1PD6A

The nmr structure of domain c2 of human cardiac myosin binding protein c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
DEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dissecting the N-terminal myosin binding site of human cardiac myosin-binding protein C. Structure and myosin binding of domain C2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Myosin-binding protein C, cardiac-type, Domain C2
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pd6A00
2P48B 1A6ZA 3K81A 5DYOA 4S0SD 1YJDH 3PL6D 1N6UA 2ICES 1ZVYA 1YECH 3PNWA 2LFGA 1YMMA 5AZEL 1GZQB 3B4NA 2P49B 5IHZA 1A4JA 5KOMC 5C0BE 4Z7VA 5JHDA 3Q6GH 4OBSA 4RMVA 4JB9L 4LKXA 1LEGA 3H0TA 3MV8A 4WGWB 2CO6B 5L2JA 4XP4H 2A83B 4PREA 4I48B 1KPUB 3A67L 4JY5H 2IFGA 3BH9B 3PHOB 4ZXBD 1CDIA 5GS2H 4ZO6A 4HH9A 4DTGH 1RFDL 1NDMB 4OCYH 4XPFL 1OAXH 3IRPX 2XKUA 3KLHC 1U8HA 3JV6B 2V2WB 2E9IA 4ONFL 3MRJB 3E6FB 1F3DH 1NBZA 3WE6A 1KT2A 2A2QT 1SYVB 1XF4A 2WBKA 5AG8A 4POZD 3T8XA 3AB0C 4OF6A 4K3JH 5EOQL 3TV3H 1F4WL 4GAJL 1DVFA 2V2WA 1HWGB 4PRIB 1ND0A 1A6WH 1JGEA 2SEBA 4M7KL 4WFED 5I18H 3UTOA 3UMTA 3X13A 1QLRA 5CFHA 4FQJH 4EI5C 1C08B 4JZOA 3UTTE 1P69B 1UB5B 4OFYD 3RVTC 1DUZA 1OAKL 3QDMB 8FABA 2PCPA 3U9PL 3AS2A 4MCYA 4HG4K 2DQDL 4JO3H 4LVNB 1J05B 2A6IA 2E27L 4D2NA 4AIXA 3FO1A 5L88H 5IFJB 1JV5A 4XNUH 3SJVE 3CUPB 5B4MD 4O4YH 4MJIB 3UCRA 3W11D 4PRPB 4GAFB 3FRPA 3MRQA 3EDEA 3UTPE 1FVDB 3QG7L 2DM7A 1T04B 2E8YA 2P8LB 2X4SB 4F7EA 3N1MC 2X4OA 1OGAD 4RGNE 5F7EH 5D7IE 2W91A 5F9OL 4C54A 3SO3C 4NQCB 5C0GA 1EO8L 2J8OA 4R96A 1A3RL 1NDGB 4WFHD 4XBGA 3MJ7B 1EH9A 4I8DA 3EUUA 5DD0L 4Z6AT 3QNYA 3V6OC 4GO6B 4YHYC 2H3NA 5DQ9A 2ICEA 3C60B 1DBML 5F72S 5HJ3B 3U9UB 1F6AB 3HC4L 4XBGB 2R0KL 3MJ9A 5F7KC 5I16B 2W0PA 2J8UF 3QNYB 2VUOA 2EKJA 2ADJA 5FECB 3MO1B 3RWCB 5A2FA 3EO9H 3P77A 5E99L 4HIJB 4YDJA 4R2GB 3ZE2F 3H3KA 1HHJB 3OJDB 4XXDA 3MFFA 4G8GE 1ZV5A 1AO7B 4J1UA 1J8HA 4G6KH 4NRYA 4LSRH 3V6OA 4OZ4B 4OTXH 3QCUL 1AGFB 2HRLA 2Z93A 3QI9D 2VE6B 3WKNA 4OCNC 5T1DH 4H5SB 4IJ3C 1GCFA 4RFEB 4I2XE 3H9ZA 1AGEB 2X6MA 1UM5H 2DOCA 3MV9D 5CZVH 1S7QA 4F8QA 5E1AB 4PBVC 4YHZL 2V5RA 4MQ7A 4QRPA 3VFMA 4KQ3H 1H0DB 3O0RH 3TCLB 3D0VA 4XX1E 3QUYD 2E3VA 2Q7YA 3CX5J 3BISA 1YMMD 3FT3A 2ICCA 4P9HL 4BZ2L 4JQIL 1S78C 1S9KC 4UTBL 4Y19E 3NFNB 4KFZC 4JDTH 4WJ5B 2LV4A 4P5TA 3VWJD 4PV8A 2EXWC 4U1KB 2BRRL 4M7JH 5DMKB 2DQHH 3DYPA 3G08A 1KXQE 2H6PB 4PP2A 3B5GA 3C2SA 5D7JC 1DE4B 5DEGB 4P2OA 5FGCE 5DGRA 3PWPE 2VQTA 4NFBA 1KIPA 3ABZA 3NZ8A 4JZJA 3U9PH 1DUYB 2Y07H 4KU1A 1R3JA 5B21A 2FIKB 4I18B 3U4EA 1NAMB 5HPMA 1EA9C 1ZA3B 4LHUG 2F19H 4WNQA 5ADPL 3BQUB 3G5XB 2XA8H 3UC0H 4IRJB 4Z8FL 4F9LA 3GMPB 1NAMH 3BZEA 4G6AC 3CC5B 4LCUA 4PJ9D 3IVKB 5FDYA 1IGJB 2HT3D 5IF0A 2YSSB 3C8HA 4D0CB 5ALCH 5D1QB 5GHWH 4U1LB 2CKBB 1D9KA 5BZDA 5I19H 5SX5K 3BPCB 2Q8BH 4LFHD 2VDPH 4F15B 4R7DA 1XGPA 4X6BB 1G6RA 5HHMD 2Y5TB 3FKUS 3WIHA 2GSIB 1J0IA 1HOCA 5FEBA 3Q6GL 5ABDE 5J11C 5DJAA 3PWPD 1NGPL 5JIIA 1M7DA 5EFIB 1G6RB 1YEKH 1K4DA 3LKQB 1V8HA 1A0QL 2GEEA 4AJ0A 1Q94B 1YJDL 1HOCB 2OQJB 2MMXA 4P59H 2MPAH 1G6VK 4JFPA 1TZHB 4PS4H 4HF5L 3KYOA 5TQ2H 3WEXA 1CI5A 1MF2H 1EV2E 1CL7L 4K3EL 1RZJH 4JJ5B 3UPCA 1SJXA 4X7SL 5BRZD 5TE7H 3RVXC 3OHXB 3HG1B 4NZUH 3S9DB 4HV8B 5DT1H 4WEBH 3VRIB 1AXIB 2P45B 1G7IB 4H0GA 4RIRB 1LO5B 5IW6B 1DZBA 3VFPA 1CFQA 3K4DA 3ARRA 1R5WA 4C56E 1R0AL 5FF6A 4S2SA 1WCQA 4G43A 3X12B 4HWEL 4NQDA 4YHPA 2PXYA 4OM0L 3AAZB 1FN4A 5LGHH 4XGZB 5J89A 5DMGD 2R2EA 3BZ4B 5FF6B 1IGCL 3SGJA 2WIIB 4NKMB 3OXRA 3SBWA 3IB4A 1ZHNB 3UX9B 1KFAH 3AAZA 1UCTA 2BMKA 1V3KA 3TO4C 3VI4E 3L6FA 1NUGA 1RJCA 1PVHA 1RVFL 4HLZG 4NKMA 3OB0H 3OXRB 43CAA 3DXAA 4Y5YA 4M1DL 1O0VA 1PG7H 3KPOA 3PDOA 3IDYB 1QOKA 4PRBA 43CAB 1WF5A 3GSRB 3PABA 4JN2A 2LVCA 4RBPK 2HT4D 3V4UH 5IP4A 4MVBD 2EYRA 3O2DL 2GY7B 1DBJL 1YPZE 3PL6B 3QUXA 2H26B 4QOKD 2EICA 5I2IA 1F4YH 3KPSB 4YK4C 2Z8SA 5EZLA 4PJEA 5C0CB 3ULVC 2HMID 4ERSL 1DBJH 1YPZF 4EKXA 5IFHL 5JLZB 1RZIA 3BJLA 3I75B 4XRCB 1MFEL 2GI7A 2IANE 1V05A 4PLOB 5MI0C 3GIVB 5IMLB 5MEQB 1AFVH 3RDTD 1BVLB 3GKWH 4U6TA 1OPGH 1FNEB 3GIZL 4WW2C 3AREC 1HH9A 5IW1A 2EKSA 4M1DH 5I1AB 3FO9A 2AAVA 2VLRD 3L5WA 3CX5K 3NPZB 4NT6B 4MD4A 4YZFF 1GC1H 1GYAA 1W72H 4KXZI 4MXQC 5H2BB 5L8LB 1C5BH 4Q74A 3WUWG 1RUQH 3ECBA 4FXGB 5CS7A 5I1AA 4RFNB 2DQFA 5D71L 4LQFL 3QI9A 2P5WB 2DWEA 4O2CA 4RAUA 3TFKC 5DRXB 2BNQA 4QYOA 3B9KD 1SY6A 2WSKA 4LDEB 4QNPE 1UH4A 3OKKB 3QIWD 5E2JA 1WTLA 5E8DH 2W0KA 2ZUWA 3CVHB 4Y4FA 3HUJE 3QDHA 1QSFD 4GRWE 5CP7B 3MNZA 1BD2A 1GHFH 3MV7B 5T5NF 3PIQA 4QLRA 1LK2A 2FR4B 1A1NB 2VAAB 3HZKA 3SQOH 4OGAD 1H5BC 4I0PA 3FRUB 3MLXL 2IADA 3LRSA 3IFLL 1TVBB 2R15A 4WI4A 3RL1B 3RWDB 4RGMB 1MWAA 5FO7B 2MPAL 1ORQB 5TF0A 4GMTH 4N8CH 4XMPH 3EDKA 3NCJL 3UYRH 1LNUA 2IBGA 3UDWC 3BX7C 5F1KC 3SCMA 2G2RA 5HGHB 1EMTL 2FSEB 3T0WA 4L4VA 1DBBL 3WFHA 4Z7UE 3FB5A 4UNVA 3ET9F 2G2RB 3N85H 4L4TA 1U8QB 4AH2A 5DD1H 4GW4B 4ZNEA 4NQDD 2V17H 4XB7A 1NUNB 4Y5VC 2Q76A 2XXCB 2NW2B 3D25A 2MTPA 3UTSE 3VXPB 4W81A 1BQLL 3V52L 4PJ9A 3KWWB 3NN8A 3IFPA 5GRUH 4PYGA 1OD7A 1K5NB 4OKDA 4HH9B 3ULVH 3MODH 2Z35A 5E2WL 3GSXB 4QKXB 2R9HC 4JFOB 1JNLH 1DFBH 3KHOA 4OAWB 3DV6B 5IG7A 4U0QB 1E28A 1NBVL 3DV4A 5EBGA 3HNVL 1FPTL 1KCUL 1NFIB 5E6ID 4IHOA 1L7TL 4PIRF 2Q1EA 1MLBB 3QDGA 2N7AA 3QPQC 4PJ9C 4DGIL 2BRRH 4M7JL 5L6YH 4F7MB 1JPTH 4K3DL 1G9NH 4ZUTA 1T89C 1MQKH 2NXYB 4L9LA 1L9MA 3QEQD 3NIGF 2DTSA 4MJIA 1CLCA 5CSBA 4KY1H 1KSRA 1RZ8B 1HQ4B 4RBPH 3RKDD 3BEWA 4U1SB 2ENSA 3NGBC 4ZFOB 4JY6A 4Z7QF 3WFZA 4J3VA 1I8MA 3G9AB 5E2UH 1MCFA 4PGDA 1S3KL 3IKCB 5F8QC 1Q0XH 1MVFA 2NY1B 5INCA 4PY8I 2R0LL 1MIML 5T1KA 4NZRH 3MJ7A 4ZUVA 3O6KL 5DQDH 5HGAA 4AMKH 4LKCA 4MA1B 1NFDF 1FAIL 1QFWI 3GB7A 2JJTA 5IB1A 4LVOB 2ADIB 1P2CA 5HYJB 3R1GH 4LCWA 3MRRA 5AWNL 2EDOA 1U95B 3MRBA 1XGQA 15C8H 1FH5H 4GBXA 3LH2H 4N0UE 4IRZL 3P0YL 2DMBA 2DJ4A 2F54E 5GGVH 3MRBB 3U46B 4KTEL 5ADOL 4OLYL 5ETUB 3RWIB 1NDMA 3DUSA 4LASL 1QBML 1QRNE 5MERA 1A1OB 2CKNA 2VE6A 3BXNB 3GJEA 5JOPD 3QUXD 4Y16C 3LPGA 2JCCB 4M93C 3T8XB 2FEDC 4PJFA 1BM3H 3E3QC 4X9HA 2EDYA 4H25B 1J9CT 1YYLL 3UZQA 3BQUD 5F7EL 4HXAL 2XV6B 4GFTB 5KOVC 4JPIB 1G7LA 4Z95L 2XOTA 4LP5A 4JFEA 4P4KB 4P57A 5CEYA 4D8PB 4NHUA 3D0VB 2R1YB 3U48A 2AK4B 5IESL 5IT2L 1EAPB 3L5XL 2HT4C 4MVBC 4D8PA 4KPHH 5IB5A 1NMAL 5F6HJ 2OM5A 5BS0A 1WISA 3GJFA 1ZLUH 2HMIC 3DETD 2EO1A 2VLRE 3PWNB 4LVHC 1EZVX 5E24E 4QHUA 4HIHA 1Z5LA 1T83C 4HK3N 1AKJA 1YUHB 2WAHA 1T04A 4J3XA 3NA9H 4M7KH 4QHLB 1V7ML 1BX2A 4HLJA 2CIKA 2YPKB 1W0VB 5JA9A 1CLOL 3ROLB 4X8JB 3ZDXE 4K3JL 4QHLA 2HWZH 4XVJL 1T1ZA 5EUOA 4OGYH 4GOSA 4ONFH 4F58L 3WFCH 1L7IL 3QJHA 4XPFH 4HJ0C 4OCYL 5CWSA 1F6AA 3O41A 1T22A 2F74A 4UDTB 3AROA 4V1DD 2X05A 3MRCB 1NCAL 1CIDA 5CILL 5HI3C 4PR5A 2UZYB 4XP4L 4OLWL 4TUKH 3WHXA 2CKBA 4JB9H 3QEQA 3RTQA 3A6OA 1PG7W 1AGBB 3BIKB 2AABH 4GW5B 4N0UA 5E6ZA 4JR9L 2JB5H 3ZZ1A 1NMBH 1N59A 2XWJB 3GGWA 4MCZB 4MAYA 4FQ2L 3QQ9C 2X9WA 3T0EC 3VWKA 1AE6H 4N0UB 1JF1A 4A2LA 1X6LA 2AK4D 5MEPA 3TN0A 2WWMD 4L4TD 1OOAA 1I9IH 3LIZL 2ILLA 1QKZH 3C9NB 4P46D 4MQ7B 4L3EA 5D72H 1A6VH 1H0DA 1HIMH 3JTTA 1Z9OA 5FHBL 1IC7L 3P73B 2CLZB 2DIAA 1KJ3H 4FFWC 1VPOL 4X6DF 4U1JB 2F58L 3Q6FA 1QACA 3TZVA 3RVWC 1EGJH 2GW5A 4NP4L 1QBAA 4JVPA 2E9WA 3LN5A 4YX2H 1S5HB 4QXTB 1QSED 2M2DA 4P9HC 1TCMA 1EX0A 3WFBH 4HUKB 5F88A 4H26B 4R90H 1BMGA 4XWGH 5C0AA 3S5LA 1VESA 1CG9A 2V6HA 1YMMB 3QP3A 5ESAB 5HHPA 3OX8A 2H9GB 2JIXA 4Z7WE 1A6AA 5I1IH 3QDMD 2DKMA 1KTDA 2PW2A 4LHUA 5EZIL 1JWSB 5D7KD 4FXKA 1MCNA 3LKRB 1MCQA 5C0AB 35C8L 4PREB 2GJ6A 4MJID 5EO0B 2M8XA 3H9SD 5IJKC 4MDJA 2YMXH 5DUML 3BWUC 2AK4E 4Z7OE 4MWFB 5IWLC 3HUJB 2UUDK 2BK8A 4JFFB 4OF0A 2VDNH 4G8IB 5C09E 3JBG7 5HHNA 1NAKH 2FBJH 1KJMB 4UIKL 4YLQT 4IMKA 1KACB 4QTIH 3EYFA 5KS9B 4ELKA 4GS7C 4C55A 3LB6C 4G80A 4QRSB 3STBA 1U8IB 2Q3ZA 3SEPA 3X13B 2YWZA 4JHZA 2HT2D 2FEEL 3EYFB 2ITCB 2LU7A 2IG2L 1TTFA 3L3HB 1LEKA 3IRZA 5IGXL 1ZTXH 3FMGL 4LCWD 3ULUC 3H9SB 1XF1A 5EFIA 2BY0A 3BGFB 2HKFL 3MRPA 5SWZE 4ZMAT 5SWQB 4IMLA 1MCJA 1VEMA 2CPCA 3U7WH 1DQLH 1ZE3C 2ED8A 1AI1H 1KUMA 3PGFL 2P42B 5ANMB 3WJJC 2AJSH 3DBXB 4K8RL 2M26A 1UVQA 1H3XA 1GH7A 2F5BH 2APVA 1NLBL 3VMOA 1GOHA 3DUUB 4XCEA 4BZ1L 4K2UH 1MEXL 5HVFB 5CIPH 4KZDL 4P23C 5AYUH 4FQCL 1FNHA 1I9JH 4JFXB 2K7PA 1G7IA 4UV7H 2BC4B 2OCFD 4KHTH 1R5WB 4G9FE 1PBYA 2DJSA 3RTQD 1SVCP 3ES6B 4CJ1A 1WBXB 4FZ8H 3WNMA 2VC2L 5JIHA 2B4CC 3ARDC 1WWBX 2V7NA 4TVPE 1K6QL 2QSCL 1MY5A 3ZTJG 2R2EB 1ZSDB 2IEPA 2QEJA 1MFCL 1WIOA 5EU4A 3AB0B 3MO1A 3RWCA 2W9EH 1JMXA 3SE9H 4LKXB 2IQAA 5D7IF 2AEPL 5DJDA 4NFCA 1FGVH 4MLIA 1N64H 1FDLH 3QXUA 1BWWA 3GI9L 3P40A 3NAAL 4FRWA 3F58L 2X89D 1CQKA 5JW3H 3ROOA 3DX8A 4MX7A 3UZVB 4X4YA 1HYSC 2MNUA 1F00I 4HWBA 2FL5B 3D85A 1BBDL 1MCIA 1Y6KR 4DFIA 4KKNA 1FJ1A 4PB9L 3ZDZF 5TJWK 5EZJA 1CYGA 5J9PB 1TZGH 5TF1H 5HDBE 5CD5D 1FZMB 2P24B 5DZNA 1ZHKA 4LPTA 5HYSB 2IANA 5E9DB 4LLUA 3SHSA 4G6ML 4JDVB 4U6VL 5BV7L 1LD9B 4RGND 3MV8D 2XNAB 4YDKL 4DK6A 1XF3B 4V1DA 1E4KA 4NBXB 4O9HH 4PD4K 1XIWD 2JIXD 3MV01 1BVLA 2DQEL 2E7LC 3N1FC 3SDCB 1SVZA 5DWUL 4BKLB 3I3DA 1G84A 1KN2H 5KVFL 1JV5B 2HLAA 1UCBL 5B3JF 2VABB 3Q1SH 2ESVE 4JFOA 4RMSA 2G60L 3V8OA 5JPNB 4PRPA 5DJYA 1KCRH 2NY1D 1BJ1J 1DBKL 3HE7D 3NCFB 4M4RA 4XC3H 5D6CA 5GJTL 1RIHL 4NQEB 3DXAE 1RIUH 5F89A 3RQ3A 4O58H 1D6EB 4Y4HC 2AQ3A 2QQNH 4HPOH 4M6NL 4J3UA 5HPMB 2OK0H 4OLXH 3S5LG 2CK0L 1J8HD 1PQZB 4O51A 3ZKMD 4JQVC 1HXMA 3FQXA 1DEEB 1FL5B 1IAKB 1MLCB 4CADA 1PFCA 3DMMA 3PV7A 3BJ91 2YD9A 3PP4L 4QRTA 1CDYA 1QLEL 5KZCB 3B6SB 1RSFA 3DGCR 4QRPD 5T3ZH 4YJZL 3N9GL 1VHPA 1EEQA 3RL1A 2A9ML 3AU1A 4HWUA 4DGYH 1Z0MA 5LGJA 3GSUA 1MWAB 5FO7A 1FZOB 3HI1B 3WSQL 1OF2B 1BHGA 5IFAH 1ZAGA 1NJ9A 4MDIB 5IHZB 3ARFA 2CLVB 2NY2B 5LGJB 1AGFA 3ARZA 5IB3B 3IDYC 4HKBA 5C07B 1T7VA 2VN7A 1QSZA 2DQGH 1WBZA 2E7MA 1QD0A 5D7SH 5ILTH 5HYJA 1RK0A 1G6RH 1QQDB 3ARFB 4QRUB 3QIBA 2W07A 3MRRB 2BY3A 2B2XH 1HSBA 4HG4J 1TZHA 3U7YH 4PY8J 3T0VA 3W9EB 4KJQC 3L3JB 1UADC 4HC1H 3ZE2E 1QLEH 3E6HB 5CZXD 1SYVA 1XF4B 1IMHC 4PLJC 1GJIA 2EC9T 1J1XL 3L3JA 1FL3B 1REIA 3UJJL 3FT4A 1FSKB 4S1RL 2Q87A 3VFUB 1J0HA 5CKGA 1BAFL 4K94H 1FNSL 1IFHH 1Q9OA 4IRJC 4KKAC 1OLLA 2MQ0A 5MHSE 1G7MA 5JUEL 1FAKT 4WFEE 3A0OA 4LLVB 1C08A 2MQCA 4JZOB 3FT4B 2X89A 5JDSB 3UBXG 2KPNA 1CGVA 2BHUA 3H7LA 4FQIL 3O6FA 3KPMB 4XC3L 2ADGA 3M07A 1ZA3A 1KCRL 3WBDA 5C09B 4TSAH 1N2RB 4IIQC 3BAEH 4YPGB 1JI1A 2Z92A 4WNQB 2XI9A 4YEEA 3DXAB 4Y5YB 5IB5B 4IRJA 1T0PB 1OB1A 3FQWA 5KANI 3OMZA 4QRRB 4F37F 5HGBB 3OG4B 1Z5LB 1JPSL 5EORH 4YDKH 4JQXA 4UQ2A 1EGJA 5GS2D 1KCLA 43C9A 3R06B 1MH5B 1MHCB 2HJFA 3D2UD 5SWZB 4QRRA 1K9TA 1R24A 5TF1L 3VFWA 5TDNB 4B53A 4MSWA 5DK0B 1UA6L 4IIQA 4LAQL 4WW1B 1RUMH 2X4PA 1DSFH 3SKMA 5IVNA 4KQ4H 2QHRL 4TUOA 2IC2A 3SKNB 5D7LE 4M7ZC 4G7VH 4X6EB 4G42B 1KIQB 1S78D 5FYLD 4OIIH 3FN3A 4LU5L 1AGCA 2VLKB 1EHLL 2Q86A 5JW3L 3NABH 4Q97A 2A77L 4G5ZH 1XF2A 4PR5B 1X5HA 2C7UA 3LEVH 4AYFA 3V6OE 3D69A 1OCWL 3RTQB 3KYMB 3CIQA 4EDXA 1P7KB 5D8JL 1AGBA 2E7BA 2CDEA 1H8NA 1LWRA 1RUAL 2IBZX 4RMRA 3VA6A 5KTEL 2N56A 2IBZY 1NGZB 3IU4L 3QEQE 4NQXA 4RDQG 3IAPA 5E7FA 4APQA 4J4PC 1K6QH 2IBBA 3U2SB 1IAOB 4ZPTA 4J6RL 4XNYH 1S5IL 5MENB 2YPLD 2R39A 2OLDA 4PJ7E 4WCYH 3IAGC 1JJUA 5BXFB 4JY4A 3GBMH 3H3BC 2ATKA 1ERNA 3TCLA 2D7TH 2ZUVA 5F9WC 1IGML 3MUGA 4WU5A 3VFNA 1OP3K 4YQXH 2YKLL 1IM3B 2G75A 4IS6A 2RB8A 3DGGB 5LBSH 4QXGL 2NLJA 1JF5A 7FABH 2MCPH 4UT9L 4HUUA 1P9MA 4X7FC 4X7TA 2DMKA 4PGCB 4OFKA 4OZHE 4J3SA 5D2NA 3CMGA 4YAQB 4WUUA 1TTUA 1GGBH 3HE7A 1MJ7H 4QHUB 4CN4A 2PN5A 3EJZC 4PBXA 4PJXB 2VLRA 3MC0A 1J87A 1QLFB 5IBTL 4KMTL 5D2NB 5I6XB 4Q9QH 2O5YL 1TJHH 1KCSL 1YEDA 2X4UB 4PRID 1BQHB 4QTIL 3TVMB 1KNOB 1SBSH 3Q5TA 1NAKL 4GW4A 4XRCA 3M45A 5J4MA 5DMYA 4HSQA 3QIUB 3WO4B 4WIQA 5B39G 1Y6MR 1JGDA 4ZO9A 4HT1L 3CVIL 1EJOH 3UPRA 1WFTA 4K23L 1CFTA 3CK0L 5GJSH 2Z35B 5D1QD 2YK1H 1QG3A 4I9WD 1PYWB 3WLBA 3OV6A 4URTB 5DMGC 2E6QA 4PB0H 4N5ED 4I0PD 5EBMB 1I1CA 3JTSA 3G5YB 3H3PH 4XWOD 1UJ3C 1INDH 1HINL 2CJUH 2JCCF 1JWMB 2J1KA 3BDYH 1JNHB 5EBLA 1OGTB 2JCCE 4LSTL 3QIBD 1NBQA 5EWIH 2VJXA 4OI8A 2VDMH 4M5YH 1D6VL 1MAJA 1NCUA 4JM2C 4LK4A 3SCMD 1KYOK 4BK5A 4LHQB 3OKYA 1E6JL 5FIEA 1RZ8A 4LSSL 4Y19B 3JV0A 2DLIA 5GRVL 3VFPB 4DZBA 5D72L 1RMFH 1HKFA 4S2SB 2DBLL 1KJ2B 1W0WA 4JY6B 3QDJD 1UKTA 3HI5L 1AO7D 1KF9B 2ZZUT 5I1GL 1TQBB 5JR1L 4WTWA 5E8NB 1M05B 1Y18A 4PTTB 5HHOD 5HHXH 2ARJB 2DL2A 1BGXL 2JB6B 3EYOA 3WV0A 3LKSA 5DLML 4YHYB 4MJIE 3QIWA 5FXCH 1VCAA 2X1OA 5HGAB 5EU7C 2YPVH 3MV9B 3U7AA 3MV8B 6FABL 4OZHB 1MI5D 4JFQB 2AABL 3LCYA 5FYKL 4POUB 2DYPA 3EYOB 4I18C 2MJWA 1EHNA 1ZLSH 5J6HA 2ENYA 1FNGA 5LCVL 4FXKB 3EO1B 5E8OA 1IEAA 5CUSL 5E2TH 4AQ1B 4KKAD 5C0ND 4U1MA 2PR4H 4M3KB 4PY7A 3O3DB 4G9DB 3H9HB 1FNGB 4PJ9B 4MDJB 3EFFA 2W38A 5SWSE 3F6LA 3DUSB 3WNKA 2CKBL 4E42A 5ALBH 4LRIA 1JGUL 3CXHJ 5EZLB 3H9HA 4QRRD 1DN2A 3PGCB 2PYED 1A9BB 5GIRB 1RZIB 3I75A 3QQ3B 5F3HB 3QFDA 2HRPL 4LSQL 3QULA 2OI9C 3MA9H 3K8LA 4FZEL 4ALAL 3BP5A 1QBLL 3W39A 8FABB 1YQ2A 1RIVH 2PCPB 1UM6H 4ODWA 4Y1AE 3ZDYF 3EJJX 1KTKE 2VH5H 1DQQA 2YWYA 1R3HA 4JREB 3ALPA 2BVQB 3CFKA 3SE3C 4E41D 1HHHA 1G7HA 4NWTL 4LRIC 3MRQB 1NEZG 1OP5H 5HYJE 2V9RA 3BPOB 1Q9WA 4S10A 4X7DC 1UVQB 2OSLA 5IT2H 2BCKA 4KUZL 4JRYA 3GBNL 1Q9WB 1FFQA 1MRFH 4I5BA 3DUUA 1IT9L 1M7IB 3LHPL 4NQEA 4HZLA 5TE4L 4Y0GA 3S35L 1KJVA 4FNLH 1RY7B 3L95A 3CVHA 3HRPA 4JFXA 2UV3A 3T4YA 3BKYH 1P7QA 1QRNB 4RWYH 1CICD 1BM3L 5IEKA 1T1YB 2KH2B 4L9DA 3SBWC 3KYKH 3C5ZB 4NYLB 4ZUSB 2C3HA 2XTLA 4QCIA 4S1DD 4GQ9H 3QJHB 1MLCA 1J86A 2E7HA 2WBWB 3HUJF 1T22B 4HIJA 3QJFA 2IMNA 4XXDB 1FCCA 4IRSD 2UVFA 1NCCH 4RZCA 4HEME 4JFED 4WUKH 3WHXB 4D0DB 2J88L 4YR6B 5DHVH 3N1GC 4OBRA 4UU9A 3VFOA 3BZDA 2VNCA 3R1GL 4RZCB 4HIXH 3ROOB 2XWBA 1TCRB 1BECA 4TVPL 4G3YH 4LPCA 2FL5A 3KPSE 2AI0H 1YJDC 1N5YL 4Z7WB 5EC1B 2M1KA 4XP6L 5I8CA 3O4LB 1MIMH 2R0LH 3BWAA 3V0AC 3BHBB 1II4E 4HMEA 1IGFL 1PJ9A 1XR9A 1S3KH 3BH8B 3JWDC 2NW2A 1CDBA 1HSBB 1G7QB 3WDJA 4WFFD 5HTSA 1OW0A 1IQDB 3KXFD 3BHBA 1BZ7A 4JFEB 4LLUB 4P4KA 4XI5C 3AREA 3WFEH 4MB5A 2VMFA 2QL1A 1I1YB 3QG6A 3U82B 4PJEE 4DUXA 2I5YH 3PP3K 2CLZA 3IDXL 2YD2A 3P73A 1MCOL 2VISA 3RWHB 3IAQA 3G08B 4UINH 4KK5C 5IK3B 1U92A 3P9WB 2FGWL 3W2DH 2NY0C 4HKXB 3G5ZB 4CKVX 2R29H 1NAMA 1CF8H 5C08A 4NJAH 3QXVA 5KSBA 4XMKH 1CG9B 2EEBA 5ESAA 4R0LA 3FB6B 4IBLT 3BQUA 2EE6A 1UZ8B 1AXSA 1LK3L 2HT3C 3MV7E 1IL1B 5FA4B 3VFRB 2PW1A 4EXKA 1DFBL 4JRXA 5EUOB 4NC1C 1G1CA 1AD9A 2VR9A 5DQJB 4DZ8A 2HA1A 4I0PC 5SX5H 3V6ZB 4MWFA 3H9YA 5HGBA 2ZOLA 5EDXA 4LPXA 5JPMB 1EVUA 4ZAKD 3VRLE 4L4JA 5MHSD 1AKJD 1S7UA 2CMRH 2VYRE 4JLRB 5JOPE 1TTGA 1PY4A 1IZJA 2NY6B 1DBBH 4LKCB 1RZGA 5TH2A 1DP0A 2ADIA 4JRYD 1INQA 3SDYH 4MAYB 3T2NH 1HZHH 4G42A 2QTEA 5DHXB 5EC2A 3SGEH 4GMTL 3TA3D 1AD0A 4CU6A 1UXWB 3IDUA 1CD0A 4M1GL 3OKOA 1E27B 5FO9A 4JHBA 3HG1A 1A6UL 4HFWA 2BFVL 4LHUD 1NCDH 4JN1H 2H1PH 2OP4H 5EBWA 5CJ5A 1SQ2N 1MWAL 5L9DL 3RVUD 1IGIH 5FCSH 3IETB 4NPYA 5E94A 5IIEA 2P8PA 2DKSA 3K8MA 3ZHLA 5E8DL 1MUJB 3MQIA 2G5BB 2YXFA 3ZYZA 4JPKL 1WBXA 1J0KA 4LDOB 5HHOB 3HTLX 4DKEH 2AK4A 3DHMA 3ULUH 5T3ZE 1NANI 3L7EB 3N1QC 3RPKA 2GJ6E 3OX8B 5CEZL 4LQFH 3IDMA 2ESVD 3I3EA 2WQRA 3VI3F 4XPHH 5EU6E 3DTXB 1FIGL 4HS6A 3PWNA 4ZYKB 3CLFH 1NCBL 3QZWA 5FA3B 4N68A 4DOHE 4YHNB 5FYLH 1DR9A 1W8NA 5CEXA 1ZVSA 4J23A 3MRNB 1LE9B 4RMWA 32C2A 3GKWL 2EE2A 2IQ9L 2DD8H 5K9OA 5T1MB 4HD9A 2IGFL 4POYA 4YHNA 5C0BB 5D96C 4U1NB 4X9GA 4HFUH 3VE0A 5F1IA 3VGHA 1JVKA 3J8F7 1BOYA 1I8LC 4A2MA 3LRGA 2IH1A 2VOTA 4DUWA 3VXSA 1F4YL 4IOSD 4X9FA 3TH4T 2EDQA 3VD9A 4RAVB 3TYFA 1NGWA 3VE0B 1SHMA 1DL7H 2P1YA 4YDVA 4FFWD 1UH3A 4NO5B 3MGTB 5F7YC 4P9ML 5JO5B 5E4EB 4YE4L 3U0PA 4TNWK 4X5WB 3UPRB 3ZTNH 4KJWC 2JELL 5I17A 3RX5A 2ZUSA 3P4LA 4NZTH 4TUJA 4OF5A 3C6LA 3VW3L 2W9LA 4ZS6C 5IEHA 1F4XH 4PJ8C 3PJSB 1JZ7A 1CLZL 4RAUB 3TBVA 1CVSC 1G7JB 2P4AB 5EULV 4DK3A 5KVDH 1BIIB 3D0LA 3LKNB 4A6YB 1EFXB 4Z0XA 4LEOB 4LVNC 4JANA 2X70B 4JHAL 2YOCA 4IEFB 4YDIH 3L3GB 1A9EB 4WU7A 3DNKA 2F9BT 4ZTPL 3ARGA 4JY4B 3EFDL 4AENA 4JFHE 3BKJL 2BSED 1RHHA 4P46B 2C9AA 4P23B 2ATKB 4OCSH 2PYEB 3FL7A 4MNGA 2OL3A 1SY6L 1NL0H 4PPTA 2UYLA 5KAQG 1WJ3A 3MR9B 1QFUL 3RJQB 1CL7H 2HFGH 2UZXB 4DZBB 2HVJA 3UYPA 4MQXC 1SM3L 2YRLA 3TO4B 1W0WB 3ARWA 1WSST 1CGTA 5JQ6L 2N1KA 5I1LA 5J3HC 3U36B 1GZPA 2ARJQ 1KGCE 5F88B 3C08H 4L29B 1N6QH 3MLVL 1JZ2A 5FUZH 2NNAA 3PUCA 3ILPB 3SE8L 3GMOB 1WCBA 2EDXA 2XY1A 3QUYB 4KAQH 4KI5C 5DZLA 4DKAA 1CGWA 5EZOL 5IVXF 2VDPL 5C09D 1GGCL 4PJDB 4L8SA 2FZ3B 4GRWH 5L8KB 4KJYA 1AO7E 4Y8DC 1MAKA 2O5ZH 4PJCF 4QEGA 3GSXA 5CJ8A 2OXHA 1MHPL 3WL9B 2ICWA 3O9WC 3NFPA 3CFIC 4PJDF 1NAML 1B88A 2DQUH 1X5KA 4GLRH 4LCCB 1ROWA 1ACZA 3CXHK 3WLBB 3MRGA 1NBZB 3WE6B 4ETQA 5C2BH 5FK9A 3MRIB 3UAJD 2WUCH 3QDME 1CT8A 3UO1H 3D85D 3W9DB 5HBBA 4LLQA 3O6LL 4GXVL 1NLDL 4WI5A 3QULB 3NGBB 1CQYA 5HDBF 1X5GA 1J0JA 4GRWF 3MACL 5F1NB 4ODTH 3PWVB 4TPRH 4GKNB 4OZFB 1FC2D 3MRDB 1OAQH 2IAND 1Z9LA 1C7TA 3EO0A 5HHVL 3EGSB 2BVQA 4WWKB 2J4WH 2Y6SD 4ZAKC 1N2RA 5CSZA 3ARFD 2GCYA 2EDTA 1CS6A 1MCLA 2NY7L 4D3CH 4Z77B 1U8LB 1CGSL 3BEWB 5AUMB 4CADB 3BMVA 3MZGB 1U3JA 4ZXBB 2D4DA 4EBQH 2X7LB 4OD3L 4AEIH 1ES0A 3BUYA 5EU3A 4KKLC 1CTOA 5GGRB 4KDTA 4JO4H 5C3LD 4KKBC 5D7IB 2BP3A 8CGTA 1A8JH 1KPRA 1ES0B 3BUYB 5EU3B 1CXEA 3FCTB 1YQVH 1IKFL 1T7ZA 4C59B 1Y18B 4PTTA 4WI3A 1KEGH 5ITBH 5B8CB 1JNNL 3HRZA 5T1DL 5C07A 5DYOB 5A3IC 4NWUH 3QCUH 5I30L 3RHWF 3KPLA 1OTTD 1MVUA 3HZMA 5EOTA 2XY2A 3MXVH 4HBCL 4DKFL 4B0MM 2V9TA 2FJFB 3DMMD 4S1SH 5IJKA 3U46A 4I0KA 2R8SL 1GPOH 1WAAA 4NNPL 4J8RB 1J11A 4YIQA 4JFDE 1OM3H 4C4KT 3OB8A 1KULA 3DPBA 1U3HA 3DRQA 4WWKD 1P7KA 3GM0A 2VKWA 3GJEB 4P3CL 3V79C 1YEHL 3CH1B 4OLVH 3CSGA 4FA8A 1NCWL 5BJTB 5K33A 4OLVL 3PGCA 3BW9B 2ZKHL 4R4BB 1OM3L 3H42L 5FV1L 1U8JA 3D39E 3ZYIA 3L7FA 1GPOL 5F9OH 4ONOA 3QHFL 4RMTA 1ZLWK 2JJVA 5JTWA 2D31B 3RAJL 1U8JB 5I75B 4ZNEE 2HN7A 3RWEB 3BPLC 4BH8A 1QVOB 3V5KA 3C6LD 4PV9B 4X6DA 4EIGB 5L88L 3QQNA 4XNMA 2NXYC 2C1OA 1BFOA 4JFYB 1G0YR 4AEHL 3WXWL 1KENL 5TE6H 3F7YB 1CD1B 3SDAB 1OAKH 3HPJA 3AUVA 5KSAD 4JFFD 4XP9L 5I1JH 4FQJL 1J8KA 4FQHB 5L7XL 2YD3A 3VGAB 4GXUN 2YZ1A 4OD3H 4AEIL 1U93B 3QFJB 2UWEE 3P0VL 4GAJH 1KJ2H 1E4KC 2F53D 3MBEC 1IAKA 4EOWL 1FFPB 4R96B 4D3CL 3RIAF 3RZCC 1MJ8H 2QQLL 2VDLL 4QF1B 1X6NA 2BXYA 3BPLB 3SKNA 4LSUL 5GGTH 5HHVH 3BIAX 4Y4KB 4YBQC 5JDJA 1FRGH 4IRJD 5H94A 3HE6A 2DQJH 4UT7L 4D0CA 2OR7A 4X4ZA 3SE4A 2HKHH 5CINH 1CICB 3KJ4B 3GRWH 2BZDA 1N3NA 3CFDA 4JLRA 3VA2C 2CLVA 2FJGA 3SDCC 3B5TA 2XTJB 5DFTA 3KJ6L 3WIFB 1BOGB 5IJVA 4YHIB 2I9LB 5BO1L 4WW2F 4CL7A 2AJXL 1J8HB 1FL6B 4QRUA 2FJGB 5FCUH 5GRWA 1F2XK 3DX7B 2AXGB 3QQ4A 4XPGL 4OI9A 2VLLB 1DLFL 4HIIB 5EC1A 1MHPH 3BE1L 3SDDB 2O5ZL 4R26L 1NPUA 4DGVH 3JTTB 5D1ZC 5CCKL 5EZOH 1IEBA 2F8XC 3DGGA 3K4ZA 3TZVB 2FNBA 4PJ5D 1E6OL 4PJGA 5FOJA 5BZWB 4X6DE 3SE8H 4J3OC 3MTRA 4Z7NF 1HI6A 4OB5L 25C8H 1R3IH 4LCIH 4DAGL 5T3ZD 3NFNA 2J8UA 3QSKB 5CSGA 2VLJB 1HI6B 4W4OC 1CU4H 1D5IH 2XN9A 1K2DA 5TQ0L 3EDDA 4AEFA 4WFGD 5E8EA 4NQDB 3SDAC 1IM9A 3L3KA 4NO2A 1AP2B 3D39A 5KSBB 4QXUH 1EEYA 4Y89A 1H3GA 1ULVA 5C2UB 1K2DB 3HLAA 4GKZB 3RI5F 5IM7B 3FN0H 4ZFGH 5KVEH 3D39B 1AH1A 2BY2A 5I1EH 5HPOA 4XP5H 3GNMH 4TNVF 5L2JB 2MKWA 5I1KH 3EFDH 3QCVL 3UBXB 2DM4A 4JFZH 4TRPL 1JGDB 3BH9A 3PHOA 1K3ZA 2NYYD 3CU1A 5DC0A 5FYJE 5HHNB 1MH5A 4N0FB 1D5XB 4YDIL 4I77H 5CJOL 3G9VA 3WN5B 1R24B 3NACL 1S9WB 4N8VA 4Z7UB 3LDBB 5H35B 1AIFA 4G80B 2VO5A 2Y6SC 4P2QA 3MLSL 5FUOL 1IZKA 1F4XL 3U6RA 5LAXA 3VDAA 5C07E 3QNXA 3C5SB 5E00B 1F90H 2NY5C 2DLFH 1KCKA 2D03H 4RWHA 4XZUB 4AT6B 1AR2A 5GGSB 1WWCA 3TPUA 5F9JA 1F13A 4GAGH 3BZFB 3GDBA 4OIBA 4M48L 5DJCB 1PLGL 2D7QA 5IFJA 4NKDA 5D7JD 1NEUA 1U3HD 2DYPD 5H2BA 1HEZB 1FO0L 1G7JA 4GRWB 3DRTA 2YC1A 3D0LB 2DQTH 3SDXF 3DHJA 1U3YA 3DSFH 2Y72A 4WHTA 5EO1B 3SOBL 3ZL4L 2BJML 4M6OH 2IPKB 1URLA 3FJTA 1Q8MA 3EOTH 2JB6A 4ZUWB 1HDMA 2PXYB 3TVMC 3ARDB 5GRJL 1UT9A 2DF3A 3I2CL 2DYPB 5BQ7A 2XQYG 3RNQB 3JVGC 3MUJA 3CPLB 3PGDA 4LMQI 4OGXL 4OLEA 2YHGA 1YDPB 4HWBL 4LMQE 3O3BA 5BMFH 2F8OA 2AKRA 4M9PA 3ISWA 3O8XA 3QZWB 5GZOD 5CJQL 4QY8A 5I0DA 4ZD3H 1X44A 1ONQA 1AO7A 4L29A 4GSDL 4DW2H 2X4UA 3HFML 1PDKA 4X98A 4JKPL 4R4FL 4PJHB 2YD4A 4U1NA 1MCHA 3BPNB 3GMOA 3QO1A 2BNUA 2GUOB 3VMPA 1A9BA 2H1PL 4JN1L 1MCDA 4N90E 1EBPA 2BHZA 1WITA 3QIUA 1DVFB 5HI4C 3DSNA 5HYEA 4M1GH 1Q0YH 4HDIA 1DVFC 2EDNA 1JGEB 4DWHA 4HQQH 5FOBA 1U8KA 4AG4L 3P11L 1AJ7L 1BIHA 5D2NC 4QRPE 2WZPD 5I6XC 2VXSH 2WW8A 4LARL 5HD8D 3HE7C 5MEQA 2GITA 3T2NL 3QRGH 5JPNA 4F7CA 3W82A 5ISZD 1QA9B 4FP8H 2NY5H 3RNKA 4I3GA 2EKSB 4LSVH 3OAZH 5JHLL 1WFNA 4XAWH 5I66A 2J6EL 1S7RA 3HMXL 2FB4L 5DMIH 3ULSB 3ZDXF 3OL2A 4U6HA 2B1HL 2GJJA 5F97E 4NKIH 2YD6A 4IRSA 4HHAB 1BF8A 1KELH 4XVUD 3S6CA 5FYJL 4JKWA 1MLBA 1D5BB 1JPGB 1KC5H 3VGDA 5DO2D 3G6DH 1FGNL 4W68A 1MFBH 1U2HA 3HR6A 3MFGB 1TJIH 2D3VA 4KTDL 4BQ6A 4N9GB 4X9BA 2H3NB 5DQ9B 4X6CF 4PJ5E 3F5WB 3IGAB 1A3LH 5E08H 2EDRA 4Z5RA 2X7LA 3GSUB 4OZIF 2EYSA 4KVNH 1RULH 3K80A 2XZAH 3FRUA 2EEAA 4Z0BH 4WTZA 5GS0D 2R4RH 1IC1A 5D7IA 3SDDD 3NCBB 4JG1L 3FONB 5DD6A 3L3IA 3W2DL 5HSFA 5LQBL 3EOAA 3FCTA 5D7JA 3X14B 4EVNA 1SEQL 2OYPA 1S9XA 4H8WL 4R7DB 1IM9D 2FHBA 5C9KA 4NM4H 4JM2A 2FD6L 1MNUH 3T09A 3HC3H 4QRRE 1OGAB 1RU9L 3RZCB 1MFAH 1BFVH 3GB7B 3H0TB 2FSEA 3WFEL 1D5ZA 4PLJD 5BV7B 5EOTB 5TDOA 4WV1A 2A83A 4Z78B 5A43C 1XF5A 2RFXB 1LILA 4DOHB 3DARA 3MLZH 3VXUE 2R1WA 4Z78A 5JXAL 1I4FA 3MRJA 2B5IC 1HYRC 4I3SL 1E4XH 3MRFB 4PRHD 3QCTH 3QIWC 3NTCH 2R0ZL 2NXZD 4TVPH 4JJHA 3U0TB 4XPBL 4HH8A 1BEYL 1P4IH 5H8DA 1N8ZB 4W6WB 4G43B 5HYQB 4P5TC 5IB2B 3MGOB 1LP9E 4F33B 3L7FB 2ADGB 1BREA 4HWZB 3CLEL 2V2TA 2Z8VC 1EUTA 4M43L 2DBJA 2EIZA 1MSPA 2Z92B 2YBRA 4GBXD 4IOFD 2JJUA 4B41A 5FHAH 4YGVA 4GQ9L 3S36L 3F7VB 3EGSA 1FZKA 5D1ZB 5C6TL 4O5LH 2OTPA 3X11B 3LS5H 4TTDD 4L9LB 1FG9C 1YEFH 1BPVA 1JFQL 2HFEA 4JCLA 3ARTA 2AP2A 32C2B 1WIUA 4G6FB 4OM1H 4UMGA 4BUGA 2NTSP 3O81A 1QTYT 2ZCHH 2HFEB 4ODSH 4NHCL 2LVEA 3N06B 5L0QB 2FATL 1AHWC 1B0WA 2EYRB 5DD3L 3EYVB 2QR0B 3LN4B 1JWUB 5GGSY 2VDQH 2ICEB 3C60A 3U9UA 1MREH 4X99A 4QF1A 3R8BB 1I7RB 4L1HA 2IFFL 3GSVB 1FVCB 5B8CC 2B7DT 3GHEH 4JFHD 3IFOA 4X5WA 1KN4L 3V4VL 3B43A 1U91A 4P2QE 3D69B 5BOZG 4CVXA 1HH9B 3KPRA 5MP6L 4MXWH 1AHWA 4UBDC 1S9VB 4M61A 4BSVB 3GMLB 5E5RB 3BI9X 3JV5A 4APQB 4JREC 1I8KB 5DVKA 3QPQD 1IAOA 5C7XH 2X09A 2BDNL 1I1AA 3U4BL 4A6YA 4I3RH 4QHKJ 3PHQB 3FAXA 3QA3B 3HB3D 1LO5A 5DFVD 5HGGS 2A74B 4NNXB 1QSEE 3BW9A 1U8PB 2F54B 4QRQB 2PO6C 5E2TL 4KV5E 4M7LH 1I1YA 2MFNA 1BFSA 1G1YA 4G7YL 4LRNL 1MPAH 4NNXA 3BZ4A 1INEL 3H2WA 3TT1L 4X7TB 1IAIM 1TZIA 3FTGA 2Y1VA 2D31A 1I8IA 4R4ND 1KTRL 3I50L 2YPVL 1GOFA 3TO4A 5FA3A 3CU7A 1CFSA 1ZVSB 1JRHL 2FCBA 2ITDB 3QUMH 3L3DA 5EA0L 5FV2A 4OD1H 2GAZB 3VI4F 1BQHA 3MRHA 1E0OB 2A9NH 4K7PL 5FA4A 2A38A 3OJMB 4OFYA 12E8L 3MJ9H 3QXWA 3OB0K 4P3DB 3VMNA 1E6JH 3B8SA 3IJSA 4MHHG 4ZOBA 2JIXB 4N0YH 5CGTA 3KPSA 2NY3C 1T1XA 5IHUH 3GEWB 2FYYB 1D6VH 2J3SA 2C3XA 4X5XA 1EIBA 4HX1B 3CC5A 4LCUB 3ULVF 3VFGH 2O93L 1KB5A 3B9EA 2GT9B 4F57L 4PJFF 4LSTH 1CLYL 3MRLB 4KVCH 4RX4D 4NBYB 1XZ0B 4PYHA 4XVUC 1HINH 2CJUL 3NCMA 1OHQA 5EBMA 1INDL 2W59A 1A14L 1AIFB 3VD4A 1RZGB 5TH2B 4NT6A 1FYHB 3MNWA 2C1PB 1HHIA 5LWYL 3QHZH 3DV4B 1KTLA 1PSKH 4OSUH 1IGYB 2FO4B 4YHLH 2AW2A 2V5SA 2YUVA 4FFYH 1NFDA 2JE8A 2NTFB 5ENWB 5K59E 4HFWB 5AAWA 5MEPB 3VFGL 2MWCA 3EHBC 1BWMA 1OTUC 3RUGE 4Z77A 1IBGH 5F93C 4Q9CA 1A1NA 2VAAA 3HZKB 4ZTOH 3TH3T 1B0GB 1TJHL 4PJIE 4Y2DB 1BLNA 4BQ9A 2IADB 2A9NL 2JJSA 3JWOH 3RWDA 2LTQC 4OD1L 1JI2A 3Q6FB 4K7FB 2IPKA 4G8FA 2KZWA 1FN4B 2VDRL 1JRHH 3CXDH 4BFIB 1X3DA 5EO9B 3LQAL 5FYJD 2LABA 3QEGL 1JP5A 1I1AD 1T2XA 5ICXA 4UT9H 3ARGD 1I3GH 5C1MB 3QUYA 1EEYB 2ZUXA 1CR9L 2ERJC 4CUCA 4YXHH 3NPSC 2C3VB 4L9LC 1INEH 2JJSC 4QHNB 5DRNB 5DSCA 1X5JA 5DRWA 1GAFH 3KXFB 4CDGC 5A16B 1WQVT 4HUNB 5AZ2L 4CNIA 5KANG 2AEQH 5ECJE 3HZVA 1OAUH 4NOBA 3QBTB 4RGOL 5GS1C 3MOBL 3UJTL 4J6RH 3G6AA 5HVGB 4PGJA 4L3CA 3QQ3A 2CUHA 3GSWA 4P2OD 5IV2A 4HXBH 3QT2A 3OKLB 1KCVL 2H26A 3QH3A 1N6VA 3VWJB 2H2PD 2P5EA 3U30B 5D8JH 4R97C 1P6AB 5HDOA 3EIFA 5GGQL 1DQQB 3TM6A 4Q9RL 2DTML 1S7XA 4G5ZL 4MXWL 3V5DA 4AT6A 1G0XA 3PQYB 1EHLH 4H1LB 2HN7B 3FO1B 3FO9B 4G7VL 1UWGL 1WT5C 2V5YA 5DJZA 5JW4R 1KB5H 1T89A 5BS0B 1R5VA 1PZ5B 1UFUA 3DURB 4LAQH 1DTUA 4FTVA 4W4NA 2X4OB 1KJVB 4F3FA 3D18A 2A6DA 1AQDB 1BQHG 3PWJA 3R0MA 1AKJB 1YUHA 3ARYA 5C0GB 4HK0B 1YEEL 4NHCH 3IDJB 4QXWA 2R69H 3WLWC 3TNNA 3EYUH 3KHQA 4PTUA 4O2EB 1VSCA 4F37K 5KN5A 2KUTA 2X44D 1A3QA 3MNVB 4JO1H 4L8CB 2O61A 3ZE0F 3IU3B 4OUOA 4X0KB 3MLYH 2AJYH 3DX9B 3MXWH 2FRGP 3BP7B 5DJ6A 3DO3A 1MCPH 4ZUVB 3VXME 3ZLQC 3BN9D 3CMOH 1FL5A 4YHKH 4EDWH 5CHNA 3ARSA 4J12A 2O61B 1BZQK 5D9SB 5C6TH 3S36H 1QR1A 3BP7A 5DJ6B 1CE1L 2NY6C 3NH7H 4Z5RB 4PRHB 3TO4D 3V7MA 2GTWB 3ARPA 1U95A 3ALWA 2Y36L 5GXBB 5BVPL 4JPWL 4YIQB 3LB6D 1EFXD 2NNAB 2AJZB 3WCYA 4ETYA 4LCCC 1FE8H 2PTVA 3ILPA 1ZLUK 1A21A 5EUOE 3P9LA 3ZSTA 1N0LA 2PXYD 3BIKA 5HGHA 4ONHA 3SKJH 3MLPA 4XMLH 2AGJL 3S34H 1JYWA 3QCTL 1CN4A 2AJZA 5C0DB 2RCSH 3RA7L 4XP1L 1C1EH 1AY1L 3UTSB 4MD0A 2FZ3A 1CFBA 1GRWA 1BZ7B 1VA9A 5TGBA 2EXYC 4U33A 2KBGA 1NCNA 4PG2C 3DROB 1OT1A 4C56D 3TWCH 4PGBA 2APBA 1I1FB 4NUGH 1C1EL 4OGZA 2D0GA 1JUFB 4MJ6B 3B3IA 3KYNB 4R97B 2D9QB 2K7QA 5T3XH 3V0WH 5DHVB 3QXAA 2DQGL 3FFCB 3PDDA 1K8DB 1FE8L 3MOQA 5MENE 4GQPH 2LTQB 3B83A 5IG7B 3B3IB 3RTQC 2DQCH 2O26U 4RISL 4QOKA 5I66B 1OTSC 3I6GA 4E5XA 3HE6D 3DO7A 4Y4KC 1ACYH 3DX6A 4MNGE 3T1WA 2YA1A 4BUHA 5A2LH 4YHKL 3MREB 4KVNL 1H8SA 2Y5EA 4JHWL 3K4AA 4P5MA 2GYSA 2MHAB 1A3LL 3TN0C 5A2IH 3CFEA 5E08L 4IDLA 2AJYL 3MXWL 1GGYA 1JWSA 2AXFA 3IDGB 1FZKB 2IALB 5AUMA 4I2XB 4NNYB 1F8TL 4LIQE 4GG8A 2YSSA 2ZOLB 1P84K 2R69L 3G6DL 1JYXA 1N0XH 3C5ZC 2JK5B 1TJGH 1YEEH 1U2CA 5DMJB 1I1RA 4DN3H 5HHOE 4M6NH 4Y4KA 4Q0XL 1T3FA 2XIDA 1T2QL 4MA3B 4O58L 5DA0B 3BPCA 3G6JB 3WHE1 5D7LB 3C5JA 5GJTH 1FQ9C 3QUMA 3MRMB 1M4KA 1U6AH 3B2UD 4HJGA 5K9QG 2ADFL 4XBPA 3TGXA 1L0QA 5FDWA 3S88H 2AV7A 3B5HA 3O4LD 1OAZL 1MHEB 3O6FD 4RFOH 5D7LA 1UCBH 4IIQB 5F3BA 2H32H 4TVPD 1K4DB 3F8UB 4FP8L 1XIWC 3INUL 2XYCA 4XNQA 4NO0D 4PJDE 3P30H 3VXSE 4AIZA 4MAYC 1XGQB 2XN9D 1YC7A 1I3RA 1B4JH 1LO4L 4NRXA 3DVGA 3D39D 1A4KA 1ZANL 3ZKNC 3O9WA 2FHCA 4KDTC 1AHWB 5I8OH 4M1CC 4ZOEA 1KCVH 4KMQA 2W65A 1GGUA 3SGKA 4Y4HD 3RU8L 1RK1A 1MRCH 1I1AB 4RGOH 2AEQL 2OTWA 4JO2L 3HFMH 3TT3L 2X40A 4L4VD 5IVOA 3FO2A 5EU6A 5C0RH 1D7FA 4HMCA 3ZHDA 3CX2A 1KLGB 4R8WH 3GI9H 2DWDB 2FJHB 3HMWH 5AAMA 1SJHB 2XQBL 3OKDB 3E8UL 3AFLA 3EW3B 3GSOB 1Y6NR 2BNRE 4GRLB 3OKMB 1KLGA 1NMCB 3NIGE 5T1LA 3QEGH 3C8DA 3WS3B 4PRAA 1MFCH 1CFVH 2CR3A 2EDDA 3RPIA 4Y4HB 3PDGA 3GJFB 4GRLA 3OKMA 3LQZA 3HA0A 5JIKA 4XCNA 3WS3A 5I1CL 4PGCA 4MA1C 3FQNA 3OPZH 4HKJA 4YBLC 1VFOA 4UV7L 4OLZH 5KJRH 4L4TE 4MA7L 4XCNB 5E6IA 3LEYL 3IDNA 2GAZA 1S9YB 2VL4A 4Z7UA 3BGAA 3RKDC 1IBGL 4EI5D 1FFPA 2CD0A 4PJ7F 2XZQH 4L4VE 4M4PA 4N0CD 3WIIH 1QFPA 1FNFA 3MGTA 1CD8A 3OAUL 4K8RH 5TDNA 2AJSL 1EUUA 4P2CG 2BVOB 5INDA 3U0PB 2NX5B 3AXLB 3QEUB 2AJ3B 4ZODA 1QUNA 4WHYG 5EUOF 2NPLX 4ORGB 2XZQL 2C26A 2K1MA 1KG0B 4FG6D 3GJFH 3VRJA 3NBNA 2NX5A 1RZFL 3MRKA 3OQ3B 2GITB 2NW3A 1YNTA 1WLHA 1UWEL 1WZKA 3F7PC 4K71C 2ICWI 2X4RB 2G5RA 4K71B 2C7UB 5I1CH 2NW3B 2EC8A 1LDPH 1QYGH 2XZCH 2JTDA 1FG2A 3FHAA 3JTSB 3G5YA 1J18A 4ZAKB 4YWGL 5IVZA 2VN4A 1CFVL 4UI2A 3WUZA 4JRXE 3NACH 3AY4A 2KQNA 5GS0L 4P23A 3TN0B 3T0DA 1FG2B 1CFNA 3E8UH 1BD2B 3MV7A 2E6JA 4ZFFA 3FAWA 1CTNA 3HCVA 3GJFK 1LK2B 3QCVH 4FFVD 1WC7A 1X7QB 4R8WL 3PWPB 1RUPH 3U0WH 5L2KD 3GNML 2N4IA 1M1SA 35C8H 5C0RL 2OJEA 4K7PH 3RDTB 3TF7C 3RJDA 3TT3H 4JO2H 2XRAL 1JHKH 4XH2A 2E7LA 2R4SL 3AC0A 5I1LB 3QUZB 2W0FA 3DVNB 4KMLB 3HNSH 1BF2A 1V3MA 1SMAA 2VKXA 2BSSB 1JZ4A 3PQYD 3EOAB 3LMJL 4TQEH 1J1PL 3V6BR 3BKMH 1LO4H 3K1KC 5ISZA 3BT2H 1HKLH 2BSSA 4LCIL 3HE7B 2XZZA 3SN6N 2WNGA 3P30L 4OB5H 3QIWB 1MPAL 1CDUA 4U1IB 3HMXA 3INUH 1E6OH 4DFHA 5TPWL 4M7LL 4YZFE 5CBEB 1OWRM 3PF2A 3QIBB 5HHQA 5L8JB 4HDIB 3S88L 1ADQL 4UDUB 4N0FA 5E9DA 1JRHI 1U6AL 4OQ1A 3KLSA 3HE6C 1EPFA 1T0NA 3BE1H 1I4FB 4GG6E 4I3RL 5H35A 5HHQB 1G9EA 3S35X 1T2QH 4KTYA 4P0DA 2G9HB 3U0TA 1GGIH 1OSZB 1N0XL 4NQSA 1PX4A 1N8ZA 4ZXBC 3WS6C 1F8TH 4WY7L 5MP6H 4JRWA 1MI5A 3M17A 2APWA 4F33A 5DEFA 5HXMA 2NQCA 5CILH 3JXAA 3MLWL 2VSCA 5F89B 4C56B 5DDHB 1JNHA 3CNKA 3O6MH 4H88H 1F4HA 5EIVA 1YYMH 1L7IH 4KKLD 4NN7C 2NX5E 2AXHA 4LSUH 4ZPVB 2NTFA 5FUCC 3R8QA 1G7HB 5HDQH 1HXMB 2QQLH 2VDLH 1J05A 2A6IB 2HWZL 4XVJH 4NJ9H 2DQCL 2GSGA 2IF7A 2YEZA 4O2FA 4CW1A 4EOWH 1VFUA 4ZPVA 3MUHL 2W9DH 3BDBA 5C0CE 4WHTB 5EO1A 1V7MH 3ORJA 2UZIH 3IFNL 3RBSA 1JFQH 2A0LC 1T03H 3C6SB 5F8RC 4XP9H 5SWZA 5I1JL 5DS8A 2UWEB 1LP9F 4O5LL 3FFDA 3HKFA 3KPLB 1KXVC 1NMAH 4KPHL 4Y1AA 2DDQH 4A6YL 4NC0B 1T0MB 1XGTA 4L3ED 1AY1H 2FJFA 4LNVA 4ZSOE 1XCTB 3VXQA 2RCSL 3UTTB 3IFOB 3LZFL 3CLEH 1U0QA 3UDWA 5AEAA 2AGJH 4KK9D 3S34L 1T20B 5IMKA 5F96H 4N8PA 4I1NB 1A1MA 4WV1B 4Z95H 3IXTA 3DRQB 1HSAA 4KK6C 2QHLA 4ZS7H 5DRWB 2CH8A 4JPWH 3GMLA 4LLWA 4F9PA 4KH2A 1D3CA 5KS9F 4MD5A 4KHXL 3VG0L 4G9DA 4UU9B 3P9LB 4OFDA 4S1QH 3VFOB 5I1HL 1CE1H 4NQXB 5DO2C 1G0DA 2WBJB 5HYIA 5JXED 5DC9B 3MLZL 3S3SA 3T2OA 3WXVH 2AJVL 5CJXC 2P5EB 4Z7WA 1FZMA 2P24A 1PD6A 3HI6H 5GIRA 3F6IA 3QUKA 1OD9A 3VH8B 2FGZA 4NQVB 1QSFE 4OCWL 4ONGL 4HWZA 1XF3A 4YHOH 5JDSA 3OAYH 5IMMA 3F65A 1X5ZA 3CVHL 2VQUA 3NIDE 3MXVL 1EDQA 4IS6B 2Q20A 4JFDB 1FAIH 3MOAH 1S7RB 3TYGL 1RJLA 1T1WB 1A7BA 1ZT4B 4JKMA 3AGVA 4N1CA 4D9RD 1QR4A 1FVEA 1KB5L 2HVKB 2P47B 4HPYH 3K2UL 3L3DB 3O45A 1ZT4A 3P4NA 5EU7E 5C9JB 3MROA 4J4PA 1FVDA 2VDKH 4HK0A 4FG6C 4EUPB 4JQXC 3R06A 4HZLB 4U6XB 3E2HC 1CDJA 4MJ4A 4R0LB 1IARB 2VRAA 3VD5A 5B38G 3TVMA 1C16B 4WW1A 2X4PB 4BELD 4Y4FD 3DX9A 4EQ3A 1C12A 4X5XB 2PW1B 4PJAE 3O41B 1DEDA 2AV1B 2VLMD 2NXZC 1KELL 2EYSB 5K93A 3GSVA 2J4WL 3SDCD 2BSRB 2EH8L 4FN0A 1AGCB 4DGIH 1F3JA 4HXBL 3X3FH 4M5ZH 4MA3A 1KCUH 1FPTH 4WFGE 2J6EH 2OR9H 5IJVB 5C08D 1RZJC 5AZ2H 4OZIE 3O6LH 4GXVH 5FDWB 4MCZA 2J7LA 3RY6A 1JNLL 2WUCL 3GI8H 4WENB 2BVUA 4HIIA 1F42A 2DI7A 3OKNA 4NKOA 3P11H 5D1ZD 4QOKE 3M8OL 1TQCC 2DQUL 4HQQL 4APQC 4B50A 3MCKB 1Q0YL 2YZ8A 4H5SA 5MENA 3D2UB 5SWZD 5CJBA 3LQAH 5ACMA 4AL8L 4JFDD 1PKQE 3LKQA 4ODVH 1OSPL 5DEZA 2VXVH 2YS4A 3Q48A 1SYSA 2AQ2A 5E9DD 5FKPB 2ZNWA 5KZCD 5FO9B 4MJ6A 1EEZB 5DR5H 4RMQA 5D2NE 4KROB 4S0TD 1PKQA 1DN0B 1NKOA 2H32B 3SDAD 3QUZD 2HTLC 5DTFB 4YNYA 2GY5A 1G7MB 3KPNB 1N6QL 1Q38A 1OQXA 1CFSB 2X5PA 1RUKH 3RVXD 5HVHC 4FABL 2ITDA 4JFEE 5C0CD 5T5FH 1M05A 2DLHA 5I73B 1MIEH 3RWJB 3L5HA 3WFDL 3I2CH 1RZ7L 3UJIL 5DMKA 1A22B 1S7WB 3IFLH 4LHUB 2O5XH 2X2YA 1N5AA 1T83A 2HFGL 1ZEAH 3HS0B 3NZ8B 4JZJB 4D94A 1QFUH 5F6IB 1LHZA 4UT6H 1SJEA 4JGMA 5LWYH 5HHME 3CH8A 5F1SA 3S96A 3TA3B 4PJ5B 4FFZH 1RJZA 2CDFA 5IKCB 1SJEB 1VGKB 1AD9B 5DQJA 1KPUA 2YD1A 1NGXB 5DFWH 1FCGA 3BZEB 3MBEB 4FMFA 2IPTL 1PEWA 2FX9L 3X3GL 1FO0H 2EH7H 3QYCA 5GSVB 1EO7A 3GSRA 1VFBA 5C0BA 3MSPA 4N9OB 4Y16B 5HY9A 5C6WH 4M48H 5F3HA 3OZ9L 4X8XA 1I7RA 1IKNA 3L3HA 1P7HL 2E8ZA 2EZ0D 2AJ3A 3NFSH 4LBEA 5F9JB 2VLKA 4HC1A 12E8H 3MJ9L 1BP3B 3GIZH 4UUJA 3ZKXC 5EBLB 3K74B 2CLRA 2XWTA 4NGHH 2JELH 2UVEA 2AEWA 1W72A 1DUZB 1ZWIA 1HHGB 4KK5D 4YE4H 1TDQA 3WD5H 4HKZB 3BVNA 4G6FD 1JTPA 1RD6A 4OD2A 3OZ9H 2BVEA 1JNJA 2YD5A 2VWEC 4PLNC 2IJ0C 4ZFZB 2X10A 5EN2A 2P44B 3L5WB 4FTVB 4QWWD 2X4NB 2MOVA 3JV4A 3PJSA 2EH7L 4F8TA 1N7ML 2IPTH 3I50H 2OMBA 4MB3A 1NGQL 4EN3A 3MYJA 2P8LA 4OT1H 2EIDA 4YXKL 5IUSA 2CGRH 5DVMA 4BZYA 1F11B 4P4RA 3VRIA 4ELMF 1DANT 5CBAA 1DQTA 1R5IA 5ICYA 1PG7L 1JMZA 4KK6D 3MUGB 4WU5B 3VFNB 2YR3A 2DWDA 4AENB 1UGNA 4RMUA 1TZIB 2NR6C 2CRIA 2IAMC 5KS9E 2CK2A 1HWHB 3LAFA 2BHYA 3DYMA 4CU8A 5SWSB 2OL3B 2IQAB 4LPUA 4U7KA 1MCSA 3WFDH 3KNBA 2BDNH 3QJFB 4M6AA 3RVVC 5B39B 4XPAL 4YAQA 2QJDA 1H3WM 4H20H 4UV4L 4HUXB 4ZSOA 5DD5L 3PWLB 3M1BA 1S7VA 3O11A 5CEXB 3MX0A 5B4MC 2ZUTA 2VSDA 4WI8A 4NN5B 5DR5L 4CMMB 1IGIL 4NZUL 4XBEH 4KJPC 5CCKH 3FQUB 3L3OA 1RZJL 4NUJB 3FQTB 4GKSB 5BOPA 5D7KE 1MREL 5KSUA 1OSPH 4PJIA 2X1QA 3DWTA 4R26H 3PL6A 4IDJL 3SDXB 4CMMA 5D1XC 5FFLA 3WFHB 5BVJA 5C0CA 4UIMA 4FQLL 1M6OA 4XPGH 1Q1JL 3QZWG 5IHBA 5DD3H 1H9VA 3MUY1 3ZTJH 1CFTB 4K9EL 3RVUC 1MCKA 3ZYOA 4M9OA 2QBWA 5DVLA 1LO2H 2X1PA 3V7AG 3QG6B 3NFPB 3OKEB 3G6JE 1I3UA 3S98A 1HZHL 3TH2T 4LL9A 3LQAC 4X80H 2XTJC 4NQSB 3BP4A 4IRSB 4JEGB 1HHIB 5JNYA 1R5VB 1PZ5A 3DURA 5IK3A 3MRGB 1JBJA 1KTLB 3PL6C 1U41A 2Q8BL 5D1XA 4E5XB 2DQJL 2ARWA 2P5ED 2BCKB 3PWJB 2QV2A 1LP9B 1PEZA 3X3FL 5JA8B 1AR1C 1NMCC 1UZ6E 5ALCL 4KKCC 3MCLL 4GMSL 4M43H 4PTUB 4IHOB 4EZMA 2PO6A 4PJBB 2RBLA 4WHCA 3QI9C 3CFEB 1QZ1A 4XTRD 1NH6A 4FQ1L 4L8CA 3KPQA 4MGXA 1KJ2L 2XA8L 3QR2A 4BQ8A 4NDMA 2DICA 2PO6B 4P46A 1UM4H 4ZDHA 4QRTB 3FN9A 5DRZB 1JCKA 1KEML 5E9DE 3NTCL 3V0VB 1R3KB 3FOLB 4R7NB 1JGVL 2QADB 3STLB 3FFCD 4F2MA 3QWOB 4U0RC 4CMHC 1H5BA 3WDHA 5DK2A 1WZ1L 2ARJA 1Q72L 5DHYA 4WI9A 4V1DE 1PGRB 4F2MB 4Q58C 4YGAB 4PGDB 2MKLC 3VFSA 3MV9A 1TVHB 1VADB 3OGCB 4UTBH 4P46C 5ISZB 5F6IC 5I0ZA 4FHBD 1MCOH 3QHFH 5ANME 2I5YL 1MNUL 3G5VA 1MCRA 4PD4J 1YPZA 1TVHA 1VADA 4WWID 4NM4L 3BPNC 2GTZB 3W9EA 1T20A 4AZ8A 4KQ3L 3BD4A 5T3XE 1GGTA 2QQQA 1O7SA 1OGAE 5AD0B 1U8OB 4U3HA 5D93C 3CDGB 3MLRH 3MRFA 3GSWB 3TIDB 3NCCB 5ICZA 4Z0BL 2XZAL 3W0WB 3QH3B 4U1HB 1RK1B 5I1HH 3E6FA 4G9FB 3KWWA 1N5YH 3VG0H 5F7LB 4N90D 3S3JA 4G3YL 5F9AC 1J7VR 4LSRL 3RWFA 4PRIA 4P5KB 3MRIA 4XT1C 1MFBL 4M8VA 4DKFH 4OAWA 3X12A 2YA0A 2YBRB 3DI3B 4DCQA 4FQ1H 3EO9L 3EDJA 3GK8L 3VXNB 3CSYA 1FNAA 4BSWB 2QQKH 5FYJH 5SX4H 1JPFA 4P5MB 4C56A 5DDHA 3KPRE 4A6YH 5ITBL 1GIGL 1KEGL 2H2SC 1BFTA 1ZHNA 3W0WD 5C70A 1FORL 4EQ2A 4YO0A 5E03A 5HDLA 4BSWA 2IALA 4WWKA 2B1HH 4HS6B 4GRMB 3RX8A 4R3SA 2FB4H 5DMIL 4WO4C 3SCMC 4DZ8B 2CRZA 4LSVL 4HKJB 2C1OB 3GO1L 5GGUA 5JHLH 4RWYL 3SPVB 4F7TA 2HJFB 1T3FB 4KI5D 3T4AB 5C9JA 5JMOC 1LO2L 4MMZC 2QADC 1CIUA 1SMOA 4K9EH 1Q9LA 2WIMA 3ULUD 2ZUUA 3BKCH 4Y5VA 4L8DB 4H1LG 3IJYA 4KUZH 4XAKD 1GSMA 5IMOA 1XFPA 1W0VA 1MCBA 3LKPA 4D0BA 3F12B 4QCIB 1FFOB 4IDJH 3BUTA 4WO4A 4GJTB 4L8DA 4RRPG 5T1KB 1FFNA 2F53B 5EU6D 2HLFC 4CVXB 5E7BA 2D0HA 4K3HA 5FECA 1F3JB 3EOYG 2F74B 4E0RB 2JJTC 4NSKB 1A4KB 3IXTB 4Y4KD 4WY7H 2AJUH 3GMNA 1P5UA 4DEPC 5DD5H 4FZEH 5T1LD 5D70L 4PUBH 4DEPB 4LSQH 3TV3L 4HWBH 3RHWK 1GGIL 4XPAH 3KLDA 4ZPTB 5HHMB 1MJJA 1D9KD 4Q6IA 4Z0XB 2I9LA 3O4LA 5C71A 2A1WL 2DWEB 1OAXL 3FO2B 4XB8A 5EU6B 2R1XB 3RRQA 1QFOA 4R4NC 2VIRB 4U7SA 3EOTL 3HCVB 1NEZB 4NO0A 1A2YB 2VWEE 3PWPA 4JDZA 4Y2DC 3VFMB 4X7EC 5J7CC 3ULVD 4OZGE 4KAQL 3VXUA 5LCVH 3CFBB 3S37X 3T77B 1WT5A 4PG9A 3RIFK 3FT2A 3MLVH 4LQ1A 4P57B 5CEYB 5AZEH 4KKBD 6FABH 4JZNB 4ODUB 3BT2L 5E5UB 5I8KL 5DJ2A 3LMJH 1SJVA 1QVOA 2BY1A 5JQ6H 1R3LA 4LVHB 1L0XA 1BGXH 4K7PY 2VERN 1PLGH 4EUPG 4TYUA 5JR1H 4P2OB 3TJEL 3HNSL 3PNWB 5ESQA 5E4EC 5T1MA 1WEJH 3HI5H 3WD5L 4PG2A 4E41B 1A4JB 1R3LB 3WKMH 1S9YA 1EERB 2XRAH 1UZ8A 5DF0A 5JW4N 4NGHL 4AIOA 3ZKND 4EUPA 4YHML 5DGQA 1LEGB 1EAJA 4I2XA 2D03L 5CBEA 5JQHC 4JRXB 3BKJH 3CAFA 4E41A 1ZXQA 5INDB 4PJ5A 2E7CA 3VXRA 3I6KB 4M5YL 4WHYH 3W5NA 2BVPB 5IF0B 1JPST 3QAZC 3HAEB 3E1F1 1FZJA 5CIPA 5KVDL 2OZ4A 3DXAD 4HGMA 5L2KA 1LDPL 5K9QI 4C83B 4KK8C 1H15B 3MPCA 2NZ9C 4JFZL 5C0JB 1NC2A 3A6BL 5IEHB 1CICA 3IS0X 3ZKMC 4EI5A 3NIFE 1JYNA 2PYEE 3UTQB 1VKXA 3TBTA 1CWVA 4ELKB 3C5SA 5E00A 2V5TA 5EOCJ 3WKML 1H3TA 3SO3B 1QPXA 4GW5A 4QHMB 3TJEH 4EI5B 5GJSL 1JL8A 3T04D 3IF1B 2Q8AH 1UXWA 3O4OB 1EJOL 2AXGA 3N50A 1LEKB 2BOBB 1ZWIB 2YN5A 5CSZB 1RHHB 5T5FL 4FABH 2F53E 3WIIL 5I8KH 3DYOA 3RDTA 4FQXA 1U8LA 4OCLC 5EN2B 4X6CB 1KJ2A 5A40E 2NMSA 3T0BA 3LPWA 5ERWB 2DD8L 2YXMA 4NQCA 3P4OA 5IQ9A 3SY0A 1Z3GL 5E8NA 2YUWA 3RZCD 5EO9A 1YN7A 4YFDB 4Z18A 2PETA 4DGVL 3V4PL 2BC4A 1LEIB 3FB8B 1XCQA 2A1WH 2C4FT 5J12C 1NSNL 3FHQA 4MNQE 3ARED 5I76B 1AP2A 2V7NB 4YFLI 5M95B 5EIQA 5JW5B 3ULUL 4DKEL 2V2XB 4PJFE 5B3JE 1MVUB 4BJLA 1A7PH 4M62H 1EBAA 4HGWA 5HGDA 4LCWB 4K9EC 4P2OC 1C5DB 5BO1H 1JN6A 3GI8L 3ZE1E 3RBGA 3MRNA 5LJYH 4M8QB 1LE9A 2ICWJ 2XFXA 4XXCA 5CINL 2HKHL 4OQTA 3GBML 1V3JA 1YEIH 3RGVC 1MWAH 5L9DH 1FHGA 1FNLA 3ETBF 4M8QA 4M5ZL 1LQSR 3RWIA 1NC4D 3RU8H 4YFLF 2ZPKH 4BQCA 4FFVC 5BJTA 1HXYA 3FZUD 5JHDE 2FX8L 2H2SD 5EIIA 3BP5B 3FOMB 1YMME 3VH8A 5KSUB 1YY9D 1B2WL 3KG5A 4LP4A 2EDEA 2ZOKB 4WO4D 4YBLB 3TBWB 2IANB 4N5UA 3RGHA 3TZVC 4L8BA 1Z6JT 4KZEH 2VDKL 1TXKA 2XNAA 2NY0B 4XCFL 3C6LB 3O2WL 4Q7DA 1RJLB 4PJXE 4RFOL 4RA0C 5J1AA 3K2UH 5SWQA 4HPYL 4OD2B 1QFWM 3C8KB 1FORH 1T4KB 4D9LH 1DE4A 4F7PB 4NKDB 2VABA 4K3GA 5D1XB 4EI6B 4PGEA 4JANB 1IJ9A 5D5MF 3VGEA 3HPJB 2QQKL 3Q2CA 3KS0H 4FMKA 1TJGL 2PYFA 4ZFFB 2ZSVA 2AQ1A 5FUCE 3WO3B 2D7MA 3KPQB 2BNRB 4ONGH 4OCWH 3QDGE 1XEDA 2C3GA 1R6VA 2NYYC 3TC9A 2FEDD 2Y06L 1FBIH 1YY8B 3HI6L 5JORA 3CZFA 3HG1D 4PLKD 1CCZA 2AJVH 4NOFA 2CDGB 4LPWA 1A7OH 4XMKL 3ARDA 4IMKC 2X4TA 4LGRB 4X4MA 4F80A 4RQQB 5CP3A 1FLTX 3VXMB 1YEHH 2P5WE 2A73B 1ZGLA 3QWOA 4OV6F 1YC8A 1XIWB 3VXTA 1KLUA 4UINL 4U2ZA 2AKRB 4DQOL 1QP1A 2R8SH 1WWWX 1YMHA 3IDXH 4FQXD 4GS7B 4S1SL 1FNSH 1IFHL 1S7VB 2BSTA 3HI1A 3ZHKA 2XN9E 3UTSA 4S1RH 3OF6D 2DIBA 4WW2B 4J2XA 3NCEB 1YEGH 2NY4B 4WI2A 3VD7A 1YMHB 1UWXK 4ENEC 1CXLA 3FB5B 4PJ8B 4LSDA 1FP5A 2VTFA 1JNNH 3ARUA 3RZCA 3KYOB 4HC1L 1IKFH 4RFNC 4U05A 3VXRD 1QBBA 2Z31B 3A6CH 1U8OA 3QAZB 3WL9A 1M6OB 4XP1H 3OHXA 2COQA 4JO4L 1BVZA 3RUGA 1EEZA 2R1WB 3EYQC 2VISB 3RWHA 4HZAA 4ZOCA 3T3ME 2UZIL 3IFNH 1U58B 4X5LA 4QOKB 4EBQL 4LFHG 4MJ5B 2RHEA 4WDIA 2W9DL 4LLMB 3SDCA 3SE3A 5F7WC 2NY7H 1E28B 3PV6B 2NXZB 2CUMA 1S7SB 5IFAL 9CGTA 5JXEA 1KBGH 3MREA 1T80A 3O45B 2V7HA 3MCLH 1NGYA 1Y0LA 4GMSH 2MHAA 1I7ZB 1YYML 4LLVA 1BD2E 3CFJB 1KIRA 3MJ6A 4NIKB 4NNYA 4ISVB 3MUZ1 3I85A 3CCHA 3TBSB 4B7LA 4KK8D 2BNQE 5D1ZA 2X9XA 4JGJA 4JO1L 2NCMA 5BRZB 1WZLA 4NDMB 3X11A 4ZXBA 1W8OA 3BO8A 5JOFA 2WUBH 3I02A 2EDJA 1FLRL 4NN6C 5DRZA 4OLXL 4ZG1A 1S8DB 3SPVA 1BVKB 6CGTA 2Z4QA 4R7NA 1D9KB 1Q1JH 4ZFOA 3QUXB 2UWEA 2JKXA 1P5VA 3HE6B 3STLA 4JAMA 5KSBF 4PJEB 4OFVA 1RIHH 2ZSWB 3W11C 1B6DA 1BVKA 4CVUA 1C8PA 4P2QB 4C57C 2GSIA 3IJYB 4KI1A 1UXSB 1GGCH 3AM8C 5LAXB 1JWUA 3GIVA 1XCTA 3VXQB 3V7AE 2Z91A 4MYWB 1ZS8A 3BFOA 1IEHA 1I3RB 4O9HL 5IOPA 4XC1L 1RIVL 4D9QE 2BRQA 1HHGA 2DTMH 2DMCA 3MA9L 1E27A 3NCYS 4Q9RH 1QO3A 3P3YA 1HKLL 3GZKA 2W65B 3BKML 3QO0A 1QQDA 3O3AB 2Z8RA 5TDOB 1J1PH 3JZ7A 5ITFB 1JGUH 5CGMA 2EC9U 2X1XR 2ZWLT 3VXMD 1SM3H 1A6PA 1TVDA 2CKBH 3WUWB 1WBYA 4PB9H 1QEWB 3WS6A 2KKQA 1VEPA 4XCEB 4GUPB 3UJTH 3D3VA 4O02L 3J7HA 4NRZA 4Y4FC 4TSCL 2I25N 4NQVA 3ULVE 1WBYB 3LEXB 2AXJA 4YHPB 4NM8L 3MNZB 3QXTA 4P5KA 3PIQB 2GHWB 3RWJA 3MA7B 1FDLL 4ZTPH 4HJ0D 2WIIA 2CGRL 1A2YA 4NO0B 2VLJE 3EZ8A 4ZUWA 1HDMB 4YXHL 1CR9H 4KUCD 3UTSD 1NGQH 4JFDA 4OZFH 1ZT1B 3SE9L 3VXNA 4NQDE 3LRSB 1N7MH 5GQBA 3RI5K 3T77A 4ZYKA 1A7NH 4WRLA 3O6FB 3R4DA 3K0WA 3FQNB 2FLBT 5HHXL 4P2RB 4PJBF 2P43B 3NIDF 3VDBA 1TPXC 5E6IB 5CJXA 3VW3H 4OKVB 1UJTA 1RMFL 2FX7L 3DIFA 4NZTL 1UWEH 3DX8B 1ITBB 5GS3A 1Q9KB 5D2LA 3NFSL 4FQCH 1RZFH 4PJXA 4P99A 1WIPA 4K2UL 2C4FU 2FO1A 4L4TB 1P7QD 2VDML 3EOBB 1P4LB 3EJZD 4M3JA 5IMOB 5EWIL 5LGKA 4XAKE 5F70A 3OAUH 1TNMA 2VLJD 5EPMB 1WAAF 3IFPB 4M7ZB 3X3GH 3I6KA 2R2CA 3ARDD 2BVPA 4OSUL 1IQWH 1L9NA 2AS5M 3FMGH 5IHLB 3LEYH 3TPUB 4OUUB 3TLRA 1N3NB 3DV6A 4FFZL 1KPVA 1UB6B 4FXGA 3RGVB 1F5WA 4PB0L 4DUVA 3OPZL 3TFKD 1DJSA 4ZFZA 3OXSB 5GISL 2DQFB 1A14H 1LVEA 4UT6L 1NCBH 1S9VA 3CLFL 2X70A 5C0BD 3W0WE 4UIKH 1FIGH 1LP9A 3UTQA 2VR5A 1CFNB 1FYTE 5FO8B 1RZ7H 3UJIH 1OT2A 2CDEB 5DUPL 5DUBA 1WC7B 1X7QA 1UEMA 4Y4FB 4K07A 3VFTB 1B90A 4X9IA 1GC1C 5FO8A 2EIEA 4K8RC 3HMWL 4JPKH 1PQZA 4O51B 1NEZA 4N0YL 1HNGA 3QNZA 3PWUB 1ETZA 4I0PB 4KMTH 2D0FA 5IBTH 4Q9QL 2WLYA 1DLHA 3STZA 3I6LE 4RA3A 1NQBA 1Z2KA 4G8EA 5EA0H 1GGBL 3PWUA 4Y19A 1ORQA 4WTXA 3SY0B 2J8UB 4ODVL 1WICA 2VITA 3JVGA 2BFVH 2FLRT 4JM2F 1XH3A 4AL8H 5I8OL 3OG6B 5E8EB 2WLZA 4NP4H 3O11B 1OF2A 3KVQA 4JGUA 1VERA 1EGJL 1B4JL 3VGGA 4UQ3A 3M8OH 1EJ6A 3HS0A 3WIHH 1UEYA 4TVSa 4BFEA 4PJHA 1A6ZB 5F1OB 3NCYP 4HS8L 3G5VB 2PW2B 4G7YH 2IMMA 1T5XA 3I3BA 3CGTA 4LRNH 4LVOC 3B2VH 5DJXA 3PXHA 4P3DA 4OZHF 3B9VA 1AC6A 1CZ8L 4KI5E 1VGKA 4PJCA 1BZ9B 4NN5C 5HVHB 5J6HB 2ICWB 3HPLA 1B0RA 1KNOA 4ZQKA 5C86A 3BESR 3KXFE 4WVRA 1J8HE 4HX1A 4G8GA 4PJCB 2GT9A 1AE6L 3O3DA 4PRPD 4JFFA 3U4BH 1UQSB 3ZE0E 5KVGH 3MRLA 5DFVC 3G6AB 5C7XL 3T3PE 3EDFA 4F7CB 2EDKA 5L2KB 1IVLA 1MI5B 3M17B 4G8GB 3RNKB 2XG4A 4HCRH 5BCAA 4H25A 1UQSA 3DJ9A 5H37H 2A77H 1VFAB 1OP3H 3S3PA 5FB8A 1JGLH 4EXPX 1T5WA 5EB9A 1VKXB 3EO0B 4HGKC 4LU5H 1IC4H 2CXGA 2IFFH 3GMMB 3QFJD 2HTKC 2EIZB 1CE6B 4K94C 1D5BA 4NJAL 4H1LA 1RUML 1ACYL 3W81A 3WFCL 2R29L 4GRMA 2NZIA 2OJZH 3TYGH 3IKKA 3MOAL 3NVQA 4RISH 5GGUB 5E8PA 1HQRB 5J6GA 4U6YA 5IVXB 1D5MA 2VZUA 4F7TB 3CVHH 1JPSH 5EORL 1AQDA 5E2VL 3V6FB 3I84A 3FFDB 1OVZA 1Q9LB 1AGDB 1YEFL 1W0YT 2A6KB 3IXAA 3PHSA 5GZND 1L4IA 4KK9C 3ES6A 1XGTB 3FONA 5DD6B 3TWCL 5M7QA 3WXVL 5FGSA 3UTTA 1FYTB 4G8FB 1IGFH 1K4CA 1JTOA 4OZGB 5CWSB 1XCQB 5T33L 4YXLH 4FQIH 3B9KC 3KNBB 4S1QL 2LAGB 4FOMA 4KHXH 5B39A 5IESH 4XMLL 1X4YA 2ZG3A 4HIXL 4GBXB 4ZS7L 3O8XB 4HUXA 4ZSOB 5GRVK 2HAZA 4I13B 5JZ7D 3KPRB 3ARQA 4P3WA 1YYLH 2B1AL 2XKSA 3CH1A 5F96L 5BVPH 4X98B 2Y36H 3W0WA 2BSTB 3FQUA 1Z9MA 3MFFB 4Q6IB 2NY2D 4YXLL 3BEVB 3B9KA 5BRZE 4J1UB 3LSOA 5SV4A 4E42B 4HJJH 3QPXH 1A02N 5EZJB 1WZMA 4OLYH 4XX1G 3KYKL 3EHBD 2B2XL 4NO3A 1T6WA 3B9KB 4JPIA 1G6RL 3GUTB 2ATPA 3PQYE 5ILTL 3U4AA 1JK8B 1LD9A 1MFAL 3T0XA 3ULUF 5E1AA 1I1FA 5E2VH 4OF8A 4MAUH 2DS4A