1PD6A

The nmr structure of domain c2 of human cardiac myosin binding protein c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
b'DEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-binding protein C, cardiac-type, Domain C2
molecule tags Structural protein
source organism Homo sapiens
publication title Dissecting the N-terminal myosin binding site of human cardiac myosin-binding protein C. Structure and myosin binding of domain C2
pubmed doi rcsb
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2003-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pd6A00
1BZ7A 1FZKB 1CU4H 5JW4N 1IL1B 1AE6L 5JO5B 5EU6E 4NNPL 1A2YB 1XF3A 4PV9B 3OGCA 4U1JB 5FF6A 4LHUA 4CVZB 3ARRA 4K94L 3G04A 1UKTA 4J6RL 2H9GB 4GOSA 1ZANH 1MRDL 2X2YA 3UYOD 5A16A 3EO1B 3HZMA 4YEFA 3FB7A 3UBXI 4U1IB 1V7NH 4HIXL 4UV4H 4I48B 3OF6A 2NY5H 4FZ8L 4NZDA 1F97A 1KCUH 3NABH 3MJ9L 4BH7B 5EN2A 4MXVF 3V8OA 3KLHD 3QWQB 1CXFA 3D25A 1EPFA 5J06A 3O4OB 4PJBF 4Z77A 2IALA 3X12B 1RUMH 3MRMA 5JZ7C 4MNQD 1RIUL 4KKLC 2KBGA 1MRFL 2DQFA 4Z7WE 1NPUA 1S5HA 5E0QA 3MV7B 4M6NL 2R15A 3S36X 5C07A 3OPZH 2K7PA 3FZUD 4K7PH 1BD2B 5L9DL 2VN7A 5B8CB 4PTUA 2B1AL 1M6OB 2AEQH 3C8KB 5IFJA 3CZFA 1HKLH 2FLBT 1OAKL 4FFWC 4QHNA 4M00A 1CF8L 5EBMB 5BV7H 3DVFA 3UBXG 4WEMB 3MBEB 1DN0A 3HAEH 2MQ3A 3C8DA 5F1NB 1KJMA 3G08A 5JPMA 1N2RB 4EI6B 4PJAA 2ZUQC 3BYYA 1RZIB 1FLRL 4NGHH 1JHKL 5GGRA 3C6LC 5C2UB 5I1GH 5INDB 3R4DA 5BVPH 2EC9U 4XC1H 4LLDB 4XHQA 3RL2A 2VDPH 5EWIL 2YR3A 4I0CC 2BNUB 2UY6A 5JQ6H 1YEFL 1T1ZA 4PJ5D 2I26N 1DUYA 4NO0D 5DD3H 1AFVH 1A6PA 1O5DT 1T5WB 3VWKD 3Q5TA 5CAYB 4ZUSA 3MBXL 3HTLX 1J11A 5AUMA 5BRZA 3SQOL 2P8PB 4J2XA 3NA9L 4M6MH 4OZIF 5DVNA 3FQNB 4MJ6B 4ODUB 1FVEB 3B3IB 4RQQB 1I8KB 2XWTA 4Z5RB 4ZXBA 5FGCB 1QFUL 2J4WL 3T0EC 4J3XA 1FNFA 2CLVB 3TNMA 4P23D 5ESVA 4JEGB 4UILL 1OP9A 2VWEE 5BVJA 4PJDB 1HHGA 1WFOA 1HQ4A 4I2XE 4FP8L 1I85A 5IVZB 5J89A 3G6DL 1V05A 3KYAA 1T20A 2E7CA 4LLVB 4J8RB 5CEZL 3OGCB 4N9OB 2OL3H 3IB4A 4H25A 1M7IA 1LO3L 3D39B 5F89A 5DA4A 1PY9A 3BDXA 4HXBL 1AO7E 1CBVL 3K2UL 2BVOA 4RFEA 3FB5A 1WCBB 4FXLA 3MMEA 3PWPA 1NLDH 4ZTPL 3G9VA 3GO1L 5JQ6L 4FG6C 1S7WB 2AJUL 4M3KB 3CMOL 1PEWA 2VDKH 1N3NA 3RWIA 4BFIB 5ICZA 4NHCH 4BZ1H 4XCNB 2OK0L 5SWZA 2G75A 1JZ3A 4OCWH 3IT8D 5C09A 1HIMH 1T89C 3QNYB 2DQJH 1VKXA 5C0BE 1JWMA 3S4SA 4GXVH 4G43B 3VXUD 4UZGA 4KY1L 4NYLA 2XY1A 3MJGX 4HAFA 3QPQD 3X3GH 2P5EA 2G9HB 3VFPB 1CZ8H 3NABL 5HHXH 3RTQA 2W91A 3L5WB 1IBGH 2VL4A 4AM0A 4X0KB 4GJTB 2F8OA 4G8GA 2XNAB 2AXJA 2W1NA 4HGMA 3H9YA 4MZ2A 1RZ7L 4UTBL 3G5XA 4HQQH 3LSOA 3FFCB 4Z7UB 3J7HA 1NH6A 2F5BL 5GZND 1A1MB 3IJHA 2Z92B 4M1CD 5HHME 4ZAKA 3WKML 5KN5A 3MRLB 1F58H 1EERB 4WU7A 2L4OA 3TC9A 2YD3A 4HPYL 1GPOL 5F9AC 3FT2B 4PJHE 4HIHA 3P77A 4I48A 4JRXD 4OLYL 4ZFFB 5GRWA 1BLNA 3GK8L 4G7YH 2L7JA 2P24A 4DCQB 1R3HA 3HI1B 4NWTL 4JFEA 4DK6A 4RRPA 1WT5C 1KJVA 2BSSB 4FMKA 4MA3A 5JW4M 1HINL 4G80A 4WTZG 2E6QA 1I7RB 3GSUB 1RHFA 1E4WL 5EBWB 4XPGH 4PJGB 2ZPKH 2VR5A 1NUGA 5FDWB 4R4FH 5EG6C 1KCUL 1BHGA 2VDQH 3W0WE 1EAPA 3C87A 3EAKA 1C5CH 3C5ZB 3T4YA 3AREC 5T1MB 1QSEA 4V1DD 4HWEH 5JHDE 5TGBA 5C0CA 4HIJB 3TYGH 5KSAB 5C0BA 1ZLUK 3V4PL 5DMIH 3TESA 5A2LH 2NW3B 5C09E 3WKNA 3RI5K 1IEAB 1LNUB 4OCLC 3VFMA 1JNNH 1RJYB 4CN1A 1YEJH 3KDMA 4Z8FH 1R3LA 1CCZA 4IRSD 5C0DB 2DQCL 3PJSA 1S7RA 2AQ1A 2XACC 4ODHH 4P46C 4PJBB 5DHVH 4Z78B 4QO1A 1JZ4A 2DQGL 1GOHA 1ZS8A 1U58B 4MAUH 4AY0A 1KIPA 3BGMB 3LMJL 2V5MA 4UU9A 5KSVA 4M8QB 5F9WB 3TH2T 2J8UE 4LP5A 5SWSA 1HILB 4PRHD 3QIWB 4ODBD 1Z9SA 2FJGB 5C3LD 4B53A 1G7PB 3ORJA 5J6HB 3BP4B 1PGRB 1HXYB 4GSDL 5E9DD 2OR8A 4IS6B 1T0PB 1U8NB 4TUKL 2VZSA 3LN5A 3LS5L 1T03H 1S7VA 2E9JA 4PGDA 2O5XH 2DI7A 3PE9A 1BFOB 2A6JB 1BQLH 2F53B 4U6VL 2VXQH 5D7LB 3RVTD 4MD4B 5DEFB 1L7TH 2DBJA 3ARFB 3MFFA 1VGEL 3MOAH 4YAQA 1ZEAH 3TT3H 4ZUUB 1J7VR 1JFQH 1NC4D 2GJJA 1A6AB 4N5ED 1F3JB 2D9CA 2GEEA 4I13B 5IJVB 1GGBL 1UWXK 1PSKH 4Y2DD 5F1SA 1XGTA 2ED9A 4QHLB 4JM2F 1LP9B 4Y8AA 1YY9D 5EUOB 1JGUL 1BBDL 1SBSL 2FBOJ 2GUOB 5FO9A 1A9EA 2P7TA 3NTCL 2X4RA 2AJ3B 4XPFL 5L2KD 1VGKA 1MLBA 1ZE3C 4YO0B 3TZVD 4M5YH 4BFBD 4E0RB 5HI4C 4D9QD 4HGWA 4GAFB 2DIBA 2YA0A 3B4NA 4OTXH 4RBPH 1X7QA 2B0SH 5DJ6A 3SDXA 4OD1L 3OJDA 3DIFA 2IG2L 4MXQC 4Q2ZB 5B39A 2FIRT 1CGTA 4C56D 2AJXH 4QRUB 3X13A 2GITB 5M95B 3QUMB 4NQCD 4XVTL 3BPOB 1EHAA 5FK9B 3E2HC 3OPZL 1I9JH 4F58H 1KCLA 2BVUA 2B4CL 1L0XA 43C9B 3GMRA 4KHTL 4HUVA 1CFNA 3B6SB 1GOFA 1D3CA 4X7TB 4YEEA 2CIIA 4Q6IC 4WI2A 3QDMD 1KSRA 3HR5B 5H2BA 2BNQB 3C6SA 3G5YB 1JWSA 5MEOA 4UIMB 1IAII 5MEQA 4K07A 2DM7A 3QDGA 1KFAH 3MTRA 1PZ5A 5GZOD 1F4HA 4KI5E 1DANU 4APQD 3CAFA 4ZXBC 5FUZL 4M6AA 4YXKH 3N85L 1SJEB 1LMKA 2BY3A 3EYUL 5HHNA 3SE4C 3TGXA 2O5ZL 4JHZA 3BGFB 4P48A 2E8YA 2PETA 4MNGE 1LD9B 3U7YH 4MNQA 1NAKH 4XNMB 1ZHKB 4H8WL 1MVFA 1JBJA 4MVBD 4IM8A 3NA4A 3N1QC 4ZUTA 4FTVB 1FAKT 4XB7A 3V6BR 4D0DB 4D0CB 1CXEA 3O45B 4KC3B 1G0YR 1HH6A 1BQHB 3O11A 3QRGH 1UCBH 4J3SA 4PJ9B 1GYAA 4MNGB 1QKZH 1QFWL 4OT1L 4M61B 1BBJB 4HWUA 5IG7B 3QUXC 3RVWC 3TN0C 1AGFB 1H8OA 5D2NB 1ZVSA 3QEQB 3V0VB 4G6FD 4GKSA 4ZNEE 1PAMA 1RFDL 2R1XA 2HKHH 5A3IC 1C8PA 5CIPH 4N9GA 1NCBH 4N5UA 2B1HH 2Q1EA 1JTPA 4NKMA 2EZ0C 1I7ZA 4GRLB 1HI6A 2ATKA 4O5LL 5JA9A 2YHGA 2A6KB 3HNVH 3KLHC 5CEYA 5IMKA 1AGBB 3KHOA 5HJ3A 1FYHB 2VC2H 3T4YB 4OJFH 1YEIH 5KTEH 1C12B 3HPJB 4TVPL 4Q0XL 4GMSH 5BOZG 5D71L 1MHCB 4R8WL 2N56A 5ITFB 3MCKB 1PVHA 1NANI 1MUJA 1BIIA 2ZWLT 1AO7B 1R6VA 5I15H 3OKMB 4BSWA 1MNUL 5FA4A 3X14B 3QHFH 3SGDH 3L3IB 2EDKA 2Z8RA 4Z7VE 3W2DH 5HHOB 4N1HB 3V0WH 3E3QC 5FAAA 2OJZL 4I18A 1NMBL 1UA6L 1FAIH 4FFWD 5BQ7B 5DF0A 1MY7A 2JCCF 2FRGP 4TSAL 3QG7H 3BN3B 4JCLA 4QRPE 1NBVH 2JJUA 2WLZA 4J23A 5I66B 2DM3A 2CD0A 4MQ7A 1U3HB 4JM4H 3VXSB 1XCQB 5IQ7H 4LVHB 4OFPA 4PJCB 2EKJA 4GO6B 5LAXA 3MCLH 1RZ8B 5T5FH 3OKOB 3VXRE 2HMIC 1RSFA 3DX9A 1YJDC 4DKEH 4Y4KC 3EYQC 4XNZC 4D0DA 1NBYA 1AHWB 1IAIL 4XPTL 3P30L 3MNWB 2XNAA 2KUTA 1C5DA 1W0YT 4FP8H 3IFLL 3DBXA 3VFUA 5E8NB 1CG9B 3VXNB 5K9JL 4G9DB 1F42A 3VW3L 4FG6D 1YZZA 4RDQG 2AK4E 2VR9A 5DEGB 1I9JL 3LKSA 5A3ID 4UOJA 4F80A 4MJ2A 5T1LA 2EXWD 3KVQA 2EECA 2WBJC 2ATPA 3IRPX 3LCYA 1D6EB 4YWGL 4YHML 1ADQA 3K2UH 1CFSB 1FP5A 1VFAA 3D6GA 5CSBA 5TDOB 2ZG3A 1FSKB 4JCMA 4Z7VB 4XNQA 1TLKA 3T4AA 2H6PB 1RUKL 3V6FA 2J1KA 2OLDA 4NQEB 5KJRH 3LB6D 4X99B 3R8BB 4RFEB 1GZPB 5ITFA 1OY3B 2EC9T 3M07A 3TBSA 4GXVL 3NCJH 3J8F7 1U8JB 3CK0L 3MV8A 4MAYA 3BIAX 3O41A 5E6IB 1OWRM 4X6DA 1WBZA 2CRMA 1E4XL 1S7VB 3RGVC 3BKYL 1TNNA 5E5UB 4H8WC 4M8VA 4MSWA 4LVNB 4OCXL 4L29A 5BXFB 3WS6A 2XA8H 1E27A 3FT3B 4KHTH 5HSFA 4F2MB 4TNVK 3B8SA 1BX2A 5A2KH 1UWGH 3AMLA 2ZSWB 2HFTA 2DLHA 3RUGB 1M71B 3ZDZE 3KPRD 4BSVA 5IMLB 1IGMH 1OD7A 3VD5A 3H9ZA 3WSQH 4HJJH 4LASL 2UUDK 2VKXA 2VXSL 2VJXA 4JZNB 3T8XA 3MLRH 5MI0C 2VABB 4QHKI 1VFAB 3BHBB 1YYLL 1T83A 3KJ6L 1RVFH 2X1QA 3V4VH 4EQ2A 3G5ZA 4L9LA 4R0LA 1I9IH 1CL7H 1CR9H 1T1WA 2X10A 1RHHB 5SWSE 4RFNC 2VQTA 4GS7C 1MRCL 4CVXB 3TYFA 5JHDD 5BV7L 4ORGA 4GKNB 5F8RC 4K3HA 1OAZL 3MYZA 3U7AA 1A5FH 5I17B 5IESL 3WFDL 1SJXA 2YD4A 3UJIL 5DS8B 5I0ZA 1Q9LA 1T0MA 4XHJC 3BKYH 4E5XA 4RGNB 4K8RC 1OPGL 1WICA 4Y2DB 2DMBA 2EKSB 4LSQL 1I8LA 5J9PA 1XCTA 2YRZA 3GMRB 3FN3A 4JO4H 3DGCR 4OZFG 4HIIB 4N90D 3I6LE 1RMFL 4WV1B 5MP6L 4M8QA 3K4DA 5IKCB 4ZPVA 4X4XA 5IQ7L 1U95B 1Z3GH 2AGJL 5DVLA 3W82A 4KJWD 3FN0L 4H26B 2A77L 1SYVA 4RMVA 1N59A 4F15B 5D5ME 4S11A 3ME0A 8FABB 2PYED 4PJBA 1RUAL 2P5WD 4NUJB 3CIQA 3Q6GL 1K4DB 1TPXC 5CWSB 3ET9F 1YMHB 2JELL 5CEYB 2Q8AH 4KUZL 4E41E 4LKCA 1IM3B 4QKXB 3IVKA 4MD5B 1MAKA 3FL7A 5DK0A 3SJVE 1A9EB 1F8TH 2FATL 3D3VB 2A73B 4TQEL 5JIIA 2PW1B 3GMPA 2FGWH 3QSKB 5GGVY 1G7HB 3CSPA 3QEQA 2VXVL 2V2WA 1U3HC 1KGCD 1NEZA 4H1LH 3ARXA 3WS3A 4HG4J 1C5CL 4OZIA 5HVHC 1R3IH 1GGIH 3TO2A 3NCBB 3BAEH 1M1SA 3GEWB 3LKOB 5F93C 5IF0B 4APQB 4Q58C 4IMLB 3MCLL 5FEBA 3OQ3B 3T1WA 3E8UL 3ETBF 4HIXH 1ES0A 4YPJA 1DLHA 1NFIB 1UWXH 4X4ZA 1N7MH 4X4MA 4QRRA 4X9IA 5I16B 5DJXA 3WL9A 2F58H 3F65A 3ARGD 3LEXB 4EDWH 2VYRE 1WEJL 5DHXB 3P77B 5MENB 3F12B 1V3KA 3ZKNC 1D5ZB 4MD5A 1IZJA 5CEZD 5JDSB 3A6CL 3U4EA 1JWUB 2P5EE 2BHUA 2X1PA 3X11B 2UV3A 2BC4A 3N1PC 5ECJE 1CFSA 5FYLD 4R4BB 5GGSB 2XZCL 2YA2A 3P4MB 1YUHB 5K93A 5B21A 1ZHNA 2VUOA 4MXQD 1XGRA 3WNKA 1G9NC 1IGFH 2GSIB 4FQCL 1J12A 4Z95L 1FIGL 5D1ZB 5GIRA 1WWCA 1U95A 3LPGA 3NCYP 4PJBE 2W38A 1UZ8B 4QRUA 5FM8A 1WITA 3ZE1E 3PWPE 1PG7X 3LEVL 1IKFL 4ELKB 1UXSB 2WIMA 2AJZA 4C4KO 3HPLB 2YPVL 3WD5H 5FKAA 2EE3A 4NC2B 4R3SA 5IFHH 1EK3A 4P3CH 2J7LA 1E0OB 1XF4B 1XCQA 5AYUL 1VFUA 4ELMA 3H3KA 2B4CH 5C0CB 4YXLH 3SDAC 5KSAA 4JM2C 4M1GH 3MLUL 4NFCA 3NCCB 2QKIB 1NFIA 2YD7A 3W0WD 3RGHA 4ZS6C 2OI9C 3QUMA 5KOVC 5SX5K 3ARBC 4NN5B 4ZO8A 4JFPB 2YSSA 4POUB 4U1KA 3G6JB 1NDMB 2R39A 3DMMC 5FGBC 1J8HD 1IFHH 4NQCA 2B39A 1TMCB 3T0DA 3RQ3A 3BH9B 2AI0H 1QEWB 1I3RA 3GNML 1A7OH 1E6OH 2D31A 5DD6B 1ZXQA 4F7TB 3KYKH 5INDA 2OBGA 3RFZC 5GJTH 2Y23A 4OCRL 1V5JA 2A77H 1KPUB 3FFCD 3RVUD 5E95B 4EZMA 2C26A 3KR3H 4RGNC 3DX8B 4GBXA 1U92A 1I75A 3UO1L 4XWOD 2X70A 4PR5A 4J3TA 2CLRA 4Q6IA 3FRPG 1G9NH 1YYLH 3D0LA 3FOMA 5HGAA 3NACL 4H1LB 1AGDA 5F6HI 4BZ2L 2XZAL 4JO2H 5C71A 1IAIH 5EPMB 3AB0B 4D9RD 4FMFA 2A83B 4Z8FL 4GLRI 2IADA 5IESH 1A5FL 5E6IA 2VKWA 2VMFA 3BGFC 3NZHH 5DUMH 4G42B 2B7DT 5IW6A 4RA0C 4PJCA 5I2IB 1AC6A 2HT3D 1BFVL 4LBEA 4L1HA 2LTQC 1E6JL 2WWKT 3FQWA 4LF3A 2YKLL 1I1RA 1GJIA 4F7CB 3FMGH 4XZUB 1J5OL 4DN4L 4PB0H 2EDBA 4OZHA 2AEWA 1BFTA 1YNKL 1BM3L 3PJSB 3GSNL 3ABZA 3ZMRA 4Z76B 1VFOA 2HN7B 1OQXA 5GRZA 1T89A 2A9MH 2MMXA 5HHOA 5EO0B 4D2NA 5SWZB 2VDLL 4PG9B 2MQCA 5T1LB 4QRPD 4J3VA 3TN0A 2A73A 2B8OT 2HH0H 4L3EA 4HJGA 2X4QA 5TGBB 1MUJB 1AGEB 5MEND 4XWOC 2VITA 2AABH 4XBPB 5DJYA 2PR4L 4ZAKC 3GBML 5I19L 2W0LA 5E94A 1D5IH 2FATH 3EYOB 4OLYH 6FABH 4Z0XA 3QQ3A 3N1GC 4HPOL 2XZCH 4K2UL 4PB0L 2UZIH 4YFEA 1JF1A 1QEWA 5F88A 3QUYD 4DUXA 1RIHL 4OFIA 3ARTA 1YEHH 5C0RH 1RZ8A 3D9AL 3TO2B 5CHNA 1KLFA 5F9WC 2VH5L 4HBQA 1H3VA 4X6DF 3BD5A 4NDMA 4ZXBD 4G80B 2IJ0C 2EEDA 3MV8E 2DL2A 3HAEA 1RAMA 4H1LG 2X4OB 3SY0A 4KMLB 3D25B 4ELMF 3MLTA 2GITA 5D7IE 4HZAA 4YFLF 5BRZD 1ZHBA 4HEME 3UJJL 4G42A 4X5XA 1P7KA 2XKNA 4A6YB 3DHJA 1KUMA 4GW4A 5DMKA 4QXUL 2B4CC 3HZVB 1DQLL 5EZJB 1T2XA 2C3XA 3PL6A 1A6VL 2XI9A 3DRTB 3MJ8A 3VXQA 1LO2H 5DMGC 5TH2B 5BW7A 5KN5B 3V5KB 2M8XA 4MA1C 1R5VA 3DVNB 3KPSB 3MBEC 1A1MA 2EDJA 4KJQC 4BK5A 2OXGA 2GUOA 5FO9B 1HH9A 1U3JA 1I7TB 1G7QA 2VLRA 2X40A 4AL8H 3G5VA 2GTZA 2VXUH 3EZ8A 3REVA 1S9XA 2DRUA 2Z8SA 1EZVY 4DZ8A 5CSGA 4FXKA 5CZXD 3R06A 4ODHL 2F15A 2I25N 4JLRA 1T7ZA 3P30H 1QLRA 3S9DB 3SE3C 5A43C 1IC1A 5KVEH 2QSCH 4I2XB 1NANH 4NRYB 3PHOB 4AYFA 4JHWH 1A6WL 1AP2A 2IF7A 1A7NL 2RBLA 4M7JL 4MX7A 5C6PB 4YE4H 4KDTA 5TE4H 1Q1JH 5HDOA 1AGFA 5IIEA 1JN6B 3FT3A 1XF4A 4PJGF 3U83A 4YHKH 5HTSA 3V9FA 3PWUA 5D70H 4D3CL 4GBXC 5I30H 2SEBB 2MFNA 4R7DB 3UYPA 4K94C 4XAWH 1MCLA 1VADB 2ZSVA 3A0OA 3MLWH 4Y5XB 3DTXA 1PBYA 1U0QA 2N1KA 4P2OD 3NCMA 2FO4B 1J88A 2NXZC 2JCCE 4PP1C 3D2UD 1P1ZB 4PBWD 4UINH 2R69L 3P0VH 1MLCA 1OT1A 2YUWA 1ZGLB 1KB5A 3O6LH 4AL8L 2FHCA 2DYPA 2NY7L 1DVFC 4QGYA 5I8CA 3ULVF 5AG8A 3MBXH 1QKZL 4KK8C 5D72L 4QT5A 5F6IB 1FE8L 2D7MA 1Y0LA 3IETA 3ULSB 1P84K 4XWGL 1CICA 4H0IA 5GGTH 1RVFL 1T1XA 2H9GA 1CT8B 3B9KC 1DUZB 2B1HL 3KWWB 2XTJE 1NUNB 1RK1A 1WCQA 1NCBL 2R4RH 1R0AH 5DJ8B 1I4FB 5DQDH 2R2EB 1HHJA 4PGCA 5IHZA 2EDNA 3FQTB 3THMH 1OVZA 3ARFA 2GCYB 5DFWH 2MCPH 5GS0L 1WWWX 4WWKD 2OJEB 1YEIL 5KVDL 4N0UE 1JK8B 3T65A 1JI2A 5KG9A 2E9WA 3GJEA 4Q7DA 3PIQA 5KSBB 3H7BA 4L8BA 3DX9B 2EDOA 2YS4A 3OJVC 4P4KB 2FL5B 1SEBA 5FHBH 1U8OA 5ITBH 3V6ZA 3E6FA 2C1OA 1NEZB 4HWBA 2CKNA 3GMQB 3BPOC 5HHMD 5AUMB 5BRZB 1LO5B 3MRIA 3DJ9A 3H3PH 2WBJD 3OAYH 4OFDA 2NNAB 4YXKL 1ZT4A 3LKSB 3U36B 4WI5A 5DK0B 1NQBA 2X4PB 4PLJD 3MJ6A 3VRIA 5ADPL 1MVUB 4Z7OF 5DJAB 4IDJL 5FUCE 4ZDHB 4R4NC 2Z0BA 5EOCL 3JTTA 4ZFOL 5FYKE 3WYRA 2WUCL 5EB9A 2HTKC 4Y4FB 2WV3A 1JF5A 4UT6H 4ZNCD 1WZLA 2DKSA 5FYJL 3WUZA 2V7NA 1S3KH 3ARGC 3QWOA 3EOTL 5EBGA 9CGTA 2NCMA 4KQ3H 4KK6C 1YEHL 1UM6H 4TOYH 1PZ5B 1FL5A 2UYLA 3GB7A 3QB7C 4DUWA 1I7ZB 2FEDD 2R1WA 3RIAK 2OJEA 4M02A 1S9VB 4QHMA 4NZJA 5DJ0B 1FORH 5ACLA 4MSWB 1X4ZA 2XZQH 2GTWA 4CJ0A 1H8NA 1JFQL 1QBBA 4MB4A 2K1MA 5DTFA 5IR1A 1MJ8H 4N0YL 2FJGA 4LLMA 3P9MA 1CFVL 4E42A 1A2YA 1DQQB 2W60A 1UVQA 4LSUH 3SQOH 2VXQL 5L8LB 2CKBH 1LGVA 3KXFE 5BMFL 3QNZA 1SEQH 4WUKL 1ZS8B 1XMWA 5GGVH 4W6XB 3D0VB 4XNUH 4X6BA 1CFTB 4OZGF 4L4TD 3S7GA 5EU5A 5BS0E 2QR0A 3TA3A 4NFBA 3ARPA 1R3LB 5L0QC 4PJ7F 3T8XB 1ZHKA 4JZNA 3RWCB 1J1OH 1QLFA 3VI3F 4NM8H 4JY6B 4P9HC 4PLKC 5IB3B 2JB6A 4KMTH 4PV9A 4ZFGH 1AJ7H 1Z9MA 3MODL 1EO8L 5JMRA 4JQVA 4Z7NF 5SWQA 1K3IA 1MAML 2OMBA 1G7MA 4P46D 1D7FA 1NAMB 2NZIA 3TEUA 3UTSE 1XGTB 4KPHL 1J8HA 1DVFA 3QG7L 4HLJA 1UM4L 1AI1L 1INDL 2Z9TA 2A74B 4PYGA 5GRJH 2HG5A 5L2KE 3C6LB 1F11B 1SQ2N 1AQKL 4ZQKB 5TE4L 3FRUA 1VPOH 4WIQA 4KU1A 1R5WA 3QPXL 15C8L 3H9SD 3IF1B 1VFMA 3LIZH 1H3WM 4PRBA 5I76A 3CH8A 1KTLA 5FUOH 3STLA 3K4ZA 3P9LA 3NIGE 3WBDA 3IJSB 5DO2D 5D96C 3L7EB 4OCWL 4YDJA 4XPAH 2K9UA 5D4QA 2A9NL 5F7HA 2OYPA 4HIEA 5K59E 4JG1H 1A7OL 1EJOH 3MV9B 2DIAA 4KPHH 3WHE1 3FT2A 1W0VA 5FM5O 5EU7C 2VLJD 5IBUG 4G6AC 3R1GH 4JE4B 5F3BB 1KCSL 1JPTL 1C16A 4PJAB 4WI9A 4NNPH 1AJ7L 2R56L 1MCFA 1JRHL 1UJTA 1JMZA 3ZHLA 1RZ7H 4UTBH 4IRJB 2YRLA 2HG5B 5MI0B 5C92A 5CUSH 4P3CL 4U1GB 3SCMA 4RNRA 3RUGF 1M6OA 5CKAA 5E2WL 3CX5K 3OZ9H 1C5DB 1Z0NA 4I9WE 2DQHH 4K3EH 4XPAL 1NAMA 4NQCE 2O61B 1QFWI 2EDHA 3BQUB 3BSZH 4WFED 1Z6JT 1A14L 1BOGA 2B5IC 2G5RA 3F7PC 5TQ0L 3SDXB 4L4TE 4UQ2B 4ISVA 3L3GB 2KH2B 4QXGH 1XZ0B 2V9TA 2UWEB 4TUJA 5C09D 5LAXB 4ODTL 1S7UA 4OSUL 1OLZA 5JHDB 2JB6B 1FV1A 4MDIB 1FBIL 3IAQA 5E4EB 2DI9A 4K7FA 1LE5A 3I85A 5IW1B 3S88L 2EYSA 2J5LC 1KTDA 3VCLA 2DQDL 2P5ED 3F62A 1BVKA 2YXFA 4AMKH 4OM1L 4P2QE 3CSYB 3UTZA 4KGLA 1A1NA 4NNYB 4HV8B 4CAGA 1H3GA 5T3XL 5A2IH 1JGEB 2OL3B 4L3EB 4LSVH 5DQJA 4LCWD 4OCNC 1L6XA 4KKCD 1BREA 4LLVA 3DRQB 1VHPA 3AXLA 3RPIA 1P4IL 4W4NA 4KKBC 3JSSA 1CLOH 4M5YL 4KKAC 1YDPA 1UGNA 3W5NA 1Q94A 1AKJA 4MD4A 1KT2A 1RPQA 2MJWA 4JFHE 4FQQA 5HVWA 4WY7L 4FRWA 4XCFL 4A6YH 4P4RA 4Q9CA 5I1EL 1H0DA 4P5MB 2YD1A 3VXOB 3QXAA 1ZA6B 4UDUB 5ESVB 4LRNL 3KYOA 1DR9A 4P2RD 1K2DB 1MHPH 2GY7B 1JHTA 1BOGB 1ZWIB 4OLWL 3A6BL 4P3DA 4WI7A 1T6VN 4S2SB 2DQUH 3AROA 4RGNE 35C8L 1JGDA 6FABL 5ABDE 2AEIT 3VWJB 2FX8L 2NR6C 1A6UL 2X6MA 1AC0A 2DJUA 1IM9A 1FNEB 4XP9H 2NXYB 2ADJB 4NKDA 1BVKB 2GAZA 5F21B 5JW4R 2CRZA 1L4IA 3CFJB 3R0MA 5C08D 5DJ6B 4O2EB 5K9QI 1U8PA 3M8OH 2OM5A 1ZGLA 4DKDC 4JY6A 3QUXA 3EDEA 5J12C 4F7TA 4KTEH 4Y5YA 4JPKL 2P5WB 3ESVF 1NFDA 4CDHA 4Y1AB 2GJ6B 5KSUA 4RIRB 3HRPA 4X6BB 5E8DL 5KANI 1C08A 5D9SA 2MHAB 2IGFL 4L5FH 4TN9A 3PWLA 4KI5D 1D5BB 1DBKH 1BD2A 1CGXA 3PL6C 3T0VA 4ALAL 2EE6A 4WHTA 1PX4A 1GGTA 3UJTH 1KCRL 2GJ6E 4L9DA 3D2UA 5T3ZL 1F11A 3MFFB 4M6ML 4PJIB 1JTOA 4MB3A 1AR1C 3UCRA 2XN9D 1BBDH 1VPOL 3AS3A 1DVFD 4ZSOE 1R3KA 3IDNB 2Y07L 1HNFA 4Y5VB 3TIEA 2R0WL 2WUBH 1UH3A 3UO1H 4I18C 4LCUB 3K1KC 2FZ3B 3V79C 3KR3L 4O00A 3UEZA 4WJ5A 2P5WA 4V1DB 2CMRH 3IJYA 4D9LL 4DOHB 4QHUB 2H32A 2XTLA 3G6DH 1HILA 4OFVA 4NUGH 2DWDA 1CFTA 5CEZE 1W0WB 3QUZD 2A38A 2E9BA 3K3QA 1D5XB 1CQYA 2WINA 1MFEL 4GAYB 3RWEB 1EBPA 1Y18A 5C07E 3QXTA 3ARSA 4HCRL 3QUZC 3DGGB 4Z7OE 4UIKL 2A0LD 4Y5YC 3WFBH 1T20B 4JPVH 2OTWA 1KPVA 1GC1C 4UB0H 3ZKMD 4NC1C 4ZQKA 1AR1D 4HIJA 2QQKH 2A74A 1A0QL 1FRGL 3OV6A 5HBBA 4N1CA 1BFOA 4GG8B 2ADGA 3V7MA 3GSQA 3BEVB 2XV6B 4CNIA 4PJHF 3LKNA 2NY3B 2GTZB 5EZLB 3CFKB 1I1CA 1NGPH 5I18H 5CFHA 1B0RA 3DVNA 3OB8A 1U8MB 1HSAB 4MA8H 3V5KA 4YGAB 1NLBL 3SDAA 1F3RB 1FLTX 4KAQH 3O4LB 5T3XH 4I0PA 3HZKA 2AJYH 1U58A 4PRAA 4YHZH 5DJ0A 1IAIM 3U6RB 2VLMD 2XPGB 4HXAH 4Z6AT 1CIUA 5FCUL 5E00A 3CFBA 3EYVB 2HKFH 1MAMH 3QWOB 4FQXD 5TQ2H 4ODXA 4BJLA 3ESUF 5I71C 3GRWL 2C1PA 3UZQA 2Q76B 3NN8B 1LO2L 1XCTB 3JWDH 5DURD 1UT9A 4OLZL 2EXWC 1QSZA 4LSRH 4MGXA 3PXJA 2CPCA 5IWLA 2YC1B 2Z31A 5DSCB 3MGTB 4HFWA 5DJ2A 3PNWB 1OAKH 1RZJC 4NKOB 4YBLC 4XCCL 4PBXA 3LS4L 1FZMB 2OJZH 3RWHA 1Z5LB 3CSGA 4JM2B 3OR7A 4Q9QH 3Q1SL 4NQDA 3W2DL 4QEGA 1NC4A 1KCSH 1TENA 2IANA 1MFNA 2M2DA 3GJFH 3SDDB 1KNOA 1HWHB 4U1LB 3MV11 3LKPA 3JV6A 1PG7W 5H94A 3RA7L 4GRLD 4YHYC 1NMAL 4WI8A 1CLYH 1EO5A 5JW3H 3WEXA 1JGEA 1OGAB 4PREB 3JV5A 4PRAB 2DYPB 3OKDA 1TNMA 4ZTPH 3EFFB 5E8PA 4HXBH 2BDNL 3QUKB 5HGDB 3HR6A 2FBJH 4HWZA 5CLWA 5HGHB 3GMNB 1CGUA 3B8YA 4YX2L 1DSFH 2XQYK 1N6UA 4NZUL 1X6LA 3TBYB 1DQDL 1ZANL 1IT9H 3HMWH 4PGCB 2Z4QA 4K8RL 4ZS7H 3TO4D 4X7CC 4IBLT 2FL5A 5I71B 1YYML 2YN5A 5AAMA 5DJ8A 5FYLH 2PTUA 3ZLQC 1NC2D 1MFCH 3AUVA 3PWUB 3BH8B 4FTVD 2BNQE 1TCRB 4FHBD 1CL7I 4IDLA 1P7KB 2XQYG 3BDBA 1U93A 4HW6A 2D0HA 4XMPH 3FRPA 1K8IA 1FYTA 1MCQA 3DURA 5B38A 1ACZA 3QULB 2GK2A 4LSPL 4I3SH 3FQRB 4GG6A 2MWCA 3PXHA 3UBXB 1KENL 3QBTB 4YK4B 1RIHH 2HVKB 3N9GH 3ULVD 1N8ZB 3MRRA 5IQ9B 2NMSA 5DQDL 5D1QC 2WAHA 3WJLA 2XN9E 4Z0XB 1YQVL 2Y5TA 4LSVL 5E94B 5IVOA 4NRXA 4ETQB 1TZHB 1YPZA 3WIHH 3BXNA 3ULSA 3ZKQD 4YZFF 1KB5L 3C5ZC 3REVB 1J05A 3CU1A 1WCBA 4OD3L 2GY5A 2VRAA 3CNKA 3MRNA 2J8UF 5GSVA 1AO7D 1NFDB 3TN0B 3LIZL 4YDLB 2IH1B 1QQDB 4Y5YB 5IUSA 2VXUL 5KS9F 3EZJB 3RNQA 5HI3C 3ARZA 4EI5B 1CWVA 4DGYH 2ICES 2ZOKB 5A2FA 3ZTJG 1AP2B 1N2RA 4EI5C 4UQ2A 4I5BA 1MCIA 1QYGH 1FYTB 3WNNA 3BE1L 2IBZY 2NTFB 5J11C 2JIXB 3BSZL 5BW7C 25C8H 2SEBA 4I0PC 1CI5A 3SE3A 3D87B 1MF2H 2XXMB 3ZT6A 2Q6WB 2CSPA 2Q3ZA 5IBLC 1G7QB 5D8JL 1MHHA 4HFUH 3F7YA 4O51B 1N0LA 2VZTA 3IDGB 2RIKA 5BQ7A 1W2KT 1G7IA 2EH7H 1QLFB 3BN9C 2ENYA 3SPVB 5HXMA 1ZV5A 3OAZK 1DUYB 2DIJA 5EZOH 5KSBE 3UYRL 3KLSA 4KDVA 4LKXB 4PJ5E 4ZPTA 5L6YL 4EXKA 1S9XB 2E3VA 1P53A 4GXUM 2YEZA 3H9HB 5DYOB 5ICYB 2EYRB 4KTDL 5T1DH 2F5AH 4X4YA 2XQBL 5BS0A 2HTLD 4DN3H 3M17B 1T22B 1FZOA 5DGQA 4TSCL 2Y7QA 4UDTB 2YC1A 3GHEH 4WGVB 1ZVSB 1IRAY 3THML 4M4RA 2WBJA 2JK5B 4YHYB 1RIUH 3OKKA 3HRZB 2EDEA 4YPGB 1MH5A 3KYOB 1F4XL 5KS9A 5EOCJ 1CE6A 3NOIA 3MA9H 5E8EA 4BQ8A 1QFOA 5KG9B 1J1OL 2AK4B 5LJYH 3VRLE 3L5IA 2XN9A 5EOQL 3PP3H 4TVSa 3FTGB 5DDHA 3T3MF 4YUEH 2R2CA 1HQRA 1BECA 1LD9A 2P43B 2VQ1A 2MNUA 1AGEA 3O2DH 3FQXA 1XGQB 2F8VA 3TJEH 1X4XA 4HS6B 4TVPE 5DFVC 1UKSA 1TJGL 3BZ4B 5CD3A 3BUTA 3LOWA 1LO5A 3RAJL 5GGUB 2E7HA 1GZQB 5J57B 3QPXH 1GXEA 5E08H 2LVCA 4OF6A 4P2OA 4PJHA 1FG2B 3WIHA 3ULUD 1E28B 1Q0XL 4BKLA 5CGYC 4CRPA 3WDIA 3X17A 3RUGA 4HH9A 2X5PA 4UNUA 4LCIL 1J86A 3H7BB 4L8BB 3QFJB 3CFIC 4LASH 3P4NA 4DZBA 1CGSL 3VFTB 2GK0B 4LVOC 4L4VD 4R0LC 4C58B 1DLHB 3O9WD 1BQHG 4TRPL 1MIEL 5L0QB 4TUJB 4OLXH 4N0CC 4ESKA 4AT6B 2AV7B 1MCEA 2J88H 1C5BL 1XF2A 5EBLA 5EU6B 2EDYA 6CGTA 4KV5E 2Y36L 2VZ1A 5KSBF 3RJQB 1MREL 5DK3A 4OZIB 2CLRB 2PUQT 3LV3B 5IVXF 5BMFH 1SEQL 4WUKH 3IKCA 4CADA 4FQXB 3WNOA 3C5JA 3MRIB 3WHXA 1C16B 3EOBB 5CJOH 2VDLH 4HFUL 5ISZA 5FOBB 3VFOB 3RWJB 4NRYA 5IB3A 2APTA 4ZODA 2P8MB 3QIBC 4J1UA 4Y5XA 5ERWA 4DZ8B 5HHXL 2RFXA 4Q74A 3S3JA 4JJ5B 3UPCA 2YZ1A 4PS4H 1QO3A 2WZPD 1UWEL 2V9QA 1N5AB 4ZPVB 2W60B 4GKZA 4N90E 4G8FB 3VFSB 5IHBA 5JXED 4YBQC 4WO4D 4K7PX 1JZ5A 2PCPB 4P2QB 1F6FB 1WIOA 1BVLB 2LU7A 3HE7D 2CQVA 4F37K 1BEYH 3B5GA 3LKRB 4JQVC 4OQTL 4OQ1A 1Z0MA 2BC4B 1R24B 4ODWB 2GJZA 4F7PB 1TXKA 4XPBH 4ELME 1RUML 1R3IL 1A1OB 1RIVH 3QG6A 4OCYH 5KSAD 1JV5A 3D3VA 4JO3L 4JO1H 4YHOL 3LV3A 5ILTL 1UWGL 3MGAA 1X5GA 3KPTA 4X7SH 3E2HB 2D7OA 1EEYB 3LN4B 2HJLB 4DGVL 2PTTA 1I1YB 3E1F1 4NO0A 4X83A 3F6IA 3MV9D 3ZYIA 5IF0A 1A7PH 4JN2A 4JZOA 5H8DA 1MEXL 2QSTA 4WW1B 4ZDHA 5EIIB 3VG9C 4KUZH 5IMMB 2ZOLA 2J8UB 3ZKMC 5D1ZD 1CVRA 3LDBC 1TJGH 2GK0A 1SM3L 1YEKL 1YNTB 3Q6FA 5I16A 5SX4H 3W11C 3CUPA 1RY7B 1ZWIA 5IROA 2I9TB 4KJQD 2X4OA 4M61A 5IG7A 1E27B 2NYYC 2VDNL 5BXFA 3RWGA 4IMLA 5DZOA 1T0MB 2W65A 3WN5C 1JF6A 5CEXA 5E1AB 5J1AB 5C0AA 5FHAH 1D9KD 4JPWH 3S36L 1ED3A 3BAEL 1KCVH 1UXWA 2UUDH 5T5FL 1PKQB 3L3IA 4OV5B 4JRWA 4PD4K 3RVVC 4M62L 3QXDB 1TJIH 4OZ4B 5K59F 1ZLVH 2HJLA 1QFHA 3I6KB 3RWFA 1XGQA 2MPAL 1BIIB 2JTDA 3DO7B 2P8LB 5D7IA 1U8QA 4OKDA 4Z95H 2WSKA 5ACZA 2R69H 4XX1G 1UZ6E 3W0WB 2ZUSA 5D7KD 1R5VB 3ARFC 4XVJH 4YDKH 3TCLA 1SY6A 3JTTB 1A21A 3IFPB 3KPOB 4LKCB 3ZHDA 5ANMA 3IXTA 1JIBA 2A1WL 5FV1L 4L4JA 1A7PL 5JORA 2DTMH 3C6SB 4QRTB 5D72H 3HMXL 1J0IA 3SKOB 3SKJL 4V2CB 4F7CA 3U0WL 3MZGB 2J8OA 4PJAF 4JREC 4JY5H 1YEKH 4PYHA 5FGBA 3W11D 3CLEH 3ILPB 5IB4B 1MFBH 1G0DA 4LCIH 2R4RL 1P1ZA 3FB8A 4JDZA 3ZTNL 4OM0H 5T3ZD 2GSGB 3RTQD 3T0XA 2EH7L 3KXFB 1CDYA 2NY0D 1R3JA 1F2XK 2X4SA 2OXHA 3GBNH 1AR2A 1SJHB 3EYSL 3BRDA 2X4TB 3MV9E 3R8QA 3VRLF 1RD6A 3UZEA 1HIML 5DRZA 3U30C 4HUXB 3OKEA 3DECA 1GGYA 2VXVH 2YPLB 2NY6C 4ZOBA 4K9EC 3QISA 1KXVC 1EFXB 5EU3B 2VAAB 4QRRD 5JOPE 2ZZUT 5GJSH 2RB8A 3EYFB 4O58L 4YR6B 5HYIA 1JTTA 5GGSA 3WIHL 2R1YB 5CS7A 4RISH 2XXCB 4OQTH 3QT2A 4DKFH 4NNXB 2BZDA 4KROD 3P4LA 3P2TA 3T08A 4WDIA 4J8RA 5DJDA 4D8PA 4PGEB 43C9A 1C7TA 4Z7UF 1K5NA 2ZCKH 5CGTA 5I2IA 4DUVA 2P48B 2X89A 1LILA 3O3AA 1U2HA 3WFHB 4J12A 5F1KC 4JKMA 1PJ9A 4FQPA 4XBEL 4F2MA 3P4NB 4DZBB 3P11L 4R4BA 1R5WB 3T2PA 4LLUB 2VZUA 5ERWB 5C0AB 5C7XL 4XCYB 3PGCA 5ICXB 2Q3AA 3N9GL 3DVGA 4OQTA 1IAMA 1F3DH 3NFSH 5E9DA 2PR4H 1PFCA 1QLEL 1FIGH 1SM3H 1QR1A 5JXEA 3EFDH 3MLTB 4U6XA 3QEQD 5HPMA 3UAJC 3KLAA 2BMKB 4QRQA 3VGEA 5E8PB 3HC3H 3BIKA 1T3FB 2WM0A 5BZDB 1BQHA 4G7VH 3ARVA 1XGPB 1LK2A 2APFA 3IFPA 1A02N 5E6YA 2D31B 2IQ9H 1YNKH 4OZIE 1BM3H 2C4FU 4TUOB 5BJTB 4DGYL 4IRSA 1MFAL 5FYKL 5ICYA 4XNMA 5DYOA 5CEZH 1AIFA 3O4OC 4WFGD 3L5XL 1ZTXH 1KLUA 1S7QA 4P99A 1P2CA 4JO1L 1JHLL 5IV2B 4NQEE 1QSFB 3W9DB 3T0EB 1PKOA 1YPZE 2DQTL 2AAVA 2F53A 2D7NA 4WV1A 5GJTL 3DV6B 1JNHA 3IFOA 2EEBA 2IBGA 2P45B 5MEQB 3H0TA 5TPWH 5ACMA 3GRWA 4FQLL 4YC2B 2X1WL 1R3JB 3WLBB 4HKXA 2F54E 2D2OA 4U3XA 4K3JL 4OLWH 4MNQE 2VTFA 1B4JH 1G9NL 1K4CB 4X5XB 5HDBF 3MRMB 3BD4A 1QA9A 5DK2A 4KHXH 5CD5C 4LBEB 1K8DB 5IKCA 2C4FT 3MV7D 3VXSA 3TT1L 3NZHL 2HTLC 5DUML 4Q2ZA 5AWNL 3VFGL 1NMCB 1YEEL 3O6KH 2DD8H 1HQRB 3VD4A 3DSNA 3EIFA 2HAZA 4N0FA 4Y4HC 4JPIB 3ULUC 3QCUH 3KGRA 3MV7E 2DDQH 2OZ4H 4Y4KB 1AY1L 1MVUA 3IDUA 3O4LA 1L7IL 5JW5A 2XICA 4KRNA 3GSXA 1T7YA 4PR5B 3N1MC 2QADC 4CJ1A 2C3HA 4JFFA 4EUPA 1T80A 4NP4L 2AXHA 4U2YA 4XMPL 4OI8A 4R6UA 1FDLH 1KLUB 1QOKA 4M4PA 4FNLL 5DD5L 3SO3C 1GH7A 3C5ZA 1JGVL 1ES0B 4N0UA 1OSZA 4IRSC 3IXAB 3KPLB 5CP3A 3VWKB 1HKFA 2G9HA 1NCCL 5FDWA 4NQED 4KUCF 1HNGA 3KPQB 1KIRB 4HUVB 1OGTA 4R26H 3O3EB 3HZYB 4EQ3A 4NCDA 1WWAX 4KRLB 1MRCH 4TRPH 4JFZL 4WEBH 4MNQB 3CLEL 1H5BC 2ZSWA 5F7FA 5FO8B 1OAYL 4YE4L 1NCDL 3SKNB 5EC1B 5DGRA 5HHNB 1EEZB 3QDGD 2JCCB 3ULVL 1TCMA 3BI9X 3MRFA 1DUZA 2CR3A 1YPZB 5GGTL 3BP4A 1FFNB 5IB5A 3BHBA 2WMPA 4IJ3C 1JYWA 4N0FB 1D6VL 4PJCF 3LMJH 4HWZB 3V7AE 4CKVX 1EFXA 5EU3A 3D39D 3WIIH 4UOW1 4BSVB 4KDWA 3B5HA 3EDJA 5JXEC 2X4NB 4LHUG 4RAHA 1MCPH 3N85H 3PWPD 3S37X 1FN4A 4L8SC 3VFPA 4K9EH 3L6FB 2ZSVB 3UPRA 4KQ4L 1JP5A 3WFZA 4KK5D 4YLQT 5CBAB 4XVUC 3T2QA 5GS0D 3ULUE 1I9RL 4FABH 2YPLA 3MNVB 3WL9B 4WNQB 5MEPA 4PRIB 4HHAA 2R0KH 3FO1A 1MFDH 2RR3A 3S35X 3KPSE 1IQDB 3MR9A 5DUBA 1XH3A 4G9FB 4LAQH 2KZ1B 3OKDB 4WV1C 1V8HA 4O9HH 1CIDA 1MJ7L 3MNZB 3PL6D 4HMDA 3VGHA 5I1IH 1EX0A 4PTTA 4S1QL 3QP3A 4H25B 3WKMH 5FYLL 4KTDH 1FNAA 1PYWA 4WEUD 5GGUA 4JB9L 5T1DL 2X05A 1CDBA 4JHBA 3UBXA 4YBHA 4P59L 2IFGA 4CU8A 4S1DC 2AJ3A 5I8OL 1EEQA 5DO2C 1P4BL 4HX1A 3IAPA 5I1CH 4WUUA 2RHEA 4TVPH 3EGSA 3QEQE 3MRGA 3L1OH 5GPRA 5AZEH 3L5XH 1KB5H 3PHSA 3GBLA 5DQ9B 5EFIA 5TE6L 1T66D 3RWDB 2OP4L 5IJVA 1CLZH 1KGCE 4F3FA 1SY6H 3NBNA 1J0KA 3GRWH 3O6FC 4CMMA 1CD8A 2FJHA 3I9GH 5TF1L 2NW3A 3JWOH 4MNHB 3L3OB 4U0RB 2VIRA 4JDVB 3SGKA 1Z3GL 2AGJH 2DJSA 3VFWA 3BEVA 1BZ9B 2YK1H 3ZDZF 5JLZA 5FDYA 1FYTD 4MNGA 3TYGL 2PNDA 5JMOC 3U2SB 1WC7B 2BSRB 2JIXA 3LKOA 1IAKB 4NO3A 5B4MC 2H6PA 3TBTB 3FT4A 4QY8B 1N6QH 2CJUH 3S97C 4OF3A 4X4YB 4BUHA 1OGAE 5JW4Q 4JKLA 3K81A 4HZLA 1TTGA 2BSSA 2UWEE 4MA3B 4YHLH 5DLML 2FHFA 1U6AH 1A3LH 1K6QL 3H9SB 5D1XB 5EO1A 3ZDXF 2IFFH 5D93B 2HH0L 1IC7H 2OS7A 5C0IB 4JFOB 4BH8B 4G6MH 1NCUA 4O2CB 1BZ7B 1FZKA 3VFNB 2YD9A 3DPBA 4DTGH 1HKLL 3SPVA 5AZEL 3MGTA 2D0GA 3MLZH 3GMOB 5GGSY 4IRSB 4UIMA 1S7RB 5LQBH 2VLJB 1SYSB 5C7XH 4M5ZL 1HI6B 1G0XA 2IPTH 5C1MB 2NYYD 1JHKH 3LSOB 5SWSD 1J1XL 4UIKH 4JDZB 1XF5B 3TIDA 3NIDF 4UT7H 2HLFC 4JRYE 1GRWA 5T1KB 5JNYA 2JK5A 1J0ZA 1A1OA 2V5YA 5MHSE 3MJ7B 1DQMH 1K4CA 1HDMA 2C7UB 4PRNB 3S3SA 4Z7VF 1EHLH 2HLFD 5C8JB 3RVTC 5EUOE 1QFWM 1DL7H 1N0XH 1URLA 5EOCH 3RDTD 2NXYC 1J18A 3HE6D 3EO1A 2H2PD 1GOGA 3VMNA 4I18B 4JY4B 4MXVE 5C09B 1PZUB 3NPSC 4L4VB 3O9WB 1Q0YH 3FOLB 2NX5E 1MFBL 3WFHA 3T3PF 2FD6H 1EEUA 4BSWB 5JOFA 4QOKE 5TQ0H 5IVXA 2CO6B 5AEAA 1OW0A 4Z7WF 1FIEA 1ITBB 3VXME 4R0LB 1NL0H 4HBCH 2X9XA 1TZHA 4PPTA 1MCCA 3BP5A 1X7QB 3RVXD 3DUSB 5J8OA 1OAQL 3KPPB 4YDIL 4XP1L 2MKWA 5F9OL 1X5XA 5LWYH 4JFHD 2VL5B 3PV6B 5F3HA 2Q7YA 3ZSTA 2CIIB 2OTWB 1MI5D 4LLWA 4PLOB 5HHPA 3DX7A 3D18A 4OUOA 1EFQA 3ZKSD 1YPZF 3W9EB 2OZ4A 5DWUH 3RZCA 2AJVL 3ARDC 3P4OB 5D70L 2ITDA 5SX5H 1C1EL 1P5VA 1EHLL 4NRZB 2BY0A 5E2TH 2ADIA 3FFCE 1EDQA 1G6VK 4C56B 4D0CA 4QF1B 3I3BA 4FQHA 4O58H 4NQUA 3FZUC 1SJVA 3I50L 2WIIB 2F19L 2KDGA 2Y06L 4Z77B 2ZOKA 5D7SH 3ZYOA 4KK8D 3LVEA 4NQXB 5LCVL 1BAFL 1H3PH 2OK0H 3UX9B 1HCVA 3SGKC 3DUHA 5E8OB 1MREH 2EDDA 3QQNA 2NXYD 3VXRD 3C60C 5GRUH 1IGCH 2LVEA 5KW9L 2A6DA 3RVWD 2F54A 2BOCB 5EORH 1U2CA 2E27H 4DKAA 2J6EA 4TNWF 1M7IB 4RMQA 3BPLC 5BVPL 3Q6GH 1KJMB 4PG2C 2R9HD 4BQ9A 5DRXA 2Q86B 5IJKA 2IEPA 1IQWL 4PRHA 4ONHA 4YNYB 3PHQB 4G9FE 4XBGA 5B22A 4HUXA 2E5EA 1OSPL 2R9HC 5IBTH 1HZHH 1HDMB 5DZLA 2PTVA 2VNCA 4K23H 4Y16C 4ZUVB 3UDWA 2A6KA 1YEGL 3GSWA 3MUGA 1RJYA 1AGCA 4DFHA 3KXFA 4QCIB 4E41B 3DI3B 2NY3C 4EUPB 4P5TA 4G6FB 2ARJB 3B2UC 5ESQA 4RMWA 1MJ8L 3Q2CA 4ZXBB 4GRWF 4HAGA 5KZCB 3Q5OA 4L8SA 1CXKA 2C3VB 4G7YL 1Q9WB 4I9WD 3DX6A 3L7FB 4PY8I 4S10A 3QDMB 4HXAL 4ALAH 3B9DA 2H8PB 4YUEL 4JVPA 5AZ2H 1EXUB 3TO4C 4ZOCA 2JJSA 1FO0H 3VFNA 1QG3A 3MROB 5JQHC 1GAFL 2Z91B 4IRJC 2NNAA 4KI1A 1MWAH 2BERA 4WW1A 3TBWB 4UBDC 3VXPA 3QNXA 4WRLA 3O2WL 2DMKA 5EULV 5IB1A 1K6QH 4WFHE 4JFDB 5E99L 5T3XE 1JZ2A 5J1SC 4YJZL 4PFEA 1MI5E 1UB5B 3TVMD 4PRID 2GTWB 4X6CE 3LKNB 1NJ9B 2GI7A 5HYSG 3O4LD 1XZ0A 4N8VG 3DV4A 3S5LB 5B3NA 3S5LG 4TOYL 2ZJSL 3GGWA 2GJZB 4JRXA 3RU8L 3BKJH 2Z31B 4WU7B 5SV4A 3MRLA 2UZIL 2AW2A 3VFWB 2JE8A 1OP3K 3TP4A 2R0ZH 3EHBC 3VGDA 3HE7A 4HMEA 1CTNA 3WIFA 3UTTB 1YQ2A 1MJJA 3RX8A 1WZMA 2E8ZA 4XC3H 4GBXD 1U3HD 3MUY1 5BJTA 4HS8H 1JZ7A 2DKMA 2BHZA 4G8GE 4LRNH 4ORGB 3L9RB 4XVSH 4ZOAA 3UYRH 1R3HB 2OL3A 4MDJA 4Y16D 1A6TB 4QRSA 4TVPD 3BIKB 3FQXB 2VQUA 2DL9A 3HB3C 1FC2D 3ZDYF 4NRXB 3U6RA 1EAJA 3RZCC 2Y1VA 3OAYK 5TDPB 3DVIA 1MHEB 4WTZA 3H2WA 5JIKA 3IDYC 2YUZA 4HUWA 5CBEB 2JJWA 5DVKA 5TFSL 3DSFH 1IGML 1XR9A 4LPYA 3O6ML 5FOBA 1JPTH 5E03A 1RJLA 3G6JF 5HHOD 4M6OH 1BQUA 5F1IB 2LU3A 4R7DA 3IDIA 5I1LA 1A6UH 4JKWA 3IDJA 1PQZA 2XA8L 3CZJA 4HF5H 1F4AA 2HWZL 5IOPA 5A1AA 3T2NH 2ITDB 3WHE0 2OTPA 2X41A 2VLJE 3V8CA 2R8SH 1G7MB 3AS1A 4RFOH 1OAUH 1OM3H 4WU5A 4DGIH 5ALCL 4WI4A 5IR1B 3OHXB 4HK0A 5FUCC 4ODSL 4RQQA 4R96B 1H15A 3TO4B 4X6EB 1J9CT 3RRQA 5F7UA 2HKFL 4ZUSB 4KK6D 1JPGA 5CCKL 3MZTA 5CMAB 4YHNA 2K3TA 5D7KE 4D3CH 3H3BC 5B8CC 3V6FB 3BP5B 4QXWA 2VAAA 3WXWH 5HYJB 1WZ1H 3RZCD 4AZ8A 3MOBH 1A9BA 1BAFH 1H3PL 1MRDH 4N0YH 4XT1C 5E08L 3FFDB 4RAVB 2ZKHL 2HFFB 4JM2D 5FYKD 5ETUA 4DWHA 2BVYA 3O6MH 4Z7WB 4N8VB 5F71A 4LCWA 1OAXH 4LAQL 4C57C 3KG5A 4GRWH 3AU1A 5DJ2B 4M3JA 2FZ3A 5GRVK 7FABH 2M26A 4AM0B 3OZ9L 5E8NA 2YPVH 3WD5L 5C6TL 1OWWA 1AH1A 4F9LA 5F1IA 2FO1A 4HWBL 5ADOH 3AC0A 5F7EH 3SDDA 3BMVA 5HHOE 4AIZA 2ZUUA 4ODSH 3DETC 3TM6A 1QBML 3NIDE 2KPNA 1F5WA 2ADFH 4JPVL 3RIAF 2R2BB 3Q3GA 4WTXA 1G9MC 2DF3A 5C86A 2WW8A 2FDBP 3RWIB 4BFIA 1D9KA 1UM4H 4NPYB 1JUFA 5CSZB 2FX7H 1QFWH 2COQA 4I0PD 1LDSA 3WXVL 1Q94B 4LLYA 3QAZB 3FB7B 3K8LA 4P2YA 4BH8A 5C0IA 4R7NA 3FOLA 3NMEA 5GGRY 1T66C 1HCFX 1F2QA 3VXPB 3OWEA 4MZ3A 3FFDA 4RAVA 5HHQB 1HHIA 1MFAH 2Z35B 4X6FA 2J6EL 3MGOB 4JG1L 2DLTA 1INDH 1S9VA 5GRJL 1J0YA 5KTEL 1MWAL 2QQQA 3P9WB 5C0DA 1S7XA 1A3RH 4XNYL 5FXCH 1OAYH 3QO1A 3VWJA 4AQ1B 1T04A 1PD6A 4LSTH 2AQ2A 4ODVH 2BX5A 4C56E 4FTVE 3ULUH 1HSAA 1AXTL 3IJHB 5IW6B 1WBXB 3DTXB 3QIWC 1KJ3L 1VADA 1NGZB 4X8JB 1CFQA 5GZNC 7CGTA 2R0ZL 3DMMB 3H0TB 3PGDA 4FQLH 5E2WH 1WAAF 3QDJA 4RGND 2J6EH 3U30B 3QI9D 1EBAA 1KN2L 2APBA 1HH6B 3DNKA 4XXDB 5I8CB 2DBLL 3B9KA 3VH8A 4R2GB 1FL6A 1JJUA 2DJ4A 4EI5A 1ZVHA 3KJ6H 1EMTL 5GSVB 3GBMH 1OTUC 2HT3C 1IC5L 5DA0B 3U7WH 5JR1H 3NFNB 2PW2A 4MWFB 2HRLA 4JKPH 1IGYA 1T4KB 4JQXC 3VXRA 4EN3A 4JFPA 4WVRA 5CINL 5HI5D 5IWLC 2B1AH 1MFDL 4PJIA 5F89B 4LPXA 3UXFA 1EV2E 2HFGH 1HSBB 5JHDA 2PO6C 1B90A 2D9QB 2HJFA 3C6LA 3KJ4B 3HUJB 5DI8B 3MQIA 1S7TA 2E7LC 7FABL 1ONQB 4PUBH 2DMCA 4GW4B 5DMKB 5IOPB 3U46B 4MYWB 2R2HB 4OB5L 5E2VL 4CU7A 5E2TL 2H1PH 4A2LA 2PN5A 5IMOB 3UZVB 3CFEB 1G9MH 1QVOA 4MJ5B 1MFCL 3PDOA 2VDPL 5EWIH 1GIGH 3HS0B 4NYLB 2BSED 3QUXB 1FLRH 1HH9B 3CCHB 4NGHL 4PP2B 4U1JA 5FF6B 2R56H 3MRCB 4NNXA 1WZ1L 2EO9A 3B83A 4K71B 1UB6B 2V2TB 5F9OH 1IE5A 2BXYA 3MPCA 4PJGE 5D7JC 1P5UA 1BJ1H 2Y72A 2MHAA 4LLAA 5DRWA 1YEFH 2AV7A 3AB0C 1PW3A 4KRPD 4PRPA 5HY9A 1KPRB 2W0PA 1D9KC 3OXRA 3RY5A 4O4YL 2NY2B 4KKAD 2ZNWA 4E42B 2D0FA 3A6BH 3CH1B 4I3RL 4EOWL 2HVKA 1I3GH 1X6NA 4M7JH 1H15B 4OLVL 1ZVYA 1U8PB 4B7LA 4EI6A 3O3UN 3P0YL 1IMHC 4JQXA 1OGTB 1QSVA 3INUH 3DURB 5FGSA 2PXYC 1A7RH 3C60B 5KW9H 1DN2A 1B0WA 3CLFH 2DQHL 3A67H 3C8KA 4G6ML 4K3EL 3WJLC 5IFJB 1F3DJ 3CSBA 3JV4A 4EKXA 4L8DA 3GMLB 4XBPA 4Y0GA 1K3ZA 5F7MC 4UBDD 4WWKA 3MRQB 4ZO6A 5C9JB 4OAWA 2I5YL 5SX4I 3SJVD 3P0VL 1K2DA 4ODTH 4OSUH 3FTGA 4MA8L 1A64A 3I84A 3RGVB 1RK1B 2YD2A 2P8PA 5JORB 3RHWK 2HLAB 4H1LA 5HPOA 1U8IB 1G7LB 4TULL 4GW5B 2IPTL 3EYVA 1Q72L 3NAAL 4P4RB 2IPKA 1CS6A 3REWB 4X98A 1KC5L 4C4KT 4P2RE 4LLQB 5LKNA 1JGLH 5DJZB 2H3NB 4BUGA 4P59H 3IDNA 5DJXB 3ARBA 5GGVL 2CUHA 4FQIL 5HD8C 3EUUA 1MRFH 3GKWL 5FUOL 1P7QB 1KEGL 3RY6A 2EYTA 5D7JD 1CXHA 1N4XL 4HQQL 2FR4B 2OP4H 1B0GB 3RWHB 1YEDB 1HN1A 4W81A 1JK8A 3T65B 4ERSH 4E9LA 1QUNA 5KVFL 4GT7A 1OTTD 1DFBH 2DQIH 4OIBA 3VFRB 1JPSL 5TF0A 3RZCB 2CGRL 3LAFA 4IRJA 4YZFE 3Q3GB 2VIRB 1ZHLB 4XI5D 1T0NA 3QFJE 3LZFH 3HMXH 2F5AL 4UMGA 2DQJL 3HPLA 2W9EH 5LWYL 4OZGE 3QIBA 2VISA 3GSXB 3RP1A 1J0JA 1AQKH 2ZUQB 5E4IA 4AEEA 4ELKA 4NFDA 3T04D 1MAJA 1GC1H 1MCDA 2H3NA 5E6IC 1I1YA 4NO0B 3K2MC 4JLRB 3L3KA 5I73B 2YSSB 4IIQA 4GQ9H 4CW1A 4HH8A 5CZXC 3CDCA 2FSEB 2OSLB 4IEFB 3QUXD 3ZL4H 3PDDA 4HIIA 5J6GA 1NCWH 3PWNB 3WO4B 2QHRL 4KQ4H 4YHLL 5DLMH 1B4JL 5EZLA 2FJHB 1FGVL 3CDFA 1TJHH 5D5MA 1OB1A 1OLLA 4LNVA 1MSPA 4TYUA 5HYJA 1RZKC 4D0BB 3PIQB 3MRPB 3B43A 3L5WA 4P0DA 3ZO0A 2YKLH 1Q1JL 4ZUVA 3C5SB 2W59A 1A4JB 1H9VA 2X70B 2DLFL 3HNTH 4HUUA 3EOTH 4NC0B 4LSPH 1AD9A 3NFPB 1KPVB 4JRXE 4JQIH 1VKXB 4JVWA 4GG6F 2NLJA 5JHLL 4BYHA 3GSVB 2V5SA 4PJEA 2XZQL 3VD7A 3OBAA 4L4VE 2O5ZH 2NY0B 4U31A 4LCWE 1INQA 3HUJF 1CICB 3CDGB 4PJDE 5DFTA 3VFGH 3EJJX 1BJMA 1X5LA 5FYJE 3WJJC 2ICWI 4NCC1 4F8TA 5MENA 3WNPA 4F37F 3IGAA 1DLFH 4HHAB 1JNLH 2FLRT 3I3DA 2DQUL 3MRCA 1FL3A 4QRPA 4F7EA 3QA3B 1MCWW 3S37L 4LOUC 3BPCB 3OL2A 3CFCL 1RUKH 1CG9A 5GSRB 4IRZH 4Z76A 1BWMA 3KYKL 5C0CE 1XEDA 4AQOA 4JRYD 4UV7L 2Y36H 3O6FB 3RNKA 1P7HL 3OTTA 1DE4B 2GAZB 1HK6A 1M05B 5E2JA 4AT6A 1QRKA 4MDJB 2VDOH 1MCJA 2LE9A 5KVDH 4X80L 4OIIL 1FJ1A 3MLSL 3LQAL 4M03A 4KTEL 2WWKO 4X5LA 1AD0A 2V7HA 2FNBA 3D5OF 4M9PA 4H5SA 4NWUL 5F3BA 2R23A 4JO2L 4U6YA 1K85A 2BSTA 2AEPL 4JR9L 5ANMB 3X11A 3T0EE 4JFQA 1GGIL 4JFDE 4I3SL 3EGSB 4HJ0C 2YPLD 4X9BA 2ERJC 3ZKND 1RHHA 4BM7A 4QRRB 1WVZA 2QQNL 2MPAH 1XFPA 5L8JB 3GSNH 5B39G 3STZB 4U1HA 1C12A 3HPJA 3DOSA 3N50A 1D6VH 2CH8A 4TSAH 5D2LB 5F44A 4Q9BA 4K8RD 1LEGA 5IMKB 2J3SA 1OGAD 1I8MA 1U8HA 1MIMH 3SE9H 2V2XB 32C2A 3VRIB 4KFZC 4TTDC 1X44A 4HKJA 1NAMH 5IMLA 3GM0A 3OKKB 2HT4D 5JLZB 1IKNA 1FYTE 5F7YC 1BZ9A 4CBPA 1B6DA 4KKCC 4KVCL 1YEEH 3O6KL 3N1FC 4WW2F 3PDGA 1CR9L 1F6LL 4U49A 3ZTJH 3MACH 5K9JH 3TYFB 5I1KH 1FV1B 4MDIA 4LDEB 1G6RA 3V5DA 4N0RA 1ITCA 4IMKA 3QXAB 4IJ3B 3ZHKA 1I7UA 3IXTB 3SN6N 1F4YL 1CT8A 4YHIA 3MUGB 3O2DA 1Y6MR 2DQGH 5C0AD 2O61A 3QO0B 4ZMAT 1WFNA 4OAWB 1FNHA 5CJ5A 3DO7A 4TNWK 3TJEL 1NL0L 4O2CA 1S7QB 4PRHB 3QJHB 3S34H 2NY4B 5FYKU 1JI1A 1YNLH 2Q86A 3FO9A 1DQQA 1H3XA 1U9KA 4HS3A 4MCYA 2AXGB 1QA9B 2D7QA 3CD4A 2CDFA 2X09A 4HD9A 2HN7A 4R26L 5TDNA 2YUXA 4B41A 1CBVH 2A6DB 5E56A 2BSTB 1YECH 1TTUA 2BRQA 3CSYA 4XVJL 3F7YB 3UTZB 2JJSC 4MMXC 3HR5A 5H2BB 5C3TA 4XHJD 1LHZA 4QXUH 2I9TA 2HT4C 2V5TA 4G7VL 1NCDH 1QR1B 3PQYB 4U2ZA 5CCKH 3D3VD 1KLGB 5GS2D 2Q6WA 3PWVA 3FONB 3P9LB 2Q8BL 1LP9E 1XGYL 3K8MA 4FA8A 3MNWA 4Q6YA 3CLFL 4IHOB 3LRHA 2D03H 4GRWE 1T7WA 1M7DB 1V3JA 4HCRH 1A7BA 5I0DA 2VLLB 2ORBH 5F6HJ 4F15C 5F7KC 2G60H 4F33B 5DQ9A 5EFIB 4HJJL 1T3FA 4RMTA 2LTQB 5GIRB 2E6JA 2GSIA 3BKCH 4CMHB 2V17H 43CAB 4XVTH 5EZIL 3L3KB 3ARGB 2Y5EA 3TIEB 1ZKAA 4LDLB 1A0QH 4HGKC 2BVPA 3V4VL 4OKVB 3MRHB 4XAWL 4JR9H 1IEHA 3WFEH 4Y4KA 4XCYA 4PJ9C 4RWYL 5FKPB 2IQ9L 3GZKA 2H41A 4S1SH 4YHKL 3X14A 1TITA 3F6LA 2WK2A 4QGTA 4NQCB 5FYJD 1KN4H 1VEPA 4GG6B 1YMMA 1HHHB 3HG1B 1FFRA 3MXVH 1P9MC 4JG0L 1RMFH 5DVMA 3SDYH 5GS1A 2F74B 2BNQD 4LEOB 4K71C 4ONGH 2RJMA 4D0BA 5DHVA 4XP5H 3CMGA 4LDOB 3VWKA 3V5HB 1PY4A 1FFOB 1NFDF 1ZOXA 4X9GA 1CICC 5TE6H 1FN4B 2C5DC 2O5YL 3EYFA 3IDXL 3QIWA 3X3FL 1YY8A 5D1QB 2WNGA 4XXDA 5GRVL 1G1YA 2Q87A 3REWA 1T1WB 1X5ZA 1A3RL 2LAGB 3JWOL 2AK4D 5LGJA 2AEPH 2IAMB 4C83A 3ROLA 2AK1L 2FH6A 4XC1L 1QNZL 3VGGA 2PO6B 3RGVA 3MRDA 5HGBA 3TNNB 2BP3A 3STZA 4N68A 3TV3H 1P4IH 1XF2B 5F97E 5H37G 3GSRB 5T33H 4I1NB 1NGYA 4MHHI 3BP6A 5ESQB 1N64H 5CJBA 1VEOA 2YUVA 2YD6A 3CXDH 3X3FH 1FNGA 4LMQI 1BF8A 4OV5A 1GGUA 4RGOH 2ZJSH 3RU8H 4OD2A 3SKMB 5E2UL 3VFRA 5FHBL 4FQQB 5INCA 5E9DB 3EO9H 2D4DA 2QSVA 3DVGB 1G6RH 4HH9B 2IPUG 4J7RA 3QDME 3TJHD 1Q8MA 4AEFA 4ERSL 3QFJD 4PJ8B 12E8H 2HFEA 2H26A 1YMME 5I73C 1ORSB 3HMWL 2C1PB 2VXTL 4L1DA 4OGZA 3PQYD 2R0LH 1QSFA 4HEPG 3W9DA 3EYQD 3ARFD 4PY8J 5L2JA 4LSSL 3U0PA 1F4WH 1BGXL 4NO5B 4WO4C 1NDGB 3KYMA 4Z9KB 3SDDC 3TF7C 2UZXB 3TCXA 4JKPL 3EW3B 3IU3B 4YFDB 1IGFL 5IHUL 3GMMB 4UV4L 5E1HB 5T3XD 1QSEE 3QNXB 4UAOC 3MV01 5HD8D 5FECA 1EA9C 4XAKE 2ATKB 2A1WH 1UKQA 3ARQA 4I8DA 4LK4A 1KENH 2OX5A 3PL6B 4NKMB 1WGOA 3QJFA 1ZMYA 4Y16A 4GW1B 3UDWC 2XG5A 3RBSA 1MQ8A 3IGAB 3B5TA 5D8JH 5D1ZC 1ACYL 1ZHBB 4WGWB 1BGXH 3VG0H 3V6ZB 1TTFA 3BJ91 2DQCH 4Y1AD 2R0WH 1IGTA 2PYFA 5DK2B 1HYSC 3T2OA 3X3GL 1AKJD 3DX7B 3MFGB 3CX2A 3G6AB 2C4XA 4K9EL 3GJEB 5ID0B 3FO2A 3C2SA 1YJDH 4P2CG 1T2QH 1AXTH 1U41A 5C0EB 1UZ8A 4KJPD 5DMYA 4XRCA 3U9PL 4F7EB 1TZIA 4BQCA 5T5NG 2X4QB 4XNYH 3FQTA 4RFOL 5I74B 1OM3L 5ICZB 4MX7B 5I66A 4I77L 5DJDB 5MERB 4NN6C 2YBRA 1BWWA 5E9DE 5HHVL 5EO0A 4W6YB 4QHLA 5GS1C 3RKDD 3SCMD 1G7LA 2J8HA 1KFAL 1L9NA 4O5LH 1E4KA 2Q8AL 5FA3B 4WO4A 4POYA 4YGVA 4HUMB 4HS3B 3VWKC 1A6AA 4NJ9L 5C9KA 4X7EC 4DAGH 4LMQE 1LEIA 1CDJA 4F57H 3EOAA 1FC1A 3FN0H 3U9PH 1AXIB 4F7MB 2OTUA 1MLCB 3E8UH 4LFHG 1U93B 1DDHA 4MQXC 1NBYB 3MJ7A 4P23C 4U05A 3QRFM 4I3GA 3DRTA 1QP1A 3MJ8B 1LWRA 5F6IC 5LG1A 2AXFB 3QIBB 2NXZD 4PP1D 1WBXA 4GAJL 3FCTB 1MH5B 4XVSL 4DVBB 4QWWD 1UG9A 3FONA 5T1KD 1ZEAL 4KJPC 4MQ7B 3TT3L 5DMGD 5HI3D 2B2XH 1YNTA 4CMHC 1NBVL 3MRNB 4EN3D 3C8HA 1U8LB 4NN7B 4RGMB 1TFHA 2H32H 3BW9B 3BP7A 5JXAH 2VL5A 1C08B 5D9SB 2W07A 2YZ8A 5DD3L 3I3EA 1OF2A 5D6CA 4I2XA 1UB6A 2V2TA 2Y5TB 3SCMC 5F88B 2DWEB 4PY7A 5HYFA 5ELIA 3ZSSA 5LQBL 3RX7A 1LDPH 1ZK9A 1P6AB 3LEYH 3BQUC 1B88A 5EBLB 2P42B 3QJHA 4J3OC 2P24B 4DCQA 1U8QB 4G5ZH 3GMPB 1JPSH 1QFPA 4HUNB 1XR8B 2IFFL 3BZFA 3MXWH 3OR7B 3ISWA 4HUUB 4S1RL 5C2BL 4OD3H 5IFAL 2WP3O 4R97B 3H6JA 4WFHD 2R2HA 3O2DL 2EE9A 5DSCA 4CVUA 3BH8A 4ZTOL 1TZGH 3S8WA 5GISL 3P73B 2G2RB 2EC8A 3LS5H 1T03L 1OB1B 4O51A 3H9SE 5JZ7D 3OKYA 3MODH 2V5RA 4P3DB 1MHHB 1E4JA 3L3OA 1I3GL 2QSQA 4MJ6A 4ODUA 5JPNB 1D5MB 4UOW0 4UUJA 4OGAD 4KJYB 5DD0L 2EDXA 3ALXA 2ID5A 2BNRB 4LSTL 1ZGLP 1MCRA 2Y7QB 4PJ9A 5L88L 5D1ZA 2DS4A 4HPYH 1ZT4B 3U36A 3HE6A 2XPGA 1EXUA 4ZO7A 4XCEB 1WV7T 2ENSA 5LGKA 1SY6L 1SYSA 3MRDB 3L3HB 3QIUB 4YHPB 1FH5L 2EYRA 1UJ3B 2NY3D 3HC4H 4GW5A 3BPCA 1LVEA 5IROC 3CH1A 4F9LC 4XX1E 4MA7H 3HG1D 3D48R 2Y6SD 4W4OC 1QBLH 2PXYA 2DLFH 3HNTL 4F7PA 4WTWA 4NT6B 2ADGB 4XTRD 3BEWA 2V6HA 3BWAA 4X5WB 4X6EA 4IMKC 3WE6B 1TZGL 3GBNL 3IFNL 2DYPD 5BZDA 2ADFL 2PCPA 3VXTB 3WDHA 3GI9L 2ARJQ 5SV3A 3OKNA 1EVTC 1T04B 4U6XB 4LPTA 4EBQH 4L5FL 1F02I 1CL7L 2V2WB 3K8KA 4HWBH 5CZVL 5IJKC 4BH7A 5B39B 5ISZE 1T6WA 4JDVA 2PW1A 5IB2A 2IADB 4BSJA 3EJZC 5E8OA 3HFMH 1RURL 1QNZH 2IPKB 3HZMB 4D9RE 4XPHH 2AJYL 4ZS6D 4NQXA 2ZCLL 4PJHB 2DLIA 4NQVA 4E41D 5E24E 3UP1A 3BWUC 3B3IA 1CDCA 4N8CH 5IEHB 3QQ9C 3QHFL 3QIWD 3CCHA 4FQ2H 4G6JL 4PP2A 1G9ML 3BZ4A 5LBSH 2NY1C 4OZFA 2PYEE 3WIIL 4PGBB 4EN3B 3EOAB 2Z31C 3TWCH 2I07B 1DQTA 4WHYH 4HWEL 3OAZH 1T1ZB 3QQ9D 1AQDA 4O4YH 3DETD 5BO1H 3VFUB 4XPTH 3HB3D 1TETH 1HHGB 4FFVD 4U7MA 5IIEB 3GO1H 5GS3A 5FA3A 4GRMB 2NTFA 1YC8A 4OLZH 3KDMB 3GSVA 2IMNA 3BT2L 2F53D 4OFYA 2QHRH 1JWUA 1D6EA 1NCTA 4MLIA 1KTKE 1LO3H 2ICEA 3EOYG 3QWRD 3ZL4L 2C9AA 3NIFE 1QTYT 4NWUH 4EI5D 3V6OA 5C0JA 4JFDD 3MBEA 1MCNA 2UVEA 3MNVA 3WFCL 2OMNA 1MF2L 1EUUA 1ERNA 4G3YH 3L3JA 4PB9L 3QUMH 3QIUC 1QO3B 1X3DA 1B9ZA 3TH4T 3MRJA 3QRGL 3DIFB 4NZTL 1UXSA 2FJFA 3INUL 5KSUB 5JOFB 4Y1AA 2VZVA 1I7RA 2DOCA 3QFDB 3T3PE 2VH5H 3HN3A 4MB5A 4OF0A 4HC1A 4N8CL 2HFFA 4NQVB 4TTGA 3ILPA 5I1HL 5CD3B 4P5TD 4MJIA 2BY1A 1CGYA 1QPXA 3QUYA 2BHYA 3KPRE 3LRGA 3O8XC 5IVZA 1MHCA 3SKOA 2BDNH 1GGCH 1DJSA 4XP4H 5F7LB 4QRSB 1BX2B 5A16B 1OARL 2FYYB 5JR1L 3QPQC 5FB8A 4JFZH 2HVJA 4HDIA 4AIOA 2NY2C 1ZSDB 2NY1D 2CKBB 1PKQE 5C0FA 1WFTA 4U1NB 1HEZB 1DFBL 2DQIL 5J12B 1E4KC 2VDOL 2O5YH 3IDIB 4KXZI 1FAIL 3KPQA 1LK3L 1KELH 2AJSH 4KAQL 2CDGA 5J1TC 4LCYB 4AJ0A 1OSPH 4JGJA 5IBTL 1YQVH 3CXHJ 5AD0A 2J12B 2NQCA 3U9UB 3MLPA 1CD9B 4GKSB 2F54B 3QIUA 4HUKB 4AG4L 5B38G 2IPUK 3VH8B 4XCNA 5CJQH 5F1NA 4LKXA 4ZPTB 4ZFZB 3EO0A 1FQ9C 5EC2A 4XNXH 5GRYA 2J8UA 1VFBA 4HIHB 2W0FB 2DD8L 3GIZH 2BK8A 4CDGC 4WHYG 3L3DB 3QIBD 4PJ9D 4JN2B 5B8CA 3I6GA 4OLVH 3GFUA 1LE5B 4MQTB 4NUJA 1YEJL 4MNHA 5HDBE 1LNUA 3KPRA 1LEKB 3DARA 5ICXA 1C5BH 5KS9B 3QCVH 2G2RA 3NCJL 1Q9KA 1BPVA 1ZLSL 3MLYH 3Q1SH 1J1PH 2DB8A 1YY8B 3OB0H 1FNSL 1CGSH 1RUPH 5K9KB 4DJMA 4OZGB 1NC2A 3QEHB 2X42A 3OJDB 2O5XL 3OG6B 3MREB 3VH8G 4U1NA 1X5IA 2XTJC 2EDQA 3G9AB 4JZJB 4M43H 3TO4A 5L9DH 3D69A 2Z35A 1RULH 1YDPB 1P9MA 3RA7H 4M6NH 1YYMH 5DHVB 5EBWA 1G84A 3GSUA 4GSDH 3GUTA 5J4MA 4OLUL 4RAUA 1L0QA 3KPPA 3SGJC 1B0RB 4XMKL 1IL1A 3HI1A 3V6OC 3RTQC 1KIQB 4G9FA 2OQJB 1NBZA 1YY9C 3MR9B 3GIZL 3K0WA 4PV8B 2H8PA 1OHQA 2VLRE 4XNQB 5CUSL 1P6FA 4JPKH 1JYXA 5FOJA 3U0TA 3L7EA 4OLEA 1U6AL 3NAAH 3IJSA 3TFKC 3LKPB 2MSPA 1UQSA 1KTLB 3SO3B 3STLB 1CGWA 1KJ2B 1OL0A 5ISZB 2X4TA 4AIZB 3OR6B 4N9GB 4PJXB 2AXFA 2I27N 1CU4L 1A14H 5BV7C 1FNEA 4N0CD 3C2AL 3FB8B 1Q9OB 2A6JA 5J13C 1UFUA 4Q0XH 3BKML 1P4LA 4WI3A 1UM5H 2ZCHH 3RI5F 3QZWB 1W72L 3BMWA 2R4SL 3HKFA 3UC0H 1YA5A 2JB5H 1E4WH 3CXHK 1MQKL 5C0JB 4K94H 3NIGF 3RVVD 3ZTNH 5CJ8A 2XWJA 5C0RL 4K3GA 4UU9B 3QWRA 5ALCH 5F96L 1F00I 4LARL 4APQC 3FO0L 1QLRB 4L3AA 3L1OL 1VFBB 3GMMA 4PJ8C 5AZ2L 2ORBL 2C3WA 5FM4A 4P5KB 3ZKXC 2UVFA 4KZDL 4RX4D 1OD9A 4OUUA 1A6ZB 1JNNL 1U36A 1Z2KA 1WLHA 1LQSR 5I1HH 2IBZX 3KJ4C 5EOTA 2CDFB 1FL6B 1F8TL 3KPSA 5JOEA 2FH8A 4Y7MA 3IRZA 3B9KB 3ULUL 4RAUB 1DN0B 4JY4A 1BD2D 5DTFB 2CMRL 5DEGA 1H5BA 3LEVH 4EXPX 3JVGA 3QZWA 5EZJA 1KULA 4OI9A 3MCKA 3HI5L 3QUZB 1HZHL 1SMAA 5EZOL 3GSNA 4XNUL 3GB7B 1TJHL 1BJ1J 5C0FB 2EYSB 1WISA 2VDRL 2IAMC 2FX8H 4EN3C 2I9LB 1ZSDA 3SDXE 4X7DC 3QH3B 4BFEA 5DJCB 1NAML 5J3HD 4JHWL 4Y8DC 4ZOEA 3WFBL 4YHPA 2DN7A 1RZJH 1VGKB 3L3HA 4YO0A 3BWAB 5GISH 4KZEL 2QEJA 5C08E 2A9NH 3D0VA 2VDMH 2CDEB 2E7BA 3PWJB 5C70A 5HYQB 4PJGA 2VZOA 3EO0B 5EC2B 4JFOA 3KPMB 3MXWL 4N8VA 2DWDB 2WBKA 4YGVB 1JHLH 4L4VA 3T09A 1G1CA 5EOTB 3MLWL 1YJDL 3W0WA 4Z7UA 1CQKA 2HFEB 3TH3T 4FQ1H 5L2KA 3WIFB 3WLBA 5HYSB 5CP7A 3E6HA 1XH3B 3OJ2C 1C1EH 5CIPB 1TQCB 5D7LE 3GSQB 5DT1L 5EA0L 5INCB 3HI5H 4JJHA 3GHBL 1FSKC 1KBGL 2AJXL 2CK2A 3UMTA 5E2VH 4XPGL 4M6OL 5MEOB 4WCYH 1U8NA 3OAUH 4OTXL 3U48A 3AAZB 4KHXL 4YIQA 2D4FA 1LEKA 4FQHB 1J1XH 1NAKL 3VXMD 3QDHA 4NHUB 4MA1B 3B2UD 4PJ7A 2Z93B 5FCUH 4LGRB 1OAUL 4FN0A 3LRSB 4ZYKB 1QSFE 3ARYA 3SOBL 2G75B 4DEPC 3FAXA 3ECBB 3O3DB 4W4OA 4QTHB 1QZ1A 2IAMA 4BZYA 4KROC 4GAYA 3RWEA 4P2OC 4PRPB 1YEGH 4KKLD 2ZOLB 4LCCB 3BP7B 3EOBA 4YHOH 1QBLL 3O45A 1H3TA 4HX1B 2Q7YB 4R90L 4MD0A 3QNYA 2C1OB 3VXUB 5KAQF 4PRDB 3DXAA 1IEAA 3U0TB 1MHEA 1JCKA 2DBLH 3WO4C 4OGXH 1X9QA 2P7TB 3TVMC 4PJFE 3FT4B 1HXMB 4A2MA 5KSBA 1PX3A 3BVNB 3QG6B 4YDJB 4DK3A 4CNIB 2FECL 3GM8A 1WBYA 2ESVD 3PABA 35C8H 2CK0L 3D39A 3I6LD 4TUKH 4M48L 5DXWA 1A3LL 3O9WA 3WLWD 3O3EA 1YMMD 1F90H 3DUUA 1CN4A 2IQAB 5D7SL 1AD9B 2WUCH 2ICEB 2OR9H 2J5LB 2WANA 4EUPH 5TDOA 5E5MB 4EEEA 2FWOB 3MLZL 2JB5L 2XY2A 3ARED 3SDYL 2R4SH 4WY7H 5EU4B 1BLNB 5C2BH 1S3KL 4S1RH 5GRUL 5SWQB 3R06B 5JNYB 3DV4B 3S5LA 4YHZL 5CJQL 5J7CC 1XF5A 3TIDB 2ZPKL 2XWBB 2A9ML 4UNVA 3MUZ1 5ESAA 3RY6C 2Z4QB 4HUWB 5I6XC 1ROWA 2BOBA 3ARDA 5C0NC 1T7XA 3AXLB 5HHMB 3ULUF 2EIEA 4NBZB 3AY4A 2CJUL 4IRJD 3QUKA 5HGDA 2VOTA 3V4PH 1RUPL 2DDQL 2OZ4L 4KZDH 2JCCA 4FFZL 2EICA 3S6CA 3VFVB 4RSVA 5DD0H 4PTUB 4PRIA 3CPLB 3N0PB 3P9MB 2F58L 4YXLL 5M7QA 2CGRH 1I9RH 4FABL 1KNOB 2FD6L 1MJJB 1LE9B 3U4BL 1JRHI 2P49B 1QRNA 5DJCA 4JANA 4LSDA 4S0TD 4HCRA 1AE6H 5ID0A 1U91B 2BVQA 5DMIL 3ZT7A 1KIUA 1N4XH 4HLZH 4WHTB 3GHBH 5E8DH 1K9TA 1NEZG 2N4IA 3O9WC 4L3EE 3EYOA 1EAPB 1UEMA 1AXSA 5DJYB 3WS3B 2MCG1 1P84J 4PGBA 4OCRH 1G7HA 1NUFA 5KVMC 1G7PA 3PP3K 4JFFB