1PD6A

The nmr structure of domain c2 of human cardiac myosin binding protein c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
DEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-binding protein C, cardiac-type, Domain C2
publication title Dissecting the N-terminal myosin binding site of human cardiac myosin-binding protein C. Structure and myosin binding of domain C2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pd6A00
1SY6A 3HN3A 1YYML 4WENB 5L2JB 1P4BL 1T3FA 3OGCB 1LILA 2JKXA 1F8TL 4ZXBA 4JLRB 3I02A 5JXED 3P4LA 3UJIL 5B39B 4X6DF 3OX8B 1R3JB 3U36A 1MCEA 1P7KA 1LO4L 4HXBH 1K8DB 1L7IL 1I4FA 1SVCP 1K9TA 4LGPB 3NMEA 1DQMH 3RY4A 4QXUH 1HH9A 3DV6B 3PG2A 4JFZH 2CGRH 2P5ED 4IIQC 4PJXF 1HSAA 4R97B 2BRRL 4QRUA 1KTKE 4LIQL 4E0RA 3MJ9L 4O58H 3DX6B 3ET9F 1DVFA 2AK4B 1C1EL 3MOBH 4TQEL 1GAFL 2W07A 2HTLC 4NNPH 4C59B 4OJFH 1JPFA 4OZHE 4DQOH 5C9JB 4FQ2L 3BP6B 2N56A 4OFYA 2CRMA 3ARRA 4A2LA 1W0YT 5DJYB 5E9DA 2XZZA 5C0IA 4XCEB 2OR9H 3RUGE 3SDDB 1XF1A 3U46B 1WIPA 3KYNB 2R56H 2MCG1 4DCQA 3VD5A 3ARFC 1EFXD 1CGXA 3SEPA 3B9KA 3MROB 3L3IB 4F8TA 1I1FA 3QDME 2VDOH 1IFHL 4K94L 3QI9D 4HWZB 3N06B 5I18L 1A4JA 3DXAB 5D1QA 4HUWB 5FO9A 5DJ2A 4MAUL 1UENA 4X98A 4PJFE 1U6AH 3D2UA 3ZTJG 2EDBA 2GAZA 2PYED 3KPRB 5CEZH 5FDYA 2ED7A 2UWEF 1HKLH 3D85B 2ATKB 5KN5A 1B4JL 3L3GB 4DZBA 4GW1A 3BKML 4XGZB 5KSAD 4I48A 3PWUB 2WBJD 2R8SL 3KXFD 4D9LL 1BQHB 3WFEL 4NC1C 4OCWL 2ARWA 2HT4C 3LHPL 1W8NA 1KBGL 4FN0A 5FKAB 3BVNB 4HC1L 2F5AH 1HILA 1QSEA 3MA9H 5F7MC 3KLHD 3N85H 3ZKQD 1ZV5A 2XQBL 1OSPL 4ZUVA 1X4XA 5A3IC 1QPXA 3ARXA 1BGXL 3UXFA 4XBPB 1MFCH 3P4NA 4JFOA 1L0XA 3H7BA 2OL3A 5GHWL 2D0GA 2E27H 1FFPA 4H20L 5E00B 3QUYB 4YO0B 4NN6B 5AG8A 1UCTA 3D48R 4HPYH 3RP1A 4PBVC 3G9VA 1OAZH 1I1AD 2D7TL 3NH7L 4I5BA 5E2VL 5I8OH 1X5XA 2CXGA 4MA8L 2GYSA 3MRDB 4WI8A 5HYQB 2BMKB 4X9HA 1FJ1A 2W59A 3L3HB 4DN4L 4X7EC 3WE6B 5I17A 2HT2C 1AXTH 1U8NB 5HXMA 3RWEB 5MEOB 2W0LA 2W91A 2NY2C 3BSZH 3VXUD 2KZ1B 1XIWD 5GIRA 4JO3L 5CBAA 2N7AA 1MCPL 2SEBA 1ZVYA 4PG9A 4X9BA 3RWJB 4M8QA 1KG0B 2R69L 1TJHL 3WD5L 1JP5A 4NSKA 4YHOL 1Y0LA 4D8PB 1VGEL 2NY3C 3RBGA 1T2XA 2C1OB 1S9WA 1WWBX 3BQUB 4OD2A 4TOYL 3I50H 4KKCD 1RUMH 4YHNB 4WEUD 4OM1H 5GJSL 4M6OH 1KIUA 1R5WB 1HQ4B 1CYGA 4JGUA 1UZ6F 4GKZA 1ZSDB 3MLWH 1BFVH 3T1WA 3H2WA 2V2WB 3DVGA 4KUCD 1OP5H 1A1OA 3EO1B 2AI0L 4NQVB 3FQTA 3SCMD 2H2SD 5LJYH 3IFPA 5IFAL 1QQDB 5FYLD 1FYTA 4EJ1C 2YXFA 4NRZB 2HT3C 5JPMA 3QO0B 3AC0A 1S78D 2GSIB 1R24B 2BVPA 4HX1A 4G8GD 5HJ3A 1PBYA 4RGND 5GGQL 4F7CB 2A6JA 3V8OA 1MCSA 4WI6A 1QBAA 3VDCA 2YBRB 4QYOA 3B9DA 1UA6H 1GGIH 5IBLD 3W9EA 4R4BA 2CLZA 1NJ9A 1JPGA 2J4WL 1CLZL 1C16A 2X4OB 4MS8D 4PJAA 4FQCL 1FFOA 4GKOA 5FYLL 1CXFA 2WINA 1KT2B 4WO4B 5I15H 1YY9D 3O4OC 5IMKB 8CGTA 5I75B 5IMLA 1KJVA 4L4VB 4G7VH 4KJQD 4KKAD 5KJRL 5EBWB 2ITCB 4UAOC 4PTTA 4LLVA 3BN9C 3PABA 2XWJA 1FDLL 4GKNB 3R4DA 3BPNB 1RD6A 1FRGH 2ED9A 4JRYA 5CKAA 4HKJA 3DJ9A 2PXYB 3CCHA 1M7DA 4HDIB 4MNGB 1DR9A 1EJOL 4P2QB 5KSUA 6FABH 2BFVL 4L8DB 4N1CA 4YHZL 4XBEL 3UYRL 4Z77A 3SKMB 3WJLA 4IRSC 4J6RH 3X13A 5C0BE 3CK0L 1VFOA 1CF8H 3N9GH 3FQRA 4DKDC 4PJEF 4XVTL 3WEXA 4RZCA 5MEQA 3VWKC 4FXLA 2I5YL 4J3XA 1OT1A 3P11H 4KROD 3ZE1F 1CE6B 4GRMA 5DUML 3LV3B 4LLDB 1WUNT 4GW4B 4UNVA 5J1AA 5L8JB 2JCCA 2D9CA 3G04B 1JPSH 4FZ8H 5A40E 5I71C 3TVMA 3RKDD 1Q1JH 4C56B 2DIAA 5KVGL 4HUKB 4PJCF 3S3JA 2O5ZH 4UT7L 1JZ7A 3CXHK 2IH3B 4OLWL 3ZDXE 3QH3B 1RURH 3HPLB 1D5ZA 1NAKH 3R06B 4Z7WB 3SDYH 1A4KB 4OQTA 4OLXL 3G5VA 3O3DA 4L4VE 4JM2C 4MAYD 5D9SA 5EORL 1T7XA 4B41A 1ZT4B 5EIVA 3GI9H 1J0KA 3O4LB 2DQIH 4YHKL 1QRND 2QEJA 2C1PA 2IGFL 4I8DA 5C0DA 2HG5B 1P84J 5IF0B 3FMGH 2D7OA 3MREA 1RZIA 1G9NH 1M7XA 5J56B 1HXMA 2Q8BH 2PTVA 1IGYB 1U93A 2C3VA 3A67L 4NP4L 1AXIB 4MNGE 3QXDA 4P2QE 1S7XA 2H26A 2P5WB 5F9JA 5EU3B 1QFWI 4XP5L 5JQ6L 1OLZA 2DQHH 5FGCE 3D87B 4FQXA 3P9LA 3U48A 3I9GH 2QL1A 2XACC 4DKFL 3UTZB 1EK3A 3QG7L 2Z93A 4PTUB 5A16B 3KPLA 3DLQR 4XNUH 3RY6A 2PO6C 4YEEA 2LAGB 3QUMB 3TYGH 5AZ2H 4OTXH 3RVUD 4OZ4B 4DGVL 2NW2A 2JE8A 3QUZB 2JLLA 2QQNH 4JJ5B 4OF6A 4YAQB 5ETUB 3QRFM 5DMKB 1CGTA 5J1SC 2XFXB 4YWGH 2XTJB 2NTFB 5FHAL 3TA3D 2OTPA 1S9VB 1OM3H 4BFIA 2Q7NA 3IFLH 1OLLA 4NCC2 1T2JA 1MCDA 3QR2A 5E8PB 5HGDA 3VI4E 5FK9A 5L7XL 4CVUA 4P4KB 3UZVB 2F5BL 3JTTA 2YKLH 1L7TH 2KBGA 3QCVH 5K9OB 2Y5TB 5F7LB 4Z7WE 1F58H 4MMXC 4QHKJ 5IT2L 5EPMA 5CBEB 1S5HB 1DTUA 35C8L 2Z8RA 1WAAE 5EDXA 1LO2H 3RTQC 4Y16D 3RJDA 3CFDA 3VD3A 4AH2B 1MF2H 3HRZA 5GGSA 4ZFFB 3SKJH 1R0AH 2VWEE 4LOUD 4WGWB 2DQFA 4ODUA 1I7TB 2D4DA 3S36L 2AJ3B 3WUWA 1FG2B 5CSGA 4HG4J 1D5MB 4K23L 2ARJA 1DE4A 5DRNA 3T0XA 5IBUG 1Z9SA 2VZVA 5FDWB 1FPTH 4KKLD 1UEYA 2LABA 4HIJA 4EDXB 3GNMH 2XV6B 1Q9LB 3NIGF 4HQQL 2FJGA 4P46D 1KCRL 1P53A 2P5WE 1MJ8H 3T4YB 3WIFB 3HI5H 3IU3B 1IGTA 5IVZA 1RZJH 5DI8B 4GLRI 1NFDF 1AHWA 5DD0L 3LQAL 2EC9U 4K7PH 1UWGH 5TQ2L 5D7LD 4K8RD 4JCMA 4CVWA 1KIQA 4H5SB 2RCSH 1Z5LB 4PRIE 1OGAA 1DBAL 4U1IB 5IGXL 4WHYH 4D0CA 3MRKB 4Z18A 5GS1B 4F33A 4FFWD 4H25A 1KCVL 3LS4L 2F15A 2OK0H 4XI5C 4AIZA 2XTJE 3PWJB 3W0WB 1LP9F 1F4WL 3BXNB 1HCFX 1OP9A 4M00A 4HD9A 1N2RA 1DFBL 3AROA 1QFHA 3FOMA 3KS0H 4Y8AA 3QIWC 4DFIA 5IFJA 4K3HA 1WBXB 4S1QH 3MRQB 5BW7C 1CBVL 3O6KL 1NMBL 3ZTNL 4XB8A 5JNYB 4QRSA 4KTEL 4R7DB 2BVOB 5F7WC 1IEAA 4G6FD 3PE9A 4HUVB 2YD6A 2LU7A 1WK0A 2VL5B 3T0DA 1IKFH 1U3HC 2BJMH 1H3UA 4I0PC 2F53D 1ADQH 5DA4A 1RU9H 3Q48A 4XNZB 2XI9A 3EJYD 1NAMH 4U3XA 3MRCA 5DFTA 3MV11 4LASH 4X6DB 3TH2T 5CILH 3E6HB 4PJ7F 5SWSE 1A14H 4MDJB 2Y06L 4HKBB 4X4ME 3BPOC 5D1XB 4U0RB 1SBSL 2VAAA 3DARA 2NTSP 5I19H 1I7ZB 4JAMB 4PJXB 1KPRB 3GMQB 2H8PA 4K7FA 3BPCA 3ROOA 3PUCA 3QI9B 4LCCC 4ZOBA 4WTZA 1G7HB 2W9DL 5ERWA 5C0EA 4NQCA 3ZL4H 4J12A 2ZPKH 2HWZL 4L9LB 4L8CA 1PYWB 4PJ9A 1A02N 4MX7A 3QULB 1KPVA 1VKXB 3KJ6L 5GRVL 1CD8A 3C6LA 4LIQE 3ZO0A 5LCVH 4U1JA 4PV8B 4Q9RH 1T22A 2WBJB 3W0WE 3KXFB 4JPKL 3MRMA 5AEAA 2EDOA 4HUMB 4X8JB 3WIHL 4OIIL 3PHSA 3GSNH 1A64A 1H8SA 5A1AA 4HIXH 5TH2B 1FL6A 1JNHB 2CMRL 1MRCL 4QOKD 1SY6H 1AGFA 4KVNL 4P9HC 1FORL 2VDPL 2IJ0C 4GG6A 2P5EE 5C0JA 4OI8A 5GS0C 1S7VA 3BKYH 2P47B 3PWPA 2PTTB 5DQ9B 2Z31A 2J8UF 1UM5H 4WEBH 1O7VA 1YN6A 2DI7A 1FVEB 3MYJB 4XHJD 5LGHH 4HZLB 2X89A 4HCRL 5IHZB 4U3HA 6CGTA 4LLWB 4OFDA 2PF6A 4CJ0A 2HTLD 1B0RB 2X4UA 4X6DE 3RPIA 3SO5A 4Q0XL 3DBXB 4ZNEE 2AERT 4XCCH 4JFYA 3OG6B 1R3LA 3QJHB 1ZE3C 4NPYA 4ALAL 2X9XA 5BZWB 3MSPA 4PJXE 4CN4A 1I8KB 3SY0B 3QQ3B 2A6IB 3ARFD 4GH7B 3RFZC 1MEXH 2ZCHL 4M6NH 3TBWA 5EOQL 5F7UA 2NW3B 4XMLH 1NBQA 3MA7A 2ZG1A 5FCSH 4F15C 5B4MC 3KWWB 3D0LB 5J13B 1N4XL 3IAPA 3QXWA 3K7UA 4KVCH 1TCMA 1CDJA 5C0CB 4G42A 4XPFH 3ARWA 2E7HA 5HDBF 2BHYA 1T1YB 1SM3H 3KXFE 2QV2A 3ZKMD 5EO0A 3SQBA 1RFDL 2WIIB 2DBLH 2VLMD 4XMKL 3V4PL 1G1CA 2ITDB 2Y6SC 1SJEB 5JW5A 2HT4D 1BVLB 1MJJA 3KPMA 1LMKA 5DUBB 1Q0YH 3DVIA 1BECA 4CMHC 1EO8H 2AXHA 4KQ4H 1FBIL 4KMLB 4JZJB 2UWEE 3UYPA 3FB5A 5DMJB 1IGCL 5A3ID 5JMOC 5A2KH 1M1SA 1T21B 5DD5L 1VPOL 5F97E 1MH5B 1C5CH 1RZKH 3RA7H 5E08L 4KK5C 2YRZA 2AV1A 3GSUB 5DEFA 4UOW1 4P57B 4BFGA 4LARL 5IESL 1JHLL 1HXYB 3REVB 3NGBC 3MRGB 1RUKH 1MFNA 4G3YH 4JZOA 1UVQA 3AS1A 4UMGA 2XA3A 4TNVF 1JJUA 1INDH 1XGYL 2HRPH 3B2VL 3BP7A 3Q0HA 1H5BA 2OL3H 5MP6H 2IALB 4FTVA 2ZSVA 3IETB 2PTUA 4O2EA 1U58A 1X3DA 2HT2D 4HS3B 4J3OC 1BLNB 2AGJH 4LSSH 5I1GH 4FG6C 5H35A 2NY2D 4JPIB 5FYKH 3BPLC 3O81A 1INEH 4GG8A 1UB5B 3C5JB 2HFTA 3O2DA 2PW1A 2ZUQC 4RCAA 3TBVA 1XCQB 4YHYB 4D94A 1UWEH 3CVIL 2YWZA 5TDNA 2PNDA 2NY3D 4U6VL 1ZMYA 4ELKB 1E27B 2NZ9C 5IEHA 4WNQA 1QRKA 2OTUA 5I1LB 2V7NA 5TQ0H 4Y2DA 3JXAA 5EB9A 2CDEB 3G5ZA 1YNKH 3NCCB 3PL6A 4NQSA 4UQ3B 5KS9A 3NZHH 4ODVL 5FYLE 3FOLB 1CIDA 3IXAA 3MRRB 4NGHH 4KGLA 4Y19B 2HLAA 1KLUB 4E42A 2F19L 4MXQD 5E2TH 3VFTB 3TNNB 2HT3D 4RGNE 1QUNA 4RQQA 3UPRB 4R0LA 5ACMA 5HY9A 5CMAA 2ZP0T 5HPMA 1UZ6E 2WANA 4U1SB 4POZD 1ULVA 5DK0B 4KDTC 3JV5A 1WBYB 2QSCL 4W4NA 1P4IL 4YPGB 1NANH 5IMOB 3B6SB 2O26U 4F80A 1WIUA 1E4KC 3VFPB 2X09A 3BYYA 4OSUH 1SYVA 3ULVH 5C6PB 3GBLA 4EKXA 4FXGA 4HWEL 1KFAL 5I6XC 4L8SC 1GVIA 4WWID 4A6YA 4HAGA 1FZMB 1N64L 4LLUA 4ZQKB 3MRIA 1QRNB 1IRAY 5ESQA 3QRGL 1JUFB 1YPZA 2XN9D 3AU1B 4GSDH 4MA1C 5TFSL 5I76A 5EBLB 5DJDB 2HH0L 1HCVA 2VITA 4OCXL 5D93C 3SDAA 3IDJA 4KWUA 4AYFA 4PJCB 3TJEL 3EYSH 3TBTA 3BISA 3GJEA 3UO1H 4BSVA 4F57L 3OKYA 3TO2A 4F37F 3QYCA 2IADA 1CVSC 1G9MH 2ZUVA 4TUJA 2XTLA 4NM4H 1IQDA 3BIKA 5HD8C 4RNRB 1BD2D 4BH8B 2XKUA 3AMLA 4XP1H 3FN9A 2BOCA 2WP3T 2VABA 3WFBL 3HAEB 5F72S 3QCTH 3KR3H 4IRSD 2GW5A 2R0KH 4LHJB 4PRAB 3WFDH 2EYRB 1K8IA 3NTCL 3QHFH 5T3ZH 3O8XC 4OD1L 1A7BA 3WFHB 4JN2B 4ZUTB 1LK2B 3QHZL 3V5KB 3TIEB 3L5XH 4ZAKD 4R2GB 4YXHL 5FGRA 3PGCB 3H9HB 5SX4I 1H0DB 1XGQA 1MCKA 2BSRB 4Y19E 1T66C 3BEVB 2ZZUT 3VFGH 3VXMA 1FC2D 5C9KA 3IDNB 4IMKC 3EYVB 5JLZB 4JM2F 1QEWA 4P2CG 4BUHA 5JOFA 5DJZA 1IJ9A 1JGDA 1W72L 4H1LB 4PYHA 4J4PC 3JV6B 3QO1A 1ZGLP 4PJEE 4BH7A 1J0IA 3L3JA 5FAAA 5ADPH 1RJZB 1N0XL 5C09A 2X1OA 2IANA 2ADIB 3ZE1E 3LN5A 4POYA 3QG6A 3ILQC 4UIMA 2EH8H 1H15B 3NCBB 5HYJD 2R9HD 1NUGA 2A83A 3GIVB 3LQZA 4M7KL 3SE3A 1J1OL 1QRNE 4R7NA 1OARL 1U8HB 4JDTH 2QSTA 3HB3C 4IRJD 3W5NA 3S5LB 4D9RE 4Y88A 1A5FH 3RGVB 4DUVA 2R29L 4PJCE 2APTA 1IM9B 4MJ5A 4R96A 3L3KB 4PJHB 3U0PB 4OKVA 2B5IC 1M6OB 4OQTH 5HHXH 3QWRD 3KPSA 3GJFK 5H94B 2VMFA 2QQKL 4P46B 4X7SH 5B38G 5DS8B 1PVHA 1KN2L 1EHLH 3IKKA 3WIIH 3ZKXC 5CINH 4M5YH 5EO1B 3BDYL 1HH6B 3PWNB 2OZ4A 1J8HA 5TE4L 3B83A 3BGMA 2VTFA 1ZLSH 3V0VA 5IR1A 1XF4B 4P3DA 4MCYA 2CJUH 3C09B 3LKRA 4NUJB 3VFVA 5FV2A 2FO4B 3BUYA 4X80L 2DM7A 5ABDE 5IIEA 5E1AA 1UT9A 4PP1D 4IHOA 1MUJB 1NEZA 3T65B 3NPSC 4UOW0 3SDCA 4M4PA 1FIEA 4J3WA 2CK0H 1A7NL 2KDGA 3VFRB 1YQVH 4JCLA 3OXRB 1GZQA 1NFDB 4GUPA 5HI4C 3LH2L 3LMJL 2FBJH 3GKZA 2BVYA 2C7UB 3HZMA 4RMWA 1EXUB 1MHCB 2C9AA 1JYNA 5D7JC 3HE7A 2NCMA 4KZEH 2P45B 2VXSH 3ZKNC 1OSZB 4J1UA 4YFDB 1TETL 1QSFA 3SGEH 3UJJH 4N0CC 5HHQA 1JN6B 1ZVSB 1ZLWH 5JW3H 4ONFH 2F53B 1Q72H 3BAEL 4M93B 1VADA 4KAQL 3RTQD 3MFFA 4UU9A 1LP9B 2RHEA 3EBAA 2BNQA 2F58H 2DQJL 1S7TB 3FFCD 4P4RB 5DTFA 3TEUA 4U05A 3QPQC 4PJ5D 3WLBA 1AXSB 4MJ6A 5CJ5A 2R1WA 4UT6L 4NO0D 2NX5D 3WUZA 3H0TB 3ZZ1A 2IPTL 4NRXA 3BIBX 4XPGH 4X6BA 4U1KA 3E6FA 1FO0H 3PXHA 4JJHA 2AEQH 2VXTH 1EH9A 1AGEB 5HHVL 3MLSH 1BMGA 5D7LE 3A6BH 3FQWA 3GB7B 2JB5L 5DRXB 1KB5A 5ESAB 5F96L 5KOVC 4EBQH 1G7LB 3QUXC 4Q9QL 3S6CA 4PJ7B 1YEDA 4KRMB 3FZUC 1BQLH 4JQXC 3H3PH 4RAHA 2A0LC 3HCVA 4HUUA 2FIKA 1YEIL 1C8PA 1OCWL 3NIGE 4HXAL 3GMNB 3LN4B 4DUWA 1NBVL 4HJJH 5ACZB 3F7VA 4R4FH 3EFDH 2M8XA 4XI5D 5KVEL 3S35L 3H9YA 3IJHA 1NFDE 4NOBA 3TZVB 5EOCH 1DQLL 3MR9B 3NACL 1WCBA 4GRLD 2EYTA 5HGHB 2VRAA 2UZYB 1M4KA 4L9DA 5DJ0A 2BY0A 1XZ0A 2X4SA 3JV0A 3QIWD 1QNZH 1Q9KB 1WFUA 3BP5A 2XZAL 1HDMB 3NFNA 4N0FB 5CJ8A 1DBJH 4YXLH 3QQ4B 1EHAA 1RMFL 2DQTH 2F53E 1NGXB 1T03L 2X4TB 1MI5A 2WUBL 1LP9E 1U3HD 3MCKA 3HC4H 2EDLA 3ECBA 4EUPA 2QADC 5CLTA 3S88L 4X6EA 4E5XA 5FF6A 5I0ZA 5E2UH 3U4BL 2NY1D 5ID0B 5ALCH 3SQOH 1BM3H 3AUVA 3LRSA 3EOBB 3QIBD 3FT3B 4YBQC 4WHYG 4YHLH 1O0VA 5E8DH 5C6TL 5CIPA 5E6IC 1MHEA 3C5ZC 2EEDA 1VEOA 2HRLA 4LLMB 4LHUA 4GAFB 2J8UB 3V52H 3I6GB 5FHBL 4MSWB 1DLHA 1FCCA 2CDGA 1EEYB 3RU8H 2YD2A 1W0VA 3QEHA 3OPZH 1JF1B 1K4DA 3O2WL 2I60H 4QNPF 4PJ7E 4ZO7A 3FO9B 43CAA 4PGJA 4EN3C 5FB8A 2XZQH 3L5IA 4K3DH 4NUGH 2YPLB 2DS4A 1NCAH 5D72H 2O5YH 4NQDA 3VH8G 1KGCE 2V7HB 1REIA 3NOIA 3U4EA 3F6LA 2FWOB 3L95B 4JKMA 1U8QA 3FKUS 4R90L 2WNGA 2A74A 5C7XL 4ETQA 4RX4D 5BXFA 2XXMB 4JR9L 4HIIA 3VJ6A 3KLAA 3OAUH 5FUCC 4OF0A 1YEKL 1YMHA 3EOAB 1U8LB 1N7MH 5FUZL 2DL2A 3BHBB 4JVUA 4HT1H 5FCUL 3C08H 4IJ3C 5CZVL 3EO9H 3FT4B 2G75A 3OF6D 2BNUB 1XGUA 2FGWL 5CCKH 2V5RA 1K85A 4PBWD 4LAQH 2YSSB 5TE6H 1A6ZB 4TRPH 1MHHB 4PV9B 4WWKC 1I9EA 1QLFB 4ZSOA 1F4XL 3P9MA 3Q1SL 3FFDA 1IZJA 4M1DL 4OFIA 1CG9B 1WICA 3MUJA 4WW2C 2AJZB 4YGVB 3GMMB 2ZCKH 1T04A 1SYSB 3KPNA 5DJ6B 4OZGA 3W39A 4UNUA 2HFEB 1RZFH 5HGAA 5EUKB 4P9HL 1MNUH 4DUXA 2CQVA 3IFNH 5GS0L 1ZT7B 2J8UE 1HHIA 5INDA 5MHSD 3THMH 1RUPH 3GSVA 1U95A 3LKSB 3EO0A 3VW3H 5MENB 4YQXL 5E8NA 3EYFB 3N1MC 2A9MH 3H42H 4RFNC 5HYIA 1A7RH 4I9WD 5DR5H 1T20A 2NY3B 1HZHH 3V5DA 2E7CA 1MVUB 2W65B 4KJYA 3NZ8B 1K2DB 1HHKB 4KHTL 4F2MA 3CFCL 1CD0A 1A6AA 2DLFH 1JV5A 4NC1E 4C4KO 3BKJL 4ZYKA 1B0GB 1EEQA 1YYLL 1XR8A 3ZYIA 2IPUG 5SWZA 2Y6SD 5FFLA 3HG1D 3NABH 4YK4C 1SEBA 1OAUL 3BWAB 5T33H 1UYWL 4KKBC 5F7DA 2AJVH 4NO2B 4L4TD 2EEAA 3LEVL 1KTDB 5IOPA 3IS0X 5HDBE 1TNMA 1MFDH 1NCCL 1WZ1L 4MJID 1QLRA 3QWOB 1JWMA 1EBPA 5EBMA 4G6MH 1NGPL 5DO2C 4H26A 3O6ML 5INCA 5KVFL 3MV01 5GRWA 3X11A 1T4KB 1WGOA 4QXGL 1IBGL 4PD4J 4O51A 2VAJA 5HDQH 1RZGA 3I6KA 2B0SL 4NZUL 3TLRA 2DWEA 3TT3L 4F7EB 1ES0B 3O4OB 3K74B 2VE6B 3JZ7A 2XN9B 2VLKD 5LAXB 4W6XB 2DI8A 2ADGA 3IDMB 3GUTA 4UAOB 4YNYB 1AR1D 4FG6D 1CQKA 3PDDA 2ICCA 2APFA 4NNXA 4OZHA 2Y1VA 1SJXA 2NXYC 3VE0B 1KYOJ 2FX8L 3D1MC 3MC0A 1CTNA 4YXKH 5HVWA 2EDWA 3SE4A 5IB1A 1BD2B 2P7TB 4QY8A 4NJAL 4MA3B 1KPUB 3RUGA 4BFBD 3E2HC 1W72B 3GRWA 4HIHB 4QRQB 4NDMA 4PS4L 5ICYB 2I9TA 3QDAA 1G6RA 3VMNA 5I9QC 2NZ9D 3O2DH 4WY7L 2IH1A 1A1MB 4E41B 4APQC 1MLCB 2AK1H 3ILPB 4UV7H 2WUCL 4CVXA 3QDMA 3VWKB 3MNWA 1IM3B 3U9UB 5LGJB 5E5MB 4GQ9L 3VFMB 4P9ML 2KQMA 4Q7DA 2R1XA 1LHZA 5I8EB 1OGTB 4WGVB 4Z7UF 4PJFA 2GHWB 3CC5A 3WS6A 1FVEA 2A73A 3QEQB 1UEMA 1MCNA 3C60C 1KJ3L 5I71B 4TPRL 5FYJH 4G9DB 1BREA 1G84A 5IB3B 1DUYB 4XC1H 4HWBL 2AXGB 3UTSD 3VG0L 1V7ML 5B39A 4HMEA 3OX8A 1R3JA 4J3VA 4MWFA 3B3IA 3VFOB 1CICC 5EU5B 1HHGB 2FX9L 2DICA 4KKNA 4PUBL 4Y4HC 4U7MA 4F3FB 2WBWB 3DV6A 4TSCL 4JM2B 1KN4H 2XN9E 5IBTH 5E6YA 1YEFL 4MD4A 1DBML 4ISVA 4OLZH 4MVBC 3KPPA 1GOFA 4WIQA 3NAAH 3DX6A 2R0LH 2AK4A 5TF0A 3VXNB 2IFGA 5H37H 3U36B 5BVPL 5GRXG 5C9JA 1P7KB 4J8RB 4N1EA 3BP6A 5DVNA 4X0KB 4MB5A 1I4FB 4LPVA 4MA7L 3ALXA 3DHJA 5GZOC 3HS0B 4A6YH 1BD2E 4TNWF 3WV0A 2UYLB 3MODL 4XCEA 4OBSA 5HD8D 3U46A 4HHAA 3KYNA 3TP4A 2DQEH 3P9WB 2MMXA 2AEPL 4XNQB 4M1GH 3STLB 5I0DA 4RA3A 5I1IH 5GPRA 5IB2A 1JPFB 1IQWL 4ZFOL 1DBKL 3C8HA 3L3IA 3O8XD 1AKJB 3AM8A 1D6EA 2PO6B 2CO6B 4HWZA 3FO0H 4DEPC 2PUQT 5C0IB 3L7FB 2R23B 4HF5H 2RFXB 2FNBA 1G9EA 2IPKB 3EDFA 1P1ZA 1T66D 1JFQL 1ZK9A 4ONOA 3HC0A 3KPRA 3QEQE 5CUSH 1DANT 5KVDH 1DQML 2ATKA 4XXCC 3TBSA 3L3GA 4K9EH 3K4AA 3QPXH 3P0YL 4JM4L 4XGZA 1PZUB 1Y18B 3PWUA 2VDQH 4NFCA 3VD9A 1BQHA 2OJZH 4J4PD 4Z78B 3DSNA 1MWAH 4CUCA 1P7QB 2H32B 4NNPL 1H3VA 2DYPD 5FO9B 1MIML 4OLEA 3VG9C 3U7AA 3B8SA 5FKAA 3BVNA 3OQ3B 1NKRA 4QLRA 2GAZB 5HYJE 5ISZB 3PGFH 1CK0H 4I48B 4NJ9H 3K8KA 4PRBB 4ZDHB 4Z8FH 4M43H 4XBPA 5IMMB 4OF5A 1YMMD 3PWVB 4JHZA 4PJ5B 1R5IA 1N5YH 5DWUL 3LKPB 5E00A 3QUYA 4YO0A 5DXWA 3MCLL 5DT1L 3JUZA 4GO6B 1D9KA 2AXJA 4M5ZL 4ZUVB 1NUDA 3WFZA 4YHPB 1A7OL 2IBZY 5HYQA 3P4NB 4OD3L 3L1OH 5F93C 4ZPVB 3MBEC 1SEQL 3L3HA 3ARDD 3WE6A 3FO1B 1FFPB 1U8NA 3RWEA 1ZA6A 1ZVHA 5MEOA 2EDHA 1A9BA 1QFWM 4L1DA 3MRFB 4I5BB 1D6VH 4U31A 3A6OA 1KG0A 4D8PA 2OZ4H 1KF9B 4U6XB 1TFHA 2C1OA 1KCSL 3BQUA 4KY1H 4YHNA 1E4JA 2VH5H 5BZDB 1G0YR 3MQIA 2DQCL 2NXZD 1MFCL 5HI4D 3UJTH 5C0BA 1R5WA 1ZSDA 2XG5A 1NLBL 2GSGB 2AJYH 2V2WA 4XNYH 3GSOB 3QIWB 2VN7A 1DN0B 3I85A 1JI1A 3EO1A 3IT8D 3L5JA 4NQVA 1X5YA 4HPYL 2QTEA 4GBXA 5D7JD 3FQXB 1BEYH 1S9WB 1QQDA 4FA8A 3ZKND 3PP4L 4GXUN 5ISZE 4NRZA 1P69B 5C3TA 3I84A 3HPJB 2YPVH 3H3BC 1U3HB 2GSIA 5I8KH 4I0PB 4NFDA 4PJ5E 3CU7A 2F54D 5HHOD 3SJVD 3FQTB 4OBRA 1CFTB 3BSZL 3QPQD 5IW1B 3BPOB 1CT8B 1FYTB 3H9SD 1K4CB 1IMHC 2X4OA 4JO4L 4XZUB 3HKFA 2BVPB 1HNGA 5J12C 4ODSH 1KT2A 5K9JH 4WO4A 2IPUK 4YDKH 4LSUL 3DETC 3I50L 5IMKA 1CU4H 4L4VA 3WXWL 1FG9C 4HH8A 1IGIL 4OM1L 4QYOB 5LBSL 5EBWA 2ITCA 1TZGH 4R4BB 4ONGH 1JPGB 3QUXD 2X1WL 5IHLB 1C16B 3OTTA 4JO1H 4LQFH 3OMZA 2DL9A 3FZUD 1RJLA 3MXWL 2A0LD 3V79C 4OCYH 3ESUF 2X41A 4HDIA 4MNGA 2MCPL 1AQKL 3OG4B 4P2QA 3U9PL 1IC1A 4L8DA 1KB5H 3HE6D 1OF2B 4JFFD 3SKMA 3GBMH 1RK0B 1FVCB 2XWJB 1S9KC 1N5AA 5C6WH 4JY4B 4I18A 1UA6L 4JRYB 1YEJH 3HI6H 3Q5TA 3U7YH 1G9MC 4F7MB 1I8MB 1S3KH 1CE6A 5IW6B 2VXUL 4Z7OE 3VRIB 3LV3A 4LLDA 2DM4A 4GW4A 4K2UL 1FNSH 3FONB 4JKPH 4RIRB 3FQRB 3UPAA 1CFBA 3O2VH 4RISL 4OZIF 3RBSA 2VOTA 4RZCB 3RX8A 2QR0B 4JHAH 3NFPA 2FDBP 2PKDA 2Y4SA 1UB6B 4KGJA 3VFUB 2IH3A 4XP6H 2VDNL 3QH3A 5FGBC 3HPLA 1H3GA 4Z7WA 4N0RA 2APVA 4EUPH 1WAAA 2UZIH 3HMWH 1MFBH 2YA2A 5E6ID 3TVMB 1MRFL 1ZT4A 1CCZA 4AY0A 2BY1A 3O4LA 3V7AE 3DX9B 3CZJA 4Y4FC 4TN9A 3CX5J 2AQ2A 3MLZH 2HG5A 3VFWB 3SBWA 5IF0A 4TUOA 4F15B 2OI9C 5L2KB 4KMTL 2FD6H 1CS6A 1A6TB 1NC4D 1CZ8H 3GO1H 3P11L 5CIPH 5SX5H 1IC7H 2ZG2A 2RIKA 2VXQH 2Q76B 4FQLH 5DZOA 4DJMA 5C07D 3X3FH 2OP4H 4KHXL 4Z95H 2P5WA 5FXCH 5EU3A 1F00I 3V9FA 2FH8A 4I3SH 3D9AH 3NFSL 1E0OB 2C1PB 3B5GA 1NUFA 4WW2F 4EI5C 4PTUA 1SMOA 5A16A 3HG1B 1GCFA 3CDGB 1G1YA 2FGZA 3CLEL 1PKOA 1T89C 2X40A 4PRIA 1MRDH 4QNPE 5BS0B 5EULV 3G6AB 3QUMA 3PGDA 2X10A 4BM7A 4CMHB 2K3TA 4GJTB 2Y07H 4OZ4A 3SDYL 4QXTB 3QUZA 4ZS6D 3PWLA 5DMKA 4RDQG 2XFXA 3K4ZA 2NTFA 4HEME 2MWCA 5DRWB 4OCLC 2Z93B 3KPLB 4CL7A 5TE7H 4G7YL 4HFUL 4ZTOL 2G9HB 4P4KA 4FZEH 1NC2D 2Q8AH 5J3HC 1IT9L 3O9WD 5K9OA 2FZ3B 1OTSC 2Y5TA 2AJUH 1KJ2L 4GLRH 4QTIH 4XPBH 3UTTD 3FTGB 1NKOA 3ARBC 5CBEA 3WFCH 5GRUH 5I1CL 3CIQA 4O2FB 2P48B 2Q86B 2APWA 1FGVH 2LE9A 3IDXL 5MHSE 4R4NC 2YN3A 4WTZG 2DQHL 4AH2A 1EMTL 1ORSA 4LKXA 1WC7A 3BPLB 3I9GL 4QKXB 4ZFFA 3S3SA 3JTTB 1M05B 2DDQL 1U9KA 2QSQA 3BGAA 1T5WB 3MO1B 5AYQA 2KUTA 1I7TA 3QJFB 4YDIL 5L2KE 1FG2A 2ZUQB 3U0TB 4AQOA 2ED8A 1D5MA 5SWSA 1E6JL 5JO5B 5DHVB 4X4MA 5FDWA 5EPMB 4EDXA 5GGVL 4CADB 1Q9LA 3OWEA 2QQLL 5IV2B 2GI7A 5JPNB 3WIFA 5E5RB 4BUGA 5A2IH 3HRZB 1KUMA 1D5BA 1IEHA 4HBQA 2DQFB 2H1PH 3AY4C 1OM3L 3WUWB 1XGPB 3MLUL 1DE4B 3IFLL 4K3GA 5K33A 3VXRD 2CKBH 1PQZB 3HG1E 4H5SA 2VLJD 2Z8VC 1Z5LA 3I2CH 1WFOA 4X99B 2L4OA 3QFJD 2NYYC 1Y6KR 4U1IA 1CWVA 1D5XB 1GJIA 2FJGB 4L4TE 4WFFD 5DD1H 2HKHL 3GMRB 3S7GA 3HNVH 2FHCA 1F58L 3MRKA 5GS1A 3MJ9A 4MJIE 2FHFA 1U42A 3DECA 4P59L 4HIEA 2AJSL 3PWJA 2C3WA 3W0WA 2FECI 4UBDC 3BXNA 4O02L 1FLRH 5JXEA 1MF2L 1LD9A 5DO2D 2C5DC 4NKMB 3SKJL 4GS7C 3PHQB 5IK3B 3SHSA 1P4LB 2HMIC 1WBXA 3ZHLA 3MRQA 5TPWL 3QAZC 1UC6A 2D7PA 3CXDH 3GNML 2JJVA 4L8SB 5JNYA 1FH5H 2BVOA 2P5EA 2LU4A 2VLKE 4ZFOB 4MNQB 4HUVA 2VLRD 3VGBA 1NMAL 3VXPB 4DVBB 3HI5L 4LVOC 3G6DH 3M8OL 2F8VA 4MA1B 1QLEH 3RWHB 1LE5A 3NN8A 5D93B 5CGMA 4L29A 4NFBA 5B3JF 1U8MA 3KHOA 4X6DA 2RCSL 2QHRH 4MDJA 2NXYD 2EYSA 4HKBA 1MCHA 2FIRT 2P43B 2YK1H 5D1XA 1IEAB 4HK3J 3SDXF 2B1AL 4ZNEA 5LWYH 1I7ZA 1B6DA 1J12A 4JAMA 4PJXA 4Y5VA 1KPRA 4P5TD 1EFXA 4XPHL 4YH6A 1VGKB 1FFNA 1CXHA 3TNMA 2YD8A 3O8XB 4XMPL 4HC1A 3KYOB 4CW1B 3QI9A 2R39A 1L4IA 4APQD 1DEDA 1G7HA 3VRJB 4G5ZL 1FVDB 1LEKB 4L9LA 1PYWA 3F12A 1NGQH 3QULA 1VKXA 3GRWH 4BZ2L 2DD8H 4LGRB 1JPTH 1G6RH 3ROLB 3MV7D 3I3EA 4PV8A 1X5ZA 4UIKL 4K7FB 2G60H 3C60D 1ZTXL 2WBJA 5ITBH 4JG0H 1Z0NA 3KXFA 4LCWD 4N0UE 3UTSE 4Y8DC 5ILTH 1ADQL 2WQRA 4GAYB 1RU9L 4MMZC 5ERWB 3C6SB 4JKLA 4L8CB 2XWBA 1ZANH 2VZTA 5TH2A 2CIKB 2X4QB 1HINH 5FA3B 4CGTA 4OLUL 2YEZB 5ALBH 4UB0L 1TJGH 2H9GB 2CH8A 4Z7UE 2B8OT 4CN6A 5K59F 3PV7A 3LKNB 3W82A 1OB1A 4MNQE 3MV9D 4G43A 1ZHKA 2PTTA 1A3RL 4RAVA 5HHMD 2DQGH 3LS5L 3MYJA 4R8WH 1AR2A 4HZLA 5IHZA 3RHWK 4LLWA 1ZLWK 1Y6NR 4OGXH 1B0RA 2B5IB 1IGFL 5DC0A 4G6KH 3GBNH 3D39D 1VB9A 4LU5L 3QIUC 2V17L 4AEHH 2Z8WC 2IC2A 1S7VB 3MV8D 1AJ7L 5GZOD 3EAKA 2FLBT 4IS6B 3U30C 1PAMA 3QJHA 2YRLA 4NZRH 5BZWA 5BV7C 4ZXBD 4Q9RL 1KSRA 4OV6F 1DQTA 4GAJL 3CU1A 3SY0A 5J06A 2X4UB 1ZEAH 1T6VN 4Y89A 5T5NG 2NW3A 3E3QC 4HIXL 5E7BA 3QFDB 3KWWA 3D0LA 1YJDH 4UTAL 3DTXA 1R3LB 3S96B 3NPSB 4U3CA 5C0CA 1I7UB 5D71L 1OTTD 4K3JH 3DSFL 1WTLA 3T0WA 1C08B 1T1YA 5DUPL 3TBWB 3LCYA 1I9RL 1PLGH 3WXVH 4LSQH 3K1KC 3DV4B 2WIIA 1IAKB 2IQAB 2ITDA 4PRPD 5H37G 5L9DH 1BJ8A 1SHMA 1SJEA 1F90H 1Z6JT 5D7JB 1BVLA 5D5MF 5DUBA 2XYCA 4G42B 4PY7B 1BP3B 1EEUA 3DVNA 5GS2H 3GHEH 1J1XH 4N8CH 4JZJA 4D9QD 4P3CL 1YMME 4MYWB 3B9KD 3LZFL 3AAZB 4GKSB 1WWCA 5EO0B 5T1MB 1T21A 3SJVB 4LCUB 4DVRH 4ORGB 3OKLB 4RMSA 1QKZH 3FN0H 4UZGA 3QDHA 1GC1H 5EO9B 1MAJA 2R0ZH 1MEXL 3BZDA 4M6NL 3OKDB 1I3RA 4P57A 2KL6A 3D2UD 2ADJB 4LCIH 3REVA 3MRGA 3P30H 4KTDH 4AL8H 3M1BB 4JDVB 1O5DT 3MGOB 3S97C 2J3SA 3AREC 1CFNB 1YA5A 1FP5A 2R0WH 4FFZH 4AG4H 2IALA 3MBED 4WUUB 5DEFB 4HS3A 1AFVL 4FQJL 1CXKA 3CFKA 1BLNA 3MUY1 3QUXB 5T5FH 1A3QA 3DRQA 4JPIA 1JVKA 2DBLL 3RAJL 5CD3B 5DFVD 2PR4H 1UB5A 3GSWA 4JZOB 4WDIB 5D96C 1CD9B 1FNEB 5GRYA 5KAQF 5GGTH 3X3GH 1CQYA 2ZKHL 2R2EB 1PX3A 2MNUA 2J7LA 1AD9B 4B0MM 1KCLA 1Q0YL 2B2XL 4FTVB 2DQUH 3QUKB 5H2BB 4KQ4L 4LFHD 4EI6B 4PG2A 5AAMA 4ELKA 3CFEA 1E27A 4O9HH 4WTXA 4ZO6A 1EUTA 5I1LA 4UT9L 1C5CL 2CDEA 3OSKA 2DOCA 4XWGL 3SE9H 4UQ3A 3BFOA 1RZ7H 1OAKH 3AFLA 2X70B 2ZSWB 1MHPL 3MRRA 4UINL 4Y19A 4G3YL 1T83A 1KLUA 2DLEA 1XR9B 2CRYA 2HRPL 2F8XC 3TNNA 2O93L 5IEHB 3GMPB 5I66B 3KYMB 1GPOL 2OTUB 5JHDD 3UPRA 5EBGA 4N8VA 1XMWA 5BQ7B 4G9FD 2F54E 5HHOE 3SJVE 2QADB 4KJWC 3JWNC 4NQSB 4AENB 5E94A 5IQ7L 1OD9A 4G8IA 1RV6X 5DK0A 3ZT7A 3H9SE 1BWWA 2YC1B 1WBYA 4HV8B 3TO4C 4YPGA 5IMOA 1GOGA 4JRXB 4M48H 3VFPA 2GY5A 5GRJL 2CUIA 2B39A 3AXLB 3QDJB 5DDHB 3V7MA 4BQ9A 1A6UH 4IM8A 3P73B 4N1HB 4R0LB 3C5ZB 5LQBH 4MAYA 4PRHD 4YX2H 2EH7H 5L0QB 4WUUE 3DETD 4ZFGL 1QRNA 4MXWH 2VISB 1JUFA 3AU1A 4PJBF 4OZIB 5SX4H 5DJDA 2XQYG 1RVFH 5IJKC 1T6WA 1YNKL 4PJCA 5I1DB 1JMZA 2Z91A 5E4EB 4PGZA 4X7CC 4EN3B 4FQ1L 3EYQC 3ULVD 1FNLA 4NGHL 3KYKH 4GMTL 3HNSH 3O0RL 3MRIB 5E70A 1X5HA 4RNRA 1YUHA 4BH8A 4JFFE 2BNRB 5E2TL 5DURD 1YPZB 1AH1A 1BZ9A 3HAEA 3IDJB 4L8BA 4PRAA 5DJCB 2EYRA 3WFHA 2JELL 3TO2B 1KJ2B 4JN2A 4ZUTA 1LK2A 3V5KA 3TIEA 4IJ3B 1L6ZA 3PGCA 1MCIA 3LD8C 1H0DA 2BSRA 4EZMA 3BEVA 4OSUL 4X4XB 2AXFB 4DTGL 4NT6B 4L3ED 4HGMA 2J88H 3IDNA 3QXVA 3EYVA 5JLZA 4EVNB 4WWKB 3KLSA 4WRLA 2BZDA 2A2QT 4S2SB 3C5SB 3GM0A 2VIRA 2YHGA 3TV3H 4H1LA 3GMOA 4NQXB 5T3ZD 4QHNA 1KJMA 2B4CC 5FO8B 4HULB 4ZO9A 2FATL 4X9IA 3IRPX 1ETZB 2R15A 1RJZA 4JRXE 1QYGL 1GSMA 2ADIA 3QDJE 2EDTA 3BZEB 1G9ML 1H15A 2PYFB 5KSAC 5JOFB 2XA8L 4Y16A 3GIVA 4KI5C 4OCRH 4XP1L 2WW8A 4QO1A 5DQDL 1KIPA 3JWOH 2OCFD 4DK3A 4OZIE 3VCLB 4EQ3A 4Y4FD 3S5LA 2NY5H 3KLHC 3RGVA 5IG7B 5C09B 1IM9A 4R3SB 4RFNB 3QG6B 3U0PA 1M6OA 3L5XL 5D7SL 4YDJA 1F3JA 3TC9A 5H94A 3GI8H 4P46A 2FB4H 5DMIL 3LQZB 3GSRB 3LPGA 4DKEL 3A6CL 2WZPD 2R4SL 3F5WB 3MRLA 2BNRE 2D03L 4Z0XB 1HH6A 3PWNA 5AYUH 3MRPB 5DEGB 3VXRB 1X9QA 1XF4A 4MJ5B 4UTBH 5FUCE 2CIIB 3O3UN 4EI5D 3KDMB 1I1AC 2FO4A 3KPOB 4YK4B 4YHIB 1I9IH 5LG1A 5L6YH 4U7KA 3DRTA 3AS2A 5ADPL 2NY6C 4WUKL 4X5LA 3KYAA 4J3TA 2GQHA 4GXVH 3C2AH 1OWWA 3RNQB 3WKMH 1MUJA 2VC2L 1DQDL 3MLRH 3T65A 2A9NL 4XVSH 3HZVB 3GKWH 3QDGB 3V0VB 2IAMC 2C26A 4BFEA 4EUPG 3ETBF 4IOIB 2XWTA 3VFRA 1I85C 3OXRA 1NFDA 4XP9L 3VFVB 1XIWC 1YECL 4N5EC 1VFUA 1MJUH 3LEXB 5JXAH 1FNHA 2C7UA 3LPWA 3QUMH 4JG1L 5AZEH 3BRDA 4ZODA 2WM0A 3WHE1 1MHCA 4IHOB 1ZHLB 4NWUL 1NEZB 3INUL 4YHMH 3U4AA 4PJDF 1A0QH 1OTSD 2E3VA 5C0AD 3SDCB 4KKCC 2J8HA 1ZT1B 1YEHL 4LHUG 1JN6A 4LPTA 3DUUB 3U6RB 4GUPB 4HK3N 3L9RA 3LY6A 5D6DA 1EHLL 3MOQA 2F53A 1MSPA 1F02I 1KB9K 1LP9A 3RJQB 3CH8A 3SKOB 5F70A 2R2BB 1S7TA 3SCMC 1BOGB 4P4RA 4JANA 2H2SC 3IFOB 4MQXC 1PX4A 4J1UB 1AXSA 1YNLL 3CX2A 4MQTB 3H0TA 4I2XB 1QFPA 1MCWW 1NGYA 3E2HB 4Z7QF 1VADB 4YR6B 3CMGA 5E5UB 4B50A 3QSKB 2PCPA 1KCUH 4OGYH 3WIHA 1QFUH 4PPTA 5I9QB 2GEEA 1OAXL 3QXUA 1Q0XL 1AGEA 3IVKB 5JUEL 3ZDZF 3VXRE 1IEBB 4G8EB 5IBLC 3W11C 2LTQC 3GB7A 3OKMA 4APQB 4QHKI 2VLJE 1G7LA 1AI1H 2HFFA 4LDLB 5FUOH 4XNMA 4OAWB 5L8KB 4PJ7A 1P4BH 4WFFE 3P4OA 1KOAA 3NCYP 4NRXB 1RPQA 2G5BB 2JJSC 3SDXB 3E6FB 1YY9C 2VXSL 1F8TH 1J18A 1QVOB 3LN4A 5TF1H 3UJIH 1RULL 3QDGE 5JW3L 4DFHA 4M6AA 4HCRA 5DJ8B 1UKQA 5ANMB 4U1LB 2GJ6B 4ZTPH 4P2OC 2DF3A 1LO4H 3MR9A 1CLYL 4YLQT 2F58L 1FCGA 5HGHA 4NKIL 2MHAB 4HUUB 1EUUA 2BRRH 4GT7A 1CICB 1Q9KA 4LIQH 3MJ9H 3VGDA 1HDMA 3T77B 4Y4HB 4QRPB 4TQEH 4TSAL 1GAFH 5E0QA 1S7UB 2VLRE 1G7JA 3QQ4A 4FFYL 4IIQA 5HHMB 4Q6IC 4FQ2H 5BRZB 2X4TA 1FO0L 1FAKT 1OGAD 4QRRB 2XPGB 1EVUA 3VRLF 3D39B 5F7HA 1CGYA 4C83B 3MV8B 5GGUB 4RGOL 2AVGA 4M7ZC 3EOBA 3BI9X 3FT3A 4I2XE 1JBJA 1TNNA 3AB0C 4PGEB 1IKNC 2NQCA 1IFHH 4K94H 1NGZB 4L5FL 3ECBB 3RKDC 3ARFA 4LLMA 2J8UA 4X6EB 4E5XB 3I6GA 3TJHD 1IE5A 1F3DJ 4MSWA 4MAUH 1F97A 3T0VA 1EEYA 5B3JE 3LRSB 2Q6WB 4OFKA 4LLQB 4DEPB 4DN3L 1B4JH 4I1NB 3MPCA 3L5WB 3FO9A 3DIFB 1ROWA 4OGZA 3SDXE 3VGAC 2R8SH 1LEGB 3T0BA 5FIEA 4D9LH 3WFEH 3BZFB 3RX7A 5JA8B 4P23C 3LHPH 3DI3B 2V7HA 4LCWE 1KBGH 1S8DB 5JIHA 2CDGB 2DQTL 2FWOA 5ANME 3RI5K 4V1DB 2GJ6E 3VWJC 4BQ6A 2DI9A 4HUNB 2YD1A 1K4DB 3QEGH 1F13A 2XQBH 1OSPH 5B21A 5DZLA 3RIAK 4LVHC 3VG9B 1AQDB 1BGXH 4Z0BL 1U8LA 2IWGA 3BHBA 5GGVY 1ZLVH 5GHWH 1INQB 4QRPE 2BNUA 3MV9E 2XQYK 4LRNH 1IGJB 2YUXA 1TMCB 5HHME 2V5MA 2YSSA 3BIAX 5BRZE 1A6ZA 1JCKA 4Y1AD 1MHHA 4PV9A 4ETQB 5F3BB 4G80B 1XF2B 1QLFA 1FZJB 2D7TH 1UJ3C 2VKXA 4KK9C 4NQCD 5E2VH 3VI4F 2NY4C 2FR4B 4QRRE 4MA8H 4PJ9D 5FKPA 4NN7C 3PQYD 3D39E 5SV3A 2AJZA 4KZDL 2ILLA 4YGVA 4DN4H 2HP4A 4U1HB 2I60L 3C6LD 4HJ0D 1SYSA 3MV8E 1U8OB 3QIUD 1X7QA 4JHWL 4Y2OA 5DJ6A 5JZ7D 3UTOA 3JVGC 4IDLA 5CJQL 2HFEA 2XZQL 4JFEB 1T80A 3VXSD 3TA3C 1NCAL 1H3WM 4X5XA 2P8LB 4JO3H 1TQBB 1GIGH 1A1NB 1MCPH 2J5LC 4HJGA 1ZT7A 4ZS7L 3WD5H 1TJHH 5DMGC 4YHOH 2EXYD 2MQCA 3MFGB 5HPOA 4F58L 2I27N 1VGEH 4AIOA 3LKSA 4LP5A 2OJEA 3SOBL 4TOYH 2OMNA 5MENA 3W39B 4RFOL 3DMMC 3EYFA 1TXKA 5GJSH 2MQ0A 2VQ1B 1MVUA 2W65A 2X4PB 2Z31D 4KC3B 2M26A 1CE1L 1K2DA 2BVEA 3TF7C 1BFTA 2X89D 4LAQL 5INDB 1B4RA 1I8LC 4V1DE 5TE6L 1QZ1A 4U49A 4LOUC 3S35X 3EO0B 5B39G 5BV7L 1BVZA 3CXHJ 4C57C 3GHBL 4PRPE 3RL1B 5E8NB 1B0GA 1U8IB 2BDNL 2DIBA 1U92A 1L9NA 3F7QA 4KJYB 4XCFH 3V6FB 5GGQH 2H45A 3BWAA 3LIZL 4F2MB 4NO2A 4PB0H 8FABB 1FNAA 3S37H 4LF3B 3WCYA 4JB9H 1FV1B 4NQEB 3UBXI 3S4SB 1MNUL 5T3XH 2IQ9L 1BBJB 4K8RC 2J4WH 1B9ZA 1CLZH 1H3PL 3QWOA 1AGBB 1NUNB 5FYLH 1DJSA 4P2RD 1SEBB 5DVLA 5JR1L 3RWCA 2DLIA 4LP4A 4ZOAA 5D5ME 3UDWC 3DOSA 9CGTA 1A7RL 4NCC1 5J12B 5KJRH 1U91B 4JFEE 5JORB 5F1SA 1NCWL 2JK5B 1ES0A 1QLRB 3ARED 1FDLH 2VE6A 1Z9LA 4RMRA 1V3KA 2DBJA 2XN9A 5LAXA 3X11B 1IAIM 1RUQL 1UH4A 4OT1L 1II4E 3QA3B 2V2TA 1RZGB 1EJOH 3I6KB 2BFVH 1WIOA 1BF8A 4UUJB 3MRNA 1KCKA 4YHZH 4XBEH 3UYRH 1JMXA 4WCYH 3CK0H 1BD2A 2P7TA 2XNAB 2ENSA 4P5KB 2I26N 4MA3A 1KPUA 1W72A 4HIHA 4QRQA 2ADGB 5CEXB 5ICYA 1BQHG 3EJYC 4IRSA 3W81A 5CJOL 1MFDL 3I75A 4CRPA 1TJIL 5ICZB 1BOYA 4PJBB 3SGJC 5J89A 5SX5K 4NNXB 1A7PL 2GJJA 3FRUB 1A1MA 5DUMH 3VWKA 2ZUUA 4JO2L 1IM3A 4OIAA 4WVRA 5LGJA 3VFMA 4QY8B 1KXTB 5HSFA 5HDQL 2ATPB 3ALPA 4ERSL 1SQ2N 4L3EB 2BSTB 3CVHL 5GJTL 5I8EA 5KVGH 1OGTA 1RIUL 1F2XK 5JHDE 1W8OA 4G9FE 3C87A 3QEQA 4NQEE 4M7JL 4WU7B 5HYSA 2IH1B 3N0PB 4OLWH 2C3XA 2VDRL 5F8QC 4KJWD 5T5NF 3BWUC 3O6FC 3FQNB 1YC8A 2RB8A 3HR5B 3KPTA 1F4HA 5IB3A 3F7YB 2AXGA 1EGJL 3R0NA 3MXVL 1I1CA 2ICWJ 4OLXH 3TO4D 5EORH 1CFSB 1PGRB 1V8HA 3ZSTA 4CKVX 3FQUB 4YHKH 5F7EL 5EU5A 1HHGA 4GW5A 4PRHE 4LPXA 2IGFH 4F3FA 1OWRM 4JM2A 3ARVA 1I8IA 1HHJB 5FYJD 4PYGA 5D8JL 5EIIB 3A67H 4NP4H 3RWFB 4MWFB 3B3IB 3VXNA 3W2DL 1ND0B 4UV7L 4PP2A 2ID5A 1HK6A 4J8RA 5JQ6H 1HYSD 4X0KA 4LPUA 5JTWA 1DLFH 3EYQD 2CLVA 3HS0A 5I1EH 3M07A 2UYLA 3ARYA 4MD4B 4PJ8C 4XHJC 2ERJC 4ISVB 3KPPB 4XNQA 4LGSB 5E99L 3STLA 1G0XA 3HTLX 1Y6MR 4PJBE 4EI5B 5FYJL 4DGVH 5KVMC 3T08A 3DO7B 4LVEA 4M6ML 3V6ZB 2YD5A 1AKJA 4IDJL 2PO6A 3VD7A 5EU6B 4MD5B 3L7FA 2J6EL 4L3EE 2R23A 2QLVB 2RFXA 1HN1A 4HHAB 3STZB 1FLTX 2IPKA 4JHBA 5I1AB 1ED3B 3HAEH 3UC0L 2BY2A 4KI5F 4UDUA 2F5BH 5IB2B 3SDAD 2VNCA 7FABL 5IBTL 3QQNA 5T3ZE 3BKCL 1Y18A 5EZIL 1D6EB 2YWYA 4PY8J 4H8WH 5IT2H 3TBYB 2BOBB 4E9LA 4Z78A 3RZWA 1P7QA 2H32A 35C8H 4YDLB 1DN2A 2K7QA 4NHCL 5C0AB 3SDDC 1P1ZB 2BK8A 4N8PA 3HC0B 4QRTB 2Z0BA 1BX2B 3O41B 3ARBB 5BCAA 3IDGB 4DKAA 5ISZA 3TBSB 3RTQA 3S36H 4PRBA 4ZDHA 4H1LH 4K23H 3ZKMC 4KI5D 4OF7A 5IMMA 1MLBB 5FV1L 3PWVA 3S37X 1TLKA 1WVZA 4PJ5A 2OSLB 2ZUYA 1WF5A 5IVXF 3LKPA 1KCRH 4NO0A 4I77L 5SV4A 2B4CL 4PJDB 1PSKL 3OAYH 4D3CH 4JZNB 1CGSL 1QO3B 2FL5A 4WEMB 5TQ2H 5JDJA 4YHPA 1I3UA 4B53A 1I7RB 4ZPVA 1DBAH 5TDOB 1R5IB 3RIFK 1MCJA 3FO1A 4PR5B 4WHCA 3RDTC 5IGXH 1XF3B 1D9KB 4NWTL 4D0DA 3LS4H 3MRFA 4MJ2A 1MWAL 1MQKL 2HKFH 5E24E 5EU6E 2NR6C 1F4WH 1K6QH 2NY6D 1EVTC 4Z5RB 1U8KB 4KDWA 1EJ6A 1OOAA 4U6XA 4XPAL 5ADOL 2VUYA 1UH3A 1DFBH 1U41A 1ZA6B 2IAMD 4NJ9L 5DD3L 4UILH 3MLYH 5BZDA 5F9AC 1A9BB 4KUCF 1JZ4A 1CBVH 2W9EL 3O6KH 2RQ8A 4N5ED 2AJXL 4G8FA 4KTEH 1TQCC 3KPSD 2GSGA 3ARPA 1V05A 3GSOA 3QIWA 2HYMA 1NFKA 1DN0A 2X42A 5C0AE 4LEOB 3ULUH 5BW7A 3QAZB 5C86A 3FQXA 4NZTL 1BJ1J 4S0TD 4M3KB 5EC1B 2CUMA 3HPJA 4LVOB 5GSVB 4GFTB 4KK8D 1U3HA 5J7CC 1D3CA 3L1OL 5C0BB 4I0PA 2Y06H 5F9OH 3V5HB 1OD7A 1SBSH 5A43C 2EEBA 5T1LD 4B7LA 1MCFA 3PIQB 3TN0C 5CEYA 2AS5M 1CFTA 4GBXB 1OQOA 4MQXD 3E1F1 5EN2B 3PP3H 3QIBA 5IW1A 1CT8A 2EO1A 4MXQC 2D0HA 4PJDE 1K4CA 1HIML 4XZUA 3K8MA 4RSVA 1JK8A 3RPKA 4LSVH 5EZLB 2YZ8A 4OI7A 1FQ9C 2AABH 2W9DH 2HWZH 3UTPD 4POZC 3ARSA 5ESVB 2ZJSL 2J8OA 4LCCA 1TVHB 3W11D 1BFOB 4HS8H 4ZD3L 4DAGH 1QSFD 2AJYL 2HA1A 4XNYL 1CL7H 5EIQA 4MD0B 2MKWA 3MGAA 3EZ8A 2HJKA 2DIJA 1JF5A 4I0CC 3WIHH 4OIIH 4OUOA 4Z7QE 3ZHKA 1T2QL 3UEZA 4FQIH 5F71A 5J57B 1EX0A 5FEBA 1OF2A 2CMRH 2GJZB 1F6LL 2ESVB 5I8KL 5BMFL 4RX4A 4S11A 3ZDZE 3IYLW 3SN6N 1KTLB 1RK0A 4KVNH 4P2OD 1FVCA 1FORH 2VDPH 2EKSA 1ZLUH 1IC4H 4PRNB 3HZKB 2C3HA 2EC8A 4JY4A 1RJLB 4F7MA 3OF6A 4JN1L 1I8MA 4TSBL 4NN5C 5DF0A 1J7VR 1YEEL 4TUKL 5IW6A 4XT1C 3VRIA 1DCLA 4JFDD 5ENWB 1S7WB 5FGCB 2JJTC 4ODSL 5IB5B 2ORBL 4YDKL 1U2CA 3FONA 4Q0XH 4RIRA 3CLFL 1N5AB 1CU4L 4ZFZA 2Z4QA 3WN5C 2WWKT 4I18B 3IB4A 3OHXB 4ZAKC 4DW2L 1A47A 5EZOH 4ALAH 1ZHBB 3IKCB 2QR0A 4ONGL 4JPWL 3QIUB 4WI7A 2PXYC 4YEFA 1UB6A 2YD7A 4PLJC 3VFUA 3WNKA 3FCTB 4M4RA 2ZCHH 3BRGC 4KPHL 3HMXL 5BV7B 2EDRA 4MNHB 2KZWA 1AC6A 4ZUSB 5C0RL 3QNYB 4GRWF 3GBML 1NL0L 3DX9A 3NFPB 3VRLE 4FNLH 4CMMB 1X4ZA 2VZOA 3VFWA 5L2KA 3TT1H 5JIPA 3BDBA 1A6TA 3VI3F 2R9HC 4EOWL 5FECA 4AMKL 3FO2B 4JQVC 2I07B 4X7TB 1RFDH 2Q76A 3V4PH 1KEML 4P23D 1FSKC 2D9QB 4IRJC 1MIEH 2Q3AA 2ESVE 3UP1A 4JKPL 3VWJD 3ARGC 4TUOB 2OR8A 2YD9A 3O2VL 4S10A 1FBIH 3HG1A 3CDGA 1CXEA 1IGCH 5BS0A 1PW3A 1OP3H 5KANI 5DD5H 5DEZA 3G6AA 5EC2B 3RZCC 4L4TA 3SKNB 5E08H 4F9LC 4LHUD 4M62L 4C58B 1R3KB 3BP4B 4QXTA 1JNLL 4Y1AE 4MJIA 5IESH 1JHLH 3OKKB 5DRWA 4JDZB 3PQYE 4EDWL 4P2RB 3EZJB 3R8BB 4KK9D 4PRIB 3OJMB 1XGYH 2NY4D 3B2VH 4NQUA 4AM0B 2G9HA 3MLZL 4PP1C 2UVFA 3PGDB 5CSZA 3VD4A 2FZ3A 2YUZA 3VXSE 1BF2A 3QCUH 3ISWA 3PWLB 3AREB 5DD6B 3FTGA 5I2IB 2EO9A 2IF7A 5GSRB 3MLXL 4O2FA 1CDHA 4BSWB 2Q86A 3V4VH 4HGKC 3MGTB 3C9NA 5DMGD 3SO3C 1Z0MA 3WKNA 1M05A 3MO1A 4U6VH 1T5WA 3E3QE 5D96B 3QJFA 1JYWA 3CVHB 3E8UL 2XKNA 5E6ZA 3U0TA 5JO5A 2UV3A 3DMMD 5DHVA 3BW9B 1A21A 4CADA 5JDSA 5IV2A 1IAIL 1HWHB 2H3NB 5D1ZC 3CFBB 5JPNA 5IROC 4ODVH 1ORSB 4EXKA 4LKXB 1WC7B 4HWBA 4KK6D 4LNRA 4U6YB 2GITA 1NCBL 1XEDA 4KUZH 5ITFB 2F19H 1XGPA 5SWSB 1JYXA 1QBBA 1PQZA 3M45A 1S7SB 2OLDA 1FZOB 1RI8A 4X99A 5T1KD 3WDIA 1D5XA 3CAFA 1P2CB 1AY1L 1J86A 4PGDB 3GMRA 2EIEA 3CZFB 3WJJC 5MERB 3DVFA 3RWDB 4XPBL 1D5BB 4XRCB 3LN9A 5C08D 2PN5A 2QSCH 15C8L 5DLML 2FBOJ 3RVWD 5A2JH 2X6MA 4I3RL 4N0UA 4P2RE 5HI5D 3NCJL 3UTSA 4HWEH 3W5MA 1KFAH 5EOTB 3FB8B 4KDTA 4P99A 4NKMA 4XPTL 3TO4B 4DGYH 1N64H 2VSCA 3WLWD 3PHQA 1E4KA 3B4NA 5IK3A 1P4LA 1A3LL 3Q3GA 3QRGH 4NBYB 2YUWA 3HZYB 5TFSH 2HH0H 4HIEB 4OCXH 4L8SA 4Z7UA 1P5VA 4Q9BA 4U6HB 3TJEH 2VL4A 4ZFOA 3SKUD 5KTEH 4MNQA 4Y4KC 3VXPA 4DVBA 2VQTA 3OJDA 4GRLC 1LD9B 3RWHA 1X5IA 4K8RL 2H1PL 4Z7VF 1BQUA 2X2YA 2G5RA 3G6JF 2LFGA 2CKBL 5IM7B 3WFBH 3QQ9D 3C8DA 4RWYL 5B3NA 5J8OA 2P5EB 32C2B 1NEUA 3GK8L 1H3XA 3RVVC 1HHHB 1WZKA 5J11C 3NTCH 4JFPA 4OD1H 3MRHB 4O4YL 4AEEA 4WFED 3QHZH 1LE5B 3NN8B 4PB9L 4YXHH 4MHHI 4OM0L 4L29B 1U8MB 1VGKA 2NY1C 1KV3A 3O8XA 3KYOA 4CW1A 1LO0L 2EYSB 3QIBC 2DMBA 2MQ3A 3VRJA 1FVDA 1J87A 1LEKA 2XRAL 3LD8B 3MLVL 4WFHD 1NBYB 1W72H 3FJTA 5E2JA 2L7UA 4M9PA 4QCIB 4IMKA 3ROLA 4Y5VB 1EFXB 4WHTB 1LO3H 1ORQB 1FFNB 3TNMB 5DJAB 5CZKA 1N0LA 1GGBL 1DSFL 4J4PA 1WFTA 3TFKC 3TGXA 4GAYA 3BE1L 3O6FD 3C6SA 3EDDA 5CS7A 1NANI 2E7LC 1MFAL 3F12B 4NYLB 1FAIL 4OLYH 1KC5L 4M7KH 2CIKA 1J1OH 2PYEB 2X4QA 3CMOL 5FA3A 2YEZA 1OARH 2QHRL 5DHXB 4WI2A 2HTKC 3SE8L 5EFIB 2W0PA 2IFFL 2H9GA 5KSAB 1TTFA 4F9PC 1YEGL 5E7FA 1A6WL 2R29H 5LWYL 3JTSB 3LKNA 3X14B 5CWSB 5FYJE 1IL1A 3QDMD 2XWBB 2QQKH 5CSBA 1PD6A 4D2NA 5D7KD 2NY0D 2D7NA 1KN2H 4PBXA 3BDYH 5TE4H 3T3MF 3ARZA 1AGDB 3PDOA 3RVTC 1GRWA 1OB1B 2UWEB 4NC2B 3VMOA 4IS6A 1SJHB 4G43B 1ZHKB 4ZUWB 3UBXA 4RAVB 5F88B 4X80H 5JHLL 4PJ8D 1JGLH 4LRIC 4M9OA 2G60L 5DVMA 5EZJB 3RWGB 4LEXL 3E0GA 2P24A 3IAGC 2AQ3A 1XGRB 2N7BA 1I1AB 5IVXB 2FEDD 5C92A 1E4XL 2A1WL 1I3GH 1ITBB 2HFGH 1FIGH 3F65A 2NY6B 1A7NH 2N1KA 4H0HB 1GHFH 1CLOL 3K0WA 3QFDA 4QEGA 1HINL 3LH2H 3LMJH 1FZKB 4IRZH 1C7TA 3S96A 1TJGL 1ZWIA 5I1KL 1MQ8A 2X1QA 4M03A 1I7UA 1VEPA 4NO3B 2AK4D 1C08A 3VXUB 3O3EB 1J8KA 1XIWB 2L0DA 4Q6YA 4NKDB 3RX5A 4R8WL 1T7WA 3DV4A 1IAKA 2YOCA 5AWNL 1FGNL 2IQAA 2VO5A 1G7MB 3DTXB 1PZ5B 1EDQA 2ZOKB 4PFEA 5M7QA 5D7JA 2R4RL 2PYEE 3BAEH 3EDKA 4OGXL 4G6KL 3SDDD 4OLVL 2FH6A 5BO1L 4XAWL 4HPOL 4AEHL 1A6VL 1EIBA 4RFEA 2DQJH 4PY7A 2X05A 3ZDYF 4H88L 4KI5E 3WNNA 1P9MC 5HVHC 4UT6H 1VEMA 1K3ZA 4GKSA 3AAZA 5T1MA 5F7FA 2F54A 5HHOA 3SJVA 4LCUA 1E6OL 2WLYA 2H32H 3BJLA 4ORGA 3OKLA 3SCMB 2IPTH 3NA9L 1JRHH 3DXAD 5EO9A 4XNXH 4K7PX 1E4WH 3OKDA 4FABL 3H9SA 3ZHDA 1CDUA 4AJ0A 2ADJA 3KPRD 5HHVH 5MEPA 3DVNB 4XVJH 4Y5XC 2HVKB 1YJDL 3D85D 2JB5H 3M1BA 4JDVA 4G8GB 4U2YA 1IGML 5EWIL 5F96H 5F89B 4RGNB 5GS2D 2DB8A 1OVZA 1UQSA 3MGOA 1I9JL 3HAEG 4Q9QH 1CFNA 5I1JH 1WISA 1QBML 1WWAX 3IRZA 4WUUA 2LTQB 2AP2A 1YEIH 4YUEH 1OCWH 3RDTD 4HXAH 3M17A 4CU8A 1I3RB 3QUXA 1NBVH 1BWMA 5IVXE 4J7RA 3PDGA 4PGBA 5CD3A 4WDIA 1CDGA 1FHGA 1AC0A 1MCQA 1FNEA 1TVDA 4JQXA 5KVEH 1UM4L 4NZDA 2R2EA 1DQLH 2NR6D 1AD9A 3NACH 2YMXL 1GZPB 3D18A 3QUKA 5H2BA 5IB4B 2FHBA 4JFFA 3GEWB 4H1LG 4EI6A 3CFKB 3VXUE 2P4AB 1NLDL 1AR1C 3F7PC 3WSQH 3QUYD 5B22A 2XZAH 3DRQB 2FJFB 3KPSE 3GSWB 1YN7B 2FX7L 4GMSH 3FN0L 1OL0A 4LSTH 4N0YH 4KDVA 1T1ZA 3MOAL 1RMFH 4LL9A 4IEFB 1OHQA 1T03H 1LE9A 1BAFH 2WUBH 2X70A 2ZSWA 3LDBC 3SGKC 3RWIB 4AL8L 3S88H 2OMBA 1RIHL 3BRFA 2H6PB 1XR9A 3CFEB 3U4BH 4Q6IB 3GMPA 5I66A 3KYMA 4GOSA 2A77L 3S5LG 2FECL 5BQ7A 3C8KA 1ZLVK 1QBLL 2CPCA 4AENA 4V2CB 2Y36L 2GY7B 4KROB 5T5FL 3TN0D 2YC1A 3F6IA 3LAFA 4HV8A 1ZXQA 1A9EB 2GCYB 4JRXA 5GGTL 5FHBH 3AB0B 4RRPA 3AXLA 3QDJA 4G8GE 3JUYA 3O6LL 5DDHA 3PJSA 5F1NB 4N8VB 4UNTA 3P73A 3UTPE 5E6IA 1DZBA 3C5ZA 3O2WH 4ESKA 2I24N 5E94B 1RIVL 2RAMA 4ODWA 2VISA 4G8IB 4PJEB 4OZIA 1P5UA 2Z35A 4DGIL 4LKCB 4QHMB 1LDPL 2YRPA 3EDEA 5I1DA 2ZCLL 3BT2L 3FB7B 4EN3A 4R90H 3JBG7 1EPFA 4CJ1A 4MAYB 5I1HL 5T1DL 4JR9H 3MZGB 1T1XB 1QOKA 1YEKH 2BNRA 2DWDB 3VWJB 5FUZH 3N1QC 5IHUL 4HW6A 5FCUH 4GRWB 3HC3H 2Z91B 3CUPB 4LVHB 2FGWH 5DJCA 3MJGX 4S1DD 1CFVL 4X6FB 1KJ2A 3GFUA 5I16B 1TPXC 1F4XH 4WO4D 2E9BA 4JFDE 1YUHB 4M48L 4M1DH 1HEZB 4U1MA 4X4XA 1NPUA 2AXFA 4L4VD 4P0DA 2EDQA 4NT6A 5CHNA 3MJ7B 1BZ9B 2EE2A 4KRNA 1IC5L 4L8BB 4WWKA 4EVNA 4S2SA 1UG9A 3C5SA 1N26A 4X9GA 4MXWL 3QHTC 4NN7B 4R26L 4WW2A 4NQXA 1NC2A 4MDIB 3TM6A 5FO8A 4P9HH 3T04D 3FRPA 3BJ91 5F7YC 2K9UA 2PXYD 1ETZA 5GS0H 1RUAL 4LSDA 4PLJD 4JPVL 1TZHB 3TA3B 5HYEA 4LBEB 5M94B 3BZEA 3KYKL 5BVJB 2EC9T 2PYFA 3HNSL 4YQXH 4LPYA 5J4MA 2J5LB 3QEUB 5E8EB 3WO4C 2VIRB 3GMOB 4QHNB 1KJMB 5DSCA 4R2GC 4H8WC 4W6YB 3VCLA 3OKNB 5HHNB 1JWUB 4KHTH 3DMMB 5IG7A 4LQ1A 4ENEC 4R3SA 1MCBA 3CFCH 1KNOA 3T2NH 4V2BA 25C8H 4OCSL 4Y16B 4JFQB 1MPAL 3BKJH 3GSRA 1YYLH 2XG4A 4PLOB 3VGEA 1WLHA 3BOVA 3F5WA 4MB4A 1KIPB 3L6FB 4C56D 4Z0XA 3LEYL 2EECA 2DKUA 2XICA 1OAUH 4GRWE 4NRYB 3MRPA 5DEGA 3VXRA 1U0QA 1UYWH 3ARGD 4U1GC 2VLJA 2CIIA 1ACYL 1AO7D 3LEVH 3KDMA 1FL3B 4YDJB 2H2PC 3KPOA 1F3JB 4YHIA 5D6CB 4HH9B 3CD4A 2EIZB 1WZ1H 1NCCH 3VI3E 1GOHA 1UWXH 4OV5B 1V3JA 3Q6FB 3RZCD 3MRLB 5C08B 1NGPH 3ARDC 4TVSa 3RNQA 5JOEA 5KVFH 2W0FA 2FCBA 3O4LD 3HZVA 1YY8B 4FOMA 3QDGA 4ZUUB 5D7LB 3LSOB 3T3PF 4IOIA 4M8VA 2B0SH 4NZUH 4OCRL 1JGVH 3TT3H 3LEXA 5IWLC 3DRTB 4TVPD 1PEWA 4Z76B 1ZHLA 1YC7A 2P5WD 5IFHL 4WI9A 3B9EA 4U1NA 3EFFB 2GT9B 4FFVC 1ZT1A 1H9VA 3GI8L 4YJZL 2CLRB 3U7WL 2XWTB 3DUUA 3U6RA 2NXZC 3T8XB 2FX8H 1NSNL 4ETYA 4YFEA 2A6KA 3SKOA 2Q1EA 2R2BA 2Y72A 1JF6A 3IDYB 1VHPA 4NJAH 1BOGA 4NM8L 3BESR 3IFOA 4MZ3A 4RA0C 3ULUC 1M71B 3IU4L 4TVPL 4PS4H 4QGYA 4G6FB 3QUZD 1BBDL 3QT2A 5KG9B 3DWTA 5FYJU 4I2XA 5FM8A 4WY7H 3L9RB 4GXVL 2KH2B 3D3VD 4YR6A 2WUCH 3SPVB 1EFQA 3LRGA 2BERA 2ADFL 5D1ZD 3GKWL 4GQ9H 4P9MH 3KNBB 1VFAA 3IVKA 5GRZA 4JANB 1JI2A 4P4KD 1IEBA 2B1HL 4G8EA 4LHQB 3NPZB 4APQA 2O61B 5DHVH 3G6JB 3T0EC 2P8PA 2RR3A 4IBLT 4FQQB 4OAWA 1KJ3H 1NGYB 2Y5EA 1LDSA 4TPRH 2G5BA 3KS0J 4U2ZA 3SDXA 4KI1A 1G7PB 5C08E 2PCPB 1QVOA 1HI6A 3C60A 3WMSA 1UM6L 4LCWA 5DJ8A 1DQQA 3OKMB 3NCEB 5ANMA 4U1LA 3K2MC 2GJ6A 4XP4H 3V6BR 2HFFB 3O6FB 2FX9H 2IEPA 4PUBH 4XNMB 4BQ8A 2LVEA 3P4OB 3QWQB 1K5NB 4XCNB 4LPCA 4TSCH 5CJXC 2MHAA 4PREB 4EIGB 2LU3A 1CGUA 2VDMH 1YEFH 1CICA 4Z7OF 1DBMH 3T77A 4OZFB 3NVQA 4QRPA 4Y4HA 1NDMB 3VDAA 3HE6C 5MI0C 3O45B 5FA4B 1S7UA 3MV9A 1S9XA 4LSRL 1XF5B 5BVPH 1I1YB 3LOWA 5K9KA 1T0NA 5BRZA 2JJUA 3PV6B 1KCUL 3P4MA 4Y4KD 4MA7H 5B8CC 2IBBA 4ZOCA 4ODTH 4QOKB 4QRRA 2XPGA 3MODH 4XXDB 3D39A 4C83A 3T1FA 1DDHB 4KV5F 3CPLB 2DQDH 2AEPH 4G6AD 3MV8A 5GGUA 3FB6B 1G7JB 1IQWH 4IIQB 4KRPC 1DBKH 4WFEE 3W0WD 4RWHA 4PGEA 4PJ8B 3TZVC 3RVVD 2ERJB 5F44A 5TF1L 2LAAA 1NGZA 2MJWA 3G9AB 3OAYK 4ZTPL 4Z7VE 1JFQH 2BVQA 3O3BB 3EJZD 3G6JE 5HVFB 1R5VB 2Y9RT 4LSPL 2Q6WA 4FRWA 1WT5C 4LLQA 1RK1A 4WFHE 1J1PH 3UYOD 1TZIB 3L5WA 5EA0H 5JW4M 3DIFA 3BEWA 4BZYA 4JM4H 3P0YH 3ALWA 2DJUA 1UCBL 2VZUA 1LEGA 3IF1B 1D5IL 3BZFA 3ARFB 4F8QA 3CDYA 4XXCA 3L5HA 4ZNCD 1MIMH 3OZ9L 1S8DA 2QHLA 4L1HA 4V1DA 4HSQA 5IP4A 12E8L 2OR7A 4PRPA 4ZMAT 3GIZL 4Y5YC 3TFKD 5D1XD 2W38A 3TWCL 4JRWA 3JWDH 1LO5B 1KEGL 1AQDA 3OR7B 3MLPA 1UADC 3V0WL 1HYRC 2HTKD 1INQA 4UV4L 5DWUH 5FOJA 3TPKA 1IGJA 1OAQH 3MCLH 5DT1H 5M95B 2FEEL 5F3BA 4G80A 1XF2A 5D7KE 4M5ZH 1AD0B 1FZJA 5I8CA 3MNVB 1G9NC 4QOKE 5IKCB 2FR4A 1A7OH 3QXAB 1MREL 4OD3H 3F8UB 3WO3B 1SEQH 5C2BL 4U1HA 1MCOL 5D5MA 5H8DA 4W6WB 1MFEL 2X1PA 1U8OA 3QB7C 4ZS6C 4O5LH 5JW4N 3RVTD 4JFEA 2P8LA 3MBEA 4YBLC 3PP3K 1A1NA 2X5PA 5HI3C 3RDTB 2FJHA 5FKPB 1VESA 2R1YB 5K9QI 5L88L 4ZG1A 1WEJL 3QEGL 4R9HA 1KCSH 3O9WC 2NY7L 1X7QB 2XZCL 1R3IL 2DQCH 4YDVB 5F1IA 3T3ME 4X5XB 5GRVK 2VQ1A 2BVTA 5HYSG 2X4PA 3MTRA 2AK4E 1NLBH 4XH2B 4BJLA 4HJGB 3OJVC 1DL7L 4LRNL 5SWQA 2GTZA 2NY2B 3NCFB 4ZPTB 2LV4A 5D2NC 3ABZA 2OJEB 1TQCB 3PP4H 3B5TA 3EKCA 3RL1A 4JEGB 1A2YB 2GK2A 1U8IA 2VXVL 3H8NA 3CFJB 3P0GB 3WL9B 3V6FA 5DGRA 1HSBB 1FL5A 1ZLUK 5JHDA 8FABA 4LF3A 4CBPA 4G9FA 1FV1A 2VLME 1IAOB 2P1YA 4NQEA 3S4SA 1F4YL 3S98A 1CR9H 1V7NL 1BBJA 1GIGL 1T5XB 2DLGA 3DXAE 1U3ZA 1AP2B 4FXKB 4JO4H 1U92B 2NNAB 3NBNA 3TN0B 1AGBA 4WI4A 4OB5H 3KPRE 4LSUH 5C0CD 1GYAA 4JFHD 3WXWH 4UDTA 4WV1C 1IGIH 2BHUA 5LBSH 1CFQB 3D69B 4JQIL 3ME0A 1CD1B 4W4OC 3ZDYE 1RZJC 5DK2B 1R6VA 1U91A 1UFUA 4PRHA 5JORA 1NCDL 2JK5A 5T3XD 2V2XA 1BIHA 2F74A 2OS7A 1X5LA 2VB5A 3MXWH 3RWCB 3K2UH 4S1RL 1U8PB 4CN1A 3QA3A 2GTWA 1AQKH 2MCPH 4OF8A 3U9PH 4UUJA 3GZKA 4AEIL 3IXTA 5JIKA 3EYOB 1JNNH 5JQHC 1HKFA 4XCFL 2MPAL 2XNAA 4AT6A 3BH8B 4P5KA 4PB0L 4M1CD 4OFPA 3S37L 5CEXA 2DTMH 4JB9L 4TTDC 5T3XL 5I30L 2V2TB 5ICZA 4PJBA 1S5IL 1QACA 4N5UA 2VXUH 3FRUA 3MRNB 1X5KA 1HQRB 5EU7C 2ZWLT 2DKSA 1J11A 5E2WL 4K2UH 3U1SL 4M7LL 4NN5B 4L3CA 3EYUL 2ATPA 1Q38A 4RISH 4CVZB 2YUVA 4L3EA 4NOFA 1LWRA 2BSTA 1WBZB 4L4JA 4IRSB 4P5TC 2ICWB 1Q9WB 3I75B 4WU7A 5D70L 1ZAGA 1OP3K 3WN5B 2VDNH 4ZAKB 4HLZH 1E28B 4HBCL 3FQNA 3HR5A 3HFML 3F7YA 2P42B 4M02A 1ONQA 2VR9A 5DQJA 2QSVA 2BSSA 5FGBA 1MRFH 1CFSA 5IHBA 1FN4B 3FQUA 4WCYL 5HYSB 4KMTH 2JIXD 1YDPB 2O5XL 3V6OC 5EUOF 1HHJA 4JY5H 1KIRB 4Y4FA 5DJXB 1J88A 3RNKB 1JHKL 5EIIA 3RWFA 2ICEB 4KHXH 4Y19D 1Z9OA 3U2SB 1ND0A 4W68A 1V3MA 4IMLB 5HYJB 3NFSH 3X17A 4GW5B 4RMTA 4LAJH 1OW0C 1GGCL 1T7YA 4JFXB 2VZSA 1FSKB 1I8IB 4IRJB 5LXGH 3Q6GL 3CLEH 3WHXA 5BJTA 3ARGB 1QSVA 1AO7B 3BYTA 4EI5A 4LDOB 4PP2B 4S1SH 3EOTH 4ODHL 3DO7A 2CDFB 1T89A 4KXZI 3V6ZA 3X12B 2CLVB 2GK0B 3RZCB 5EU6A 4MD5A 3TIDA 2IG2L 2OQJA 2VZ3A 4ZOEA 5IVNA 4ZXBC 4G7YH 1FE8L 3STZA 5I1AA 4HFUH 4ZTOH 2DLTA 2OM5A 1ED3A 4QT5B 4ELMF 4TNVK 5HHPB 4PJGF 4D9RD 1IT9H 3CH1B 3MX0A 1KJ2H 2EDYA 3BX7C 2H41A 3TBYA 2BOBA 5I1CH 3LPFA 2J1KA 5C0AA 1X44A 3IDXH 4HXBL 5CD5D 4QRTA 1BX2A 1EMTH 1DLFL 1OTTC 1DVFC 3O41A 3ARBA 4C54A 3IDGA 4UDUB 4Q58C 3T2OA 5I1EL 4QXUL 2DDQH 4JFZL 2CGRL 2RGSA 4YDIH 3V7AG 1KTRL 2W60B 5GISH 2BXZA 1E6JH 1S7QB 4O58L 3SO3B 1MLBA 3DURA 3KLDA 5F3HB 3MOBL 4P3WA 5GGVH 4R2GD 1X5FA 2OSLA 5TDPB 4OJFL 2QQLH 4DQOL 2ZNXA 4LK4A 1C12B 1UJTA 4I4WB 4ENED 2N4IA 2XY2A 4D0BB 4PJDA 5CEZD 3D3VB 4JZNA 3RTQB 1QO3A 2OR9L 1JGEB 3B9KC 3MLUH 1WCQA 5A2LH 4C56E 5D1ZB 2R56L 3S3PA 4NC0B 3FFCB 5IEKB 1I7RA 1MAMH 1FYHB 5TDOA 2X4NB 3QNXB 4PJHF 5D1QC 4PR5A 5ECJE 3AY4A 1TDQA 2HKHH 1AO7E 4DK6A 1HNFA 4NO0B 2NX5B 1XF3A 2VDOL 2E8ZA 5CP7B 4GXUM 4H8WL 1JNJA 4GAGH 4P59H 2H2PD 2AJSH 3CSYB 2FL5B 1N6VA 1U6AL 1J05B 1IAII 4O02H 3O4LE 4Z5RA 1P6AB 1U8KA 5CEZL 1FO0A 1HKLL 1XGTB 5IQ9B 1NDGB 1UGNA 1RZKC 4FS0A 2GUOA 3RGVD 5C70A 2Y7QB 4BSJA 1IM9D 5TPWH 4TVPE 5DFVC 4D0DB 1K3IA 3ESVF 1VDGA 4EEEA 3DPBA 5GZND 3ULUF 1TENA 2FSEA 1RHHB 5E8OB 2F5AL 3MA9L 1NMAH 4LEOA 3PXJA 3M8OH 3KHQA 3IJYB 3N85L 2EZ0C 1U8JA 4D3CL 4FFVD