1PDQA

Polycomb chromodomain complexed with the histone h3 tail containing trimethyllysine 27.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein
publication title Molecular basis for the discrimination of repressive methyl-lysine marks in histone H3 by Polycomb and HP1 chromodomains
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Structural protein
total genus 11
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2003-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pdqA00
1IL8A 1DOLA 1VMCA 2B2VA 2EE1A 3D6WA 4XT3B 3TN2A 1ICWA 3QO2A 1WTQA 1F9SA 2K1BA 1U4MA 1BO0A 1DZ1A 4ZKBB 4CJ1B 1BF4A 1RTOA 2FINB 1IKLA 2X6LA 4ZAIA 4IUVA 2B2YC 2Q8RE 2K03A 1J9OA 5E4XA 2K05A 2BDNA 2EOTA 3I8ZA 4CJ2C 1G6ZA 3IFDA 5CBAE 1AZPA 1IKMA 3GV6A 2KECA 1B53A 3LWEA 1XYIA 1U4PA 1G91A 1X3PA 1PFBA 2FFKB 1KNAA 5EPLA 1Q3LA 5AFWA 2K28A 2M2LA 2L12A 1ILPA 2KEEA 1WTPA 2XIWA 1MSHA 1DOKA 1ESRA 2HDMA 2JP1A 3MTSA 1QNKA 2J7ZA 5CORA 2B2TA 2RVLA 2N55A 4HSVA 4QUCA 4ZLTF 2HDLA 1WD0A 3KUPA 4XT1B 1X3QA 4R8IA 1HA6A 5CMDA 1NAPA 2HCIA 2RSOA 2R3ZA 1RHPA 2FJ2A 2EPBA 4OIJA 5EJWA 4IUQA 3UI2A 2KOLA 5JJZA 2B2YA 1BNZA 1NR4A 2IL8A 2L4NA 3F2UA 2DY8A 1EQTA 1CA5A 3Q6SA 3GV3A 4DN4M 2MGSA 1WTRA 2L9HA 4IUTA 4R9WA 1HHVA 2DY7A 4CJ0B 3DEOA 3FDTA 4HAEA 2L1BA 1SSOA 1RODA 3SVMA 1LV9A 1ILQA 4RWSC 1HRJA 1X32A 3N52A 2N88A 2MPMA 5D14A 1C8CA 1EIGA 1EOTA 4RAUC 1QE6A 2D9UA 5EPKA 1B2TA 1A15A 2VXWA 1TVXA 2NWGA 5D65A 4HCSA 1J8IA 2CVRA 3ONAB 2RA4A 3IL8A 1F9PA 3I90A 4IURA 4X3SA 5EKIA 2L11A 1QG7A 1B4OA 1O7ZA 2B2UC 1B3AA 1RTNA 4MHEA 1AZQA 1VMPA 1HUMA 1PFMA 1S4ZA 1SAPA 3FPUB 3KBXA 1JE4A 2RSNA 4QUFA 3G7LA 1KNEA 2B2WC 2K01A 4ZK9B 1WD1A 4NW2A 1ZXTA 1MGSA 1F9QA 2MP1A 4UAIA 2JYOA 1BBXC 5DNFA 4LMQD 1GUWA 1WTXA 3R93A 4ZKCB 1B50A 2NZ1D 3HP3A 4O42A 1F9RA 1G2SA 1WTWA 3MWYW 1EL0A 2B2TC 2KUMA 2NYZD 2B2VC 2Q8TA 2K04A 5EPJA 4X3TA 1CA6A 3H91A 5EQ0A 1WVLA 1F2LA 4U68A 1HUNA 4HEDA 2SDFA 4X3UA 1AP0A 1EIHA 1O7YA 1PFNA 2B2UA 1DONA 1MI2A 1M8AA 2HUGA 1U4LA 3P7JA 1ML0D 4XDXA 5COYA 1NCVA 2KVMA 1SDFA 2B2WA 3I3CA 5CBEE 2H1EA 4MN3A 1MSGA 4X3KA 1G2TA 4OIKA 1HFNA 2HCCA 1HFGA 2X69A 1JICA 1PDQA 1O80A 1PLFA 3I91A 4RA8A 1DOMA 2FMMA 1WTOA 5E4WC 1U4RA 3TZDA 1WTVA 2FHTA 1E0BA 1NR2A 3DM1A 4IUPA 3DEPA 2KEDA 4IUUA 5T1IA 2MJ8A 1CM9A 5T1GA 1RJTA 1XX8A 2X6GA
chains in the Genus database with same CATH superfamily
1VMCA 5C3XA 3JAML 4RHRA 3VYRA 3OHXC 1CQFA 4LW1A 2R92G 2ZJQA 4X6AH 3M7NA 4IUVA 2UXDL 3L2PA 1VF7A 3K58A 3VYTA 2EY2A 2BCOA 1RKNA 1UUPA 2CQAA 1U4PA 1FNVA 1WI5A 4A3DH 2RCFA 2L12A 1LT5D 3VA5A 2PI2E 4HIOA 3X3MA 5A2QE 3J81j 5C0XJ 2GVBA 5ELDA 3TP8A 4R8IA 2E2HB 1E7ZA 3S16H 3PUXA 4R4OA 2NB0A 4JOIA 1X3FA 2F0HA 2MGSA 1WFQA 4K8JA 3CD6A 1NMGA 2VQFQ 1NBWA 1X3GA 1P16A 5BR8Q 1SSOA 3EVQA 3CCSA 4IZ8A 1EIGA 3NQIA 3HKSA 3BJUA 1Q86C 4A3KB 5CV9A 1L1OC 2H5XA 2B3GA 5A2QL 4CGYB 1XMQL 1HZ9A 2Q2UA 3I90A 1SYDA 4DR1L 2EXZA 2E74C 2QW7A 4CKCA 5C44G 1EWCA 4ULLA 4EQNA 4A93B 1LTID 2L0CA 4A3KH 1JB3A 5ELBA 1IYUA 4JC0A 2QDBA 5IP9G 1F9RA 3NWTA 1XTCD 4ID6A 2MUYA 5KEEA 4DR7Q 4GNXC 1STBA 5IIFA 4V190 4QQBX 3J7AV 1AFPA 4HIKA 3HOWB 3FHWA 4U68A 3NWSA 4RH6A 2NZHA 3K5LA 3CCVA 1ML0D 1EY6A 1G6PA 3H3VC 3AQQA 4EQ5A 1Y1WH 2CKZB 4BA2I 1Q1EA 1SFOH 3HFZB 1HFGA 4ODGA 4QGUA 2D0OA 2XRQD 4RGTA 1EY8A 1K83B 2EVBA 2UUAL 4DAYB 2DN8A 4X66Q 4IUUA 4ZYSA 1P8LA 4WJWA 1RJTA 4V0BA 1IBKL 2X6GA 2WKCA 4DUYL 1TWGB 1H9SA 3BDOA 4KN7C 4JYAQ 4DV2L 3D4RA 2Z4HA 2Z6KC 4HJ5A 2NN6I 5JEAG 1SJHD 2F0DA 1PRTD 4A4IA 1LYLA 3CCJA 4K6DA 2RKSA 1A2UA 5IOCA 1G91A 3R3OA 1TWGH 4IQZA 1K28A 5A35A 1I5FA 4HJAA 3T56B 4BS9A 1CKNA 1Y14B 4Z9CB 3PO3G 3CAMA 1BCPF 3F2CA 1SJED 2F0VA 1XPOA 4OX9L 1VQ4A 2NN6H 1ZEQX 4LF9L 4F88A 1D2BA 1NR4A 3NBIA 1ENFA 2E2JB 2F0IA 2AHOB 1DD2A 2L9HA 1R9TB 4X65Q 3FDTA 1CTMA 1V1QA 1Q82C 3M4YA 3N52A 1OXXK 4B3TQ 3MXGA 4LWCA 4LF7L 2EYOA 4QMGA 2XSCA 5C3EG 2E2JH 4A3FB 3M3YH 3OW2A 1YHAA 3A5UA 1LT3D 1N32Q 1TT2A 3Q24A 3ULJA 1VMPA 2H4OA 4BY1B 5CV4A 2OEOA 4BA1I 2MP1A 3N6RA 2JA5G 4C56C 2L55A 3MVVA 4RKBA 2OTLA 3A54A 4JG2A 1PYWD 3ND9A 1VQCA 5M3FH 4APVA 2LKVA 2CW0C 5I9OA 4KKUA 2B2VC 2G9HD 1AW7A 1YJ9A 4BY1H 1Q8IA 3VR2A 5KNBA 4J6HA 3TMEA 1MKHA 4NB3A 4DV3Q 2HUGA 5COYA 4XDXA 4IUNA 4QCLA 3HGBA 4DR3L 1DM0B 3QIAA 1V8QA 3ULLA 4A3MG 1STNA 5C5MA 2IY5B 1VQIA 3DM1A 3DEPA 1AN8A 3BU2A 1IL8A 4XT3B 5ELOA 4JBMA 2EYMA 2VY3A 4FF3A 2F0PA 3A8IE 5ELFA 3GTPH 3MXPA 1IXRA 5CYUA 3A7LA 5EGTA 4ZKBB 5GADC 2Q8RE 4UP7A 2NVTH 1PZID 2A6ED 1SNMA 4LFAQ 3NTKA 5GROA 1MBYA 3NBHB 3LWEA 1VS0A 2K4KA 1N34Q 4OONA 4B3RL 2R92H 2PZWA 1AEXA 3EN2A 1J5EL 1NMFA 4A3EB 3T4AC 3E0JA 4K6LA 4DK3C 4KY5A 1VQMA 4JCVE 2RVLA 3H94A 2ICIA 3KUPA 2K14A 5TSSA 5GAEC 4K5WA 5E3FA 1PTOF 1PZKD 1JE5A 2PCFB 4OIJA 5JJZA 1W2BA 5IGBA 4GKJL 2K5NA 2ZXRA 3EQLC 3GV3A 2F0MA 4RG1A 4BXXH 4UY8C 2ASBA 3J81i 1HHVA 3CF5A 1SE4A 3C46A 1JWMD 4DV0Q 3DEOA 2M9VA 3D3RA 4LUOA 3K0YA 2F0KA 1S72A 2N88A 1BCPD 5D14A 1C8CA 1EOTA 4RAUC 2D9UA 5FO7B 4NXNL 1JR0D 3GTOB 4JI6Q 4JI5Q 3KDFA 4FP5D 5C44B 5KRUA 1NTGA 1AZQA 1TXYA 5I2YA 4CBVA 2EY6A 1FR3A 2F0UA 4DV1Q 1PVOA 4UAIA 3GTOH 3Q8DA 1M1KC 3M4QA 1I50H 4TSSA 1SLJA 2B2TC 3WOFA 2C9OA 4OXPA 5C44H 1V1PA 4NP5A 2RQXA 5LL6S 3MAQA 1D5XC 1WCMG 1JOOA 2KCNA 1HNZQ 4HEDA 5IP9H 5C4XB 3S14B 3VR5A 1JORA 3VR3A 1PFNA 1YVCA 2P5ZX 2JN4A 4L5RC 2BA0A 1EY9A 4PNYA 1L1OB 1HFNA 1HQRD 2X69A 3Q0AA 4RA8A 4GOPB 1N33Q 1PH6A 5CGKA 3WOEA 4LUZA 3RUZA 2VQFL 4A76A 1CM9A 3SR1A 1LT4D 4QJFA 5C4XH 2DUDA 3S14H 3HOUB 1L0YB 1BKBA 3PGZA 1LABA 3MXUA 3FMCA 5M5XB 4GN4B 1BF4A 1ESFA 1IL2A 1J9OA 3IKJA 4OL7A 4H44C 4BY7B 3GTGH 4DV4Q 1PFBA 3H09A 3H0GG 4G7ZC 4GLAC 2K33A 5JEAH 3H3VI 4DKAC 2OT2A 3TS0A 5M5XH 4QUCA 3FRPB 1X56A 2R7ZG 3CCQA 2NVQB 3Q22A 4FXKC 5JVH3 4BY7H 1RHPA 4DR7L 2PI2A 1FYCA 3RZOH 3DMUA 1STEA 2IL8A 1FVIA 1CT1D 1K3BC 3A8JE 1A63A 2PQAB 1I4PA 3H3VH 4FF4A 5M3MG 3SVMA 4FXDA 2NVQH 3ICEA 4H13C 1H9RA 2CHBD 1QE6A 3HS0C 3SK8A 1BVSA 3KLSA 4WRDA 3KLWA 3B6YA 4JV5Q 1D5ZC 3CXCA 1EFWA 4X66L 3I73A 1S5CD 1YNND 1B4OA 2N49A 1HUMA 1SXTA 2IX3A 3VDYA 4DK1A 1HJPA 3MXNB 1VQ6A 1E22A 2UUBL 1KQSA 1OXUA 3HOVB 4DUYQ 4BBSG 5LMNL 3LWUA 2MO1A 1C48A 1CUKA 4PMWA 3GTKB 1EIFA 1JWSD 1F2LA 3KLRA 4AH6A 2A74C 4DAYA 1JT8A 3HOVH 5IYDG 4DV7L 3KYHC 2LXKA 1VF5C 4HN7A 4DAVA 4IJLA 2B39A 1ZYRD 3I4MB 1E1OA 1EY0A 4XTCS 4A3JG 1EOVA 3F2DA 1FNWA 4KJOA 2K5HA 3CCUA 4LF9Q 5AJ3L 4PMCA 4A3MH 4PQXA 1BO0A 4R4TA 5C4JB 2EOTA 3A7AB 5M5WH 3HOZG 4CDFC 4FYDA 2ZTCA 2FFKB 1N32L 5I6YA 2F0NA 3S2HB 2B63G 4GN5A 1S5BD 2XIWA 2JP1A 3PSIA 2IPKD 4DAMA 1VQLA 3CU7A 3NTHA 1NUCA 2ATWA 3UI2A 2KOLA 2XWJB 1YEZA 4XYOA 3ZJYC 3KOJA 2RHSB 2LS01 2K7VA 4QY7A 1LV9A 1AE2A 4HJ9A 1MD2D 1WOCA 2R6GA 3QR8A 1SRUA 3PF5A 1NJIC 5EPKA 3K7UC 4K8IA 3F8TA 4JI8L 1CZGA 4RGOS 2CVRA 4IOAA 2AQ2B 4IOCA 4DR3Q 1PTOH 3K57A 5EKIA 3D8GA 4P74A 2OXPA 3T13A 2B2WC 2WIIB 2BH8A 1RD9D 3FKIB 4K5VA 2G9DA 3G4SA 2MO0A 3QG1A 5I4DA 1WTXA 4LFAL 1DCZA 5FK9C 3MWYW 1N34L 1HH2P 2F03A 1XPRA 2PMZE 4IPGA 5LMUL 2JA7G 2AQ1B 5ELNA 4OGQC 4G7HC 2SDFA 1K8AC 3E6ZX 2PW7A 2L5TA 4B3RQ 1LUZA 2R7FA 1PRTC 1WCMH 1AE3A 1G2TA 1XMOQ 4TQUS 1GO3E 1W3SA 3K59A 1IBMQ 2GN5A 1PA6A 1VQBA 4XYQA 1F2YA 3TZDA 1X65A 1XTDA 4A3IB 4OO1G 2KHSA 2F4IA 4DV0L 3LX0A 3NBHA 5IWAQ 4HMIA 2EDGA 1E2WA 1EU4A 4HMJA 2PMZB 1SR3A 2QDLA 1RTOA 1Q90A 1EQRA 5C4ZA 5DM73 3PQIA 2JA8G 4K2LA 4JI6L 4JI5L 2PQEA 3D6CA 1Q1BA 1V1PB 4P72A 3P20A 1Q3LA 1H9KA 2PYKA 3W5OA 1Z7TA 1PMRA 4NXNQ 1IZ6A 3HKZG 4GN3B 5IYBG 1ILPA 3KK7A 1DOKA 4L5SA 4PG3A 4ZLTF 3CCEA 4DV1L 4MIUA 4KY7A 4ZCKA 4A3DB 3BZDB 4ILWA 1Y1VG 4IUQA 2E75C 4AQYL 4XXEA 3F2UA 5ISRA 2R7ZH 5CC4A 1HNZL 4R9WA 3S16B 4N8X1 1KL9A 1RDPD 5FKAC 4RGNA 1LTAD 3VA7A 4CDDC 1CK1A 1LTLA 2A69D 3PUWA 4LNQA 3KFUA 4QL5A 3V96A 3PO2G 1N33L 1UEAB 5IP7G 4IURA 4X3SA 2L11A 3KJPA 2XTIA 2C5CA 2B2UC 3BS1A 3PF4A 1H95A 1GUNA 1JE4A 3NXWA 1Q46A 2RHQB 3OSOA 2ZT9C 3GTJB 3E3XA 2VS1A 2LXJA 3UDGA 2ZM6Q 4BWGB 3HOXG 1Q7YC 4DV4L 1I4QA 1D1KA 2K52A 3T1HQ 4KTAA 1L1OA 4Y7NH 2OTJA 4MZ9A 2TMPA 1B1ZA 4KJNA 3ERQA 4TVAB 4K2KA 4GOPA 1X9NA 3GTJH 1O7YA 2YYZA 4B9WA 2A6EC 3U9OA 1XWEA 4FXGC 2JEBI 4JI1Q 5K36G 2CWAA 4JVZA 2ZXPA 4X62L 2UU9L 1SYFA 4KHPQ 3NPPA 1UE7A 3Q23A 4R8NA 1WTVA 5IYDH 5IODA 5IE8A 4DV6Q 1Y1WB 4KD3A 1FL0A 1MJEA 3OMCA 1SFOB 1YNJD 1HNWQ 1LLRD 3I72A 2R7DA 2O2LD 1EY5A 4U673 3STBD 4CJ1B 2ZJPA 3KF6B 1LT6D 4ZUIA 4JV5L 2CH4A 2K32A 3I8ZA 1VQ7A 3A0JA 1UE1A 1KAAA 2F4VQ 3PIP3 1BCPC 3CQZB 4HR7B 2XRSD 1CHPD 2HDMA 4PZ8A 3D31A 1TWAH 2PQAA 1F77A 2WP8J 2EIFA 1VQKA 1EEFD 1X3QA 4Y52H 3AYHB 2RSOA 5EJWA 1C9OA 1EYCA 2Z6KA 3TS2A 1VQHA 2UUBQ 2UUCL 4TRDA 2F0JA 4UPAA 2O5JC 1CA5A 3E0EA 1TIID 3CQZH 5F2DA 4IUTA 3LGJA 4QF4A 1LACA 2DY7A 5LMNQ 5KNDA 2D2CC 2D0PA 2R93G 3U58A 2J0TD 1ILQA 1X32A 4FNFA 1TS2A 4A3BB 2EXDA 3HOYG 3TEHB 1CSPA 1BOSA 3MXNA 4YHHL 2JA6G 4LUVA 4DV7Q 3J80i 2Y0SE 4DR4L 1STAA 3G6EA 1KIXA 4FDBA 5JOBA 2QEXA 3NUCA 1O7ZA 1C7YA 5I2XA 3OIQA 1SAPA 4FF1A 3G7LA 3M3YB 2BE5D 1JJCB 4A3BH 2F3VA 1UEBA 1GKHA 2JYOA 1XNRQ 2WFWA 4DR5L 3MA2B 3PUYA 5AJ3Q 2NVYH 1DXMA 3QWNA 3I2ZA 1CHQD 1GJXA 1BBWA 5KIXA 2EYJA 4K14A 2Q8TA 1MJCA 4DXGA 2Z4IA 1ENCA 4IPDA 2WB1G 1HUNA 3CRKC 2Y0SB 5D3IB 5M3FB 3ZYYX 4OO1I 4LF6L 1DONA 5CV5A 5JEAJ 1PXUA 3ULPA 2VUMG 1JJGA 1NCVA 3U4VA 4X3KA 3QJYA 5LL6X 2XGTA 3I4LA 3UDIA 2KENA 1DOMA 2PNHA 4HJ8A 3DUZA 1LO5D 2KEDA 1OO9B 3PIO3 2B2VA 3BVGA 4Q0FA 4H0LC 2QCPX 3T1YQ 1F9SA 1HCZA 1DYQA 4FO2A 3RNUA 4OO1H 3K6OA 3M85A 4ZAIA 5J1ZA 2K03A 4PMBA 3GTQH 3RMHA 3F2BA 1A0IA 4DGZA 1IKMA 4C3IG 3GTPB 1PH7A 3CCMA 1KXLA 4EQOA 1NY4A 1R4QB 2NVTB 4NKLA 4GZYC 3RLNA 4IPCA 2CH4W 4JI8Q 4A3CG 5CORA 2KCTA 5GAHC 1PRTB 4CDEC 2R92B 2WAQG 1PTOC 3T51B 2DJGC 2O4XA 1SEBD 4LK1C 1NE3A 1T5EA 1X3EA 4TKOB 1YNNC 4DFAA 3KF8A 3Q6SA 5BN3A 3HG9A 2IHEA 1Y1VH 4MTNA 4C3HG 2CQOA 5L37A 3K7AH 2D62A 1SE8A 1JOKA 1RF2D 2KCCA 2QF7A 5LMUQ 1XMOL 2Q8IB 1IBML 5BN4A 4A3GG 3A74A 1I6HB 3PV0A 4OWTB 2RDFA 2DNEA 5GQOA 5D65A 4B08A 3J81c 1GM5A 1U9RA 5IYCG 4B3MQ 3IRBA 4YIJA 5IWAL 1HZBA 3FPUB 2EJFC 1KNEA 3V2TA 1PHJA 1GHJA 2JEAI 3E9IA 3G6JB 3PUZA 1D1IA 2FXQA 5IP7H 5J39A 4NMZA 1ZYRC 3CKIB 2EZVA 1I6HH 4RMFA 4JK1C 5DNFA 1ONLA 2E2IB 3R93A 2NTSA 4GKKL 3HP3A 4O42A 1U0LA 4LAAA 4KMUC 2I0QA 3J81E 4YWKA 4LF8L 2LFNA 1PH8A 3SE0A 1UE6A 1I50B 3CPWA 4DNRB 2PZUA 4IJHA 1EFID 1QVFA 2E2IH 4UHVA 3I4NG 1I94Q 1NNXA 3C3LA 1PLFA 1JQYD 1WTOA 2EYPA 2GVAA 4H02A 1E1TA 3K0XA 2ICEC 5FJ8G 1XX8A 4AQYQ 1S5DD 3QO2A 3K80C 5EBCA 2PPBC 3AFPA 3GQBA 4DK0A 3IFTA 4IFDG 2JA9A 3AB9A 1SE2A 3U9SA 3J81L 3G71A 1WJJA 1HA5A 2VZAA 1D8LA 2BDNA 1GUGA 2KECA 1SNOA 4M8AA 5J3BA 1TY0A 1NSNS 3SK4A 4KLKA 5AFWA 1LTBD 1MSHA 2F0LA 3GTGB 4S3SA 1YHQA 5I6WA 1T5XD 5HGTA 4XT1B 1OTCA 2ZM6L 1YIJA 1BQQT 4EVOA 2LMCB 4XQQA 3T1HL 3UDXA 1SBBB 2R93B 2AUJD 1FGUA 2KBNA 3U50C 1G8ZD 1HNXQ 2WKDA 4GNXB 4C2MH 1EU3A 4RHSA 3HOYB 3PO3B 3RZOB 2VL6A 3ER0A 4RWSC 4BBRG 3GTLH 4JI1L 3NSWA 1SYBA 4L63B 2JJQA 4XIGS 4YCUA 3I56A 4KHPL 2AWOA 2R93H 3WWVA 1UWVA 4DV6L 3VYSA 3C1FA 2IJ0A 1A2TA 1HNWL 3SXHA 1HR0Q 3S1RH 3HOYH 3PO3H 4X62Q 3KLSX 3PIPA 2UU9Q 1I3QB 2EYHA 2JA6H 2K5VA 2AKWB 1O7IA 2IW3A 2V1CC 5EKLA 2E5LL 2NZ1D 4NXML 1EZ6A 4KKTA 5C3EB 1G2SA 4PZ6A 2KUMA 1Y8OB 4CKEA 2HHHQ 2YU9H 5FO9B 4C1NI 1J6QA 2F4VL 1CA6A 1I3QH 3RLOA 2KQ3A 2F0SA 1VQ9A 2G5DA 1MI2A 1GUSA 4L5TA 4R1JA 1PH4A 2JA5B 2RDGA 5C3EH 2EJGC 1STHA 1L0XB 1JICA 1O80A 2A19A 2HQLA 3TSSA 2KHIA 3NE5B 3KF6A 4O2DA 3RD4A 2VUMH 1BDOA 1E0BA 2CFMA 4IUPA 2MJ8A 3X3NA 1QUQB 1B9MA 5GAGC 1ICWA 2UUCQ 2JA5H 4N9PA 1I6VC 1UNSA 2B8GA 3SDZA 2JK8A 2A1AA 3A56A 2K05A 3E9HA 5E4XA 1KD1C 4A3MB 1MIUA 1EQVA 3TDQA 1VQAA 5KYLA 1GUTA 3MHBA 2F0WA 1CI3M 2A6HD 1F2ZA 2WAQB 2OQ0A 3PCOB 2KEEA 2IWHA 3WDNA 2OWOA 4YHHQ 1K0RA 5M5WB 2A69C 3MTSA 4C3IH 2N55A 4DR4Q 1TWCH 1XNRL 2XVSA 2A68D 3OWEB 3RN5A 2HCIA 1R4PB 2B8FA 1V1OA 4A3KG 4A3CH 5C3WA 4K0KL 3BYTB 4JBJA 4IPHA 3FVQA 4DR5Q 2HIXA 4JW0A 3PIOA 5FO8B 2VNUD 1QOHA 1STYA 4XQNA 5KGUA 3OOCA 4PZ7A 4A93G 3I55A 4C3HH 3CCLA 2QEJC 4JI3Q 4LF6Q 3QOJA 3MEHA 4J15A 4G4KA 2SNSA 1QG7A 1JJ2A 1I4GA 3HOWG 1UAPA 2D5DA 2N78A 2SNMA 3T1YL 1Y8NB 2RSNA 4KK7A 3GTMB 4JPBW 1PTOB 3SK6A 3NENA 5IYCH 1L2FA 3TP5A 4NW2A 5IY0A 2BOSA 1BBXC 1ZKOA 4HCEA 1YHBA 4DPGA 3TQYA 1I4RA 1HZAA 1YNJC 2OF1A 1VQDA 3KF8B 4R4CA 3AEVA 3H91A 3CC2A 3GTMH 3OWFA 3STBC 1EYAA 1UE5A 1TWFB 4JI4Q 1GVPA 2MHVA 1D7QA 3RLFA 2B2WA 2SEBD 4IFDI 1PDQA 1I4XA 1II3A 4LFBL 4L8JA 3H15A 3P1HA 2A5HA 1WCMB 1F2MA 2L15A 5T1IA 2NZOA 1ICFB 4XQJA 1TWFH 4UP9A 3HZXA 4DA2A 3S9WA 2EYLA 3UE1A 1IW7D 1TKWB 2FINB 2X6LA 3OMGA 2B2YC 5FOBB 5FJ8H 4E6IA 2NTTA 1SMYD 2BH2A 5CV6A 2IHFA 3F1ZA 3GV6A 4IFDH 1B53A 4B3ML 3KJOA 1X3PA 1SNDA 3EIVA 1XNQQ 3NP8A 1BUVT 4WORA 3L7ZC 5KYIA 1FD7D 2K28A 2A8VA 2XWBB 3I70A 1PV4A 3TRZA 1JOQA 1JCKB 3J7AF 4RFBA 1X6OA 2RBMA 1PH9A 5JAVA 2FJ2A 1WYDA 2HD3A 1EUJA 1X54A 4Q5VA 3S2DH 4A3FG 4QIWE 3JAMi 3H0GB 4HJ7A 2F3WA 3PMFA 4C3JG 1IBLQ 4DN4M 3TP7A 4GKKQ 2K50A 3BDCA 1A6XA 1HQMC 2SOBA 4FF2A 3E5SA 4LF8Q 3UDFA 2R7ZB 1I94L 1CKMA 5C0XG 4KV6A 2ZJRA 4B3SQ 3MZ5A 1C4QA 2C35B 3H0GH 1RIPA 3K5OA 1YITA 1TWHB 4YCWA 3IL8A 1Q12A 4QB4A 5HY6A 2QILA 3DM3A 4MHEA 4QIWB 5M3MB 1EY7A 4YY3Q 3JC66 4OWWB 3RR5A 5DEHA 2ZTEA 3OTOL 3M9BA 1EWHA 2CWPA 3L3OC 1TWHH 3GP7A 2K75A 1CSQA 1MHWC 4P75A 2NUCA 2RCNA 4A75A 1B8AA 2NBFA 3CC4A 5M3MH 1N36Q 5NUCA 5I9PA 3CCRA 5JJLA 1AP0A 1EIHA 2B2UA 2JXMB 1DJRD 4Y7NB 2EY1A 4ABNA 1YNXA 3M7GA 3I3CA 1K3RA 2Q2IA 4BBSB 5K5PA 1ASZA 1SNCA 4IO9A 2JE6I 1HNXL 5M9OA 2MFIA 3SEBA 1Z6HA 1VQFA 4A3EG 3SGIA 1HTPA 4BXXG 3TN2A 1VCIA 1EEID 4LF5L 5C6AA 4BBSH 1VQEA 2UXBQ 3TBIB 1M4VA 4JOIC 3IFDA 5HURA 1SYEA 4A3JB 1HR0L 1A3UA 3AFQA 1KDBA 5CR3A 1K73C 2E2HH 3DXJC 3S1MB 2BDOA 4NDXA 4GNXA 2ALYB 1QWYA 3FP9A 3K5NA 3EROA 1S5FD 4GOPC 3CMEA 4DV5L 4A3JH 3HOZB 4P73A 1CFMA 2HHHL 3NEMA 4JBKA 3PUVA 1TWAB 2DY8A 3G48A 2CCZA 1TR5A 2J4XA 2B63B 3S1MH 2E5LQ 1CQVA 1AH9A 4NXMQ 5HGQA 1YBYA 2L1BA 1RODA 4KHVA 3MC0B 1HRJA 1B9NA 1QJOA 1FNUA 4LFCQ 3C1EA 1BXTA 3MEFA 5G3LD 2KCMA 1A15A 5EAYA 3HOZH 1GD7A 3OW7A 2B63H 2VQEQ 4WJ3M 1F9PA 1JB7A 2I5LX 4A93H 4C1NK 4O1NA 1FJGQ 4POGA 1QZGA 5C4XG 4M1UB 3CC7A 1WD1A 4IALA 1VDZA 3L0OA 1Q81C 4R4QA 3U4ZA 3J80c 3HOWH 1VQ5A 1TS3A 1KRSA 1SN8A 4EX5A 1EL0A 1ET9A 3VYUA 1GHKA 1PFSA 3BG3A 2NVYB 4YCVA 2KA7A 1TY2A 3HOUG 2DNCA 1SE3A 2F1MA 1CKOA 1EYDA 1K83H 1QUQA 2KVMA 1Z47A 4MN3A 4JI7L 3ITPA 1H9JA 1G291 4A3LG 3J80E 5IGGA 4BY7G 5C4HA 2VW9A 4HTHA 2JA7B 2EE1A 4K0KQ 1FGBD 2ENBA 2UXCL 4P2CB 3CW2C 4KI0A 4DAPA 5CV8A 5C5LA 4JI3L 5CBAE 5IGEA 3HKZE 4JI0L 4N9TA 4FVMA 1XYIA 1V43A 1RL2A 2JA7H 5EPLA 3GTQB 2M2LA 2FMCA 1SYCA 1WTPA 1OXVA 1PH2A 3J80L 1E2ZA 1EWIA 1HPCA 2ES2A 3BDLA 3SHLA 1HA6A 4R4IA 2JA8B 3TP6A 4C3JB 2DGYA 2R3ZA 1R9TH 1KABA 1OXSC 2Z9HA 2RDHA 5C0XI 1E2VA 1A62A 4ZRZA 3HKZB 5BN5A 1XPUA 1C0AA 5H1SE 3NHHA 4JI4L 3S24A 1B44D 1SNPA 4MTKA 4J1MA 3HRZC 2VB3X 4A3FH 3BZCA 2JA8H 1TS4A 2MPMA 4C3JH 2OCEA 2WACA 3HOVG 3R2TA 4NPSA 1Y1VB 2JQOA 1TVXA 2RF4A 3K7AB 2NWGA 5J22A 4POFA 1PH5A 1HTLD 2RA4A 1QNUA 1O78A 5IYBH 1ASYA 3R8BA 2PW5A 2F0GA 1VQGA 1QVCA 4H7BA 5C0XH 1RTNA 1VQPA 4LFBQ 2EJMA 1ZXTA 3J7ZC 1U5KA 3PO2B 2ZXOA 4ZKCB 2Z6BA 1N8RC 1K8MA 1WTWA 3I4OA 4JI2Q 4B9XA 1JC7A 4L5QA 1XNQL 3I4MG 5JPNC 4DXFA 3CMAA 5EQ0A 5IT9c 2F0FA 4I7AA 3P7JA 1SROA 2V4DA 2HQEA 3PO2H 1SDFA 3HOXB 2EY5A 4OIKA 4HIMA 4CDCC 3NTIA 3A5ZB 1BBUA 1QILA 1L0WA 5LMNW 4DR6Q 2A6HC 2YV5A 2Q2HA 4ZQ3A 2O5IC 5E4WC 1IBLL 1JMCA 2F0OA 1NR2A 4ZUJA 4OELB 4RGMA 4N8FA 3UE0A 4J8QA 1K9MC 4WJ4A 2A68C 5IT9E 3DWQA 1CZWA 1A3TA 5EKKA 4DK6C 2JSOA 3HOXH 1ET6A 1RCVD 1TU2B 2M00A 1IKLA 3L9AX 4B3SL 3NK9A 3S15B 2XN9C 4YWMA 2NVXB 4A3EH 2F0TA 1VQJA 4X64L 4JBWA 5FLMG 1AZPA 4GS3A 1DGSA 3K81C 1QB5D 1K0SA 4DUZQ 1PYBA 1ESRA 4LF4Q 4YY3L 2B2TA 1KLUD 1WD0A 5K36H 1XJVA 3S15H 4LJZC 2NVXH 3C2PA 3EA6A 3TREA 2DJFC 4O0AA 4DR2Q 3M4OB 5FLXc 3J7A5 5IT9L 3BVZA 1K8GA 1V9PA 2K5WA 4HSPA 3OTOQ 1EIYB 4RCNA 1N36L 4CHTB 3S1QB 2E8GA 3K5MA 1KTKA 1HXYD 1I4HA 4HAEA 5IGCA 2Z0SA 3IAYA 3FKIG 4YWLA 3J7YW 3M4OH 3NQTA 4C2MB 1PH1A 3ND8A 2UXDQ 2A73B 4AYBG 4HCSA 5FLXE 4OEMB 1VQNA 3GTLB 1TQOA 2KJXA 3S1QH 1B3AA 3I7FA 4QUFA 2B29A 5JPMC 1IYJB 3SK5A 1F9QA 2UXBL 3QOLA 3S1RB 2XNAC 2F52A 4G7OC 2JA6B 4ALPA 2WB1E 3HEJA 5BR8L 4LF5Q 4DU9A 3DWAA 2AWNA 2F0EA 4A3IG 2TSSA 3T53B 4IFDJ 4I65A 2IX0A 3D4WA 1IW7C 1Y69U 2ID0A 1EY4A 5FLXL 2YU9B 1BCPB 1SMYC 1U4LA 3K8AA 2WV6D 3P75A 1SYGA 4UDUC 2HCCA 4KKSA 2LY7A 5KNCA 3HOUH 3DHQA 3W1BA 1GUOA 1XMQQ 2FHTA 4DNIA 3D4DA 1G51A 1LM0A 4UP8A 4OWXB 1GOZA 5T1GA 2WB1B 4KD4A 1DOLA 2MNAA 2CW0D 3MFYA 5DM63 4DV5Q 4A3LH 2AMCB 4I7ZC 4DR1Q 1E3PA 2Z8LA 1WTQA 2VUMB 3FEWX 3V05A 1U4MA 4LFCL 4CKBA 4P71A 2VB2X 4F7XA 3M4PA 3BZKA 2GA4B 3CPFA 4A3DG 1GXDC 3TZUA 4CJ2C 4RCOA 1KAWA 2VQEL 1H9SB 1LTGD 1EZ8A 1KNAA 3NELA 3BVMA 4F87A 1FJGL 2WAQE 1QNKA 4GLXA 5M5YB 1PTOD 1JWUD 2QA4A 3A55A 4C3IB 2PNRC 2OQKA 1KDAA 1TWCB 1STGA 2L4NA 4JYAL 1CKNB 5JJIA 3CRLC 1WTRA 3GDEA 2UUAQ 1W6KA 5ELCA 4CJ0B 2E2DC 5M5YH 1IBKQ 1VQ8A 3DLLA 1Y8PB 1YJNA 3BYYB 2F3IA 3VR4A 1QVGA 4DV2Q 5D3DA 2KHJA 1YJWA 1M90C 1PH3A 1J8IA 3KBGA 1BR9A 1W6JA 3EBEA 4JI7Q 2QKIC 1LTRD 4C3HB 5CV7A 2Q2TA 1A8VA 1PFMA 3RN2A 1WTHA 3MFGA 1X55A 2K01A 4ZK9B 3H6MA 2YTYA 3GTKH 4DNTB 1O7LA 4K5XA 1S40A 4A3GB 4LMQD 1GUWA 2K5DA 3EFXD 4OX9Q 1H9MA 4X65L 4MNOA 2MQHA 3GO5A 3URYA 5E7NA 1Q8KA 1YI2A 2UXCQ 2I5HA 3ERSX 2K04A 5EPJA 1Y1WG 4X3TA 4B3TL 1OXTA 2N8NA 4JI0Q 4X3UA 5E1FA 3CHBD 1K8OA 2BA1A 3I4MH 2K5QA 3D0FA 4A3GH 2EYFA 2F0QA 5CBEE 2H1EA 5JJKA 4KY6A 3S17B 4IN3A 3I91A 4LF7Q 2YTXA 1U4RA 2I5MX 5C4JH 5LHY1 3CP0A 1EYGA 3D6WA 3RZDB 1KDCA 4WFN3 2K1BA 3OIPA 3S17H 1DZ1A 2YTVA 3I4NB 3S2HH 1HR0W 4KN4C 1PZJD 2IX1A 1G6ZA 1N9WA 2IT1A 4DV3L 2LSSA 3W1GA 2HIVA 4ME5A 1PYSB 3DWPA 4AYBE 1QCBD 4DF7A 2QGQA 5FLMH 3RZDH 2NN6G 5EBDA 3OYYA 2J7ZA 3S1NB 1T9HA 4HSVA 3I4NH 2HDLA 5JVG3 4L6TB 3AMUA 4G57A 5CMDA 4A3BG 1NAPA 2E76C 2EPBA 4JI2L 1IHZA 4AIMA 2B2YA 1BNZA 2N3SA 1KC8C 4ME3A 3EJIA 2PZTA 1EQTA 3W3AA 4GLVB 1YZ6A 5DLQE 3AU7A 1LTSD 3W2DA 3S1NH 3S2DB 2EQSA 3GD7A 3T16A 1HZCA 4AYBB 3FPPA 2AQ3B 4F8MA 4EQPA 3JAMc 4DR6L 1A3VA 1ENAA 1B2TA 2VXWA 4KHZA 3ONAB 1XXGA 1LTTD 5G3LF 3FKIH 1TS5A 1S3OA 1J5EQ 2WINB 1S4ZA 5IGDA 1KLGD 2Z1CA 1B3QA 2Y0SG 3KBXA 5M3FG 1KHIA 1E24A 4BBRB 2BE5C 3LNNA 3R2IA 4RKLA 1MGSA 2K6AA 2HT1A 4BY1G 3KDFB 1B50A 5DAUA 3JAME 3O13A 1B70B 1KRTA 1VQOA 2NYZD 2R61A 5IGFA 2PO4A 4GKJQ 3QB3A 1QZHA 4DUZL 4X64Q 1SNQA 1WVLA 3VR6A 2AUKA 4EGVA 4LF4L 4BBRH 3OPOA 1B7YB 2ZTDA 1EQQA 4HIDA 1D6EC 1M8AA 4OHJA 4DR2L 4A3IH 5ELEA 1MSGA 1S5ED 2I07B 1Z9FA 1PRTF 1D5MC 2FMMA 4PV1C 3A8KE 1IYVA 1SMXA 2I46A
chains in the Genus database with same CATH topology
1VMCA 5C3XA 3JAML 4RHRA 3VYRA 3OHXC 1CQFA 3M7NA 4IUVA 1VF7A 3K58A 3VYTA 2EY2A 2BCOA 1RKNA 1UUPA 2CQAA 1U4PA 1FNVA 2L12A 1LT5D 3VA5A 3X3MA 5A2QE 5C0XJ 5ELDA 3TP8A 4R8IA 2E2HB 3PUXA 2NB0A 2F0HA 2MGSA 4K8JA 1SSOA 3EVQA 4IZ8A 1EIGA 3NQIA 4A3KB 5CV9A 5A2QL 4CGYB 3I90A 1SYDA 2EXZA 2E74C 4CKCA 1EWCA 4ULLA 4EQNA 4A93B 1LTID 2L0CA 1JB3A 5ELBA 1IYUA 2QDBA 1F9RA 3NWTA 1XTCD 4ID6A 2MUYA 5KEEA 1STBA 5IIFA 4V190 3J7AV 1AFPA 3HOWB 4U68A 3NWSA 4RH6A 3K5LA 1ML0D 1EY6A 3H3VC 4BA2I 1Q1EA 1HFGA 4ODGA 2XRQD 4RGTA 1EY8A 1K83B 2EVBA 2DN8A 4IUUA 4ZYSA 4WJWA 1RJTA 4V0BA 2X6GA 2WKCA 1TWGB 1H9SA 3BDOA 4KN7C 3D4RA 2Z4HA 2NN6I 5JEAG 1SJHD 2F0DA 1PRTD 4K6DA 2RKSA 1A2UA 5IOCA 1G91A 3R3OA 4IQZA 5A35A 3T56B 4BS9A 4Z9CB 1BCPF 1SJED 2F0VA 2NN6H 1ZEQX 4F88A 1D2BA 1NR4A 3NBIA 1ENFA 2E2JB 2F0IA 1DD2A 2L9HA 1R9TB 3FDTA 1CTMA 3M4YA 3N52A 1OXXK 3MXGA 2EYOA 4QMGA 2XSCA 4A3FB 1LT3D 1TT2A 3Q24A 1VMPA 2H4OA 4BY1B 5CV4A 2OEOA 4BA1I 2MP1A 3N6RA 4C56C 2L55A 3MVVA 4RKBA 3A54A 1PYWD 3ND9A 2LKVA 2CW0C 5I9OA 4KKUA 2B2VC 2G9HD 1AW7A 1Q8IA 5KNBA 3VR2A 4J6HA 3TMEA 2HUGA 5COYA 4XDXA 4IUNA 4QCLA 3HGBA 1DM0B 3QIAA 1V8QA 1STNA 5C5MA 3DM1A 3DEPA 1AN8A 1IL8A 4XT3B 2EYMA 4FF3A 2F0PA 3A8IE 5ELFA 3MXPA 5CYUA 5EGTA 3A7LA 4ZKBB 2Q8RE 1PZID 2A6ED 1SNMA 3NTKA 1MBYA 3LWEA 2PZWA 1AEXA 4A3EB 3T4AC 3E0JA 4K6LA 4KY5A 2RVLA 2ICIA 3H94A 3KUPA 5TSSA 4K5WA 5E3FA 1PTOF 1PZKD 2PCFB 4OIJA 5JJZA 5IGBA 2ZXRA 3EQLC 2F0MA 3GV3A 1HHVA 1SE4A 3C46A 1JWMD 3DEOA 2M9VA 3D3RA 3K0YA 2F0KA 2N88A 1BCPD 5D14A 1C8CA 1EOTA 4RAUC 2D9UA 5FO7B 1JR0D 3GTOB 4FP5D 5C44B 5KRUA 1AZQA 5I2YA 4CBVA 2EY6A 1FR3A 2F0UA 4UAIA 4TSSA 2B2TC 3WOFA 2C9OA 1V1PA 4NP5A 2RQXA 5LL6S 3MAQA 1D5XC 1JOOA 2KCNA 4HEDA 5C4XB 3S14B 3VR5A 1JORA 3VR3A 1PFNA 2BA0A 1EY9A 4PNYA 1HFNA 1HQRD 2X69A 3Q0AA 4RA8A 5CGKA 3WOEA 3RUZA 1CM9A 3SR1A 1LT4D 3HOUB 1L0YB 1LABA 3MXUA 3FMCA 5M5XB 1BF4A 1ESFA 1J9OA 3IKJA 4OL7A 4H44C 4BY7B 1PFBA 3H09A 4G7ZC 2K33A 5JEAH 2OT2A 4QUCA 3FRPB 2NVQB 3Q22A 4FXKC 5JVH3 1RHPA 1FYCA 3DMUA 1STEA 2IL8A 1CT1D 3A8JE 1I4PA 4FF4A 3SVMA 4FXDA 4H13C 1H9RA 2CHBD 1QE6A 3HS0C 3SK8A 3KLSA 4WRDA 1D5ZC 3I73A 1S5CD 1YNND 1B4OA 1HUMA 1SXTA 2IX3A 4DK1A 1OXUA 3HOVB 3LWUA 1C48A 4PMWA 3GTKB 1JWSD 1F2LA 3KLRA 2A74C 4DAYA 1VF5C 4HN7A 4DAVA 2B39A 1ZYRD 3I4MB 1EY0A 4XTCS 1FNWA 4KJOA 4PMCA 4PQXA 1BO0A 5C4JB 2EOTA 3A7AB 4FYDA 2FFKB 5I6YA 2F0NA 3S2HB 1S5BD 2XIWA 2JP1A 2IPKD 3CU7A 3NTHA 1NUCA 3UI2A 2KOLA 2XWJB 4XYOA 2LS01 2K7VA 1LV9A 1MD2D 2R6GA 5EPKA 4K8IA 1CZGA 4RGOS 2CVRA 2AQ2B 1PTOH 3K57A 5EKIA 3D8GA 2OXPA 3T13A 2B2WC 2WIIB 1RD9D 3FKIB 4K5VA 2G9DA 3QG1A 5I4DA 1WTXA 1DCZA 5FK9C 3MWYW 2F03A 2AQ1B 4OGQC 4G7HC 2SDFA 3E6ZX 2PW7A 2L5TA 1PRTC 1G2TA 4TQUS 3K59A 4XYQA 1F2YA 3TZDA 4A3IB 4OO1G 2KHSA 2F4IA 3LX0A 3NBHA 4HMIA 2EDGA 1E2WA 1EU4A 4HMJA 2PMZB 1RTOA 1Q90A 5C4ZA 5DM73 4K2LA 2PQEA 3D6CA 1Q1BA 1V1PB 3P20A 1Q3LA 1H9KA 2PYKA 1Z7TA 1PMRA 1ILPA 3KK7A 1DOKA 4ZLTF 4MIUA 4KY7A 4A3DB 3BZDB 4ILWA 4IUQA 2E75C 4XXEA 3F2UA 5ISRA 5CC4A 4R9WA 3S16B 1RDPD 5FKAC 4RGNA 1LTAD 3VA7A 1CK1A 2A69D 3PUWA 3V96A 1UEAB 4IURA 4X3SA 2L11A 2C5CA 2B2UC 3BS1A 1GUNA 1JE4A 3NXWA 3OSOA 2ZT9C 3GTJB 4BWGB 1I4QA 1D1KA 4KTAA 2TMPA 1B1ZA 4KJNA 3ERQA 4K2KA 1O7YA 2YYZA 4B9WA 2A6EC 3U9OA 1XWEA 4FXGC 2JEBI 5K36G 2ZXPA 1SYFA 3NPPA 3Q23A 4R8NA 1WTVA 5IODA 1Y1WB 4KD3A 3OMCA 1SFOB 1YNJD 1LLRD 3I72A 2O2LD 1EY5A 4U673 4CJ1B 1LT6D 4ZUIA 2K32A 3I8ZA 1KAAA 3PIP3 1BCPC 3CQZB 4HR7B 2XRSD 1CHPD 2HDMA 3D31A 1F77A 2WP8J 1EEFD 1X3QA 2RSOA 5EJWA 1EYCA 4TRDA 2F0JA 2O5JC 1CA5A 1TIID 5F2DA 4IUTA 4QF4A 1LACA 2DY7A 5KNDA 2D2CC 2J0TD 1ILQA 1X32A 4FNFA 1TS2A 4A3BB 1BOSA 3MXNA 1STAA 5JOBA 3NUCA 1O7ZA 5I2XA 3OIQA 1SAPA 4FF1A 3G7LA 3M3YB 2BE5D 2F3VA 2JYOA 3MA2B 3PUYA 1DXMA 3QWNA 1CHQD 1GJXA 5KIXA 2EYJA 4K14A 2Q8TA 4DXGA 2Z4IA 1ENCA 1HUNA 3CRKC 2Y0SB 5D3IB 5M3FB 3ZYYX 4OO1I 1DONA 5CV5A 5JEAJ 1PXUA 1NCVA 4X3KA 3QJYA 5LL6X 3I4LA 1DOMA 3DUZA 1LO5D 2KEDA 1OO9B 3PIO3 2B2VA 3BVGA 4Q0FA 4H0LC 2QCPX 1F9SA 1HCZA 1DYQA 4FO2A 4OO1H 3K6OA 3M85A 4ZAIA 5J1ZA 2K03A 4PMBA 3RMHA 4DGZA 1IKMA 4C3IG 3GTPB 4EQOA 1R4QB 2NVTB 4NKLA 4GZYC 5CORA 1PRTB 2R92B 1PTOC 3T51B 2O4XA 1SEBD 4LK1C 1T5EA 4TKOB 1YNNC 4DFAA 3KF8A 3Q6SA 5BN3A 3HG9A 4C3HG 2D62A 1JOKA 1RF2D 2KCCA 2QF7A 2Q8IB 5BN4A 1I6HB 3PV0A 2RDFA 2DNEA 5D65A 4B08A 1U9RA 4YIJA 3FPUB 2EJFC 1KNEA 3V2TA 1GHJA 2JEAI 3PUZA 3G6JB 1D1IA 5J39A 4NMZA 1ZYRC 3CKIB 2EZVA 5DNFA 4JK1C 2E2IB 1ONLA 3R93A 2NTSA 3HP3A 4O42A 4LAAA 4KMUC 3J81E 2LFNA 3SE0A 1I50B 4DNRB 2PZUA 1EFID 3C3LA 1PLFA 1JQYD 1WTOA 2EYPA 2ICEC 1XX8A 1S5DD 3QO2A 5EBCA 2PPBC 4DK0A 3GQBA 4IFDG 3IFTA 3AB9A 1SE2A 3U9SA 3J81L 1HA5A 2BDNA 1GUGA 2KECA 1SNOA 4M8AA 1TY0A 1NSNS 3SK4A 5AFWA 1LTBD 1MSHA 2F0LA 3GTGB 4S3SA 5I6WA 1T5XD 5HGTA 4XT1B 1BQQT 4EVOA 2LMCB 4XQQA 1SBBB 2R93B 2AUJD 1G8ZD 2WKDA 1EU3A 4RHSA 3HOYB 3PO3B 3RZOB 4RWSC 3NSWA 1SYBA 4L63B 4XIGS 2AWOA 3VYSA 3C1FA 2IJ0A 1A2TA 3SXHA 3KLSX 1I3QB 2EYHA 2IW3A 5EKLA 2NZ1D 1EZ6A 4KKTA 5C3EB 1G2SA 2KUMA 1Y8OB 4CKEA 5FO9B 4C1NI 1CA6A 2KQ3A 2F0SA 1GUSA 1MI2A 2JA5B 2RDGA 2EJGC 1STHA 1L0XB 1JICA 1O80A 3TSSA 3NE5B 3RD4A 1BDOA 1E0BA 4IUPA 2MJ8A 3X3NA 1B9MA 1ICWA 4N9PA 1I6VC 1UNSA 2B8GA 3SDZA 5E4XA 3A56A 2K05A 4A3MB 3TDQA 1EQVA 5KYLA 1GUTA 3MHBA 2F0WA 1CI3M 2A6HD 1F2ZA 2WAQB 2KEEA 2IWHA 3WDNA 5M5WB 2A69C 3MTSA 2N55A 2XVSA 2A68D 3OWEB 2HCIA 1R4PB 2B8FA 1V1OA 5C3WA 3BYTB 3FVQA 5FO8B 2VNUD 1QOHA 1STYA 4XQNA 5KGUA 3OOCA 2QEJC 3QOJA 3MEHA 4G4KA 2SNSA 1QG7A 1I4GA 1UAPA 2D5DA 2SNMA 1Y8NB 2RSNA 4KK7A 3GTMB 1PTOB 3SK6A 3TP5A 4NW2A 2BOSA 1BBXC 1ZKOA 4HCEA 1I4RA 1YNJC 2OF1A 3H91A 3OWFA 1EYAA 1TWFB 2MHVA 3RLFA 2B2WA 2SEBD 4IFDI 1PDQA 1I4XA 1II3A 4L8JA 3P1HA 2A5HA 1WCMB 1F2MA 5T1IA 4XQJA 3HZXA 4DA2A 3S9WA 2EYLA 1IW7D 1TKWB 2FINB 2X6LA 3OMGA 2B2YC 5FOBB 4E6IA 2NTTA 1SMYD 5CV6A 3GV6A 4IFDH 1B53A 1X3PA 1SNDA 4WORA 3NP8A 1BUVT 3L7ZC 5KYIA 1FD7D 2K28A 2XWBB 3I70A 1JOQA 1JCKB 3J7AF 4RFBA 2RBMA 5JAVA 2FJ2A 4Q5VA 3H0GB 2F3WA 3PMFA 4C3JG 4DN4M 3TP7A 3BDCA 1A6XA 1HQMC 2SOBA 4FF2A 3E5SA 2R7ZB 5C0XG 4KV6A 3MZ5A 1C4QA 3K5OA 1TWHB 3IL8A 1Q12A 4QB4A 2QILA 4MHEA 4QIWB 5M3MB 1EY7A 5DEHA 1EWHA 3L3OC 3GP7A 2NUCA 2NBFA 5NUCA 5I9PA 1AP0A 1EIHA 2B2UA 2JXMB 1DJRD 4Y7NB 2EY1A 4ABNA 3M7GA 3I3CA 4BBSB 5K5PA 1SNCA 2JE6I 5M9OA 3SEBA 1Z6HA 1HTPA 3TN2A 1VCIA 1EEID 5C6AA 3TBIB 1M4VA 3IFDA 5HURA 1SYEA 4A3JB 1A3UA 1KDBA 5CR3A 3DXJC 3S1MB 2BDOA 4NDXA 1QWYA 3K5NA 3EROA 1S5FD 3HOZB 1CFMA 3PUVA 1TWAB 2DY8A 1TR5A 2J4XA 2B63B 1CQVA 2L1BA 1RODA 4KHVA 3MC0B 1HRJA 1B9NA 1QJOA 1FNUA 3C1EA 1BXTA 5G3LD 1A15A 3OW7A 1F9PA 4C1NK 4O1NA 4M1UB 1WD1A 4IALA 1VDZA 1TS3A 1EL0A 1ET9A 3VYUA 1GHKA 3BG3A 2NVYB 2KA7A 1TY2A 2DNCA 1SE3A 2F1MA 1EYDA 2KVMA 1Z47A 4MN3A 3ITPA 1H9JA 1G291 3J80E 5IGGA 5C4HA 4HTHA 2JA7B 2EE1A 1FGBD 2ENBA 4P2CB 4KI0A 4DAPA 5CV8A 5C5LA 5CBAE 5IGEA 4N9TA 4FVMA 1XYIA 1V43A 5EPLA 3GTQB 2M2LA 2FMCA 1SYCA 1WTPA 1OXVA 3J80L 1E2ZA 1HPCA 3BDLA 3SHLA 1HA6A 2JA8B 3TP6A 4C3JB 2R3ZA 1KABA 1OXSC 2RDHA 5C0XI 1E2VA 4ZRZA 3HKZB 5BN5A 3NHHA 1B44D 1SNPA 4J1MA 3HRZC 2VB3X 1TS4A 2MPMA 2WACA 3R2TA 1Y1VB 1TVXA 3K7AB 5J22A 2NWGA 1HTLD 2RA4A 1QNUA 1O78A 3R8BA 2PW5A 2F0GA 4H7BA 5C0XH 1RTNA 2EJMA 1ZXTA 3PO2B 2ZXOA 4ZKCB 1K8MA 1WTWA 4B9XA 1JC7A 5JPNC 4DXFA 5EQ0A 2F0FA 3P7JA 2V4DA 2HQEA 1SDFA 3HOXB 2EY5A 4OIKA 3NTIA 1QILA 2A6HC 4ZQ3A 2O5IC 5E4WC 2F0OA 1NR2A 4ZUJA 4RGMA 4J8QA 2A68C 5IT9E 3DWQA 1CZWA 1A3TA 5EKKA 2JSOA 1ET6A 1RCVD 1TU2B 2M00A 1IKLA 3L9AX 3NK9A 3S15B 2XN9C 2NVXB 2F0TA 4JBWA 1AZPA 1QB5D 1ESRA 2B2TA 1KLUD 1WD0A 5K36H 4LJZC 3C2PA 3EA6A 3M4OB 5IT9L 3BVZA 2K5WA 4HSPA 4RCNA 4CHTB 3S1QB 3K5MA 1KTKA 1HXYD 1I4HA 4HAEA 5IGCA 3IAYA 3J7YW 3NQTA 4C2MB 3ND8A 2A73B 4HCSA 5FLXE 3GTLB 1TQOA 2KJXA 1B3AA 4QUFA 5JPMC 3SK5A 1F9QA 3QOLA 3S1RB 2XNAC 4G7OC 2JA6B 3HEJA 4DU9A 3DWAA 2AWNA 2F0EA 2TSSA 3T53B 4IFDJ 4I65A 2IX0A 3D4WA 1IW7C 1Y69U 2ID0A 1EY4A 5FLXL 2YU9B 1BCPB 1SMYC 1U4LA 2WV6D 3P75A 1SYGA 4UDUC 2HCCA 4KKSA 2LY7A 5KNCA 3DHQA 1GUOA 2FHTA 3D4DA 1GOZA 5T1GA 2WB1B 4KD4A 1DOLA 2CW0D 3MFYA 5DM63 4I7ZC 2Z8LA 1WTQA 2VUMB 3FEWX 3V05A 1U4MA 4CKBA 2VB2X 4F7XA 2GA4B 1GXDC 3TZUA 4CJ2C 4RCOA 1H9SB 1LTGD 1EZ8A 1KNAA 3BVMA 4F87A 1QNKA 5M5YB 1PTOD 1JWUD 3A55A 4C3IB 2PNRC 1KDAA 1TWCB 1STGA 2L4NA 3CRLC 1WTRA 1W6KA 5ELCA 4CJ0B 2E2DC 1Y8PB 3BYYB 3VR4A 5D3DA 1J8IA 3KBGA 1BR9A 1W6JA 2QKIC 1LTRD 4C3HB 5CV7A 1PFMA 3MFGA 2K01A 4ZK9B 3H6MA 4DNTB 1O7LA 4K5XA 4A3GB 4LMQD 1GUWA 2K5DA 3EFXD 1H9MA 3GO5A 3URYA 2K04A 5EPJA 4X3TA 1OXTA 4X3UA 5E1FA 3CHBD 1K8OA 2BA1A 2K5QA 2EYFA 2F0QA 5CBEE 2H1EA 4KY6A 3S17B 4IN3A 3I91A 1U4RA 5LHY1 3D6WA 3RZDB 1KDCA 4WFN3 2K1BA 3OIPA 1DZ1A 3I4NB 4KN4C 1PZJD 2IX1A 1G6ZA 2IT1A 4ME5A 3DWPA 4DF7A 1QCBD 2NN6G 5EBDA 2J7ZA 3S1NB 4HSVA 2HDLA 5JVG3 4L6TB 3AMUA 4G57A 5CMDA 1NAPA 2E76C 2EPBA 1IHZA 2B2YA 1BNZA 3EJIA 2PZTA 1EQTA 3W3AA 3AU7A 1LTSD 3W2DA 3S2DB 3GD7A 3T16A 4AYBB 3FPPA 2AQ3B 4F8MA 4EQPA 1A3VA 1ENAA 1B2TA 2VXWA 4KHZA 3ONAB 1XXGA 1LTTD 5G3LF 1TS5A 2WINB 1S4ZA 5IGDA 1KLGD 2Z1CA 3KBXA 4BBRB 2BE5C 4RKLA 3LNNA 3R2IA 1MGSA 2K6AA 1B50A 5DAUA 3JAME 3O13A 2NYZD 2R61A 5IGFA 2PO4A 3QB3A 1SNQA 1WVLA 3VR6A 2AUKA 4EGVA 3OPOA 1D6EC 1M8AA 4OHJA 5ELEA 1MSGA 1S5ED 2I07B 1PRTF 1D5MC 2FMMA 4PV1C 3A8KE 1IYVA 2I46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL8 A;  1DOL A;  1VMC A;  2B2V A;  2EE1 A;  3D6W A;  4XT3 B;  3TN2 A;  1ICW A;  3QO2 A;  1WTQ A;  1F9S A;  2K1B A;  1U4M A;  1BO0 A;  1DZ1 A;  4ZKB B;  4CJ1 B;  1BF4 A;  1RTO A;  2FIN B;  1IKL A;  2X6L A;  4ZAI A;  4IUV A;  2B2Y C;  2Q8R E;  2K03 A;  1J9O A;  5E4X A;  2K05 A;  2BDN A;  2EOT A;  3I8Z A;  4CJ2 C;  1G6Z A;  3IFD A;  5CBA E;  1AZP A;  1IKM A;  3GV6 A;  2KEC A;  1B53 A;  3LWE A;  1XYI A;  1U4P A;  1G91 A;  1X3P A;  1PFB A;  2FFK B;  1KNA A;  5EPL A;  1Q3L A;  5AFW A;  2K28 A;  2M2L A;  2L12 A;  1ILP A;  2KEE A;  1WTP A;  2XIW A;  1MSH A;  1DOK A;  1ESR A;  2HDM A;  2JP1 A;  3MTS A;  1QNK A;  2J7Z A;  5COR A;  2B2T A;  2RVL A;  2N55 A;  4HSV A;  4QUC A;  4ZLT F;  2HDL A;  1WD0 A;  3KUP A;  4XT1 B;  1X3Q A;  4R8I A;  1HA6 A;  5CMD A;  1NAP A;  2HCI A;  2RSO A;  2R3Z A;  1RHP A;  2FJ2 A;  2EPB A;  4OIJ A;  5EJW A;  4IUQ A;  3UI2 A;  2KOL A;  5JJZ A;  2B2Y A;  1BNZ A;  1NR4 A;  2IL8 A;  2L4N A;  3F2U A;  2DY8 A;  1EQT A;  1CA5 A;  3Q6S A;  3GV3 A;  4DN4 M;  2MGS A;  1WTR A;  2L9H A;  4IUT A;  4R9W A;  1HHV A;  2DY7 A;  4CJ0 B;  3DEO A;  3FDT A;  4HAE A;  2L1B A;  1SSO A;  1ROD A;  3SVM A;  1LV9 A;  1ILQ A;  4RWS C;  1HRJ A;  1X32 A;  3N52 A;  2N88 A;  2MPM A;  5D14 A;  1C8C A;  1EIG A;  1EOT A;  4RAU C;  1QE6 A;  2D9U A;  5EPK A;  1B2T A;  1A15 A;  2VXW A;  1TVX A;  2NWG A;  5D65 A;  4HCS A;  1J8I A;  2CVR A;  3ONA B;  2RA4 A;  3IL8 A;  1F9P A;  3I90 A;  4IUR A;  4X3S A;  5EKI A;  2L11 A;  1QG7 A;  1B4O A;  1O7Z A;  2B2U C;  1B3A A;  1RTN A;  4MHE A;  1AZQ A;  1VMP A;  1HUM A;  1PFM A;  1S4Z A;  1SAP A;  3FPU B;  3KBX A;  1JE4 A;  2RSN A;  4QUF A;  3G7L A;  1KNE A;  2B2W C;  2K01 A;  4ZK9 B;  1WD1 A;  4NW2 A;  1ZXT A;  1MGS A;  1F9Q A;  2MP1 A;  4UAI A;  2JYO A;  1BBX C;  5DNF A;  4LMQ D;  1GUW A;  1WTX A;  3R93 A;  4ZKC B;  1B50 A;  2NZ1 D;  3HP3 A;  4O42 A;  1F9R A;  1G2S A;  1WTW A;  3MWY W;  1EL0 A;  2B2T C;  2KUM A;  2NYZ D;  2B2V C;  2Q8T A;  2K04 A;  5EPJ A;  4X3T A;  1CA6 A;  3H91 A;  5EQ0 A;  1WVL A;  1F2L A;  4U68 A;  1HUN A;  4HED A;  2SDF A;  4X3U A;  1AP0 A;  1EIH A;  1O7Y A;  1PFN A;  2B2U A;  1DON A;  1MI2 A;  1M8A A;  2HUG A;  1U4L A;  3P7J A;  1ML0 D;  4XDX A;  5COY A;  1NCV A;  2KVM A;  1SDF A;  2B2W A;  3I3C A;  5CBE E;  2H1E A;  4MN3 A;  1MSG A;  4X3K A;  1G2T A;  4OIK A;  1HFN A;  2HCC A;  1HFG A;  2X69 A;  1JIC A;  1PDQ A;  1O80 A;  1PLF A;  3I91 A;  4RA8 A;  1DOM A;  2FMM A;  1WTO A;  5E4W C;  1U4R A;  3TZD A;  1WTV A;  2FHT A;  1E0B A;  1NR2 A;  3DM1 A;  4IUP A;  3DEP A;  2KED A;  4IUU A;  5T1I A;  2MJ8 A;  1CM9 A;  5T1G A;  1RJT A;  1XX8 A;  2X6G A; 
#chains in the Genus database with same CATH topology
 1VMC A;  5C3X A;  3JAM L;  4RHR A;  3VYR A;  3OHX C;  1CQF A;  4LW1 A;  2R92 G;  2ZJQ A;  4X6A H;  3M7N A;  4IUV A;  2UXD L;  3L2P A;  1VF7 A;  3K58 A;  3VYT A;  2EY2 A;  2BCO A;  1RKN A;  1UUP A;  2CQA A;  1U4P A;  1FNV A;  1WI5 A;  4A3D H;  2RCF A;  2L12 A;  1LT5 D;  3VA5 A;  2PI2 E;  4HIO A;  3X3M A;  5A2Q E;  3J81 j;  5C0X J;  2GVB A;  5ELD A;  3TP8 A;  4R8I A;  2E2H B;  1E7Z A;  3S16 H;  3PUX A;  4R4O A;  2NB0 A;  4JOI A;  1X3F A;  2F0H A;  2MGS A;  1WFQ A;  4K8J A;  3CD6 A;  1NMG A;  2VQF Q;  1NBW A;  1X3G A;  1P16 A;  5BR8 Q;  1SSO A;  3EVQ A;  3CCS A;  4IZ8 A;  1EIG A;  3NQI A;  3HKS A;  3BJU A;  1Q86 C;  4A3K B;  5CV9 A;  1L1O C;  2H5X A;  2B3G A;  5A2Q L;  4CGY B;  1XMQ L;  1HZ9 A;  2Q2U A;  3I90 A;  1SYD A;  4DR1 L;  2EXZ A;  2E74 C;  2QW7 A;  4CKC A;  5C44 G;  1EWC A;  4ULL A;  4EQN A;  4A93 B;  1LTI D;  2L0C A;  4A3K H;  1JB3 A;  5ELB A;  1IYU A;  4JC0 A;  2QDB A;  5IP9 G;  1F9R A;  3NWT A;  1XTC D;  4ID6 A;  2MUY A;  5KEE A;  4DR7 Q;  4GNX C;  1STB A;  5IIF A;  4V19 0;  4QQB X;  3J7A V;  1AFP A;  4HIK A;  3HOW B;  3FHW A;  4U68 A;  3NWS A;  4RH6 A;  2NZH A;  3K5L A;  3CCV A;  1ML0 D;  1EY6 A;  1G6P A;  3H3V C;  3AQQ A;  4EQ5 A;  1Y1W H;  2CKZ B;  4BA2 I;  1Q1E A;  1SFO H;  3HFZ B;  1HFG A;  4ODG A;  4QGU A;  2D0O A;  2XRQ D;  4RGT A;  1EY8 A;  1K83 B;  2EVB A;  2UUA L;  4DAY B;  2DN8 A;  4X66 Q;  4IUU A;  4ZYS A;  1P8L A;  4WJW A;  1RJT A;  4V0B A;  1IBK L;  2X6G A;  2WKC A;  4DUY L;  1TWG B;  1H9S A;  3BDO A;  4KN7 C;  4JYA Q;  4DV2 L;  3D4R A;  2Z4H A;  2Z6K C;  4HJ5 A;  2NN6 I;  5JEA G;  1SJH D;  2F0D A;  1PRT D;  4A4I A;  1LYL A;  3CCJ A;  4K6D A;  2RKS A;  1A2U A;  5IOC A;  1G91 A;  3R3O A;  1TWG H;  4IQZ A;  1K28 A;  5A35 A;  1I5F A;  4HJA A;  3T56 B;  4BS9 A;  1CKN A;  1Y14 B;  4Z9C B;  3PO3 G;  3CAM A;  1BCP F;  3F2C A;  1SJE D;  2F0V A;  1XPO A;  4OX9 L;  1VQ4 A;  2NN6 H;  1ZEQ X;  4LF9 L;  4F88 A;  1D2B A;  1NR4 A;  3NBI A;  1ENF A;  2E2J B;  2F0I A;  2AHO B;  1DD2 A;  2L9H A;  1R9T B;  4X65 Q;  3FDT A;  1CTM A;  1V1Q A;  1Q82 C;  3M4Y A;  3N52 A;  1OXX K;  4B3T Q;  3MXG A;  4LWC A;  4LF7 L;  2EYO A;  4QMG A;  2XSC A;  5C3E G;  2E2J H;  4A3F B;  3M3Y H;  3OW2 A;  1YHA A;  3A5U A;  1LT3 D;  1N32 Q;  1TT2 A;  3Q24 A;  3ULJ A;  1VMP A;  2H4O A;  4BY1 B;  5CV4 A;  2OEO A;  4BA1 I;  2MP1 A;  3N6R A;  2JA5 G;  4C56 C;  2L55 A;  3MVV A;  4RKB A;  2OTL A;  3A54 A;  4JG2 A;  1PYW D;  3ND9 A;  1VQC A;  5M3F H;  4APV A;  2LKV A;  2CW0 C;  5I9O A;  4KKU A;  2B2V C;  2G9H D;  1AW7 A;  1YJ9 A;  4BY1 H;  1Q8I A;  3VR2 A;  5KNB A;  4J6H A;  3TME A;  1MKH A;  4NB3 A;  4DV3 Q;  2HUG A;  5COY A;  4XDX A;  4IUN A;  4QCL A;  3HGB A;  4DR3 L;  1DM0 B;  3QIA A;  1V8Q A;  3ULL A;  4A3M G;  1STN A;  5C5M A;  2IY5 B;  1VQI A;  3DM1 A;  3DEP A;  1AN8 A;  3BU2 A;  1IL8 A;  4XT3 B;  5ELO A;  4JBM A;  2EYM A;  2VY3 A;  4FF3 A;  2F0P A;  3A8I E;  5ELF A;  3GTP H;  3MXP A;  1IXR A;  5CYU A;  3A7L A;  5EGT A;  4ZKB B;  5GAD C;  2Q8R E;  4UP7 A;  2NVT H;  1PZI D;  2A6E D;  1SNM A;  4LFA Q;  3NTK A;  5GRO A;  1MBY A;  3NBH B;  3LWE A;  1VS0 A;  2K4K A;  1N34 Q;  4OON A;  4B3R L;  2R92 H;  2PZW A;  1AEX A;  3EN2 A;  1J5E L;  1NMF A;  4A3E B;  3T4A C;  3E0J A;  4K6L A;  4DK3 C;  4KY5 A;  1VQM A;  4JCV E;  2RVL A;  3H94 A;  2ICI A;  3KUP A;  2K14 A;  5TSS A;  5GAE C;  4K5W A;  5E3F A;  1PTO F;  1PZK D;  1JE5 A;  2PCF B;  4OIJ A;  5JJZ A;  1W2B A;  5IGB A;  4GKJ L;  2K5N A;  2ZXR A;  3EQL C;  3GV3 A;  2F0M A;  4RG1 A;  4BXX H;  4UY8 C;  2ASB A;  3J81 i;  1HHV A;  3CF5 A;  1SE4 A;  3C46 A;  1JWM D;  4DV0 Q;  3DEO A;  2M9V A;  3D3R A;  4LUO A;  3K0Y A;  2F0K A;  1S72 A;  2N88 A;  1BCP D;  5D14 A;  1C8C A;  1EOT A;  4RAU C;  2D9U A;  5FO7 B;  4NXN L;  1JR0 D;  3GTO B;  4JI6 Q;  4JI5 Q;  3KDF A;  4FP5 D;  5C44 B;  5KRU A;  1NTG A;  1AZQ A;  1TXY A;  5I2Y A;  4CBV A;  2EY6 A;  1FR3 A;  2F0U A;  4DV1 Q;  1PVO A;  4UAI A;  3GTO H;  3Q8D A;  1M1K C;  3M4Q A;  1I50 H;  4TSS A;  1SLJ A;  2B2T C;  3WOF A;  2C9O A;  4OXP A;  5C44 H;  1V1P A;  4NP5 A;  2RQX A;  5LL6 S;  3MAQ A;  1D5X C;  1WCM G;  1JOO A;  2KCN A;  1HNZ Q;  4HED A;  5IP9 H;  5C4X B;  3S14 B;  3VR5 A;  1JOR A;  3VR3 A;  1PFN A;  1YVC A;  2P5Z X;  2JN4 A;  4L5R C;  2BA0 A;  1EY9 A;  4PNY A;  1L1O B;  1HFN A;  1HQR D;  2X69 A;  3Q0A A;  4RA8 A;  4GOP B;  1N33 Q;  1PH6 A;  5CGK A;  3WOE A;  4LUZ A;  3RUZ A;  2VQF L;  4A76 A;  1CM9 A;  3SR1 A;  1LT4 D;  4QJF A;  5C4X H;  2DUD A;  3S14 H;  3HOU B;  1L0Y B;  1BKB A;  3PGZ A;  1LAB A;  3MXU A;  3FMC A;  5M5X B;  4GN4 B;  1BF4 A;  1ESF A;  1IL2 A;  1J9O A;  3IKJ A;  4OL7 A;  4H44 C;  4BY7 B;  3GTG H;  4DV4 Q;  1PFB A;  3H09 A;  3H0G G;  4G7Z C;  4GLA C;  2K33 A;  5JEA H;  3H3V I;  4DKA C;  2OT2 A;  3TS0 A;  5M5X H;  4QUC A;  3FRP B;  1X56 A;  2R7Z G;  3CCQ A;  2NVQ B;  3Q22 A;  4FXK C;  5JVH 3;  4BY7 H;  1RHP A;  4DR7 L;  2PI2 A;  1FYC A;  3RZO H;  3DMU A;  1STE A;  2IL8 A;  1FVI A;  1CT1 D;  1K3B C;  3A8J E;  1A63 A;  2PQA B;  1I4P A;  3H3V H;  4FF4 A;  5M3M G;  3SVM A;  4FXD A;  2NVQ H;  3ICE A;  4H13 C;  1H9R A;  2CHB D;  1QE6 A;  3HS0 C;  3SK8 A;  1BVS A;  3KLS A;  4WRD A;  3KLW A;  3B6Y A;  4JV5 Q;  1D5Z C;  3CXC A;  1EFW A;  4X66 L;  3I73 A;  1S5C D;  1YNN D;  1B4O A;  2N49 A;  1HUM A;  1SXT A;  2IX3 A;  3VDY A;  4DK1 A;  1HJP A;  3MXN B;  1VQ6 A;  1E22 A;  2UUB L;  1KQS A;  1OXU A;  3HOV B;  4DUY Q;  4BBS G;  5LMN L;  3LWU A;  2MO1 A;  1C48 A;  1CUK A;  4PMW A;  3GTK B;  1EIF A;  1JWS D;  1F2L A;  3KLR A;  4AH6 A;  2A74 C;  4DAY A;  1JT8 A;  3HOV H;  5IYD G;  4DV7 L;  3KYH C;  2LXK A;  1VF5 C;  4HN7 A;  4DAV A;  4IJL A;  2B39 A;  1ZYR D;  3I4M B;  1E1O A;  1EY0 A;  4XTC S;  4A3J G;  1EOV A;  3F2D A;  1FNW A;  4KJO A;  2K5H A;  3CCU A;  4LF9 Q;  5AJ3 L;  4PMC A;  4A3M H;  4PQX A;  1BO0 A;  4R4T A;  5C4J B;  2EOT A;  3A7A B;  5M5W H;  3HOZ G;  4CDF C;  4FYD A;  2ZTC A;  2FFK B;  1N32 L;  5I6Y A;  2F0N A;  3S2H B;  2B63 G;  4GN5 A;  1S5B D;  2XIW A;  2JP1 A;  3PSI A;  2IPK D;  4DAM A;  1VQL A;  3CU7 A;  3NTH A;  1NUC A;  2ATW A;  3UI2 A;  2KOL A;  2XWJ B;  1YEZ A;  4XYO A;  3ZJY C;  3KOJ A;  2RHS B;  2LS0 1;  2K7V A;  4QY7 A;  1LV9 A;  1AE2 A;  4HJ9 A;  1MD2 D;  1WOC A;  2R6G A;  3QR8 A;  1SRU A;  3PF5 A;  1NJI C;  5EPK A;  3K7U C;  4K8I A;  3F8T A;  4JI8 L;  1CZG A;  4RGO S;  2CVR A;  4IOA A;  2AQ2 B;  4IOC A;  4DR3 Q;  1PTO H;  3K57 A;  5EKI A;  3D8G A;  4P74 A;  2OXP A;  3T13 A;  2B2W C;  2WII B;  2BH8 A;  1RD9 D;  3FKI B;  4K5V A;  2G9D A;  3G4S A;  2MO0 A;  3QG1 A;  5I4D A;  1WTX A;  4LFA L;  1DCZ A;  5FK9 C;  3MWY W;  1N34 L;  1HH2 P;  2F03 A;  1XPR A;  2PMZ E;  4IPG A;  5LMU L;  2JA7 G;  2AQ1 B;  5ELN A;  4OGQ C;  4G7H C;  2SDF A;  1K8A C;  3E6Z X;  2PW7 A;  2L5T A;  4B3R Q;  1LUZ A;  2R7F A;  1PRT C;  1WCM H;  1AE3 A;  1G2T A;  1XMO Q;  4TQU S;  1GO3 E;  1W3S A;  3K59 A;  1IBM Q;  2GN5 A;  1PA6 A;  1VQB A;  4XYQ A;  1F2Y A;  3TZD A;  1X65 A;  1XTD A;  4A3I B;  4OO1 G;  2KHS A;  2F4I A;  4DV0 L;  3LX0 A;  3NBH A;  5IWA Q;  4HMI A;  2EDG A;  1E2W A;  1EU4 A;  4HMJ A;  2PMZ B;  1SR3 A;  2QDL A;  1RTO A;  1Q90 A;  1EQR A;  5C4Z A;  5DM7 3;  3PQI A;  2JA8 G;  4K2L A;  4JI6 L;  4JI5 L;  2PQE A;  3D6C A;  1Q1B A;  1V1P B;  4P72 A;  3P20 A;  1Q3L A;  1H9K A;  2PYK A;  3W5O A;  1Z7T A;  1PMR A;  4NXN Q;  1IZ6 A;  3HKZ G;  4GN3 B;  5IYB G;  1ILP A;  3KK7 A;  1DOK A;  4L5S A;  4PG3 A;  4ZLT F;  3CCE A;  4DV1 L;  4MIU A;  4KY7 A;  4ZCK A;  4A3D B;  3BZD B;  4ILW A;  1Y1V G;  4IUQ A;  2E75 C;  4AQY L;  4XXE A;  3F2U A;  5ISR A;  2R7Z H;  5CC4 A;  1HNZ L;  4R9W A;  3S16 B;  4N8X 1;  1KL9 A;  1RDP D;  5FKA C;  4RGN A;  1LTA D;  3VA7 A;  4CDD C;  1CK1 A;  1LTL A;  2A69 D;  3PUW A;  4LNQ A;  3KFU A;  4QL5 A;  3V96 A;  3PO2 G;  1N33 L;  1UEA B;  5IP7 G;  4IUR A;  4X3S A;  2L11 A;  3KJP A;  2XTI A;  2C5C A;  2B2U C;  3BS1 A;  3PF4 A;  1H95 A;  1GUN A;  1JE4 A;  3NXW A;  1Q46 A;  2RHQ B;  3OSO A;  2ZT9 C;  3GTJ B;  3E3X A;  2VS1 A;  2LXJ A;  3UDG A;  2ZM6 Q;  4BWG B;  3HOX G;  1Q7Y C;  4DV4 L;  1I4Q A;  1D1K A;  2K52 A;  3T1H Q;  4KTA A;  1L1O A;  4Y7N H;  2OTJ A;  4MZ9 A;  2TMP A;  1B1Z A;  4KJN A;  3ERQ A;  4TVA B;  4K2K A;  4GOP A;  1X9N A;  3GTJ H;  1O7Y A;  2YYZ A;  4B9W A;  2A6E C;  3U9O A;  1XWE A;  4FXG C;  2JEB I;  4JI1 Q;  5K36 G;  2CWA A;  4JVZ A;  2ZXP A;  4X62 L;  2UU9 L;  1SYF A;  4KHP Q;  3NPP A;  1UE7 A;  3Q23 A;  4R8N A;  1WTV A;  5IYD H;  5IOD A;  5IE8 A;  4DV6 Q;  1Y1W B;  4KD3 A;  1FL0 A;  1MJE A;  3OMC A;  1SFO B;  1YNJ D;  1HNW Q;  1LLR D;  3I72 A;  2R7D A;  2O2L D;  1EY5 A;  4U67 3;  3STB D;  4CJ1 B;  2ZJP A;  3KF6 B;  1LT6 D;  4ZUI A;  4JV5 L;  2CH4 A;  2K32 A;  3I8Z A;  1VQ7 A;  3A0J A;  1UE1 A;  1KAA A;  2F4V Q;  3PIP 3;  1BCP C;  3CQZ B;  4HR7 B;  2XRS D;  1CHP D;  2HDM A;  4PZ8 A;  3D31 A;  1TWA H;  2PQA A;  1F77 A;  2WP8 J;  2EIF A;  1VQK A;  1EEF D;  1X3Q A;  4Y52 H;  3AYH B;  2RSO A;  5EJW A;  1C9O A;  1EYC A;  2Z6K A;  3TS2 A;  1VQH A;  2UUB Q;  2UUC L;  4TRD A;  2F0J A;  4UPA A;  2O5J C;  1CA5 A;  3E0E A;  1TII D;  3CQZ H;  5F2D A;  4IUT A;  3LGJ A;  4QF4 A;  1LAC A;  2DY7 A;  5LMN Q;  5KND A;  2D2C C;  2D0P A;  2R93 G;  3U58 A;  2J0T D;  1ILQ A;  1X32 A;  4FNF A;  1TS2 A;  4A3B B;  2EXD A;  3HOY G;  3TEH B;  1CSP A;  1BOS A;  3MXN A;  4YHH L;  2JA6 G;  4LUV A;  4DV7 Q;  3J80 i;  2Y0S E;  4DR4 L;  1STA A;  3G6E A;  1KIX A;  4FDB A;  5JOB A;  2QEX A;  3NUC A;  1O7Z A;  1C7Y A;  5I2X A;  3OIQ A;  1SAP A;  4FF1 A;  3G7L A;  3M3Y B;  2BE5 D;  1JJC B;  4A3B H;  2F3V A;  1UEB A;  1GKH A;  2JYO A;  1XNR Q;  2WFW A;  4DR5 L;  3MA2 B;  3PUY A;  5AJ3 Q;  2NVY H;  1DXM A;  3QWN A;  3I2Z A;  1CHQ D;  1GJX A;  1BBW A;  5KIX A;  2EYJ A;  4K14 A;  2Q8T A;  1MJC A;  4DXG A;  2Z4I A;  1ENC A;  4IPD A;  2WB1 G;  1HUN A;  3CRK C;  2Y0S B;  5D3I B;  5M3F B;  3ZYY X;  4OO1 I;  4LF6 L;  1DON A;  5CV5 A;  5JEA J;  1PXU A;  3ULP A;  2VUM G;  1JJG A;  1NCV A;  3U4V A;  4X3K A;  3QJY A;  5LL6 X;  2XGT A;  3I4L A;  3UDI A;  2KEN A;  1DOM A;  2PNH A;  4HJ8 A;  3DUZ A;  1LO5 D;  2KED A;  1OO9 B;  3PIO 3;  2B2V A;  3BVG A;  4Q0F A;  4H0L C;  2QCP X;  3T1Y Q;  1F9S A;  1HCZ A;  1DYQ A;  4FO2 A;  3RNU A;  4OO1 H;  3K6O A;  3M85 A;  4ZAI A;  5J1Z A;  2K03 A;  4PMB A;  3GTQ H;  3RMH A;  3F2B A;  1A0I A;  4DGZ A;  1IKM A;  4C3I G;  3GTP B;  1PH7 A;  3CCM A;  1KXL A;  4EQO A;  1NY4 A;  1R4Q B;  2NVT B;  4NKL A;  4GZY C;  3RLN A;  4IPC A;  2CH4 W;  4JI8 Q;  4A3C G;  5COR A;  2KCT A;  5GAH C;  1PRT B;  4CDE C;  2R92 B;  2WAQ G;  1PTO C;  3T51 B;  2DJG C;  2O4X A;  1SEB D;  4LK1 C;  1NE3 A;  1T5E A;  1X3E A;  4TKO B;  1YNN C;  4DFA A;  3KF8 A;  3Q6S A;  5BN3 A;  3HG9 A;  2IHE A;  1Y1V H;  4MTN A;  4C3H G;  2CQO A;  5L37 A;  3K7A H;  2D62 A;  1SE8 A;  1JOK A;  1RF2 D;  2KCC A;  2QF7 A;  5LMU Q;  1XMO L;  2Q8I B;  1IBM L;  5BN4 A;  4A3G G;  3A74 A;  1I6H B;  3PV0 A;  4OWT B;  2RDF A;  2DNE A;  5GQO A;  5D65 A;  4B08 A;  3J81 c;  1GM5 A;  1U9R A;  5IYC G;  4B3M Q;  3IRB A;  4YIJ A;  5IWA L;  1HZB A;  3FPU B;  2EJF C;  1KNE A;  3V2T A;  1PHJ A;  1GHJ A;  2JEA I;  3E9I A;  3G6J B;  3PUZ A;  1D1I A;  2FXQ A;  5IP7 H;  5J39 A;  4NMZ A;  1ZYR C;  3CKI B;  2EZV A;  1I6H H;  4RMF A;  4JK1 C;  5DNF A;  1ONL A;  2E2I B;  3R93 A;  2NTS A;  4GKK L;  3HP3 A;  4O42 A;  1U0L A;  4LAA A;  4KMU C;  2I0Q A;  3J81 E;  4YWK A;  4LF8 L;  2LFN A;  1PH8 A;  3SE0 A;  1UE6 A;  1I50 B;  3CPW A;  4DNR B;  2PZU A;  4IJH A;  1EFI D;  1QVF A;  2E2I H;  4UHV A;  3I4N G;  1I94 Q;  1NNX A;  3C3L A;  1PLF A;  1JQY D;  1WTO A;  2EYP A;  2GVA A;  4H02 A;  1E1T A;  3K0X A;  2ICE C;  5FJ8 G;  1XX8 A;  4AQY Q;  1S5D D;  3QO2 A;  3K80 C;  5EBC A;  2PPB C;  3AFP A;  3GQB A;  4DK0 A;  3IFT A;  4IFD G;  2JA9 A;  3AB9 A;  1SE2 A;  3U9S A;  3J81 L;  3G71 A;  1WJJ A;  1HA5 A;  2VZA A;  1D8L A;  2BDN A;  1GUG A;  2KEC A;  1SNO A;  4M8A A;  5J3B A;  1TY0 A;  1NSN S;  3SK4 A;  4KLK A;  5AFW A;  1LTB D;  1MSH A;  2F0L A;  3GTG B;  4S3S A;  1YHQ A;  5I6W A;  1T5X D;  5HGT A;  4XT1 B;  1OTC A;  2ZM6 L;  1YIJ A;  1BQQ T;  4EVO A;  2LMC B;  4XQQ A;  3T1H L;  3UDX A;  1SBB B;  2R93 B;  2AUJ D;  1FGU A;  2KBN A;  3U50 C;  1G8Z D;  1HNX Q;  2WKD A;  4GNX B;  4C2M H;  1EU3 A;  4RHS A;  3HOY B;  3PO3 B;  3RZO B;  2VL6 A;  3ER0 A;  4RWS C;  4BBR G;  3GTL H;  4JI1 L;  3NSW A;  1SYB A;  4L63 B;  2JJQ A;  4XIG S;  4YCU A;  3I56 A;  4KHP L;  2AWO A;  2R93 H;  3WWV A;  1UWV A;  4DV6 L;  3VYS A;  3C1F A;  2IJ0 A;  1A2T A;  1HNW L;  3SXH A;  1HR0 Q;  3S1R H;  3HOY H;  3PO3 H;  4X62 Q;  3KLS X;  3PIP A;  2UU9 Q;  1I3Q B;  2EYH A;  2JA6 H;  2K5V A;  2AKW B;  1O7I A;  2IW3 A;  2V1C C;  5EKL A;  2E5L L;  2NZ1 D;  4NXM L;  1EZ6 A;  4KKT A;  5C3E B;  1G2S A;  4PZ6 A;  2KUM A;  1Y8O B;  4CKE A;  2HHH Q;  2YU9 H;  5FO9 B;  4C1N I;  1J6Q A;  2F4V L;  1CA6 A;  1I3Q H;  3RLO A;  2KQ3 A;  2F0S A;  1VQ9 A;  2G5D A;  1MI2 A;  1GUS A;  4L5T A;  4R1J A;  1PH4 A;  2JA5 B;  2RDG A;  5C3E H;  2EJG C;  1STH A;  1L0X B;  1JIC A;  1O80 A;  2A19 A;  2HQL A;  3TSS A;  2KHI A;  3NE5 B;  3KF6 A;  4O2D A;  3RD4 A;  2VUM H;  1BDO A;  1E0B A;  2CFM A;  4IUP A;  2MJ8 A;  3X3N A;  1QUQ B;  1B9M A;  5GAG C;  1ICW A;  2UUC Q;  2JA5 H;  4N9P A;  1I6V C;  1UNS A;  2B8G A;  3SDZ A;  2JK8 A;  2A1A A;  3A56 A;  2K05 A;  3E9H A;  5E4X A;  1KD1 C;  4A3M B;  1MIU A;  1EQV A;  3TDQ A;  1VQA A;  5KYL A;  1GUT A;  3MHB A;  2F0W A;  1CI3 M;  2A6H D;  1F2Z A;  2WAQ B;  2OQ0 A;  3PCO B;  2KEE A;  2IWH A;  3WDN A;  2OWO A;  4YHH Q;  1K0R A;  5M5W B;  2A69 C;  3MTS A;  4C3I H;  2N55 A;  4DR4 Q;  1TWC H;  1XNR L;  2XVS A;  2A68 D;  3OWE B;  3RN5 A;  2HCI A;  1R4P B;  2B8F A;  1V1O A;  4A3K G;  4A3C H;  5C3W A;  4K0K L;  3BYT B;  4JBJ A;  4IPH A;  3FVQ A;  4DR5 Q;  2HIX A;  4JW0 A;  3PIO A;  5FO8 B;  2VNU D;  1QOH A;  1STY A;  4XQN A;  5KGU A;  3OOC A;  4PZ7 A;  4A93 G;  3I55 A;  4C3H H;  3CCL A;  2QEJ C;  4JI3 Q;  4LF6 Q;  3QOJ A;  3MEH A;  4J15 A;  4G4K A;  2SNS A;  1QG7 A;  1JJ2 A;  1I4G A;  3HOW G;  1UAP A;  2D5D A;  2N78 A;  2SNM A;  3T1Y L;  1Y8N B;  2RSN A;  4KK7 A;  3GTM B;  4JPB W;  1PTO B;  3SK6 A;  3NEN A;  5IYC H;  1L2F A;  3TP5 A;  4NW2 A;  5IY0 A;  2BOS A;  1BBX C;  1ZKO A;  4HCE A;  1YHB A;  4DPG A;  3TQY A;  1I4R A;  1HZA A;  1YNJ C;  2OF1 A;  1VQD A;  3KF8 B;  4R4C A;  3AEV A;  3H91 A;  3CC2 A;  3GTM H;  3OWF A;  3STB C;  1EYA A;  1UE5 A;  1TWF B;  4JI4 Q;  1GVP A;  2MHV A;  1D7Q A;  3RLF A;  2B2W A;  2SEB D;  4IFD I;  1PDQ A;  1I4X A;  1II3 A;  4LFB L;  4L8J A;  3H15 A;  3P1H A;  2A5H A;  1WCM B;  1F2M A;  2L15 A;  5T1I A;  2NZO A;  1ICF B;  4XQJ A;  1TWF H;  4UP9 A;  3HZX A;  4DA2 A;  3S9W A;  2EYL A;  3UE1 A;  1IW7 D;  1TKW B;  2FIN B;  2X6L A;  3OMG A;  2B2Y C;  5FOB B;  5FJ8 H;  4E6I A;  2NTT A;  1SMY D;  2BH2 A;  5CV6 A;  2IHF A;  3F1Z A;  3GV6 A;  4IFD H;  1B53 A;  4B3M L;  3KJO A;  1X3P A;  1SND A;  3EIV A;  1XNQ Q;  3NP8 A;  1BUV T;  4WOR A;  3L7Z C;  5KYI A;  1FD7 D;  2K28 A;  2A8V A;  2XWB B;  3I70 A;  1PV4 A;  3TRZ A;  1JOQ A;  1JCK B;  3J7A F;  4RFB A;  1X6O A;  2RBM A;  1PH9 A;  5JAV A;  2FJ2 A;  1WYD A;  2HD3 A;  1EUJ A;  1X54 A;  4Q5V A;  3S2D H;  4A3F G;  4QIW E;  3JAM i;  3H0G B;  4HJ7 A;  2F3W A;  3PMF A;  4C3J G;  1IBL Q;  4DN4 M;  3TP7 A;  4GKK Q;  2K50 A;  3BDC A;  1A6X A;  1HQM C;  2SOB A;  4FF2 A;  3E5S A;  4LF8 Q;  3UDF A;  2R7Z B;  1I94 L;  1CKM A;  5C0X G;  4KV6 A;  2ZJR A;  4B3S Q;  3MZ5 A;  1C4Q A;  2C35 B;  3H0G H;  1RIP A;  3K5O A;  1YIT A;  1TWH B;  4YCW A;  3IL8 A;  1Q12 A;  4QB4 A;  5HY6 A;  2QIL A;  3DM3 A;  4MHE A;  4QIW B;  5M3M B;  1EY7 A;  4YY3 Q;  3JC6 6;  4OWW B;  3RR5 A;  5DEH A;  2ZTE A;  3OTO L;  3M9B A;  1EWH A;  2CWP A;  3L3O C;  1TWH H;  3GP7 A;  2K75 A;  1CSQ A;  1MHW C;  4P75 A;  2NUC A;  2RCN A;  4A75 A;  1B8A A;  2NBF A;  3CC4 A;  5M3M H;  1N36 Q;  5NUC A;  5I9P A;  3CCR A;  5JJL A;  1AP0 A;  1EIH A;  2B2U A;  2JXM B;  1DJR D;  4Y7N B;  2EY1 A;  4ABN A;  1YNX A;  3M7G A;  3I3C A;  1K3R A;  2Q2I A;  4BBS B;  5K5P A;  1ASZ A;  1SNC A;  4IO9 A;  2JE6 I;  1HNX L;  5M9O A;  2MFI A;  3SEB A;  1Z6H A;  1VQF A;  4A3E G;  3SGI A;  1HTP A;  4BXX G;  3TN2 A;  1VCI A;  1EEI D;  4LF5 L;  5C6A A;  4BBS H;  1VQE A;  2UXB Q;  3TBI B;  1M4V A;  4JOI C;  3IFD A;  5HUR A;  1SYE A;  4A3J B;  1HR0 L;  1A3U A;  3AFQ A;  1KDB A;  5CR3 A;  1K73 C;  2E2H H;  3DXJ C;  3S1M B;  2BDO A;  4NDX A;  4GNX A;  2ALY B;  1QWY A;  3FP9 A;  3K5N A;  3ERO A;  1S5F D;  4GOP C;  3CME A;  4DV5 L;  4A3J H;  3HOZ B;  4P73 A;  1CFM A;  2HHH L;  3NEM A;  4JBK A;  3PUV A;  1TWA B;  2DY8 A;  3G48 A;  2CCZ A;  1TR5 A;  2J4X A;  2B63 B;  3S1M H;  2E5L Q;  1CQV A;  1AH9 A;  4NXM Q;  5HGQ A;  1YBY A;  2L1B A;  1ROD A;  4KHV A;  3MC0 B;  1HRJ A;  1B9N A;  1QJO A;  1FNU A;  4LFC Q;  3C1E A;  1BXT A;  3MEF A;  5G3L D;  2KCM A;  1A15 A;  5EAY A;  3HOZ H;  1GD7 A;  3OW7 A;  2B63 H;  2VQE Q;  4WJ3 M;  1F9P A;  1JB7 A;  2I5L X;  4A93 H;  4C1N K;  4O1N A;  1FJG Q;  4POG A;  1QZG A;  5C4X G;  4M1U B;  3CC7 A;  1WD1 A;  4IAL A;  1VDZ A;  3L0O A;  1Q81 C;  4R4Q A;  3U4Z A;  3J80 c;  3HOW H;  1VQ5 A;  1TS3 A;  1KRS A;  1SN8 A;  4EX5 A;  1EL0 A;  1ET9 A;  3VYU A;  1GHK A;  1PFS A;  3BG3 A;  2NVY B;  4YCV A;  2KA7 A;  1TY2 A;  3HOU G;  2DNC A;  1SE3 A;  2F1M A;  1CKO A;  1EYD A;  1K83 H;  1QUQ A;  2KVM A;  1Z47 A;  4MN3 A;  4JI7 L;  3ITP A;  1H9J A;  1G29 1;  4A3L G;  3J80 E;  5IGG A;  4BY7 G;  5C4H A;  2VW9 A;  4HTH A;  2JA7 B;  2EE1 A;  4K0K Q;  1FGB D;  2ENB A;  2UXC L;  4P2C B;  3CW2 C;  4KI0 A;  4DAP A;  5CV8 A;  5C5L A;  4JI3 L;  5CBA E;  5IGE A;  3HKZ E;  4JI0 L;  4N9T A;  4FVM A;  1XYI A;  1V43 A;  1RL2 A;  2JA7 H;  5EPL A;  3GTQ B;  2M2L A;  2FMC A;  1SYC A;  1WTP A;  1OXV A;  1PH2 A;  3J80 L;  1E2Z A;  1EWI A;  1HPC A;  2ES2 A;  3BDL A;  3SHL A;  1HA6 A;  4R4I A;  2JA8 B;  3TP6 A;  4C3J B;  2DGY A;  2R3Z A;  1R9T H;  1KAB A;  1OXS C;  2Z9H A;  2RDH A;  5C0X I;  1E2V A;  1A62 A;  4ZRZ A;  3HKZ B;  5BN5 A;  1XPU A;  1C0A A;  5H1S E;  3NHH A;  4JI4 L;  3S24 A;  1B44 D;  1SNP A;  4MTK A;  4J1M A;  3HRZ C;  2VB3 X;  4A3F H;  3BZC A;  2JA8 H;  1TS4 A;  2MPM A;  4C3J H;  2OCE A;  2WAC A;  3HOV G;  3R2T A;  4NPS A;  1Y1V B;  2JQO A;  1TVX A;  2RF4 A;  3K7A B;  2NWG A;  5J22 A;  4POF A;  1PH5 A;  1HTL D;  2RA4 A;  1QNU A;  1O78 A;  5IYB H;  1ASY A;  3R8B A;  2PW5 A;  2F0G A;  1VQG A;  1QVC A;  4H7B A;  5C0X H;  1RTN A;  1VQP A;  4LFB Q;  2EJM A;  1ZXT A;  3J7Z C;  1U5K A;  3PO2 B;  2ZXO A;  4ZKC B;  2Z6B A;  1N8R C;  1K8M A;  1WTW A;  3I4O A;  4JI2 Q;  4B9X A;  1JC7 A;  4L5Q A;  1XNQ L;  3I4M G;  5JPN C;  4DXF A;  3CMA A;  5EQ0 A;  5IT9 c;  2F0F A;  4I7A A;  3P7J A;  1SRO A;  2V4D A;  2HQE A;  3PO2 H;  1SDF A;  3HOX B;  2EY5 A;  4OIK A;  4HIM A;  4CDC C;  3NTI A;  3A5Z B;  1BBU A;  1QIL A;  1L0W A;  5LMN W;  4DR6 Q;  2A6H C;  2YV5 A;  2Q2H A;  4ZQ3 A;  2O5I C;  5E4W C;  1IBL L;  1JMC A;  2F0O A;  1NR2 A;  4ZUJ A;  4OEL B;  4RGM A;  4N8F A;  3UE0 A;  4J8Q A;  1K9M C;  4WJ4 A;  2A68 C;  5IT9 E;  3DWQ A;  1CZW A;  1A3T A;  5EKK A;  4DK6 C;  2JSO A;  3HOX H;  1ET6 A;  1RCV D;  1TU2 B;  2M00 A;  1IKL A;  3L9A X;  4B3S L;  3NK9 A;  3S15 B;  2XN9 C;  4YWM A;  2NVX B;  4A3E H;  2F0T A;  1VQJ A;  4X64 L;  4JBW A;  5FLM G;  1AZP A;  4GS3 A;  1DGS A;  3K81 C;  1QB5 D;  1K0S A;  4DUZ Q;  1PYB A;  1ESR A;  4LF4 Q;  4YY3 L;  2B2T A;  1KLU D;  1WD0 A;  5K36 H;  1XJV A;  3S15 H;  4LJZ C;  2NVX H;  3C2P A;  3EA6 A;  3TRE A;  2DJF C;  4O0A A;  4DR2 Q;  3M4O B;  5FLX c;  3J7A 5;  5IT9 L;  3BVZ A;  1K8G A;  1V9P A;  2K5W A;  4HSP A;  3OTO Q;  1EIY B;  4RCN A;  1N36 L;  4CHT B;  3S1Q B;  2E8G A;  3K5M A;  1KTK A;  1HXY D;  1I4H A;  4HAE A;  5IGC A;  2Z0S A;  3IAY A;  3FKI G;  4YWL A;  3J7Y W;  3M4O H;  3NQT A;  4C2M B;  1PH1 A;  3ND8 A;  2UXD Q;  2A73 B;  4AYB G;  4HCS A;  5FLX E;  4OEM B;  1VQN A;  3GTL B;  1TQO A;  2KJX A;  3S1Q H;  1B3A A;  3I7F A;  4QUF A;  2B29 A;  5JPM C;  1IYJ B;  3SK5 A;  1F9Q A;  2UXB L;  3QOL A;  3S1R B;  2XNA C;  2F52 A;  4G7O C;  2JA6 B;  4ALP A;  2WB1 E;  3HEJ A;  5BR8 L;  4LF5 Q;  4DU9 A;  3DWA A;  2AWN A;  2F0E A;  4A3I G;  2TSS A;  3T53 B;  4IFD J;  4I65 A;  2IX0 A;  3D4W A;  1IW7 C;  1Y69 U;  2ID0 A;  1EY4 A;  5FLX L;  2YU9 B;  1BCP B;  1SMY C;  1U4L A;  3K8A A;  2WV6 D;  3P75 A;  1SYG A;  4UDU C;  2HCC A;  4KKS A;  2LY7 A;  5KNC A;  3HOU H;  3DHQ A;  3W1B A;  1GUO A;  1XMQ Q;  2FHT A;  4DNI A;  3D4D A;  1G51 A;  1LM0 A;  4UP8 A;  4OWX B;  1GOZ A;  5T1G A;  2WB1 B;  4KD4 A;  1DOL A;  2MNA A;  2CW0 D;  3MFY A;  5DM6 3;  4DV5 Q;  4A3L H;  2AMC B;  4I7Z C;  4DR1 Q;  1E3P A;  2Z8L A;  1WTQ A;  2VUM B;  3FEW X;  3V05 A;  1U4M A;  4LFC L;  4CKB A;  4P71 A;  2VB2 X;  4F7X A;  3M4P A;  3BZK A;  2GA4 B;  3CPF A;  4A3D G;  1GXD C;  3TZU A;  4CJ2 C;  4RCO A;  1KAW A;  2VQE L;  1H9S B;  1LTG D;  1EZ8 A;  1KNA A;  3NEL A;  3BVM A;  4F87 A;  1FJG L;  2WAQ E;  1QNK A;  4GLX A;  5M5Y B;  1PTO D;  1JWU D;  2QA4 A;  3A55 A;  4C3I B;  2PNR C;  2OQK A;  1KDA A;  1TWC B;  1STG A;  2L4N A;  4JYA L;  1CKN B;  5JJI A;  3CRL C;  1WTR A;  3GDE A;  2UUA Q;  1W6K A;  5ELC A;  4CJ0 B;  2E2D C;  5M5Y H;  1IBK Q;  1VQ8 A;  3DLL A;  1Y8P B;  1YJN A;  3BYY B;  2F3I A;  3VR4 A;  1QVG A;  4DV2 Q;  5D3D A;  2KHJ A;  1YJW A;  1M90 C;  1PH3 A;  1J8I A;  3KBG A;  1BR9 A;  1W6J A;  3EBE A;  4JI7 Q;  2QKI C;  1LTR D;  4C3H B;  5CV7 A;  2Q2T A;  1A8V A;  1PFM A;  3RN2 A;  1WTH A;  3MFG A;  1X55 A;  2K01 A;  4ZK9 B;  3H6M A;  2YTY A;  3GTK H;  4DNT B;  1O7L A;  4K5X A;  1S40 A;  4A3G B;  4LMQ D;  1GUW A;  2K5D A;  3EFX D;  4OX9 Q;  1H9M A;  4X65 L;  4MNO A;  2MQH A;  3GO5 A;  3URY A;  5E7N A;  1Q8K A;  1YI2 A;  2UXC Q;  2I5H A;  3ERS X;  2K04 A;  5EPJ A;  1Y1W G;  4X3T A;  4B3T L;  1OXT A;  2N8N A;  4JI0 Q;  4X3U A;  5E1F A;  3CHB D;  1K8O A;  2BA1 A;  3I4M H;  2K5Q A;  3D0F A;  4A3G H;  2EYF A;  2F0Q A;  5CBE E;  2H1E A;  5JJK A;  4KY6 A;  3S17 B;  4IN3 A;  3I91 A;  4LF7 Q;  2YTX A;  1U4R A;  2I5M X;  5C4J H;  5LHY 1;  3CP0 A;  1EYG A;  3D6W A;  3RZD B;  1KDC A;  4WFN 3;  2K1B A;  3OIP A;  3S17 H;  1DZ1 A;  2YTV A;  3I4N B;  3S2H H;  1HR0 W;  4KN4 C;  1PZJ D;  2IX1 A;  1G6Z A;  1N9W A;  2IT1 A;  4DV3 L;  2LSS A;  3W1G A;  2HIV A;  4ME5 A;  1PYS B;  3DWP A;  4AYB E;  1QCB D;  4DF7 A;  2QGQ A;  5FLM H;  3RZD H;  2NN6 G;  5EBD A;  3OYY A;  2J7Z A;  3S1N B;  1T9H A;  4HSV A;  3I4N H;  2HDL A;  5JVG 3;  4L6T B;  3AMU A;  4G57 A;  5CMD A;  4A3B G;  1NAP A;  2E76 C;  2EPB A;  4JI2 L;  1IHZ A;  4AIM A;  2B2Y A;  1BNZ A;  2N3S A;  1KC8 C;  4ME3 A;  3EJI A;  2PZT A;  1EQT A;  3W3A A;  4GLV B;  1YZ6 A;  5DLQ E;  3AU7 A;  1LTS D;  3W2D A;  3S1N H;  3S2D B;  2EQS A;  3GD7 A;  3T16 A;  1HZC A;  4AYB B;  3FPP A;  2AQ3 B;  4F8M A;  4EQP A;  3JAM c;  4DR6 L;  1A3V A;  1ENA A;  1B2T A;  2VXW A;  4KHZ A;  3ONA B;  1XXG A;  1LTT D;  5G3L F;  3FKI H;  1TS5 A;  1S3O A;  1J5E Q;  2WIN B;  1S4Z A;  5IGD A;  1KLG D;  2Z1C A;  1B3Q A;  2Y0S G;  3KBX A;  5M3F G;  1KHI A;  1E24 A;  4BBR B;  2BE5 C;  3LNN A;  3R2I A;  4RKL A;  1MGS A;  2K6A A;  2HT1 A;  4BY1 G;  3KDF B;  1B50 A;  5DAU A;  3JAM E;  3O13 A;  1B70 B;  1KRT A;  1VQO A;  2NYZ D;  2R61 A;  5IGF A;  2PO4 A;  4GKJ Q;  3QB3 A;  1QZH A;  4DUZ L;  4X64 Q;  1SNQ A;  1WVL A;  3VR6 A;  2AUK A;  4EGV A;  4LF4 L;  4BBR H;  3OPO A;  1B7Y B;  2ZTD A;  1EQQ A;  4HID A;  1D6E C;  1M8A A;  4OHJ A;  4DR2 L;  4A3I H;  5ELE A;  1MSG A;  1S5E D;  2I07 B;  1Z9F A;  1PRT F;  1D5M C;  2FMM A;  4PV1 C;  3A8K E;  1IYV A;  1SMX A;  2I46 A; 
#chains in the Genus database with same CATH homology
 1VMC A;  5C3X A;  3JAM L;  4RHR A;  3VYR A;  3OHX C;  1CQF A;  3M7N A;  4IUV A;  1VF7 A;  3K58 A;  3VYT A;  2EY2 A;  2BCO A;  1RKN A;  1UUP A;  2CQA A;  1U4P A;  1FNV A;  2L12 A;  1LT5 D;  3VA5 A;  3X3M A;  5A2Q E;  5C0X J;  5ELD A;  3TP8 A;  4R8I A;  2E2H B;  3PUX A;  2NB0 A;  2F0H A;  2MGS A;  4K8J A;  1SSO A;  3EVQ A;  4IZ8 A;  1EIG A;  3NQI A;  4A3K B;  5CV9 A;  5A2Q L;  4CGY B;  3I90 A;  1SYD A;  2EXZ A;  2E74 C;  4CKC A;  1EWC A;  4ULL A;  4EQN A;  4A93 B;  1LTI D;  2L0C A;  1JB3 A;  5ELB A;  1IYU A;  2QDB A;  1F9R A;  3NWT A;  1XTC D;  4ID6 A;  2MUY A;  5KEE A;  1STB A;  5IIF A;  4V19 0;  3J7A V;  1AFP A;  3HOW B;  4U68 A;  3NWS A;  4RH6 A;  3K5L A;  1ML0 D;  1EY6 A;  3H3V C;  4BA2 I;  1Q1E A;  1HFG A;  4ODG A;  2XRQ D;  4RGT A;  1EY8 A;  1K83 B;  2EVB A;  2DN8 A;  4IUU A;  4ZYS A;  4WJW A;  1RJT A;  4V0B A;  2X6G A;  2WKC A;  1TWG B;  1H9S A;  3BDO A;  4KN7 C;  3D4R A;  2Z4H A;  2NN6 I;  5JEA G;  1SJH D;  2F0D A;  1PRT D;  4K6D A;  2RKS A;  1A2U A;  5IOC A;  1G91 A;  3R3O A;  4IQZ A;  5A35 A;  3T56 B;  4BS9 A;  4Z9C B;  1BCP F;  1SJE D;  2F0V A;  2NN6 H;  1ZEQ X;  4F88 A;  1D2B A;  1NR4 A;  3NBI A;  1ENF A;  2E2J B;  2F0I A;  1DD2 A;  2L9H A;  1R9T B;  3FDT A;  1CTM A;  3M4Y A;  3N52 A;  1OXX K;  3MXG A;  2EYO A;  4QMG A;  2XSC A;  4A3F B;  1LT3 D;  1TT2 A;  3Q24 A;  1VMP A;  2H4O A;  4BY1 B;  5CV4 A;  2OEO A;  4BA1 I;  2MP1 A;  3N6R A;  4C56 C;  2L55 A;  3MVV A;  4RKB A;  3A54 A;  1PYW D;  3ND9 A;  2LKV A;  2CW0 C;  5I9O A;  4KKU A;  2B2V C;  2G9H D;  1AW7 A;  1Q8I A;  5KNB A;  3VR2 A;  4J6H A;  3TME A;  2HUG A;  5COY A;  4XDX A;  4IUN A;  4QCL A;  3HGB A;  1DM0 B;  3QIA A;  1V8Q A;  1STN A;  5C5M A;  3DM1 A;  3DEP A;  1AN8 A;  1IL8 A;  4XT3 B;  2EYM A;  4FF3 A;  2F0P A;  3A8I E;  5ELF A;  3MXP A;  5CYU A;  5EGT A;  3A7L A;  4ZKB B;  2Q8R E;  1PZI D;  2A6E D;  1SNM A;  3NTK A;  1MBY A;  3LWE A;  2PZW A;  1AEX A;  4A3E B;  3T4A C;  3E0J A;  4K6L A;  4KY5 A;  2RVL A;  2ICI A;  3H94 A;  3KUP A;  5TSS A;  4K5W A;  5E3F A;  1PTO F;  1PZK D;  2PCF B;  4OIJ A;  5JJZ A;  5IGB A;  2ZXR A;  3EQL C;  2F0M A;  3GV3 A;  1HHV A;  1SE4 A;  3C46 A;  1JWM D;  3DEO A;  2M9V A;  3D3R A;  3K0Y A;  2F0K A;  2N88 A;  1BCP D;  5D14 A;  1C8C A;  1EOT A;  4RAU C;  2D9U A;  5FO7 B;  1JR0 D;  3GTO B;  4FP5 D;  5C44 B;  5KRU A;  1AZQ A;  5I2Y A;  4CBV A;  2EY6 A;  1FR3 A;  2F0U A;  4UAI A;  4TSS A;  2B2T C;  3WOF A;  2C9O A;  1V1P A;  4NP5 A;  2RQX A;  5LL6 S;  3MAQ A;  1D5X C;  1JOO A;  2KCN A;  4HED A;  5C4X B;  3S14 B;  3VR5 A;  1JOR A;  3VR3 A;  1PFN A;  2BA0 A;  1EY9 A;  4PNY A;  1HFN A;  1HQR D;  2X69 A;  3Q0A A;  4RA8 A;  5CGK A;  3WOE A;  3RUZ A;  1CM9 A;  3SR1 A;  1LT4 D;  3HOU B;  1L0Y B;  1LAB A;  3MXU A;  3FMC A;  5M5X B;  1BF4 A;  1ESF A;  1J9O A;  3IKJ A;  4OL7 A;  4H44 C;  4BY7 B;  1PFB A;  3H09 A;  4G7Z C;  2K33 A;  5JEA H;  2OT2 A;  4QUC A;  3FRP B;  2NVQ B;  3Q22 A;  4FXK C;  5JVH 3;  1RHP A;  1FYC A;  3DMU A;  1STE A;  2IL8 A;  1CT1 D;  3A8J E;  1I4P A;  4FF4 A;  3SVM A;  4FXD A;  4H13 C;  1H9R A;  2CHB D;  1QE6 A;  3HS0 C;  3SK8 A;  3KLS A;  4WRD A;  1D5Z C;  3I73 A;  1S5C D;  1YNN D;  1B4O A;  1HUM A;  1SXT A;  2IX3 A;  4DK1 A;  1OXU A;  3HOV B;  3LWU A;  1C48 A;  4PMW A;  3GTK B;  1JWS D;  1F2L A;  3KLR A;  2A74 C;  4DAY A;  1VF5 C;  4HN7 A;  4DAV A;  2B39 A;  1ZYR D;  3I4M B;  1EY0 A;  4XTC S;  1FNW A;  4KJO A;  4PMC A;  4PQX A;  1BO0 A;  5C4J B;  2EOT A;  3A7A B;  4FYD A;  2FFK B;  5I6Y A;  2F0N A;  3S2H B;  1S5B D;  2XIW A;  2JP1 A;  2IPK D;  3CU7 A;  3NTH A;  1NUC A;  3UI2 A;  2KOL A;  2XWJ B;  4XYO A;  2LS0 1;  2K7V A;  1LV9 A;  1MD2 D;  2R6G A;  5EPK A;  4K8I A;  1CZG A;  4RGO S;  2CVR A;  2AQ2 B;  1PTO H;  3K57 A;  5EKI A;  3D8G A;  2OXP A;  3T13 A;  2B2W C;  2WII B;  1RD9 D;  3FKI B;  4K5V A;  2G9D A;  3QG1 A;  5I4D A;  1WTX A;  1DCZ A;  5FK9 C;  3MWY W;  2F03 A;  2AQ1 B;  4OGQ C;  4G7H C;  2SDF A;  3E6Z X;  2PW7 A;  2L5T A;  1PRT C;  1G2T A;  4TQU S;  3K59 A;  4XYQ A;  1F2Y A;  3TZD A;  4A3I B;  4OO1 G;  2KHS A;  2F4I A;  3LX0 A;  3NBH A;  4HMI A;  2EDG A;  1E2W A;  1EU4 A;  4HMJ A;  2PMZ B;  1RTO A;  1Q90 A;  5C4Z A;  5DM7 3;  4K2L A;  2PQE A;  3D6C A;  1Q1B A;  1V1P B;  3P20 A;  1Q3L A;  1H9K A;  2PYK A;  1Z7T A;  1PMR A;  1ILP A;  3KK7 A;  1DOK A;  4ZLT F;  4MIU A;  4KY7 A;  4A3D B;  3BZD B;  4ILW A;  4IUQ A;  2E75 C;  4XXE A;  3F2U A;  5ISR A;  5CC4 A;  4R9W A;  3S16 B;  1RDP D;  5FKA C;  4RGN A;  1LTA D;  3VA7 A;  1CK1 A;  2A69 D;  3PUW A;  3V96 A;  1UEA B;  4IUR A;  4X3S A;  2L11 A;  2C5C A;  2B2U C;  3BS1 A;  1GUN A;  1JE4 A;  3NXW A;  3OSO A;  2ZT9 C;  3GTJ B;  4BWG B;  1I4Q A;  1D1K A;  4KTA A;  2TMP A;  1B1Z A;  4KJN A;  3ERQ A;  4K2K A;  1O7Y A;  2YYZ A;  4B9W A;  2A6E C;  3U9O A;  1XWE A;  4FXG C;  2JEB I;  5K36 G;  2ZXP A;  1SYF A;  3NPP A;  3Q23 A;  4R8N A;  1WTV A;  5IOD A;  1Y1W B;  4KD3 A;  3OMC A;  1SFO B;  1YNJ D;  1LLR D;  3I72 A;  2O2L D;  1EY5 A;  4U67 3;  4CJ1 B;  1LT6 D;  4ZUI A;  2K32 A;  3I8Z A;  1KAA A;  3PIP 3;  1BCP C;  3CQZ B;  4HR7 B;  2XRS D;  1CHP D;  2HDM A;  3D31 A;  1F77 A;  2WP8 J;  1EEF D;  1X3Q A;  2RSO A;  5EJW A;  1EYC A;  4TRD A;  2F0J A;  2O5J C;  1CA5 A;  1TII D;  5F2D A;  4IUT A;  4QF4 A;  1LAC A;  2DY7 A;  5KND A;  2D2C C;  2J0T D;  1ILQ A;  1X32 A;  4FNF A;  1TS2 A;  4A3B B;  1BOS A;  3MXN A;  1STA A;  5JOB A;  3NUC A;  1O7Z A;  5I2X A;  3OIQ A;  1SAP A;  4FF1 A;  3G7L A;  3M3Y B;  2BE5 D;  2F3V A;  2JYO A;  3MA2 B;  3PUY A;  1DXM A;  3QWN A;  1CHQ D;  1GJX A;  5KIX A;  2EYJ A;  4K14 A;  2Q8T A;  4DXG A;  2Z4I A;  1ENC A;  1HUN A;  3CRK C;  2Y0S B;  5D3I B;  5M3F B;  3ZYY X;  4OO1 I;  1DON A;  5CV5 A;  5JEA J;  1PXU A;  1NCV A;  4X3K A;  3QJY A;  5LL6 X;  3I4L A;  1DOM A;  3DUZ A;  1LO5 D;  2KED A;  1OO9 B;  3PIO 3;  2B2V A;  3BVG A;  4Q0F A;  4H0L C;  2QCP X;  1F9S A;  1HCZ A;  1DYQ A;  4FO2 A;  4OO1 H;  3K6O A;  3M85 A;  4ZAI A;  5J1Z A;  2K03 A;  4PMB A;  3RMH A;  4DGZ A;  1IKM A;  4C3I G;  3GTP B;  4EQO A;  1R4Q B;  2NVT B;  4NKL A;  4GZY C;  5COR A;  1PRT B;  2R92 B;  1PTO C;  3T51 B;  2O4X A;  1SEB D;  4LK1 C;  1T5E A;  4TKO B;  1YNN C;  4DFA A;  3KF8 A;  3Q6S A;  5BN3 A;  3HG9 A;  4C3H G;  2D62 A;  1JOK A;  1RF2 D;  2KCC A;  2QF7 A;  2Q8I B;  5BN4 A;  1I6H B;  3PV0 A;  2RDF A;  2DNE A;  5D65 A;  4B08 A;  1U9R A;  4YIJ A;  3FPU B;  2EJF C;  1KNE A;  3V2T A;  1GHJ A;  2JEA I;  3PUZ A;  3G6J B;  1D1I A;  5J39 A;  4NMZ A;  1ZYR C;  3CKI B;  2EZV A;  5DNF A;  4JK1 C;  2E2I B;  1ONL A;  3R93 A;  2NTS A;  3HP3 A;  4O42 A;  4LAA A;  4KMU C;  3J81 E;  2LFN A;  3SE0 A;  1I50 B;  4DNR B;  2PZU A;  1EFI D;  3C3L A;  1PLF A;  1JQY D;  1WTO A;  2EYP A;  2ICE C;  1XX8 A;  1S5D D;  3QO2 A;  5EBC A;  2PPB C;  4DK0 A;  3GQB A;  4IFD G;  3IFT A;  3AB9 A;  1SE2 A;  3U9S A;  3J81 L;  1HA5 A;  2BDN A;  1GUG A;  2KEC A;  1SNO A;  4M8A A;  1TY0 A;  1NSN S;  3SK4 A;  5AFW A;  1LTB D;  1MSH A;  2F0L A;  3GTG B;  4S3S A;  5I6W A;  1T5X D;  5HGT A;  4XT1 B;  1BQQ T;  4EVO A;  2LMC B;  4XQQ A;  1SBB B;  2R93 B;  2AUJ D;  1G8Z D;  2WKD A;  1EU3 A;  4RHS A;  3HOY B;  3PO3 B;  3RZO B;  4RWS C;  3NSW A;  1SYB A;  4L63 B;  4XIG S;  2AWO A;  3VYS A;  3C1F A;  2IJ0 A;  1A2T A;  3SXH A;  3KLS X;  1I3Q B;  2EYH A;  2IW3 A;  5EKL A;  2NZ1 D;  1EZ6 A;  4KKT A;  5C3E B;  1G2S A;  2KUM A;  1Y8O B;  4CKE A;  5FO9 B;  4C1N I;  1CA6 A;  2KQ3 A;  2F0S A;  1GUS A;  1MI2 A;  2JA5 B;  2RDG A;  2EJG C;  1STH A;  1L0X B;  1JIC A;  1O80 A;  3TSS A;  3NE5 B;  3RD4 A;  1BDO A;  1E0B A;  4IUP A;  2MJ8 A;  3X3N A;  1B9M A;  1ICW A;  4N9P A;  1I6V C;  1UNS A;  2B8G A;  3SDZ A;  5E4X A;  3A56 A;  2K05 A;  4A3M B;  3TDQ A;  1EQV A;  5KYL A;  1GUT A;  3MHB A;  2F0W A;  1CI3 M;  2A6H D;  1F2Z A;  2WAQ B;  2KEE A;  2IWH A;  3WDN A;  5M5W B;  2A69 C;  3MTS A;  2N55 A;  2XVS A;  2A68 D;  3OWE B;  2HCI A;  1R4P B;  2B8F A;  1V1O A;  5C3W A;  3BYT B;  3FVQ A;  5FO8 B;  2VNU D;  1QOH A;  1STY A;  4XQN A;  5KGU A;  3OOC A;  2QEJ C;  3QOJ A;  3MEH A;  4G4K A;  2SNS A;  1QG7 A;  1I4G A;  1UAP A;  2D5D A;  2SNM A;  1Y8N B;  2RSN A;  4KK7 A;  3GTM B;  1PTO B;  3SK6 A;  3TP5 A;  4NW2 A;  2BOS A;  1BBX C;  1ZKO A;  4HCE A;  1I4R A;  1YNJ C;  2OF1 A;  3H91 A;  3OWF A;  1EYA A;  1TWF B;  2MHV A;  3RLF A;  2B2W A;  2SEB D;  4IFD I;  1PDQ A;  1I4X A;  1II3 A;  4L8J A;  3P1H A;  2A5H A;  1WCM B;  1F2M A;  5T1I A;  4XQJ A;  3HZX A;  4DA2 A;  3S9W A;  2EYL A;  1IW7 D;  1TKW B;  2FIN B;  2X6L A;  3OMG A;  2B2Y C;  5FOB B;  4E6I A;  2NTT A;  1SMY D;  5CV6 A;  3GV6 A;  4IFD H;  1B53 A;  1X3P A;  1SND A;  4WOR A;  3NP8 A;  1BUV T;  3L7Z C;  5KYI A;  1FD7 D;  2K28 A;  2XWB B;  3I70 A;  1JOQ A;  1JCK B;  3J7A F;  4RFB A;  2RBM A;  5JAV A;  2FJ2 A;  4Q5V A;  3H0G B;  2F3W A;  3PMF A;  4C3J G;  4DN4 M;  3TP7 A;  3BDC A;  1A6X A;  1HQM C;  2SOB A;  4FF2 A;  3E5S A;  2R7Z B;  5C0X G;  4KV6 A;  3MZ5 A;  1C4Q A;  3K5O A;  1TWH B;  3IL8 A;  1Q12 A;  4QB4 A;  2QIL A;  4MHE A;  4QIW B;  5M3M B;  1EY7 A;  5DEH A;  1EWH A;  3L3O C;  3GP7 A;  2NUC A;  2NBF A;  5NUC A;  5I9P A;  1AP0 A;  1EIH A;  2B2U A;  2JXM B;  1DJR D;  4Y7N B;  2EY1 A;  4ABN A;  3M7G A;  3I3C A;  4BBS B;  5K5P A;  1SNC A;  2JE6 I;  5M9O A;  3SEB A;  1Z6H A;  1HTP A;  3TN2 A;  1VCI A;  1EEI D;  5C6A A;  3TBI B;  1M4V A;  3IFD A;  5HUR A;  1SYE A;  4A3J B;  1A3U A;  1KDB A;  5CR3 A;  3DXJ C;  3S1M B;  2BDO A;  4NDX A;  1QWY A;  3K5N A;  3ERO A;  1S5F D;  3HOZ B;  1CFM A;  3PUV A;  1TWA B;  2DY8 A;  1TR5 A;  2J4X A;  2B63 B;  1CQV A;  2L1B A;  1ROD A;  4KHV A;  3MC0 B;  1HRJ A;  1B9N A;  1QJO A;  1FNU A;  3C1E A;  1BXT A;  5G3L D;  1A15 A;  3OW7 A;  1F9P A;  4C1N K;  4O1N A;  4M1U B;  1WD1 A;  4IAL A;  1VDZ A;  1TS3 A;  1EL0 A;  1ET9 A;  3VYU A;  1GHK A;  3BG3 A;  2NVY B;  2KA7 A;  1TY2 A;  2DNC A;  1SE3 A;  2F1M A;  1EYD A;  2KVM A;  1Z47 A;  4MN3 A;  3ITP A;  1H9J A;  1G29 1;  3J80 E;  5IGG A;  5C4H A;  4HTH A;  2JA7 B;  2EE1 A;  1FGB D;  2ENB A;  4P2C B;  4KI0 A;  4DAP A;  5CV8 A;  5C5L A;  5CBA E;  5IGE A;  4N9T A;  4FVM A;  1XYI A;  1V43 A;  5EPL A;  3GTQ B;  2M2L A;  2FMC A;  1SYC A;  1WTP A;  1OXV A;  3J80 L;  1E2Z A;  1HPC A;  3BDL A;  3SHL A;  1HA6 A;  2JA8 B;  3TP6 A;  4C3J B;  2R3Z A;  1KAB A;  1OXS C;  2RDH A;  5C0X I;  1E2V A;  4ZRZ A;  3HKZ B;  5BN5 A;  3NHH A;  1B44 D;  1SNP A;  4J1M A;  3HRZ C;  2VB3 X;  1TS4 A;  2MPM A;  2WAC A;  3R2T A;  1Y1V B;  1TVX A;  3K7A B;  5J22 A;  2NWG A;  1HTL D;  2RA4 A;  1QNU A;  1O78 A;  3R8B A;  2PW5 A;  2F0G A;  4H7B A;  5C0X H;  1RTN A;  2EJM A;  1ZXT A;  3PO2 B;  2ZXO A;  4ZKC B;  1K8M A;  1WTW A;  4B9X A;  1JC7 A;  5JPN C;  4DXF A;  5EQ0 A;  2F0F A;  3P7J A;  2V4D A;  2HQE A;  1SDF A;  3HOX B;  2EY5 A;  4OIK A;  3NTI A;  1QIL A;  2A6H C;  4ZQ3 A;  2O5I C;  5E4W C;  2F0O A;  1NR2 A;  4ZUJ A;  4RGM A;  4J8Q A;  2A68 C;  5IT9 E;  3DWQ A;  1CZW A;  1A3T A;  5EKK A;  2JSO A;  1ET6 A;  1RCV D;  1TU2 B;  2M00 A;  1IKL A;  3L9A X;  3NK9 A;  3S15 B;  2XN9 C;  2NVX B;  2F0T A;  4JBW A;  1AZP A;  1QB5 D;  1ESR A;  2B2T A;  1KLU D;  1WD0 A;  5K36 H;  4LJZ C;  3C2P A;  3EA6 A;  3M4O B;  5IT9 L;  3BVZ A;  2K5W A;  4HSP A;  4RCN A;  4CHT B;  3S1Q B;  3K5M A;  1KTK A;  1HXY D;  1I4H A;  4HAE A;  5IGC A;  3IAY A;  3J7Y W;  3NQT A;  4C2M B;  3ND8 A;  2A73 B;  4HCS A;  5FLX E;  3GTL B;  1TQO A;  2KJX A;  1B3A A;  4QUF A;  5JPM C;  3SK5 A;  1F9Q A;  3QOL A;  3S1R B;  2XNA C;  4G7O C;  2JA6 B;  3HEJ A;  4DU9 A;  3DWA A;  2AWN A;  2F0E A;  2TSS A;  3T53 B;  4IFD J;  4I65 A;  2IX0 A;  3D4W A;  1IW7 C;  1Y69 U;  2ID0 A;  1EY4 A;  5FLX L;  2YU9 B;  1BCP B;  1SMY C;  1U4L A;  2WV6 D;  3P75 A;  1SYG A;  4UDU C;  2HCC A;  4KKS A;  2LY7 A;  5KNC A;  3DHQ A;  1GUO A;  2FHT A;  3D4D A;  1GOZ A;  5T1G A;  2WB1 B;  4KD4 A;  1DOL A;  2CW0 D;  3MFY A;  5DM6 3;  4I7Z C;  2Z8L A;  1WTQ A;  2VUM B;  3FEW X;  3V05 A;  1U4M A;  4CKB A;  2VB2 X;  4F7X A;  2GA4 B;  1GXD C;  3TZU A;  4CJ2 C;  4RCO A;  1H9S B;  1LTG D;  1EZ8 A;  1KNA A;  3BVM A;  4F87 A;  1QNK A;  5M5Y B;  1PTO D;  1JWU D;  3A55 A;  4C3I B;  2PNR C;  1KDA A;  1TWC B;  1STG A;  2L4N A;  3CRL C;  1WTR A;  1W6K A;  5ELC A;  4CJ0 B;  2E2D C;  1Y8P B;  3BYY B;  3VR4 A;  5D3D A;  1J8I A;  3KBG A;  1BR9 A;  1W6J A;  2QKI C;  1LTR D;  4C3H B;  5CV7 A;  1PFM A;  3MFG A;  2K01 A;  4ZK9 B;  3H6M A;  4DNT B;  1O7L A;  4K5X A;  4A3G B;  4LMQ D;  1GUW A;  2K5D A;  3EFX D;  1H9M A;  3GO5 A;  3URY A;  2K04 A;  5EPJ A;  4X3T A;  1OXT A;  4X3U A;  5E1F A;  3CHB D;  1K8O A;  2BA1 A;  2K5Q A;  2EYF A;  2F0Q A;  5CBE E;  2H1E A;  4KY6 A;  3S17 B;  4IN3 A;  3I91 A;  1U4R A;  5LHY 1;  3D6W A;  3RZD B;  1KDC A;  4WFN 3;  2K1B A;  3OIP A;  1DZ1 A;  3I4N B;  4KN4 C;  1PZJ D;  2IX1 A;  1G6Z A;  2IT1 A;  4ME5 A;  3DWP A;  4DF7 A;  1QCB D;  2NN6 G;  5EBD A;  2J7Z A;  3S1N B;  4HSV A;  2HDL A;  5JVG 3;  4L6T B;  3AMU A;  4G57 A;  5CMD A;  1NAP A;  2E76 C;  2EPB A;  1IHZ A;  2B2Y A;  1BNZ A;  3EJI A;  2PZT A;  1EQT A;  3W3A A;  3AU7 A;  1LTS D;  3W2D A;  3S2D B;  3GD7 A;  3T16 A;  4AYB B;  3FPP A;  2AQ3 B;  4F8M A;  4EQP A;  1A3V A;  1ENA A;  1B2T A;  2VXW A;  4KHZ A;  3ONA B;  1XXG A;  1LTT D;  5G3L F;  1TS5 A;  2WIN B;  1S4Z A;  5IGD A;  1KLG D;  2Z1C A;  3KBX A;  4BBR B;  2BE5 C;  4RKL A;  3LNN A;  3R2I A;  1MGS A;  2K6A A;  1B50 A;  5DAU A;  3JAM E;  3O13 A;  2NYZ D;  2R61 A;  5IGF A;  2PO4 A;  3QB3 A;  1SNQ A;  1WVL A;  3VR6 A;  2AUK A;  4EGV A;  3OPO A;  1D6E C;  1M8A A;  4OHJ A;  5ELE A;  1MSG A;  1S5E D;  2I07 B;  1PRT F;  1D5M C;  2FMM A;  4PV1 C;  3A8K E;  1IYV A;  2I46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...