4RMWA 3QPQD 5HHQA 1I1AD 3QIBC 3E8UL 3EDDA 5D2LF 2DQUH 3UPRB 4P59L 4YBQC 5HHOD 2ESVB 4BYHA 3G04A 4WEBL 2O26U 4D94A 2AXJA 1AGBB 3AMKA 4WJ5A 1FDLH 3CMOL 4OZGF 2RB8A 5HGAA 5C3LD 3CSGA 1WITA 4TVPL 4AQ1B 2Q1EA 5K33A 3QCUH 1PFCA 2ZSWB 4ZQKB 4YEFA 2EIZB 3HPJA 4PG9B 4CN1A 2FYYA 1CL7H 4PS4L 3U9PH 2VZUA 1FJ1B 2CKBL 5ETUA 4L8DA 4JFYA 4M1GL 1HXYB 3WO4C 3AREB 1IC7H 2OR7A 3BWUC 4KGLA 1PZUB 5T3ZH 1MRDH 4WI2A 5HHOB 1NAKL 4ELME 2IAMC 3RA7H 5JQ6H 1CBVL 1K85A 1ADQL 4OI9A 3G5ZB 1RZGA 4KY1L 3MRHB 1NCBL 2HRPH 4HQQH 3MUGA 2UY6A 3WCYA 1V7MH 3TNMA 4MAUL 4K9EC 5FK9A 3RTQA 2VR9A 2XRAL 5I1IL 3BE1L 3IDIA 5B39B 3CFBB 1S7TA 2CRZA 5KSAC 5IMMA 3ZKMD 4G43A 4QOKE 5H2BB 1MAJA 4M61A 3VD3A 3TLRA 1CVRA 2BRRH 2F19L 5F9AC 3A6BL 1J12A 4YDIH 1RAMA 3L3OB 3N9GH 3LSOA 2ICWB 1MREH 4CVXB 1A7PH 2XFXB 1EJ6A 2EO9A 4UV7L 4OFDA 5CJQH 2PYED 3MNVA 3QUKB 1FN4B 3WD5H 1FG9C 5EN2B 4NKIH 5CEZL 4CDGC 1MY7A 4M5ZH 3VD7A 2HWZL 2DI9A 2JCCB 1I9EA 1K6QL 4L1DA 5CEYA 1OQOA 4ZUVB 3IFPA 1VEMA 1NGYB 2WQ8A 1J86A 3DX7B 2PW2B 3V4PL 5C7XH 3CXDL 1RZIA 4DEPC 2AERT 5C0FB 3MA9L 4AENA 2YBRB 4J3XA 4EI6A 3BHBB 5BO1H 4Q0XH 4ZTPH 2FX9L 4L4TE 2BK8A 3FL7A 5DJAA 3QULA 3S34L 4KK8D 2PYEB 3QI9C 2EDNA 1C12A 2HJFB 3T0WA 1UXSB 5EIIA 4OZFB 4PJGB 2CDEB 3TESA 2XV6B 2E7BA 3PV7A 2ARJA 1QRNE 4PR5A 5KSUA 3DXAA 3GHBL 2N7BA 1G7LB 1C5BH 3LKSB 5GGVL 3LQMA 3UCRA 2H3NA 3LN9A 5ANME 3S4SG 3VRLF 5C0JB 5KTEL 3BX7C 2QADC 4QNPF 1ZGLA 4KVCH 3P3YA 4ONHA 5E08L 1KN2L 4RSVA 4OI8A 1N5YH 2MKWA 4MA8L 3MV7A 5FHBH 3T3ME 3GBMH 4YFEA 5DMYA 2CMRH 4O58L 3ZYJA 1DQQB 2ADGB 4MB3A 3RX8A 2RCSL 3QDGD 1IGTB 3MODH 2DLFL 2OR8A 3SKOB 1ZXQA 1HH9A 2HN7B 3HR5B 3G6JE 5JNYA 2HT3D 5IM7B 3MRDA 1J8KA 1A5FL 2ZSVB 4P4RB 3CX2A 2X4UA 4MGXA 4XXDA 3L6FA 4UIKL 3Q2CA 1TIUA 5LAXB 4WU5A 1A6AA 1CE1L 1UB6B 3DSNA 4KK6C 3PHQA 1QFUH 1S9XA 3B3IB 1H8SA 2WWMD 3FT4B 4P9HL 5DJ6B 4Z7WB 3GSUB 4U31A 5M7QA 4LQ1A 3QDGB 2LTQB 4FTVB 4YGVA 3I02A 1G9MH 5DD0L 5EU6D 4C4KO 4JZNB 5TFSH 5GRVL 1CR9H 4Q58C 4N8CL 1OTTD 2OR9L 4U1LA 1UACH 2XQBL 5ADOH 3C6LA 1ZT1A 4NP4H 3RVUD 4IOIA 4JY5H 4YHOH 5LCVL 4RGOL 2G2RA 2H2SD 2HT4D 1EMTL 1OTUD 1AIFA 3QDHA 3GSOB 1CFVL 5FYKE 3HE7A 4TUKL 2GY7B 4QXUL 4RMRA 1AQDA 2AI0H 4HAFA 3WFCL 3MLYL 5EU6B 3QUYC 1KYOJ 5FKAA 4MNQE 5F1IA 3BD5A 1ZA6B 2VDLH 5E9DE 3VWJA 3ORJA 4PY8I 1S5HB 4U6YA 1MFDH 3MCLL 3DV6A 1KCRL 4QWWC 4POZD 1OLLA 1SYVA 2AXGA 5CFHA 3HNSH 1C16B 4LK4A 1F45A 3U36B 2C9AA 2CGRL 1HWGB 3LPWA 1S7VB 3NBNA 2GIYA 4I13B 2B1HL 1IL1B 3A67L 3TNNB 2EDJA 4Q97A 4OT1H 3C60D 1SEBA 2ZUTA 1EVUA 1W0YT 5IMKA 4MNHA 4X6CA 4YIQB 4QRUA 4X6BA 4AIXA 1MCPL 3QPXH 1NAMB 4NYLA 1IC4L 5FUOH 3F7VA 4LBEA 1FFQA 1YEGH 4XI5C 2MCPH 4M62H 3HG1D 1BPVA 4AMKL 3SQOH 1RUAH 2NX5E 2DN7A 2V2WB 5J11B 5DJXA 3QAZC 1A6TB 5AAWA 2VLLA 3C60B 1KJ3H 5F1NB 4K7PY 1S7UB 2IJ0C 1A14L 5FGRA 3CD4A 1GHFH 3GM8A 1JK8B 4ZFOB 2X4TA 1A2YB 1I9RH 3Q5YA 1BD2E 5CBAB 4PV9B 4MZ2A 3S96A 4LP4A 3V2AR 3RAJL 4PJDB 3VH8B 2VXVL 3MRLB 2P5EB 2R0LH 3MV9A 1K8IB 3P4NB 5TDNA 4BZ2H 1LILA 4XMKL 3UBXA 3AU1A 3HG1B 4U3CA 1DJSA 4MJ4A 3F6LA 1J5OH 3T0EA 2PN5A 3OXRA 3V5DB 2L4OA 4ODSL 3KWWB 2W65A 1OAYL 4MJIE 3FN3A 3RL2A 4UT9H 1CLYH 2HLAB 3PJSB 5GIRB 5I73B 5FGSA 1RZ7H 1N59B 4JFEA 4NRXB 2VXUL 5D5ME 12E8L 2P44B 4CVUA 1WFUA 5MHSE 1IEHA 3JTSB 1VACB 4M7ZC 4JRYE 4YHZH 1WAAF 3IFNH 3U4EA 3S4SA 3G6AA 5B3NA 3VXUD 5TE4H 3QXDB 1R3HB 2R0ZL 4XCFL 1RU9H 4W6WB 5TF0A 1D3CA 2ZPKL 4XCNA 3UJJL 2BFVL 1EEUA 4RFOL 2KQNA 4AL8L 1XR8A 5I1CL 4GG6A 3ULVH 2UZXB 3D3VA 3MMEA 3GK8L 5DXWA 4GMSL 2PW1A 2XA8L 3CLEH 1PEZA 2W0FA 5BV7L 2J1KA 4XGZB 1PG7H 3VXUB 4GJTB 2EEDA 2DM7A 5DT1H 1YEJH 1P69B 3JWNC 2G60L 1FFPB 4X6EA 2WSKA 4R26H 2RAMA 1T5WA 5ICXA 5BW7A 1QKZH 2FECI 3EDKA 3QRGH 2ZUUA 3BISA 3KJ6H 3OJVC 3RIFF 1NCCH 5C0BE 3RTQD 1FZMA 4G6ML 3HPJB 4X80H 2FYYB 1GRWA 2VDOH 3S37H 4LAQH 5CEZE 4OD1H 3RVWC 2W0KA 4JFYB 4Z0XA 3PWLA 5C0CE 1FAKT 1A1NA 3V95A 1JYVA 4BZ1H 5DS8A 4FHBD 4Q6IB 5EZLA 2F53D 2X42A 1RZGB 4JFZL 1RMFH 3RVXD 4YDJA 4E5XB 3KYOA 3MUGB 1JUFA 1D5ZA 3LEVL 3RTQB 1ZEAH 2OK0H 1B88A 3EDEA 3IDIB 5MEOB 2PKDA 5HSFA 4FG6D 1S7TB 5JZ7C 5IMMB 1XF3A 5ADPH 1KIQB 4G43B 1H0DA 4K55A 3SY0A 2UZYB 5IR1A 5GJSL 1XIWD 4ZS6C 4P5TA 1OSPH 4Y4HD 2ZP0T 4YHYB 2VSCA 4JPVL 3LSOB 2O61A 4FQCH 2VWEE 2V7HA 4HWZA 2F53B 1I9JH 3Q3GA 4D0CA 4FP8H 4Y89A 1DL7H 3MNVB 2MNUA 1F2QA 1PQZA 4HH9A 1CXEA 1U58A 3LS4H 4PP1C 3QNXA 5FIEA 4NBYB 3VG0L 5CEYB 3DXAD 3IFPB 2HLFC 5I1JH 4UBDD 1OAZL 1RZIB 4P46A 2AK4A 4R9HA 4ISVA 1JI2A 4Y4HB 4WEMB 2CJUH 2ARJQ 4J23A 3QULB 5DJAB 4YHKL 1F2XK 3FN9A 3OV6A 5JW3L 1BOYA 2DRUA 3VJ6A 3ARZA 1C12B 4OAWA 5I16A 3NFSL 3LEYH 2JJTC 4RZCA 3MV7D 5EIIB 1TQCB 3SGJC 5FEBA 1LQSR 2ARJB 4PR5B 5KSUB 1W0VA 3DXAB 1AFVL 1YJDC 1KYOK 2ED9A 1C1EH 5I74B 2H3NB 3RIAF 4GXUM 5HI5D 5H35B 4IRZH 5D70L 5C0NC 5DMGC 1IC5H 5E4IA 3QQ9D 4GMTL 4E41A 3HMXA 1ZGLB 1KEGL 4JZJB 5CINL 2AK1H 3ULUE 2FBJL 1AP2B 3INUL 1U0QA 3MV7B 3EO9H 2EYRB 1YYMH 1T0NA 3STBA 3M45A 5E8DL 1CXKA 2ZCKL 4TQEH 3SDXF 1KULA 4XNZC 1CICA 4PRHA 3TCXA 4ZXBD 4GQ9H 2GTWB 5I6XC 1IE5A 3LN4A 4HV8B 2X4UB 2LFGA 3MNWB 2BNRA 1L7TL 3L6FB 4RGNE 4Y19A 4WU5B 5KS9F 1Y6KR 2BVEA 1INEL 2VKXA 5I1EL 4UINL 1MUJA 4Z77A 4NUGL 1L0XA 4NKQB 4KU1A 3VI4F 4I9WD 4XXCA 5A16A 4YGVB 1L4IA 2V6HA 4OCSH 4KZDH 5C07E 5AAMA 4KMTL 4ZXBB 3VWJD 3WN5C 1E4XL 4LHUA 1RVFH 1ZHLA 3TBWA 3WFEL 4U1LB 3DIFA 5CEXA 1O7VA 5C9JA 4YHIA 1IGML 1ZT1B 4XHJD 4IOIB 4S1RH 4TSBL 4HJ0C 3RUGF 2G2RB 5IBUG 3ZKNC 3C6SA 2XPGB 1J87A 1AIFB 3EIFA 5KVGH 4OB5L 1KIRB 1FRGH 1MVFA 4U49A 3VGHA 4Y8AA 1AQDB 4JAMA 3X3GL 1F11A 5E99H 4GQPH 5I1AA 5FKAB 5F1IB 1U41A 3VWJB 4ERSL 4KJYA 1JNNH 4U6YB 3SGKC 2J8UF 4OFYA 2WBJA 3DV6B 3LRGA 3QUZC 2AXGB 1MLBB 1P4IH 4JM2C 2VLKA 4QRTA 3DURA 5IBTH 5C6TH 4QXGL 4U1GB 5C0RL 1HYSD 1F90H 1CDJA 3QG7L 2XT1B 2ZOLA 1BQSA 1JF6A 2YKLH 4G9FD 4LSRH 1SEBB 4Y16C 1LE9A 4K23L 2IGFL 5IMKB 4MNHB 5GS0H 4QRUB 2VC2H 2NY4C 3FONA 3EYSH 2OX5A 1Z0MA 2ZCLL 1QBLH 5F96L 4KAQH 4NYLB 4LBEB 3MV9D 4WW1A 5CGMA 5DJ8A 1CF8H 2N1KA 3L95A 4HWBL 1CDYA 3QCTH 1C08B 3KHQA 4YEEA 4Z0BH 5JW4N 2I60H 5I15L 3CLFH 1S78D 3DYOA 5DJXB 2VLLB 3CSYB 3ARFC 5ITBH 4WI6A 1I8MB 2Z8VC 1BQLH 2H6PB 1WISA 1QO3A 2X4TB 3V8OA 1A47A 1AE6H 5IGXH 4MX7A 5JQHC 1N3NB 4IOFD 3ZE0E 4OV5A 1LMKA 3MV9B 1RUQH 3KHOA 2E27L 3R0MA 43C9A 1N2RA 3BGAA 3AU1B 2VDQL 5KVFL 2NR6D 5D2NB 5DJZA 4OKVA 2FR4B 4MB5A 1CZ8H 4W68A 5F1OB 3OXRB 5IMOA 4FA8A 5CHNA 4V1DA 5K9OA 3RL2B 4WDIA 5IMLA 2R23A 3N1FC 2WQRA 4LASH 2IFFH 4PLNC 1FNEA 1CGUA 4CNIB 5LQBH 3D3VD 1MPAL 1YECH 2E8ZA 4FZ8H 1QNZL 1NAML 1FO0A 3AXLA 3JV6A 1ZVSA 3U4EB 3S4SB 4FQJH 3PGFL 2MCG1 5EUOE 1A22B 4HWEH 2E7CA 2Y7QA 3HUJB 1OD9A 2VZTA 1KT2A 4JO4L 5K59F 3EZJB 1HN1A 4E42A 4XCNB 3SDCA 3ZDYE 2PR4L 1T89A 3V6ZA 3W0WE 4ZFOL 3W5NA 5CIPA 1XR8B 4KH2A 4H0IA 3T1FA 4GG6B 3EJJX 3SE8H 3D3VB 3MMEB 5AZEL 1NBVL 5E8EA 4TVSa 2PW1B 1DFBH 2W0FB 3O2VH 3MCKA 2X1OA 3K4ZA 1RZJH 5F72S 2IPTH 2NNAA 5I19H 2WZPD 3HNTL 1T5WB 4HXAH 5ICXB 5FYLE 2ESVE 3H7BB 1JGDA 3QJFA 2FH6A 2FATL 3H9SA 1OSZA 4S1QH 5F7NC 4PB9L 2JLLA 1UEYA 1QFOA 3H9HB 2EDEA 1FZMB 5FDWA 4MQXC 2EKSA 4YK4C 1EDQA 4UQ2A 2J8HA 1T2XA 4Z0XB 2OS7A 3PWLB 4ZTOH 3UTPD 4P5TD 2AXFA 4ZFGH 1A1NB 3TIDA 4OIIH 5DS8B 2DL2A 1E4WL 5L0QB 4RCAA 5EZLB 1S7RA 5HHOE 3KYOB 4M3KB 2FZ3A 4MXWH 1JUFB 1D5ZB 1U8KA 3WKNA 1TETH 4HIXH 3LZFH 3I75B 4UDUA 3U7YL 1CFBA 1DVFA 1XF3B 3H8NA 3EFFA 5KJRL 5IR1B 4HF5L 4N8PA 4P5TB 2BY1A 5FYKH 3LHPL 2QTEA 1S9YA 3QXWA 1KC5H 3GRWA 5T1DL 4HWZB 2R2EB 1FIEA 3Q3GB 4D0CB 3S7GA 5DO2C 4L9LA 1PQZB 3MFGB 5ID0A 2R69L 2GSIA 4LVNC 5HDQH 1G1CA 2E5EA 2VITB 2Y23A 3P4LA 4JFFD 2JCCE 5CGYC 4HD9A 3O6MH 4ISVB 4NKOA 4O9HL 3FT3A 3TT1H 3OJ2C 1BBDL 1ZS8A 4MVBD 2ADIA 4E41D 1JPSH 5IFAL 4G6AC 4U1HA 2CIKA 3NPSC 1R0AL 2C7UA 3VRJA 4Z7UA 1EGJH 3VJ6B 2OXHA 3VFVA 4YNYA 3LV3A 4TOYH 1W72H 3LIZL 2PYEE 4DK6A 1BVKA 1CCZA 1W0VB 4PG2A 5FOBA 1CICD 4PRHD 3TBSB 4PJGE 4OV6F 4JFFB 1QYGL 4LDOB 1KBGH 3VW3H 1MHPH 1BGXL 3S9DB 5B8CA 1I7ZA 3G6DL 4KUZL 1B4JL 1NPUA 4E41B 2BNRD 5HDBF 3WIFA 4R7DA 2X44D 4Y19D 4TSCL 2CK0H 3IDXL 1QR1A 4OQTH 3QUMA 1A0QL 3QUXD 4ETQB 4FQHA 5E4EC 3IS1X 4XX1E 1GOHA 2XKNA 3N0PB 3STLB 2K1MA 4GKSA 1T0NB 4DGIH 3QDJA 4R6UA 1CICB 1C5CH 1FZJB 1YPZF 4PRHB 3BKML 3E6FA 2EXWD 2XNAA 3ZKQD 4Q9CA 5JA8B 1QPPA 1CFTA 1KJMB 4JCLA 1MH5A 4I48A 5I17A 3LN4B 1CFNA 4G8FA 5CSZA 5BS0A 3MLXH 5IFJA 1Y18A 1ZMYA 2ID5A 2BNRB 2DWDA 4Y19B 3SE9L 3E8UH 4ONGL 3UTTA 3O8XC 4HW6A 1W8NA 2M1KA 4HGWA 3QUXB 4WEBH 1ERNA 5HHXH 1NEZG 1MUJB 3TVMA 1WWCA 1RZKC 4XPAH 3CMOH 4OGAD 1AO7D 1QSVA 5AG8A 4YAQA 1JGVL 5TDOA 3FB6A 4KI5C 2EDKA 1F6AA 4Z7WE 4U1NB 3U7AA 2BSTB 4KJWC 3PQYA 3QDGE 5T1KA 4OFYD 3TBWB 3DIFB 2WBJD 4M7LT 5CEXB 3ARUA 4JHBA 1RZFH 4YHIB 3B5GA 2W1NA 2VLKD 5D4QA 2CKBH 4M1GH 4WHTA 1FORH 3M8OH 3C6SB 1X4ZA 3PHOA 1Q94B 4UI2A 2LABA 2P47B 2P8PA 4ONOA 1ADQH 3FHAA 2VDRH 2AP2A 4KY1H 1NCBH 5GZND 5C1MB 2D7QA 4JAMB 1ZANH 4UAOC 4NQTA 4MHHI 5IROA 1F11B 3T4YA 5I1AB 3VXMA 2D03L 2B0SL 1HH6A 4KJYB 2XRAH 3BQUA 1NGZB 4KKCC 2W9DH 5EU6E 2WBJB 2WAHA 2Y5TB 4HUKB 3QBTB 3NVQA 2VLKB 4GH7B 4OCWL 2QQQA 3JWDH 1A1OA 3A6BH 4OCXL 1J8HA 2QL1A 3WLBA 3UEZA 1V3KA 4UV7H 2IPKA 3QWOA 4P2RA 2F5BL 3DECA 3OQ3B 3ILQD 1LE9B 1KF9B 4JREB 4JY6B 5CEZH 5DFVC 2HWZH 1MCKA 3H3PL 4OIBA 4K7FA 5DQDL 3TWCL 3FONB 2JB6A 4R4BA 3V4PH 2QV2A 4PJXA 3ZKSD 3FN0L 1JPTL 5F9WC 5DJ8B 4QKXB 4EI5C 4QRRA 5JPMA 2GK2A 3DRTA 4MWFA 2DD8L 2R15A 1A9BA 3S34H 4YPJA 3GBNH 3ULSA 3NIGE 5HI3D 1R3IL 2CRIA 3CJJA 4K8RC 5D7SH 1U8IA 2IAMA 1EK3A 1QO3B 3GHBH 4FQXC 2NMSA 2KKQA 3CDFA 4MX7B 4UOW1 3HC4L 3VXQB 2C3GA 4YR6A 4OV5B 5KTEH 4HIIA 4QGTA 1N2RB 3NCMA 3OB0K 4PJDE 4OF7A 3ARBC 1F3DJ 2P5EE 4EQ3A 3GHEH 4H88L 5DJZB 4OKVB 5KSAA 3T4AA 4JKLA 4P2YA 1S5IL 3HG1E 4MA8H 3IAQA 5CHNB 3KPPA 1LO0L 2EDLA 4KUCF 3I2CL 5B22A 4BSJA 3MXVL 3BGFC 5K9OB 1OB1A 1MCRA 4WDIB 3SDCD 2R23B 5IMLB 5DLML 5LXGH 5HI4D 2OZ4H 3RRQA 1DDHA 5GSVA 2Q3AA 4IDLA 3DYPA 1U6AH 3ULVF 1FO0B 3AXLB 3JV6B 1ZVSB 5MENA 1A5FH 3MFFB 2PTUA 4Y5VC 3LQAL 5I8OH 1XCTA 1I75A 2NTFB 1LO5A 5KVEH 3O3EA 4UIKH 1G7IA 1CE1H 2Y7QB 4X5XA 5DEGA 4HXBH 2ERJC 3OKNA 1S9VA 1MWAH 4P9HH 4YWGL 3GJEB 3SDCB 1Q0XH 3H9SD 4P2OA 3K1DA 4LGPB 4X7DC 5DD0H 3R8QA 4CVZB 2YHGA 5L8LB 1TZIB 3T1FB 3ZHLA 3QI9A 4L1HA 4N8CH 5E8EB 4XBEH 3DLQR 5T1LA 2OR9H 3MLTB 3TN0C 1NCNA 2EE9A 4NFCA 2N7AA 3ULUH 1HZHL 3SDYL 4RGOH 5EZIH 3P0VL 3VXUE 2NNAB 4A2LA 1CFVH 4LSTL 5IIEA 4TUKH 1U93B 35C8L 1U92A 1NEZA 4QXUH 1JGDB 4FQ2H 4BFBD 3REWA 4J7RA 3DHJA 3H9SB 1OSZB 3WFCH 1QLEL 3MLYH 2IC2A 3VXSA 5GRUL 5FDWB 4K94C 3GMRA 2EKSB 5L88H 3V7AE 3ZKXB 3HE6C 3S35L 3KJ4B 3FMGL 4WY7H 2ADFL 5JO5B 1RI8A 4D9LL 4B53A 1YN6A 4NZRH 2AXFB 4B5EA 3TIDB 4XVTH 5IBUB 1QBBA 1BFTA 5T5NF 1NC2A 1U8QA 4JB9L 3Q6FB 3T3PE 2AJYH 3F7RA 2B1HH 3KPNA 5I18H 3A67H 1QLFA 4Z78A 3NCBB 3LRHA 5IKCA 1Z0NA 2FZ3B 1JMZA 1U8KB 2Z93A 5J6GA 3NCCB 3NACL 4UDUB 5F1SA 1AQKL 4OD2B 2OSLB 2FSEA 5D7IA 4WI7A 1Z5LA 3ELAT 4J4PC 1MCPH 3EFFB 3QFJA 1IAKA 4GKNA 1X9QA 2AV7A 4Z7VF 1S9YB 1G9MC 3D9AL 1R6VA 3VXTB 4M03A 1K4DA 3KYNA 4K3JL 3IF1B 5CGTA 3BZFA 3KVQA 1IFHH 4L9LB 1SMAA 1F4HA 3P0YL 1VFAA 4JGMA 4KQ4H 1GXEA 2F53E 5ID0B 4U6VH 2GSIB 2WIIA 4N0UA 1MCWM 4R0LC 5EULV 1ZV5A 3X11B 2XIDA 4YXLL 4Y4KC 4NKOB 5D7JD 3FT3B 2VXVH 3QUYA 1NMAH 3GJFB 3WS3A 1M4KA 1ZS8B 3U2SB 1XAUA 4XMKH 1NFDF 3DX6A 4YHMH 2CIKB 4Z76A 2C7UB 3VRJB 4Z7UB 1FIGL 5KVDH 3NZ8A 4M7KH 1G7HA 4F15C 3C8KA 5J7CC 3PG2A 4YNYB 4OZIA 4ODSH 3T2PA 3QDJD 3TF7C 5F7MC 2VXTH 5FOBB 4X6DB 3WJJA 2UYLA 2VXUH 4MDJA 1JFQL 12E8H 4RMVA 1QOKA 4PTUA 4I0PC 4LLYA 3DXAE 1WC7A 4AYFA 2EECA 3B9EA 4JQXC 5EH1A 2C5DC 3LD8B 4OFKA 5BS0D 1JI1A 5DK2A 2DQDH 3S97C 4R7DB 1TCRA 2DLEA 1QR1B 5JUEH 4JO3L 4PJIA 4DFIA 2VLRA 4HT1L 3V4VL 2FO1A 9CGTA 3QUMB 4XCFH 3UTTD 4X9BA 5EORL 2XKNB 3TVMD 4GKSB 2IBZY 2ZPKH 2AGJL 3QDJB 2LAAA 3MV7E 3O2DH 4MD4B 4DN4L 5KZCD 2H41A 3E6FB 2XNAB 1LDPL 5IEHA 1G7MA 3GK8H 1ACZA 1CFTB 4L3AA 2ZG2A 3FO2B 4P2QD 2BVOB 1L6XA 1MH5B 4JVWA 4QHLA 5FV2A 4I48B 3HR6A 3W2DH 4F80A 3HB3D 3RWIB 2BDNH 3KLAA 1CFNB 4G8FB 5CSZB 5BS0B 1I7UA 1FFNA 1UM5L 1Y18B 2IPUG 4GS7C 1Q0YL 2DWDB 1HILA 5HHMD 1WZ1L 3VFRA 2G60H 4WI5A 1FFRA 2QBWA 1X5LA 3C2AL 3UTTB 2BVPB 2YUWA 3D39A 4U0RC 5IOPB 1MCLA 3KPSA 3TVMB 2FX8L 4WIQA 4YAQB 1DQLL 5TDOB 3FB6B 2J4WL 1F6AB 2BXYA 4QHMB 3VXMD 4DZ8A 5L7XL 2AJVL 3LDBB 3PQYB 1MJJA 3SDDC 3BQUD 2YPLA 3QISA 4G6MH 4P2QB 3VI3E 3SO3C 2EKJA 4CVWA 4KDWA 5HYJA 3ARDD 1JZ6A 4ENEC 3V4UL 5HDLA 3HMXL 1T2QL 1NCDH 3KPRA 3GB7A 5T3ZD 4HX1A 5HHMB 5LWYH 5LKNA 5D1QC 5CZKA 1S3KH 2P8PB 2PXYC 1DBBH 4JFZH 2GJZA 1QA9A 3WNLA 4P2RD 2DQEL 3WIHH 1RD6A 2X1PA 3VXMB 4YBQD 1HH6B 3KS0H 1OW0C 3BQUB 4I9WE 2W60A 1NL0L 2G5BA 4J3WA 5GPRA 2DQHL 2P4AB 3ARDB 3HFML 3SGDI 5GS2D 1A1OB 2MFNA 4F57H 3CFCL 5GJSH 4ELMF 2X9WA 1XGRA 4OCNC 3CNKA 1CDGA 5FYLH 4QRRD 1JZ3A 4WFFD 3ULVC 4X9FA 2BY0A 2IH3A 4PBVC 4MA1C 2IPKB 3QWOB 4P2RB 1HHGA 3OAZK 3FAWA 1HE7A 3O3BB 4KI1A 4B50A 2IAMD 3QT2A 4K7FB 2X4OA 4BFGA 1S7WB 1OAZH 5FOJA 4PJXB 2XXCB 3HI6L 4O02L 2NY5H 4QRRB 4P3CL 1UH3A 1NGXB 2GKIA 5DEFA 5JPMB 3RWDA 1BZ7A 3DRTB 3WNOA 5H37G 5JXEC 5JW3H 1OT2A 1A9BB 5KSAD 5EWIL 4N0YL 3RU8H 3ULSB 1MF2L 3NFSH 5C09D 1TZHA 2HFTA 3WO4B 4XB7A 2VDKL 5FGBC 1U8IB 2IAMB 1OWWA 5SX5K 1AFVH 3MLVL 3WFDL 3SQBA 5IT2L 3O11A 1KCUL 3MRQA 3S98A 2Y5EA 3BUTA 4YR6B 3S5LG 3WS6C 5D70H 4WUUD 3MGAA 2DWEB 3RFZC 3MLUL 3ARQA 4D8PA 5FO8A 5LGJA 1KEGH 3WLWD 2YR3A 3MV9E 4KHXL 4U33A 4HIJA 1P7KB 3ZDZE 5KSAB 2O5XH 3T4AB 2FBJH 5C09B 3INUH 3L5XL 3MUZ1 3KPPB 5D2NE 5ID1B 1F13A 3DSFH 4WRLA 4ORZC 3CDGA 2ZCKH 4DKDC 4P2OD 1DDHB 5GSVB 5EBGA 4WVRA 1IVLA 2IG2L 3MLSL 5MENB 4X6FA 3DVNA 3OZ9L 1P6AB 2R4RH 2ENSA 5D72L 4U2ZA 1JWMA 3W39A 1LO5B 2A0LD 1L7TH 1G7IB 4KK9D 3JWOL 2EDRA 4BKLB 4U1IB 4S1DC 4CGTA 1INEH 5J12B 4X5XB 1H3PH 3OKNB 2HTLC 5I1EH 3H42L 4UINH 5IQ7H 4OZFH 3HUJE 4P2OB 2VL4A 5DDHA 3G6JF 1OAQH 3HNVL 4KMTH 5IJVA 3QI9B 5IW3A 1E4XH 2JJTA 3WFEH 1A4JA 1JV5B 2DS4A 1YY9C 4GG6E 3D3VE 3KDMA 3SGJA 3D85A 4PRPA 1VFOA 4TSBH 5D7LA 4PJAB 2VH5H 4Q7DA 1NC2D 1NKOA 3F8UB 5IIEB 4XT1C 3RKPA 3BT2L 3WUWG 4YUEL 1NEZB 3MYJA 4N1HB 1BREA 1UB5A 4OTXH 1FGVL 4JG0L 4G42A 4ZAKC 1MCOH 3VXSB 3FFDB 1FP5A 1J9CT 1L9MA 3GMRB 4BQBA 4ZUSA 1FO0L 5E6ZA 1CFQA 4OBSA 1WT5C 3UZEA 3K4DA 4TNVK 1FSKC 3EJYC 4LLQB 2XY1A 1IMHC 3V0VA 5JOEA 3QFJD 1YN6B 4QXGH 2V17H 1L0QA 1G9NH 3QG7H 1NC2B 1U8QB 1NMBL 1P2CA 1TVHA 4LNRA 4OF5A 4WCYL 1PY4A 2GSGB 1MNUL 3C08H 1WFTA 3T04D 1A3QA 1MVUA 3KPNB 4ZO8A 5E94A 4Z78B 1IC1A 2A6DA 4G7YL 5IKCB 3QFDA 4RISL 4X9GA 5J6GB 4K23H 3IU3A 1AGEB 2YPVL 3MJGX 3CVHL 5D7IB 1JCKA 3SBWC 1G6RL 2A9ML 1G1YA 3VXPA 4PJBA 4A2MA 1MFEL 5ESQA 3QFJB 3EOBA 3RJDA 1IAKB 4GKNB 5LBSL 3TJEH 2AV7B 4HWBH 4I8DA 3QSKB 1XGUA 4XPFH 3KYNB 1QR4A 4OUUA 1UKQA 25C8L 4ZOAA 2VN7A 3BYTA 4GBXC 2AAVA 4RX4A 3OTTA 4CU6A 1VFAB 3LMJL 1FBIH 5DRNB 4HUVA 1EO8H 3OR6A 2WIIB 4N0UB 1HHJB 5F9JA 3U0PA 3ARWA 2ICWI 3NCJL 3BP7A 3LVEA 3U6RB 1OAKL 5DJDA 2DJSA 1K3ZA 1ZWIA 2ILLA 3PUCA 3WHE1 5ISZA 2D0FA 4M7JL 5HGDB 1UVQA 2E27H 1PDKA 4POUB 4QT5A 3DX6B 3SGKA 1E6OL 1YNLL 4Z76B 3QUZA 1MQ8A 3CDCA 3NZ8B 3BD3A 1D6VL 4JM2A 3U83A 3W9EB 1G7HB 1QBML 2XA3A 2C4FT 3C8KB 3MRGA 4J3VA 4MXQD 4OZIB 4L3CA 4LVHC 4JPWL 5E5MA 1CYGA 5F7WC 5I9QC 4H0GA 2UYLB 1AR2A 1WTGT 4PTUB 4U1MA 3DMMC 4LLYB 4WGWB 8FABB 2VISA 5I2IA 1WC7B 5TPWL 1NAMH 1XGPA 4JFFE 1INDL 3BO8A 5ACLA 3GRWL 1QZ1A 4NRYB 1MCIA 3B9DA 4PJIB 4G7VH 4JKPH 4DOHB 4KUCD 2UY7A 4E41E 5GSRB 1DBAH 4PRNB 1K5NA 4NNYA 3KPSD 1AGFA 4EIGB 4TSAL 1LK2A 2PR4H 1GGCL 3GMNA 2WINA 3RL1A 4KJQD 2DDQL 2NY1C 3KYMA 4GW4A 5IEHB 5AZEH 4CBPA 1PG7W 4NJ9L 1NBVH 1BM3L 3QAZB 4QHLB 3PGCA 4PRHE 3DX9A 4NCC1 3KLAB 1F58H 1I7UB 1FFNB 3DI3B 4TULL 3KPRD 2OYPA 1HILB 1J11A 3VMNA 4AM0B 4ZUWA 4LARL 2BNRE 3EFDH 1U2CA 4WW2C 4AEIL 2H1PH 4Y19E 3GIZL 2FJFB 3KPSB 3T2QA 3CIQA 4PYHA 4ESKA 2FATH 4ZOBA 1I3GH 4BUGA 3BJ91 1RULH 3B2VL 3CGTA 4PB9H 5J4MA 3R1GL 4PB0H 1V3MA 4XCYA 3E2HC 1HOCB 3VFMA 5HYJB 1KNOA 5IWLC 1WAAE 4J8RA 1F4YL 4ZS7L 3KPRB 3GB7B 1DQDL 4HX1B 2HFGL 2D7TL 5DFWH 4QF1A 5C0GA 3OJMB 2V5MA 4XNUH 4M7ZB 5DJ0B 3WL9A 3O9WC 1SEQH 4MSWA 2GJZB 1QA9B 2HG5A 1TTFA 3WUZA 1M05A 3UPAA 3WEXA 4I3SH 4QRQA 3AC0A 2G5BB 6CGTA 4Y7MA 5JLZA 3V9FA 3E3QE 2J6EA 4UZGA 4HDIA 3HZMA 2I24N 2EEAA 4CMHB 4HF5H 3O4LA 4YFDB 2JF1A 1JRHL 2UV3A 1MFAL 2VLKE 3LHPH 5D96C 5JDSA 3UMTA 1XGRB 2DM3A 4Z8FL 1D6EA 5T1DH 5IVOA 1JHKH 1A7NL 5BVPH 3D48R 1X5XA 4YXKL 1T7XA 1N0XH 5E56A 1QHOA 1MCSA 5FO9A 3B9AA 4M1DH 2R69H 3VD4A 5HVHC 3F7QA 1IGFL 1IAMA 1RZJC 2X4OB 4L8SC 3BN9C 3MJ7A 1YEKH 1JNLH 2Y4SA 3KR3L 3BDYH 3QIUC 4X5WA 2R8SL 1KPRB 4EN3C 4O9HH 3EW3B 4U6TA 4H8WL 4P2CG 3OKOA 1T04A 1BBDH 3OHXA 1MAKA 2KZWA 4O51A 2DKMA 2V2XA 1BZ7B 1DBML 1OLZA 2BSSB 2DLGA 2P8MA 3Q5TA 4TNWK 1YN7B 5ESAB 5E2TH 3QJHA 1TZHB 5F7LB 3DNKA 4XMPH 1LO3H 4JHAL 4P23A 2EICA 1T6WA 3R0NA 1PLGH 1M1SA 2YXMA 5DD5H 2A38A 5DI8A 2BHUA 4D0DB 3P73B 3GSNB 3NH7L 1U8LA 3O11B 4GFTB 3MRQB 1QYGH 1HNGA 4GW1A 3D18A 2EDTA 3OAZH 3OGCA 3L5IA 3CSPA 4PP1D 5GZOC 4KDTC 4D8PB 4KUZH 5LGJB 1RK0A 4R4NC 2HLFD 4TSCH 2FDBP 5DQJA 2LU4A 1EBPA 2Q6WA 5JXAH 5DD6A 2NY0C 2E6JA 5I8EA 3QYCA 3CDGB 4HS6A 3ARYA 1SMOA 4L3EA 4JQVC 2M26A 3BKMH 5B38G 5D6DC 1MJ7L 1KJVA 3CX5J 3DVNB 3U0TA 2F58L 3SHSA 1FGNL 5KS9A 3D85D 3GI8L 4PRPD 5J9PA 1X5FA 3W39B 4FXLA 3BZEA 1RUML 3ULUF 2DAVA 1HI6B 3DGCR 3SE9H 4ONGH 4HIEA 5KVMC 3UTZA 2H32A 3B9KD 3FQUA 4KTYA 5C0ND 5DK0A 3DOSA 2DLTA 3HRZA 3TEUA 2GY5A 1JGVH 1JZ8A 4OSUL 5DDHB 3C87A 2ATKA 4UV4L 5IJVB 3HRPA 3BIBX 3X14B 4P3WA 3VDBA 4F9LC 3MLZL 1A4JB 4K9EL 3MRMB 1MHCA 3RUGA 3KDMB 4HS3A 3D85B 4PRPB 3JTTA 3LQZA 4JG1L 5FYJD 1LD9A 4DJMA 3BPLC 3K2UL 1TQBC 1A6VL 2GITA 3B9KB 5CKAA 1UA6L 5HGBA 3WXVL 2F5AL 5EC2A 3MYJB 3CU7A 1UB5B 2JJVA 4QLRA 2COQA 2ZKHH 4G42B 2P42B 2X9XA 5HGGS 2D03H 2B0SH 3H9SE 4UB0L 2NY7L 3BPCB 4ZUSB 1CFQB 4XPGH 5BMFL 5I71C 5IG7A 5DMKB 3DROA 3U4AA 4OCWH 2XY2A 1HNFA 3PWJA 4NKDA 5GISH 1BF8A 3V0VB 3BIAX 1JN6B 4OCXH 2PO6D 3QEGL 3N1MC 4LNRB 1P2CB 1TVHB 3V6OE 1FLRL 5I6XB 4PRBA 4U1SA 1MVUB 4ZUTA 4AEHL 1GVIA 5E94B 4YHNA 4RX4D 1ZGLM 2A6DB 3VI4E 4EDXA 4HJ0D 5KAQF 3QFDB 3LY6A 5F7DA 3ZKND 3MLWH 5GS0D 3V7MA 1SJEA 3O8XA 3H3PH 1QQDA 1CLZL 5DQDH 3IU3B 5E1HB 4XCCL 1GPOL 3MBXL 1G7PA 3S36L 1T80A 3QDMA 3VXPB 4PJBB 1JHLH 3S3SA 3SDAC 5ISZD 3EOBB 3FN0H 2VDNL 4APQD 4FQPA 3FRPA 2VLMD 1XGUB 3U9UA 4P5MA 4XAWL 1LGVA 4JM2D 4XP1L 2JTDA 1E6JH 3T8XA 4Y2DD 3P11L 5TGBA 4ZPTA 4HUVB 4Z7NE 2IQ9L 3D6GA 3OR6B 1Q9OA 1R3IH 4QOKD 5F9JB 3U0PB 3CZJA 3H0TA 3BP7B 3LEXB 4XC1L 1I85C 2XG4A 1ZWIB 3H9YA 4AJ0A 2X2YA 2C3WA 2IWGA 2GK0A 3HC4H 2OMNA 3P9MA 5ISZB 5EU5B 4WWKC 2VDML 3LH2L 4APQB 4HBCL 1AGCA 4ZYKB 4MJ2A 2KH2B 2HYMA 4JM2B 3H3BC 4H88H 5E95B 3ZTNH 4Y2DB 3MRGB 4WI9A 4A6YL 4L3CB 1P5VA 4Z7UE 3UDWC 1LO0H 3JWDC 1TITA 2CO7B 5I66A 3G08A 5DLMH 1J1OL 2ZNXA 1PX3A 3EJZC 3TIEA 5E5MB 1GGTA 1TNMA 4UT6H 3ZE0F 3T08A 1WGOA 3TO4A 1ED3A 2VISB 5I2IB 2Q86B 5ILTH 4X6DE 2BMKA 4NM4H 1A3LL 2JK5B 2OLDA 5BJTA 3S5LB 3OF6D 3JVGC 3LQAH 4PJHA 3BO8B 2CD0A 5IEKA 1T1ZA 5JIIA 2MOVA 1CDCA 4OM0L 1Y0LA 1QHPA 1FNFA 3Q48A 1PW3A 1K5NB 4NNYB 1LHZA 4ALAL 1AGFB 1VHPA 4KRPD 1DLFL 4NN7C 3GMNB 1A9EA 1QG3A 3RL1B 1AHWA 5E0QA 4HJGA 3KYMB 4GW4B 4HLJA 5LJYH 4DFHA 3QDJE 2VZSA 3MRNA 3PGCB 3ARGD 4LSQH 1F00I 4J1UA 1HEZA 4LQFL 5EUOF 4MNGA 3HA0A 3SDYH 4FQXA 4KMQA 1WCBA 3U0WH 3I9GL 4N0FA 1MCQA 1UZ8A 3RIAK 2MKLC 4ZUWB 3P0VH 5BS0E 4OLYH 4ZFFA 3ZDYF 1AKJA 1BECA 4KRPB 2DIAA 3UTTE 4NC1E 3TM6A 1BIHA 4HGKC 1AY1H 1QLEH 5DJYA 2V5YA 3AY4C 2DI8A 1UFUA 1V3JA 3HC3L 1LEGA 4XCYB 4GW5A 3O3AA 4PJ5A 1ZLWH 3ARGB 3VFMB 1KB5L 5T1MB 1TENA 1KNOB 1UWXH 3PQYE 4J8RB 3FMGH 4P2QE 3OKKA 3EO0A 1P7QA 2ADFH 5A2KH 4D9LH 4FNLL 2W9LA 5E1AB 1L6ZA 1N6QH 1MELA 5DUML 2DJ4A 1I4FA 1YMMA 1YZZA 4QF1B 4JB9H 5GJTH 3CDYA 4FFVC 2EYTA 5HHME 3RGVC 3IRPX 3WL9B 2NY6D 1MAMH 4MSWB 4BSVA 2HG5B 4Y5VA 3WUWB 4KGJA 1TJHL 4PBXA 5DWUH 4U1JA 3TA3A 3GMPA 3EUUA 3NACH 4QRQB 1AQKH 2Z8SA 5JLZB 2C26A 2B2XL 3HCVA 3VXME 5AD0B 4PJ8D 1MRFL 4NHCL 2B5IC 4KHTH 5I1HL 3PXJA 1VGEL 2NZ9C 4HDIB 5B21A 1DQML 3CX5K 3B8YA 3O4LB 4NJAH 4RRPA 5JDSB 4I1NB 1D6EB 3P4OA 5T3ZE 5T5FH 5KSBA 4HBQA 3MSPA 2NY6B 3FO9A 3MACL 3KPOA 1NH6A 3MRCA 4P23D 1ZLUK 2DI7A 1VKXA 4P2RE 1QSZA 4GSDH 1SM3H 4RMUA 3FB5A 4R4FL 1U8PA 3MJ7B 4XP5L 3ARTA 4QTHA 5KG9A 1YEDB 4NPYA 4X5WB 1R3KA 1RIVL 2W92A 4XPHL 1II4E 4KKAD 3OKOB 1T04B 2VL5A 3OHXB 4O51B 4PJXE 3IU4L 2V2XB 4YK4B 4NZTL 4XMLL 5A1AA 1IEBB 2P8MB 3ARPA 3DETC 4LSVL 4B7LA 3HE6A 1FIGH 4JKWA 5J0BA 3HLAA 2YWYA 3QJHB 4QRRE 4WFFE 1TFHA 5T3XL 4UMGA 2ICCA 3IRZA 4ORGB 4MLIA 1KENL 4H20L 5IB3A 4P4KC 4P23B 5DUBA 3GJFK 2I9LA 2ICES 5DI8B 3ROOA 2JCCF 4L3ED 3RY6C 3UP1A 3ZTJG 1GIGH 3FFCA 4KQ3L 4GW1B 5EFIA 1RUKL 3OGCB 3DVGA 3JUYA 4FQLL 2YD4A 3FRUB 3I6KA 2WWKT 2NX5D 2EH8L 3V52L 4RMSA 1RK0B 5IVXA 1XGYL 4HS8H 3O2WH 1KIPA 2Q6WB 3V4VH 4J4PA 2H45A 4K2UH 4Q9BA 2MTPA 2C4FU 5KOVC 3MXWL 2X1WL 5DD6B 5EORH 5AWNH 4D3CL 2YWZA 4G6JL 1YPZA 5I8EB 1JGLL 3VG9B 1VEPA 3MOBH 2AGJH 5E2VL 5C09E 1GC1H 4PJGF 5FHAL 4PD4J 3UC0L 4MQ7A 4L3EB 3IFLH 4PRDB 4U6XA 1H3VA 2JE8A 2NXZD 4OLZL 4LLWB 4F8TA 2A1WL 4LPVA 3HS0A 1GZPA 4NQCD 2OTPA 1ZE3C 3U0TB 4CU8A 2AW2A 1CFSA 3FQRB 3S88L 4R0LA 4BSWA 5J9PB 1UM5H 3BZEB 1U8HA 5MENE 4LVNB 1Q0YH 4WO4A 4LVOC 1KG0A 5H8DA 4Y4KA 4MQSB 4PRIA 3C2AH 1YEIL 3UTZB 2H32B 3FQUB 3QEQA 4JRXA 2F54D 3JV4A 1LEIA 2FX8H 3O4OB 4Q6YA 4TVPD 1F4XL 1W8OA 3NPSB 3BKCL 2ATKB 2GUOA 2NXZB 1R5IA 5E00A 2AJVH 4PJFB 2YA0A 4K71C 3DX8A 4KZEL 1PKQA 5GGSY 4NQCB 1LP9B 1KN4L 1MHCB 1YEFL 3AROA 3OMZA 3JTTB 1A7QL 5L9DH 3HMXH 1T2QH 3LQZB 5L2KA 4AQOA 1LD9B 4I0PA 1ZSDA 2HVJA 3FB7A 1WVZA 4HAGA 4LIQL 3VGAB 2F54B 5HGBB 3MR9A 4JQXA 4PJAE 5EC2B 3LKRA 2UWEA 4Z7WF 4CKVX 3C5SA 4FMFA 2DQEH 1XH3A 1YMHA 1KEMH 5JHLH 1CS6A 3O8XD 5DC9B 5JHDA 5SWQB 4MXVF 1JVKA 3VXSE 2CKBB 3ISWA 1T66D 2UVEA 2DQHH 1H9VA 3DROB 1BFOA 2BOBA 1OP3H 3PWJB 3QDMD 1U95A 4NKDB 3CFCH 1H3WM 1FPTL 4KI5D 3VFTA 1Q9WA 2DQJL 2JELL 2DQCL 3BPNB 1REIA 4YBLC 4ZSOA 2ZUXA 2HMIC 2BJML 4PRBB 1UENA 4U1SB 4ZO6A 4ZUTB 4RDQF 5DVOA 4YHNB 2JKXA 5BVJA 4YO0A 4OF0A 4EDXB 4Z95L 3O8XB 1QQDB 1T4KA 3OWEA 1WSST 3LN5A 4JFQA 1C7TA 1G7PB 3QDMB 1RUPH 3BP5A 1YJDL 4O2EB 3QHFH 1UWGH 3Q0HA 5D7IE 1IGCL 4O02H 3SDDA 1TPXC 3U9UB 3QFJE 4DW2H 1P9MC 1ZLSH 4DZBA 1GGIL 2A6IA 1GAFL 4G8GA 1MQKH 3T8XB 5TGBB 4ZPTB 4GXVL 2UVFA 4XVUC 1Q9OB 5D1QA 1KTLA 3TFKC 4CU7A 4OJFL 2QQNL 3H0TB 2PXYA 2Z8WC 3WFDH 1DLHA 1KV3A 3VA6A 2YPKB 4N0UE 4L5FL 4EVNA 1KCUH 4OZHA 4HLZG 3TO4D 4CN6A 4F7EA 5IHZA 3W82A 3P9MB 5FYJL 4EUPG 5DFVD 1AGCB 1OW0A 3MLUH 1L7IL 3RBSA 3VA2C 4KTEH 3F58H 2YUZA 3GMLA 3NIGF 5ICZB 1TTUA 1PYWA 3SN6N 2N4IA 5I66B 3G08B 1OCWL 5ALBH 3TIEB 4OZIE 2YMXH 3RPIA 1HCVA 1BEYL 5FA3B 3DVFA 4I3RH 3L7FA 2IG2H 1ED3B 3TO4B 2FL5A 4WI8A 1MFCL 2BMKB 1GGUA 3MLSH 1O5DT 4PJDF 3BGMB 5BJTB 5D72H 4PJHB 5A2JH 1J18A 3GO1L 4FQXD 2Z91A 2OP4L 5J6HA 1T1ZB 3MGOA 3ZYIA 2V7NA 2VR5A 1MHEA 2I9TA 4CRPA 4XC3H 1AKJD 2HVKA 3GSQA 4PJIE 1IQDA 2VERN 5F9WB 3H42H 4KC3B 4DOHE 2XTLA 3AREC 3QPQC 3ROLA 1I1AC 1A9EB 3QZWA 1AHWB 3PWVA 2NY5C 4HJGB 5JXEA 3R06B 4H25A 3VWKD 3HNVH 4WV1A 5FF6A 5B38B 3MRNB 4PLKC 1NC4A 4PJ5D 1IJ9A 1HEZB 3B4NA 4J1UB 4JPKL 1MFNA 5SWZA 5FGBA 4YDLB 1P7QD 4MNGB 4HHAA 1PVHA 4FQXB 2IQAB 5FV1L 4N0FB 3FO1A 1UZ8B 2NYYD 5FUZL 1I9IL 5EIVA 1YMMD 1ETZA 4ZFFB 4NHUA 2X4PA 3AB0B 1AKJB 2CKNA 2B4CC 5B3JE 3WS6A 4BFEA 4NQUA 4YUEH 2H8PB 2HFEA 3ZSSA 1FGVH 4HULB 3KPSE 5DJYB 4M48L 5CWSA 5JTWA 3VWKB 3OKYA 1B0GB 3TA3D 5D8JH 3Q1SL 1FO0H 4PJ5B 2WUBL 2I07A 2NXYD 2AKRB 3GSXA 2NLJB 1OGTA 1SBSL 3OKKB 1P7QB 4OGXH 2X7LA 5C08A 2HH0H 2MHAA 1MCWW 1KSRA 5HYJE 2DLIA 2Z31A 2I5YL 5EUKA 1NMBH 2JJSC 3GMMA 5D7KD 1I4FB 1YMMB 3KPRE 4DGYH 2EYTB 1MNUH 1P1ZA 2PYFB 2I26N 4ODVL 1EV2E 4Y5VB 2B20A 1VERA 3RZCD 1HQRA 4RISH 1ZT4A 4U1JB 2QSCL 3GMPB 3TA3B 5L2JA 4UILH 1YA5A 4KXZH 4PD4K 5CLTA 3V6FA 4C59B 2YPVH 2ERJB 3B2UC 3HCVB 2NXYB 4PGZA 3HZVB 4DQOL 2WP3O 3F62A 4ODXB 3FTGA 2HKHL 4KKLC 5CBEA 1BX2A 5LBSH 5F3BA 3ES6A 5C71A 1FE8H 3EKCA 3P4OB 2ZUQC 1QFPA 5EO1A 3KYAA 1NBZA 2XQYK 4EJ1C 3P0GB 3LMJH 4EBQL 3KPOB 4M5YL 3RZCB 3OL2A 2NTSP 1VKXB 1FL6A 4MCZA 1KLUA 3FB5B 4KK8C 3BH9A 4Z7QE 4NBZB 5IB2A 1OAKH 1U8PB 4HK0A 3FOMA 1OF2A 4QTHB 5KG9B 3PWPD 1FNSL 2ITCA 4RAUA 4ZAKA 3BAEL 5JOPD 3G5YA 2FNBA 1KELL 3B9VA 3MREA 2DBJA 1T20A 3LKNA 2VL5B 4ZG1A 1E6OH 2O5YH 3FQWA 2R2HA 4PPTA 4YJZL 5LGHH 3FQNB 1WT5A 4EDWH 2R56L 5SX4H 1D6VH 3HLAB 4LPWA 4J4PD 1QBMH 4YXHL 4QCIA 3CSBA 5AUMB 5IB3B 5DUBB 5K93A 5FA4A 1KACB 4JPWH 2I9LB 1A6UL 1G9NC 5TE7L 3KPQA 1D5XA 3I50L 2GW5A 1RIHL 3FFCB 4ODWA 3PWPB 5EFIB 4LCCC 4RFEA 3I6KB 3O45A 5K9JL 4WI3A 3QEHB 4EUPA 4GAJH 2LTQC 4LCWA 3VXOA 1WBXB 5FYKU 3QXAA 5F8RC 1KIPB 4WO4D 4UNUA 4TUOA 2APTA 4PRID 3OX8A 4S1SL 4OLUL 1ONQA 3EOTL 1Q9LA 4JRXD 5F6HJ 5GGQL 4DAGH 1G0DA 2ZJSH 4IIQA 4XZUA 1CQKA 3MA7A 1GGCH 1UXWA 2F15A 3MJ6A 1Z2KA 4MQ7B 4OIAA 2DDQH 3U7WL 4U6XB 5HBBA 1TVBA 1FZOA 3EOAA 4GBXA 2EYSA 4NJ9H 5M95B 1XMWA 5AZ2H 5J57B 4J3SA 2WV3A 5CJBA 1CFSB 1IEAA 4R0LB 4BSWB 4M4RA 3GSVB 3WNNA 1HSAA 1U8HB 3IJYA 5L2KD 1IGIL 4WO4B 1U3HC 32C2A 4PRIB 2YRZA 3QEQB 4NQSA 4JRXB 4AEIH 1UG9A 3RVUC 4OCRH 1LEIB 1IRAY 4PGBA 4RIRA 4M7LL 2FO4A 5DVLA 4Q74A 1OTUC 3EYQD 2A9NL 4JDZA 2GUOB 3B2VH 1R5IB 2QEJA 3FAXA 5D1ZA 5E00B 3L3IA 2R1XA 4F15B 2Z8RA 3DX8B 5BV7B 1MY5A 1I8IA 1NFKA 5CILH 2GEEA 3IETA 2OXGA 1JGUH 4DVBA 1F4YH 4NZUH 1NGPL 1DQDH 5L2KB 1CGVA 2HFGH 2D7TH 4F2MA 1T5XA 4PRPE 5I1GH 3QUMH 1ZSDB 4PJCA 2CLZA 4POZC