1PDQA

Polycomb chromodomain complexed with the histone h3 tail containing trimethyllysine 27.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
b'DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein
publication title Molecular basis for the discrimination of repressive methyl-lysine marks in histone H3 by Polycomb and HP1 chromodomains
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Structural protein
total genus 11
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2003-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pdqA00
1NCVA 3P7JA 3DEPA 1XYIA 2X6GA 2RSNA 2L4NA 1MGSA 2L12A 3MTSA 2MJ8A 4ZAIA 4DN4M 2K03A 3F2UA 1CM9A 5CBEE 3N52A 1ML0D 1ZXTA 1DOLA 4X3SA 5EPKA 1WTVA 2EPBA 1RHPA 1WTQA 1RTNA 2KECA 1EIGA 3IL8A 1WTRA 1AZQA 2R3ZA 1U4LA 2KUMA 4OIKA 1J9OA 4R9WA 5CMDA 1E0BA 2B2TC 3H91A 2X69A 2B2WA 2MGSA 4O42A 2Q8TA 4RA8A 4X3TA 2EE1A 1WD0A 1HHVA 1DOMA 1WTOA 1WTWA 5D65A 4MN3A 1IKMA 1O7YA 1WVLA 4IUPA 2B2WC 1JICA 1QNKA 1NR2A 2K04A 3ONAB 2B2UA 1HFNA 1SSOA 4XDXA 1WTXA 1MSHA 2N55A 4IUTA 1GUWA 1XX8A 1F9SA 2MPMA 2B2UC 2DY8A 4HAEA 1Q3LA 1MSGA 1NAPA 2NWGA 3IFDA 1C8CA 5T1GA 4R8IA 3DM1A 5AFWA 2EOTA 2FFKB 1CA5A 1CA6A 3QO2A 4X3UA 2D9UA 2X6LA 2KOLA 1WD1A 1ESRA 1B2TA 5EJWA 1A15A 1F9PA 2RVLA 4HSVA 1F9RA 5E4XA 4QUFA 1X3PA 4XT3B 1RODA 4HEDA 4ZK9B 5D14A 1PFBA 1IKLA 1AZPA 1PFNA 2J7ZA 1PLFA 2RA4A 3I8ZA 2BDNA 2K1BA 4ZLTF 1BO0A 4ZKBB 3GV6A 1O80A 3DEOA 2L1BA 1DOKA 5EPJA 2XIWA 4HCSA 1F2LA 1U4PA 1QE6A 1DZ1A 3LWEA 5COYA 2FMMA 2HDMA 4CJ0B 1F9QA 1QG7A 1S4ZA 1AP0A 1BNZA 1VMCA 1B4OA 5EKIA 1NR4A 5DNFA 4CJ1B 4IURA 2DY7A 2N88A 3FPUB 1HFGA 1U4MA 2K01A 2L11A 3D6WA 4IUUA 4NW2A 5E4WC 3UI2A 1SAPA 1HA6A 3G7LA 2K05A 1VMPA 2M2LA 4OIJA 1HUMA 1ICWA 2VXWA 2SDFA 3KBXA 1G2SA 1X3QA 1EQTA 2HCCA 2Q8RE 2H1EA 2CVRA 4IUVA 1IL8A 1LV9A 2JP1A 4RAUC 1O7ZA 1SDFA 3TZDA 3SVMA 3FDTA 2K28A 3I90A 1BBXC 3I91A 3R93A 2L9HA 3HP3A 1EOTA 1HUNA 1B50A 5CBAE 1G6ZA 3MWYW 1HRJA 4MHEA 1KNAA 3I3CA 1BF4A 4LMQD 4IUQA 1X32A 1B3AA 1MI2A 2FHTA 2KEDA 1JE4A 1KNEA 5EPLA 1DONA 1RTOA 2IL8A 2JYOA 2MP1A 2NYZD 4CJ2C 1WTPA 4UAIA 2B2TA 5CORA 5T1IA 2KVMA 2KEEA 1RJTA 2HUGA 1J8IA 2FINB 1G2TA 2B2VA 4XT1B 2FJ2A 1M8AA 3GV3A 5EQ0A 5JJZA 1PDQA 2B2YA 3Q6SA 4QUCA 4ZKCB 1B53A 2B2VC 2NZ1D 1ILPA 2B2YC 1PFMA 1EL0A 1TVXA 2HCIA 3TN2A 4X3KA 1EIHA 2HDLA 2RSOA 1ILQA 3KUPA 4U68A 4RWSC 1G91A 1U4RA
chains in the Genus database with same CATH superfamily
1HR0L 2JA7B 1IW7C 3C46A 2RHSB 1DM0B 1I94L 1WTHA 1KABA 1K8OA 1TIID 3M4OB 1IYVA 4LFCL 2B8FA 3ULPA 1A0IA 3F2DA 5CMDA 3AFQA 1VQPA 4O42A 1V9PA 1GUWA 1FNWA 2HIVA 4K0KQ 2UXBQ 2K04A 2F0PA 5E3FA 4A76A 3CC2A 1XMQQ 1YI2A 4L5TA 1LM0A 1GUSA 1TS5A 4A3IH 3EJIA 1TY2A 2E76C 3DM1A 2KOLA 5I9PA 1FR3A 5EJWA 4B3TQ 3KLSX 3SE0A 5HGQA 1LT5D 2CHBD 1EZ6A 4OXPA 3T1HQ 4BY1H 4O2DA 4JI4Q 2J7ZA 1VF7A 4ZLTF 5DAUA 3M3YB 2F0JA 4RFBA 3SEBA 2BH8A 2R92H 2AMCB 2YU9H 4JBWA 3BYTB 2JN4A 4QB4A 5CV4A 3DM3A 5DNFA 5ELFA 1HFGA 1EY6A 1XNRL 2K01A 3UI2A 4BY7B 1GO3E 5E4WC 1PRTC 5IODA 4OIJA 2VXWA 1QUQA 2CVRA 2WB1E 5KNCA 1BBXC 5I6YA 3SDZA 2L9HA 2F0DA 3D3RA 1FGUA 3AMUA 1VQDA 5IGGA 3AU7A 4PZ8A 1ASZA 5IGBA 2OT2A 1K8AC 3A8JE 4KD3A 2EJFC 2EYMA 3TDQA 2EYJA 4DV1L 3S1QB 1D6EC 2G9HD 4DV2L 5IOCA 4RKLA 3GV3A 5EQ0A 1PDQA 3WWVA 2UUCL 3TRZA 3TN2A 4X3KA 2HDLA 1SEBD 3R8BA 3RZOH 3ZYYX 4AQYQ 4KY6A 1M90C 2NVQB 4DNRB 2X6GA 1BDOA 4DR1L 4ZUJA 3CCSA 4FF4A 1AEXA 2JK8A 2XGTA 4JI1L 1AFPA 4M8AA 5EPKA 2KA7A 4KN7C 1EIGA 4DR5Q 1MD2D 4XTCS 2KCMA 1HQMC 4R9WA 1UNSA 3M7GA 1HHVA 4RA8A 2CWPA 3R2TA 5DEHA 4EVOA 1WTWA 1IYJB 5NUCA 1SSOA 1VQ5A 3S14H 3EQLC 1HQRD 4K5VA 4L8JA 2OF1A 1BBWA 4HJ9A 2JA8G 4R1JA 2EIFA 4A3CG 1MSGA 3L0OA 5DM63 1EYAA 2QCPX 2HHHL 1CA5A 1PH5A 1VQ6A 1E7ZA 4JYAQ 3NWSA 3A0JA 2JA8B 1KTKA 3NBHA 5IGEA 2Y0SG 1FNVA 4OGQC 3NTKA 5LHY1 2JEBI 1X3GA 3ERQA 3HKZG 4HR7B 4YHHL 1TU2B 3VR5A 2NVYB 2MQHA 1BO0A 3A74A 4V0BA 4DNIA 4MZ9A 2J4XA 2F0VA 1B7YB 2VNUD 4J6HA 3TREA 4FF1A 4PG3A 1AP0A 4K5XA 4IFDG 2IHFA 3CCRA 4KKSA 1V8QA 4A3FH 1SAPA 4YIJA 4FYDA 5ISRA 1ESFA 1TWGH 2F0OA 1G2SA 4DR6Q 3T16A 4LUZA 4JI6Q 2R7ZH 2WFWA 3PGZA 3CW2C 3TS2A 4DXGA 2JA5G 5CBAE 2KBNA 3MWYW 2E5LL 3ND8A 3I3CA 4ZYSA 2DNCA 4XQJA 2LKVA 4JVZA 3OPOA 5C4HA 2YTVA 5C4JH 4L63B 5IWAQ 3V05A 2FINB 1H9RA 1WFQA 4JI5L 2E2JB 4G4KA 3NSWA 2Z6KA 3ULJA 1EIYB 3OIQA 3CQZH 1O78A 1JCKB 4DF7A 5JEAH 1JE5A 5M5WH 5CYUA 3HOZH 4ZRZA 5CV6A 4A3MG 1A2TA 2TSSA 2JA6G 1VQCA 3ND9A 4LUVA 1CKMA 1I4QA 5JVG3 1PA6A 1MGSA 1EYDA 1B9MA 1IBML 1SMYD 3K7AH 4ILWA 1VQMA 4A3MB 1MKHA 5CBEE 3K7UC 1LTRD 4PZ7A 3SK4A 3I4NG 3J7YW 3JAMc 1TWHH 1WTRA 3U4ZA 2VQEL 3FP9A 2XSCA 1E0BA 3G48A 1CKNB 2A19A 4B9XA 2F03A 3K80C 5M5YB 2BE5D 1HFNA 1TQOA 3ONAB 4IUTA 4HIOA 1K0SA 3BS1A 1KC8C 4KLKA 2K14A 3M85A 4A3BG 2VUMB 2EYOA 2E2DC 1ESRA 5IP7H 2ZJQA 1NY4A 4LF5Q 4DUYL 4HIKA 5KIXA 1DJRD 3BZCA 1K8MA 3VR3A 3K5MA 2SOBA 5JEAJ 4EGVA 3DEOA 2ZXOA 4GS3A 2A68D 3GO5A 4QMGA 3D0FA 1TXYA 2R93B 2F4VL 1WCMG 1PTOD 5COYA 2F3VA 2HDMA 3DLLA 2HQEA 4JG2A 2HIXA 1B1ZA 1T5EA 4CJ1B 5I2YA 3AB9A 3I70A 4DV7L 2K50A 2EXZA 4KD4A 1HA6A 1SXTA 2P5ZX 4IUUA 4C3JG 1WCMB 2K33A 3DWQA 3RN2A 3KF8A 1SN8A 5IT9L 4UY8C 4JI8Q 2K28A 1HUNA 1WI5A 3BVGA 4HIMA 4C3JB 2B29A 1Z47A 3BZDB 1IBKL 1FVIA 3GTKH 1KNEA 3VA5A 2UU9L 1K73C 4JI0Q 4CJ2C 4DR7L 3P1HA 1JJ2A 4GOPC 1TWCB 5T1IA 2I5HA 3CCEA 1CQFA 3IFTA 4GKKL 3H0GH 1V1QA 1LT3D 3I55A 2I5MX 1XXGA 2AKWB 3PUYA 5CV7A 3J81E 4DV0L 1V43A 3LNNA 4RGMA 3RLOA 4OL7A 5IP9H 1YNND 2MO1A 3DEPA 2F3IA 4BBRB 3OOCA 2MJ8A 4IJLA 4KV6A 1GHKA 5A2QL 4KN4C 5KYIA 5M3FG 4EQOA 4ALPA 1PV4A 3MXUA 4QCLA 5IYDG 3PMFA 3RNUA 4R4QA 2F0LA 4ODGA 1JR0D 1BQQT 1VQFA 1HNZQ 3T13A 2B2WA 2EE1A 5FJ8G 4GLVB 1MJCA 1H9SA 4C3IG 4A3KG 2G5DA 2L5TA 1JB3A 5HY6A 1FJGQ 4DAPA 5LMNQ 1PH2A 2O5JC 3RR5A 3KYHC 4PMCA 1SFOH 2B39A 1LT4D 1JOOA 2BH2A 3PUXA 2NWGA 1ONLA 5AFWA 2OWOA 2TMPA 2A1AA 4P73A 5JVH3 4X3UA 4YWLA 1E1OA 3AFPA 1LTLA 1VQEA 3ER0A 1B8AA 2H4OA 3URYA 5C44G 2RVLA 3HFZB 4HJAA 3AEVA 1HCZA 4ABNA 1CKOA 2JSOA 3I4LA 3HG9A 4TKOB 4XT3B 3S2HH 2JA9A 1QOHA 4HEDA 5HGTA 1C9OA 1EIFA 3TP5A 1N32Q 2Z8LA 1EU4A 1N36Q 5L37A 3J7ZC 4X62Q 3ITPA 3OIPA 4DR4Q 1VCIA 3RMHA 1SE8A 1T9HA 2HQLA 4LW1A 3E3XA 1DXMA 4AYBE 3DMUA 1X3EA 3UE0A 3UDGA 3S1RB 3BDCA 2LFNA 5IYCH 2JE6I 2K05A 3I7FA 4A3JH 3KDFB 3CCMA 4UAIA 3J81i 1X3QA 2Q8RE 4DV3Q 2GVBA 4H44C 1EY9A 1C4QA 1JOKA 5D3DA 4GOPB 1K3BC 3IAYA 4CGYB 2HD3A 2WIIB 3VYUA 1ENFA 4KHPQ 3E0EA 2BOSA 5CV9A 4LMQD 4NXML 4ULLA 1ENCA 2KEDA 2Z0SA 3VYTA 2NYZD 1X65A 5CORA 4DR2Q 1LABA 5F2DA 1HZBA 2FJ2A 1M8AA 1I50H 1I5FA 2B3GA 1N34L 3P75A 2ZTEA 5E1FA 2EJMA 3RN5A 1KDCA 1EWHA 1OXVA 4CKCA 2A6HD 1CSQA 3GDEA 3GTQH 3S17B 2YTXA 4X66L 1EFID 4U68A 1U4RA 1EQVA 3P7JA 2B8GA 5BN4A 1B9NA 5FO8B 4FF3A 4FVMA 2CWAA 2K03A 2K5NA 1G6PA 1D1IA 3N52A 3WDNA 1DOLA 3NELA 1RTNA 1X3FA 3LWUA 4GKJL 4QIWB 2R3ZA 4ZQ3A 3A55A 1YJNA 1RKNA 1JB7A 1TWFH 2F0HA 3OTOL 3H15A 1S5BD 1O7LA 2RQXA 1WVLA 4I65A 3BJUA 3I56A 1MSHA 1Q8IA 2N55A 3PO3G 3CMEA 2PO4A 5I4DA 1V1PA 1SJHD 4IPDA 5IYBH 1SYCA 4R8IA 1NNXA 1QZGA 2D9UA 4LF8L 3VR2A 4QQBX 1EEID 3PO3B 3C2PA 4RGNA 3A7AB 2DJGC 5C3EG 2K5DA 3J81L 3R2IA 3S15H 4ZK9B 3NQTA 1IXRA 4C56C 3OWEB 4EQPA 1CI3M 1PLFA 2K1BA 2EY6A 2YTYA 3KJOA 3GV6A 1GUOA 1L1OA 1GHJA 4N9TA 5C3EB 5FO7B 3CPFA 5LL6X 4JV5L 1EFWA 3L9AX 2N3SA 1QG7A 2EYPA 4DR3Q 1Q1EA 3B6YA 2VW9A 2O5IC 4P75A 4IFDH 4KY7A 3HOUH 2KHIA 1OO9B 1PRTF 1VQIA 2XNAC 4RAUC 3I4MG 4A3DH 2QEJC 5D3IB 1GUGA 4RCOA 2JA5H 2A6ED 1EZ8A 1BF4A 5ELBA 3GTGH 4IPCA 2WAQB 3OWFA 1SNQA 1UAPA 1PHJA 4A3GG 1HTPA 4KHZA 2DGYA 2B2YA 5LMNW 2PZTA 3RZDH 3GQBA 2WP8J 1YBYA 1PH9A 4DK3C 4C1NK 4DPGA 4A3GB 1ZKOA 2HT1A 3PUZA 2ID0A 4PMBA 3DUZA 1U0LA 1VS0A 3KUPA 4A3EG 5M5XH 4R8NA 3U50C 5CC4A 3FKIG 4GN4B 4L5QA 2JA6H 4JI7L 1H9KA 3D31A 3OMCA 4LF4Q 1B44D 4JI3Q 3M9BA 2EPBA 1X56A 1SE4A 2KECA 2WINB 3FKIB 3I4NH 1U4LA 3PUWA 4JBJA 2XRQD 3GTJB 2ATWA 2GN5A 3W5OA 1RDPD 1Y8NB 3R3OA 1WTOA 1I6HB 1CSPA 3H3VH 1C0AA 4Y7NH 3DHQA 2EXDA 3HOVG 3A7LA 2RDFA 3GTLB 3KLSA 4KTAA 1JMCA 3BU2A 4RKBA 4RMFA 1IW7D 1N33L 4BXXG 1K3RA 1PH1A 3KF6B 5M9OA 4A3BH 3QO2A 3HOVB 3KJPA 2UXCL 2QKIC 5TSSA 3HOYB 4HSVA 5GAGC 2LXKA 2EDGA 1RODA 5GAEC 1EY4A 2QDBA 4YY3Q 1JC7A 2XWBB 4KKTA 5ELEA 1KRSA 2NTTA 2ZJRA 1H9MA 2A8VA 4WFN3 4CJ0B 3ULLA 5EKLA 1P16A 4AQYL 2MO0A 3PO2H 1PVOA 3DXJC 4KK7A 4P74A 1VMPA 4C3JH 1HUMA 4CDDC 1KRTA 1EQTA 4DK0A 5E7NA 3FDTA 2C9OA 3X3MA 3S2DH 2AHOB 3HP3A 1Q81C 1QB5D 1B50A 1QILA 5C0XJ 2F0UA 4YCUA 1Y1VG 5M3MB 2Z6BA 1Z6HA 3MXPA 2PZUA 5KRUA 1XWEA 4I7ZC 1TS2A 2FHTA 4K2KA 4XYOA 4BY7G 1RIPA 1HH2P 3T1YQ 3NTIA 5C3XA 5KGUA 2K5VA 1Q8KA 4K5WA 1NE3A 3A8IE 1Y1VB 2KEEA 3KOJA 1PRTD 2Z4IA 2UUAQ 2JXMB 1OXTA 3GP7A 4GLAC 4B3ML 3RLFA 1N9WA 3CXCA 3CRLC 3A5ZB 4CDFC 3MXNA 3M4QA 4GZYC 2L4NA 4LJZC 1KHIA 4TVAB 4LF6Q 1S72A 3Q0AA 1XNQL 3S16B 4QL5A 2VQFL 1ML0D 4X3SA 5M3FH 4NDXA 3SXHA 1WJJA 1HR0Q 3CCQA 3C1EA 1J9OA 1HXYD 1I94Q 2B2TC 1X6OA 3I73A 1PFSA 3NPPA 1A63A 3QWNA 5FJ8H 4C3IH 4A3KH 2B2WC 2ALYB 1PZKD 2ES2A 3FHWA 4XDXA 1NUCA 4FXDA 2ASBA 1JOQA 2PI2A 4DR6L 2F0TA 4YWMA 5DM73 1PH3A 3BZKA 4JI6L 4YWKA 1PTOH 3CMAA 2B63G 1QVGA 1G8ZD 4J8QA 5C44H 1R9TH 2QGQA 2UXDL 1VQ8A 3STBC 3CF5A 5D14A 1CZGA 5IGFA 2B63B 4DK1A 3F2BA 1D5ZC 3UDXA 1XPRA 2OCEA 4GNXA 2DJFC 3EA6A 3H94A 1F77A 1SMXA 4LAAA 4FXKC 5BN5A 3GTPB 2QW7A 1Z7TA 5EKIA 2NBFA 1W3SA 4DGZA 4X65Q 1Y14B 2IW3A 3NHHA 1A3UA 1NJIC 2NVTH 4RG1A 5FOBB 1SDFA 4FNFA 3PF4A 1K8GA 5FLXL 1I4XA 1GM5A 1BCPC 2PW5A 2F0EA 1SYGA 1PRTB 1SYFA 1B3AA 2ENBA 2PNRC 1JE4A 1AH9A 1RTOA 2E2HH 1ZYRC 2SNSA 5ELDA 2Y0SE 1XTCD 3U9SA 1TY0A 3HKZE 1B53A 3J80c 2AQ2B 3J7AV 4DV1Q 4LFBL 1ICFB 1C48A 4NB3A 4OX9Q 4DV2Q 5JJKA 2AUJD 4KY5A 3HOXG 2NN6H 1VQ9A 4JBMA 4RWSC 2Q2IA 3E9IA 2CW0C 4L5RC 2UUCQ 4LF5L 3HOWG 2RSNA 4J1MA 1KQSA 4OO1I 1M1KC 5C4XB 1S5DD 1L0XB 4G57A 1AN8A 3HOXB 3GTMB 4TQUS 2NVXH 1WTVA 1RHPA 3D4WA 5DLQE 4WJ3M 4IOCA 3HOWB 1AE3A 4OIKA 4MNOA 4B3SL 4RHSA 4F7XA 4DV4L 4JI1Q 3GTOH 1EOVA 2B2UA 1W2BA 2PMZE 1LYLA 4H13C 1XX8A 1F9SA 4DV5L 1STEA 1K0RA 1M4VA 4OEMB 1PYSB 3L7ZC 4V190 3Q23A 5LMUQ 4NXNL 4R4CA 1WD1A 4O0AA 1ZEQX 4A93B 1F9RA 3RLNA 1STHA 1I4HA 2HHHQ 1EY0A 1IKLA 4FP5D 2JEAI 2VUMG 3BDOA 2D0PA 2IHEA 3S1NB 5EPJA 2WV6D 2RDGA 1L1OC 4C2MH 2E2IB 4O1NA 4YHHQ 3ICEA 2DUDA 5J22A 1VMCA 1BCPB 1K83H 2N88A 1EY5A 1BR9A 2K5WA 2CKZB 4N9PA 4NW2A 3D6WA 1IYUA 5EBCA 3KK7A 1K9MC 4WJWA 1AW7A 3CCUA 3L3OC 2HCCA 2DNEA 1LV9A 2R93G 1S40A 2R7FA 1X55A 4APVA 3S1MH 4C3HB 3I4MH 2L15A 4K2LA 4HJ8A 1HJPA 1KNAA 3KBGA 1HR0W 3T53B 3G71A 1Y1WH 1QVFA 2BDOA 1AE2A 1LTBD 4BBSH 5LMNL 1A3VA 3E0JA 5CGKA 2E5LQ 2F0KA 1KDBA 1B3QA 1ILPA 2B2YC 1NBWA 4UDUC 2R6GA 4L5SA 2CQAA 5JPMC 4JI5Q 1SJED 4LF7L 4A3EH 4A3IG 2ZT9C 1NTGA 1FGBD 4KMUC 1LTSD 1CM9A 2KHSA 1EY8A 1TWAH 5FLMG 5G3LF 1CFMA 2CCZA 2Q2TA 3FPPA 1Y69U 4A3IB 1CHQD 2C5CA 3K81C 1I3QH 1SR3A 1UWVA 4XIGS 1IBMQ 1V1PB 1DOMA 1KL9A 4BBRG 4DA2A 2JA7H 2WKDA 2QEXA 1I4RA 5C4ZA 2ZXRA 2VQEQ 1JJGA 2EJGC 3M4OH 3HOVH 4HCEA 4BY1B 3HZXA 3A56A 2QF7A 2PQEA 4LFAL 2G9DA 2ZTCA 3IFDA 3M7NA 4BXXH 1EYGA 3E9HA 2R7DA 3F2CA 2R92B 1STYA 2YU9B 5C5MA 2PQAA 1L1OB 3NEMA 4KHPL 1GKHA 4NP5A 2Z9HA 1VQJA 1TS3A 2M00A 1YITA 5EAYA 4ZKBB 3VDYA 4CKEA 1DOKA 1F2YA 2A74C 4DUYQ 4DAVA 1QE6A 2FMMA 2XWJB 1S4ZA 2BCOA 4UHVA 4Y52H 5J39A 5A35A 5C5LA 3I2ZA 3M3YH 4KHVA 1SYEA 1U9RA 2IY5B 4DV7Q 4YCWA 3TZUA 1HRJA 2ZXPA 1EU3A 2WACA 2AUKA 3PV0A 1XMOL 3RZOB 5EPLA 4A3LG 3CCVA 2IL8A 2JYOA 4BY7H 5IIFA 3K58A 4AYBG 3CKIB 3QIAA 2KVMA 3TBIB 2HUGA 4DUZL 3BG3A 4DAYB 1OTCA 4XT1B 1G2TA 4JI2L 1IBKQ 1LLRD 1Q46A 4QUCA 3TQYA 2UU9Q 4AYBB 4G7ZC 1F2ZA 2E8GA 1SRUA 5CV5A 5ELOA 5I6WA 3S1QH 3MTSA 4DV0Q 3S14B 2EZVA 1EEFD 1E24A 4H02A 2ZM6L 1J6QA 4DXFA 3OW7A 1RD9D 2VS1A 3PIO3 1J5EL 3IL8A 1ET9A 3PUVA 4LNQA 3H6MA 1OXSC 4TSSA 3J7AF 5BN3A 3H91A 3RUZA 3Q22A 3PF5A 4P2CB 2NVQH 1A3TA 2BA1A 4BA1I 3G4SA 1I4PA 3IRBA 3LX0A 1NAPA 1SROA 1SNOA 2RBMA 3JAME 3C3LA 2FFKB 1H9JA 2CQOA 1JQYD 3K57A 1F9PA 4QF4A 1WYDA 4HJ7A 2A69C 2F0QA 2R7ZG 3NWTA 2F0WA 1X3PA 3H09A 5AJ3L 1GD7A 2JJQA 4A3FB 4FXGC 4RGOS 1BOSA 1JWMD 3GTPH 2Z4HA 1TWGB 1O80A 3SR1A 1NSNS 2XIWA 4QIWE 2R7ZB 4LWCA 1YIJA 4GNXC 1DZ1A 2JA8H 1LO5D 2NTSA 4OO1G 1BNZA 4A3CH 1B4OA 2PNHA 1IBLL 4IURA 5IGCA 2UUBL 3K5OA 3F1ZA 4DAMA 1U4MA 3PIP3 2NVYH 2F0GA 3AQQA 5C4JB 1QJOA 5JEAG 1W6KA 4IUVA 3SVMA 4Q5VA 3DWAA 2J0TD 3I91A 3M4PA 4B3RQ 3CRKC 3TS0A 4KI0A 1XPOA 3CQZB 1G6ZA 4BA2I 4K6LA 1D7QA 2NUCA 2L0CA 4WJ4A 5M5WB 1X32A 2AQ1B 3HOZB 3LGJA 1QUQB 3C1FA 2F3WA 3FRPB 4JBKA 1E2ZA 1RJTA 1J8IA 5FKAC 3V2TA 2EY1A 1YEZA 3A54A 3K7AB 3TEHB 1UE1A 2XVSA 1QZHA 4ZKCB 2RHQB 4X64L 2RDHA 1E2WA 4ID6A 2KCCA 1TWHB 3SHLA 2WAQG 1MIUA 1A6XA 3EN2A 3K0YA 3J81j 3D4RA 1N34Q 2MNAA 1UE7A 1S5ED 5I9OA 4C1NI 5IT9c 1A62A 1K28A 2E2JH 2SEBD 4K0KL 3JC66 2UXBL 2F0FA 4YY3L 2PI2E 3QOLA 1VQBA 5IP7G 1D8LA 1HNXQ 1WTQA 5KNDA 1XMQL 4PV1C 1Q12A 3BVMA 3K59A 1R4PB 3PIOA 3CU7A 3MFGA 4AH6A 1SNMA 5EKKA 4RCNA 1Q1BA 2Z6KC 1NR2A 1HNWQ 3NQIA 4GKJQ 1EWIA 4A3MH 4HMJA 5EGTA 2B2UC 4B3TL 2DY8A 1PZID 3CCLA 3HS0C 1SNDA 3T1HL 1F2MA 3MFYA 2PPBC 4G7OC 4JI4L 3MC0B 2KCTA 3CHBD 4KKUA 5M5YH 4G7HC 1EYCA 4IFDJ 3G6JB 1QNUA 5IY0A 2VZAA 4PMWA 2ZTDA 3TSSA 1PFNA 5C0XI 4LF8Q 2R61A 2KHJA 2NZOA 3KDFA 2VUMH 4CDCC 3RD4A 1F2LA 4R4OA 4MIUA 1U4PA 1HZ9A 4K8IA 4GOPA 3HOYG 1QCBD 4JPBW 3NBHB 1F9QA 4DK6C 1OXXK 2DY7A 3E6ZX 3H0GG 1STBA 2GA4B 4FDBA 3GTKB 2L11A 2F0MA 1RCVD 3KBXA 1GJXA 1YNJC 4LF9Q 3PIPA 1IL8A 1XTDA 1Q82C 2R93H 3D8GA 3R93A 3H0GB 2K4KA 1BCPF 3MVVA 3JAML 3SK6A 4M1UB 4HJ5A 1CZWA 1SBBB 5BR8Q 2LSSA 4S3SA 1WCMH 4NPSA 1P8LA 2F4IA 2YYZA 4IUNA 5M3MG 3BYYB 1EL0A 2F0SA 2VY3A 3WOEA 1PH6A 1PH7A 2JQOA 4JW0A 4DR5L 4AIMA 1TWCH 2BA0A 4PQXA 1SFOB 5ELCA 3K5LA 5FLMH 1UEAB 4DV6Q 1CK1A 4JI7Q 2X69A 2Q8TA 3EVQA 3OHXC 1IKMA 5D65A 3L2PA 3T56B 1O7YA 2WB1G 1QNKA 4BBRH 5EBDA 1STAA 3MZ5A 3BVZA 5JAVA 4ZCKA 3S2HB 2F0IA 1E1TA 4JYAL 3FEWX 1YJ9A 2V4DA 1JT8A 4X65L 4OWWB 4HAEA 2K5HA 3QOJA 2EYHA 1Q90A 2EVBA 2WB1B 5T1GA 1XPUA 2IX0A 1L0WA 1HA5A 1PMRA 1BKBA 5IYCG 3PSIA 2OTLA 4A3JG 1STNA 1SLJA 1B2TA 3K6OA 1A15A 2WKCA 1N33Q 1YHBA 4FF2A 2I46A 3CC4A 5IYDH 4HN7A 3K8AA 5GADC 3OSOA 3OMGA 2PZWA 1AZPA 3I8ZA 4IN3A 2RA4A 1TKWB 4A3JB 4LFCQ 2UXCQ 1Q7YC 1S3OA 2CH4A 3EFXD 3KLWA 3S9WA 4IZ8A 4OX9L 4UP7A 3FPUB 1TR5A 2PW7A 3ERSX 5FO9B 2SDFA 3VR6A 4I7AA 1BBUA 1LACA 2H1EA 2VB3X 3STBD 3TZDA 1O7ZA 3WOFA 3NK9A 1I50B 2PCFB 1YJWA 5K36G 5IWAL 3J81c 3K0XA 1A8VA 1RL2A 3GTQB 4TRDA 1ASYA 3UDIA 2F0NA 3S1RH 3KF8B 4A3LH 4GN3B 2E75C 4ME5A 5J1ZA 1G51A 2D0OA 2B2VA 1B70B 1G291 4PNYA 3Q6SA 1QWYA 3HEJA 2NZ1D 1EY7A 4LUOA 3T51B 2XRSD 1PFMA 1EIHA 5IT9E 1BCPD 2RSOA 1WOCA 1TWFB 2AWNA 5LMUL 1CQVA 1JORA 3W3AA 1XNRQ 2KJXA 1BXTA 5IYBG 4EQ5A 1YVCA 4ZAIA 2L12A 2OQ0A 4DN4M 4B3MQ 1PTOF 1SNPA 2D5DA 2LS01 3TP6A 5GROA 4J15A 1ZYRD 3IKJA 5C3WA 3S17H 2KUMA 2N8NA 3KF6A 5KYLA 4X3TA 3H3VC 1XNQQ 1L0YB 2KCNA 4XQNA 1FNUA 2VQFQ 2NN6I 3TMEA 1HZCA 3VA7A 2I5LX 5C4XG 4XQQA 1EQQA 1IZ6A 3S15B 2Y0SB 2PQAB 1KLGD 3A5UA 2CW0D 4YCVA 3HKZB 3U58A 2EQSA 1R4QB 2EOTA 4WRDA 5A2QE 1H9SB 2X6LA 3HOUG 2IPKD 2N78A 4LK1C 1RF2D 1GUTA 5JOBA 4DR1Q 1TT2A 3X3NA 1FD7D 4A3DG 3HOUB 2BDNA 1UE6A 3AYHB 2L1BA 2Q2UA 4HCSA 1JWSD 2UXDQ 1T5XD 2FMCA 4A93G 1L2FA 3PO3H 3LWEA 4A3DB 2JA5B 1MJEA 2A73B 4OO1H 4JOIA 4JI8L 1NR4A 1SNCA 1IL2A 2PMZB 3GTGB 3UE1A 1CUKA 4L6TB 3OYYA 4OWTB 1ICWA 2RKSA 5C3EH 1GVPA 1LUZA 3Q24A 2JP1A 4K8JA 4UPAA 2QILA 3RZDB 4JI0L 2GVAA 2OQKA 2OXPA 3O13A 1YNXA 3D6CA 4MHEA 4IUQA 2ICEC 1SMYC 5M5XB 1JJCB 2L55A 4KJNA 2JA6B 4A4IA 3E5SA 1D2BA 4P72A 4R4IA 2RCFA 4C3HG 4POGA 3NP8A 4RHRA 3T4AC 4CHTB 4UP9A 1KAAA 2OEOA 1UEBA 4H0LC 3I4NB 5C0XG 3U4VA 2BE5C 3NBIA 1ILQA 3CCJA 3U9OA 4N8FA 4Y7NB 3P20A 1HNZL 3KFUA 4LFBQ 1CTMA 3F2UA 3CAMA 2CFMA 2M9VA 1U5KA 5J3BA 1PH4A 2QA4A 3QG1A 1FJGL 1O7IA 2I07B 1AZQA 4A3GH 4OELB 4A3BB 2PYKA 3W1BA 4Z9CB 1DGSA 2IWHA 4MN3A 4HSPA 2AQ3B 3NTHA 2VB2X 4IUPA 5IE8A 1X9NA 4ZUIA 1LTID 4GN5A 2A68C 4Q0FA 1PYWD 1Q86C 4B3SQ 2RF4A 1DD2A 1Q3LA 4OWXB 4DV4Q 1PTOC 4IALA 5JPNC 3FKIH 1CA6A 3PO2G 3GTJH 1I6HH 1N32L 1N36L 4DV5Q 4F8MA 4QGUA 4X62L 1D5MC 1PYBA 5E4XA 4DR4L 4IOAA 4K14A 4BY1G 4QUFA 3GTLH 3PO2B 1PFBA 2EY2A 2EY5A 5FK9C 4NXNQ 1LTGD 4R4TA 1UUPA 3EBEA 2R92G 4QY7A 4B9WA 4EQNA 3S2DB 1S5FD 1H95A 3QR8A 1GXDC 1E22A 4IJHA 3HOYH 4DV3L 4N8X1 1HTLD 3NENA 2NZHA 2EYFA 4BS9A 2LY7A 1CHPD 1Y8PB 2MUYA 1PZJD 1LT6D 1EOTA 4DR2L 4ME3A 3HKSA 2Z1CA 1YNNC 2AWOA 1TS4A 3TP8A 2CH4W 3NUCA 3M4YA 1SE2A 1WTPA 4XXEA 2B2TA 2DN8A 1S5CD 4NMZA 2F4VQ 2A5HA 5M3FB 3KLRA 3FVQA 5M3MH 1GOZA 1TVXA 3MA2B 4MTKA 5I2XA 1EQRA 4MTNA 1KIXA 3G6EA 4C3IB 3SGIA 2VL6A 4A3KB 1XYIA 1STGA 1Y1VH 3EROA 3VR4A 4E6IA 3OW2A 3CD6A 1VQHA 2LMCB 4FO2A 3GD7A 1VQLA 4XYQA 3W1GA 4IPGA 5FLXc 5H1SE 3J80E 4LF7Q 3MHBA 3QB3A 3Q8DA 2QDLA 1VDZA 1PTOB 1Z9FA 1BVSA 2MGSA 1VQKA 1ET6A 4DR7Q 4IPHA 1NMFA 1JICA 5C44B 1R9TB 3VYRA 1WTXA 2ZJPA 3NXWA 1HZAA 2F52A 1KDAA 4GKKQ 1CKNA 3S16H 2XN9C 4PZ6A 3MEHA 4JC0A 1C8CA 1BUVT 4OONA 2XTIA 1X54A 4B3RL 1OXUA 3HGBA 5K5PA 3VYSA 4LFAQ 3PCOB 1D5XC 4F88A 1VF5C 3A8KE 3UDFA 4DFAA 1JWUD 1W6JA 1I6VC 2IJ0A 4DR3L 2K75A 4DKAC 5CV8A 4KJOA 2NVTB 1A2UA 1EUJA 1LTTD 1KAWA 4JK1C 5G3LD 5KEEA 1VQ7A 4U673 4A3FG 3MAQA 3PQIA 2A69D 2B63H 5CR3A 2E2HB 4DU9A 3EIVA 4CKBA 1SYBA 2RCNA 2A6HC 3I90A 2NN6G 2K7VA 3V96A 4P71A 1HNXL 1LTAD 4B08A 2K32A 1UE5A 5K36H 1EWCA 5JJIA 2KQ3A 3ZJYC 2MP1A 2D62A 3J80i 1HNWL 1ENAA 4CBVA 1DCZA 1Y8OB 4QJFA 5GQOA 5JJZA 1XMOQ 3F8TA 1FL0A 1I4GA 2B2VC 2NVXB 2NB0A 3HOZG 2HCIA 5LL6S 4IO9A 3I4OA 4LF4L 4DUZQ 4CDEC 2Q8IB 4JI2Q 3MEFA 4JI3L 3DWPA 1C7YA 3J7A5 4GLXA 1G91A 3GTOB 1NCVA 4JCVE 4OHJA 5IGDA 2EYLA 1SYDA 2FXQA 1XJVA 2MHVA 4BWGB 1MHWC 1SE3A 1QVCA 4IFDI 1ZXTA 2H5XA 3N6RA 4NXMQ 5JJLA 4WORA 5C6AA 3MXNB 1WD0A 2N49A 4POFA 1YHQA 4NKLA 2ZM6Q 3D4DA 4DNTB 4RH6A 1J5EQ 3HRZC 1VQGA 5C4XH 1E2VA 3CPWA 2MPMA 1KXLA 3HOXH 3GTMH 3TP7A 1DYQA 3W2DA 1FYCA 3JAMi 4LF9L 2IX1A 3HOWH 4IQZA 4C2MB 2MFIA 4X66Q 2ICIA 3SK8A 2KENA 3SK5A 2OTJA 3FMCA 4HMIA 1K83B 1VQ4A 5BR8L 2I0QA 2WAQE 1MBYA 2IX3A 2IT1A 1YZ6A 2SNMA 2V1CC 2YV5A 1N8RC 1IHZA 1PH8A 2A6EC 1Y1WG 1CT1D 2D2CC 5AJ3Q 3OTOQ 3S24A 3S1MB 1HPCA 3I4MB 4A93H 1PXUA 4BBSG 3J80L 4A75A 3CP0A 2O2LD 3CC7A 4JOIC 1Y1WB 3G7LA 2M2LA 4K6DA 1KLUD 3QJYA 4GNXB 3K5NA 4BBSB 3S1NH 3H3VI 3BDLA 3T1YL 1IBLQ 2O4XA 1GUNA 4DAYA 2UUBQ 3NE5B 2E2IH 2F1MA 2C35B 4DV6L 3I72A 4UP8A 3MXGA 1MI2A 1VQNA 2UUAL 2K5QA 1DONA 1YHAA 5KNBA 4A3EB 1NMGA 1II3A 2E74C 4H7BA 1KD1C 1D1KA 4F87A 1VQOA 4HTHA 4JV5Q 1E3PA 2K6AA 2LXJA 4RGTA 1TWAB 1YNJD 5GAHC 4C3HH 2JA7G 4HIDA 5ELNA 1VQAA 2Q2HA 5HURA 4LF6L 1V1OA 1I3QB 2K52A 5C0XH 5IP9G 5FLXE 4X6AH 4X64Q 4EX5A
chains in the Genus database with same CATH topology
2JA7B 1IW7C 3C46A 1DM0B 1K8OA 1KABA 1TIID 3M4OB 1IYVA 2B8FA 5CMDA 4O42A 1GUWA 1FNWA 2K04A 2F0PA 5E3FA 1GUSA 1TS5A 3EJIA 1TY2A 2E76C 3DM1A 2KOLA 5I9PA 1FR3A 5EJWA 3KLSX 3SE0A 1LT5D 2CHBD 1EZ6A 2J7ZA 1VF7A 4ZLTF 5DAUA 3M3YB 2F0JA 4RFBA 3SEBA 4JBWA 3BYTB 4QB4A 5CV4A 5DNFA 5ELFA 1HFGA 1EY6A 2K01A 3UI2A 4BY7B 5E4WC 1PRTC 5IODA 4OIJA 2VXWA 2CVRA 5KNCA 1BBXC 5I6YA 3SDZA 2L9HA 2F0DA 3D3RA 3AMUA 5IGGA 3AU7A 5IGBA 2OT2A 3A8JE 4KD3A 2EJFC 2EYMA 3TDQA 2EYJA 3S1QB 1D6EC 2G9HD 5IOCA 4RKLA 3GV3A 5EQ0A 1PDQA 3TN2A 4X3KA 2HDLA 1SEBD 3R8BA 3ZYYX 4KY6A 2NVQB 4DNRB 2X6GA 1BDOA 4ZUJA 4FF4A 1AEXA 1AFPA 4M8AA 5EPKA 2KA7A 4KN7C 1EIGA 1MD2D 4XTCS 1HQMC 4R9WA 1UNSA 3M7GA 1HHVA 4RA8A 3R2TA 5DEHA 4EVOA 1WTWA 5NUCA 1SSOA 3EQLC 1HQRD 4K5VA 4L8JA 2OF1A 1MSGA 5DM63 1EYAA 2QCPX 1CA5A 3NWSA 2JA8B 1KTKA 3NBHA 5IGEA 4OGQC 1FNVA 3NTKA 5LHY1 2JEBI 3ERQA 4HR7B 1TU2B 3VR5A 2NVYB 1BO0A 4V0BA 2J4XA 2F0VA 2VNUD 4J6HA 4FF1A 1AP0A 4K5XA 4IFDG 4KKSA 1V8QA 1SAPA 4YIJA 4FYDA 5ISRA 1ESFA 2F0OA 1G2SA 3T16A 4DXGA 5CBAE 3MWYW 4ZYSA 3I3CA 3ND8A 2DNCA 4XQJA 2LKVA 3OPOA 5C4HA 4L63B 3V05A 2FINB 1H9RA 2E2JB 4G4KA 3NSWA 3OIQA 1O78A 1JCKB 4DF7A 5JEAH 5CYUA 4ZRZA 5CV6A 1A2TA 2TSSA 3ND9A 5JVG3 1I4QA 1MGSA 1EYDA 1B9MA 1SMYD 4ILWA 4A3MB 5CBEE 1LTRD 3SK4A 3J7YW 1WTRA 2XSCA 1E0BA 4B9XA 2F03A 5M5YB 2BE5D 1HFNA 1TQOA 3ONAB 4IUTA 3BS1A 3M85A 2VUMB 2EYOA 2E2DC 1ESRA 5KIXA 1DJRD 1K8MA 3VR3A 3K5MA 2SOBA 5JEAJ 4EGVA 3DEOA 2ZXOA 2A68D 3GO5A 4QMGA 2R93B 1PTOD 5COYA 2F3VA 2HDMA 2HQEA 1B1ZA 1T5EA 4CJ1B 5I2YA 3AB9A 3I70A 4KD4A 2EXZA 1HA6A 1SXTA 4IUUA 4C3JG 1WCMB 2K33A 3DWQA 3KF8A 5IT9L 2K28A 1HUNA 3BVGA 4C3JB 1Z47A 3BZDB 1KNEA 3VA5A 4CJ2C 3P1HA 1TWCB 5T1IA 1CQFA 3IFTA 1LT3D 1XXGA 3PUYA 5CV7A 3J81E 1V43A 3LNNA 4RGMA 4OL7A 1YNND 3DEPA 4BBRB 3OOCA 2MJ8A 4KV6A 1GHKA 5A2QL 4KN4C 5KYIA 4EQOA 3MXUA 4QCLA 3PMFA 2F0LA 4ODGA 1JR0D 1BQQT 3T13A 2B2WA 2EE1A 1H9SA 4C3IG 2L5TA 1JB3A 4DAPA 2O5JC 4PMCA 2B39A 1LT4D 1JOOA 3PUXA 2NWGA 1ONLA 5AFWA 2TMPA 5JVH3 4X3UA 2H4OA 3URYA 2RVLA 1HCZA 4ABNA 2JSOA 3I4LA 3HG9A 4TKOB 4XT3B 4HEDA 1QOHA 5HGTA 3TP5A 2Z8LA 1EU4A 3ITPA 3OIPA 1VCIA 3RMHA 1DXMA 3DMUA 3S1RB 3BDCA 2LFNA 2JE6I 2K05A 4UAIA 1X3QA 2Q8RE 4H44C 1EY9A 1C4QA 1JOKA 5D3DA 3IAYA 4CGYB 2WIIB 3VYUA 1ENFA 2BOSA 5CV9A 4LMQD 4ULLA 1ENCA 2KEDA 3VYTA 2NYZD 5CORA 1LABA 5F2DA 2FJ2A 1M8AA 3P75A 5E1FA 2EJMA 1KDCA 1EWHA 1OXVA 4CKCA 2A6HD 3S17B 1EFID 4U68A 1U4RA 1EQVA 3P7JA 2B8GA 5BN4A 1B9NA 5FO8B 4FF3A 4FVMA 2K03A 1D1IA 3N52A 3WDNA 1DOLA 1RTNA 3LWUA 4QIWB 2R3ZA 4ZQ3A 3A55A 1RKNA 2F0HA 1S5BD 1O7LA 2RQXA 1WVLA 4I65A 1MSHA 1Q8IA 2N55A 2PO4A 5I4DA 1V1PA 1SJHD 1SYCA 4R8IA 2D9UA 3VR2A 1EEID 3PO3B 3C2PA 4RGNA 3A7AB 2K5DA 3J81L 3R2IA 4ZK9B 3NQTA 4C56C 3OWEB 4EQPA 1CI3M 1PLFA 2K1BA 2EY6A 3GV6A 1GUOA 4N9TA 1GHJA 5C3EB 5FO7B 5LL6X 3L9AX 1QG7A 2EYPA 1Q1EA 2O5IC 4IFDH 4KY7A 1OO9B 1PRTF 2XNAC 4RAUC 2QEJC 5D3IB 1GUGA 4RCOA 2A6ED 1EZ8A 1BF4A 5ELBA 2WAQB 3OWFA 1SNQA 1UAPA 1HTPA 4KHZA 2B2YA 2PZTA 3GQBA 2WP8J 4C1NK 4A3GB 1ZKOA 3PUZA 2ID0A 4PMBA 3DUZA 3KUPA 4R8NA 5CC4A 1H9KA 3D31A 3OMCA 1B44D 2EPBA 1SE4A 2KECA 2WINB 3FKIB 1U4LA 3PUWA 2XRQD 3GTJB 1RDPD 1Y8NB 3R3OA 1WTOA 1I6HB 3DHQA 3A7LA 2RDFA 3GTLB 3KLSA 4KTAA 4RKBA 1IW7D 5M9OA 3QO2A 3HOVB 2QKIC 5TSSA 3HOYB 4HSVA 2EDGA 1RODA 1EY4A 2QDBA 1JC7A 2XWBB 4KKTA 5ELEA 2NTTA 1H9MA 4WFN3 4CJ0B 5EKLA 3DXJC 4KK7A 1VMPA 1HUMA 1EQTA 4DK0A 3FDTA 2C9OA 3X3MA 3HP3A 1QB5D 1B50A 1QILA 5C0XJ 2F0UA 5M3MB 1Z6HA 3MXPA 2PZUA 5KRUA 1XWEA 4I7ZC 1TS2A 2FHTA 4K2KA 4XYOA 3NTIA 5C3XA 5KGUA 4K5WA 3A8IE 1Y1VB 2KEEA 1PRTD 2Z4IA 2JXMB 1OXTA 3GP7A 3RLFA 3CRLC 3MXNA 4GZYC 2L4NA 4LJZC 3Q0AA 3S16B 1ML0D 4X3SA 4NDXA 3SXHA 1J9OA 1HXYD 3C1EA 2B2TC 3I73A 3NPPA 3QWNA 2B2WC 1PZKD 4XDXA 1NUCA 4FXDA 1JOQA 2F0TA 5DM73 1PTOH 1G8ZD 4J8QA 5D14A 1CZGA 5IGFA 2B63B 4DK1A 1D5ZC 3EA6A 3H94A 1F77A 4LAAA 4FXKC 5BN5A 3GTPB 1Z7TA 5EKIA 2NBFA 4DGZA 2IW3A 3NHHA 1A3UA 5FOBB 1SDFA 4FNFA 5FLXL 1I4XA 1BCPC 2PW5A 2F0EA 1SYGA 1PRTB 1SYFA 1B3AA 2ENBA 2PNRC 1JE4A 1RTOA 1ZYRC 2SNSA 5ELDA 1XTCD 3U9SA 1TY0A 1B53A 2AQ2B 3J7AV 1C48A 2AUJD 4KY5A 2NN6H 4RWSC 2CW0C 2RSNA 4J1MA 4OO1I 5C4XB 1S5DD 1L0XB 4G57A 1AN8A 3HOXB 3GTMB 4TQUS 1WTVA 1RHPA 3D4WA 3HOWB 4OIKA 4RHSA 4F7XA 2B2UA 4H13C 1XX8A 1F9SA 1STEA 1M4VA 3L7ZC 4V190 3Q23A 1WD1A 1ZEQX 4A93B 1F9RA 1STHA 1I4HA 1EY0A 1IKLA 4FP5D 2JEAI 3BDOA 3S1NB 5EPJA 2WV6D 2RDGA 2E2IB 4O1NA 5J22A 1VMCA 1BCPB 2N88A 1EY5A 1BR9A 2K5WA 4N9PA 4NW2A 3D6WA 1IYUA 5EBCA 3KK7A 4WJWA 1AW7A 3L3OC 2HCCA 2DNEA 1LV9A 4C3HB 4K2LA 1KNAA 3KBGA 3T53B 2BDOA 1LTBD 1A3VA 3E0JA 5CGKA 2F0KA 1KDBA 1ILPA 2B2YC 4UDUC 2R6GA 2CQAA 5JPMC 1SJED 2ZT9C 1FGBD 4KMUC 1LTSD 1CM9A 2KHSA 1EY8A 5G3LF 1CFMA 3FPPA 1Y69U 4A3IB 1CHQD 2C5CA 4XIGS 1V1PB 1DOMA 4DA2A 2WKDA 1I4RA 5C4ZA 2ZXRA 2EJGC 4HCEA 4BY1B 3HZXA 3A56A 2QF7A 2PQEA 2G9DA 3IFDA 3M7NA 2R92B 1STYA 2YU9B 5C5MA 4NP5A 1TS3A 2M00A 4ZKBB 4CKEA 1DOKA 1F2YA 2A74C 4DAVA 1QE6A 2FMMA 2XWJB 1S4ZA 2BCOA 5J39A 5A35A 5C5LA 4KHVA 1SYEA 1U9RA 3TZUA 1HRJA 2ZXPA 1EU3A 2WACA 2AUKA 3PV0A 3RZOB 5EPLA 2IL8A 2JYOA 5IIFA 3K58A 3CKIB 3QIAA 2KVMA 3TBIB 2HUGA 3BG3A 1G2TA 4XT1B 1LLRD 4QUCA 4AYBB 4G7ZC 1F2ZA 5CV5A 5I6WA 3MTSA 3S14B 2EZVA 1EEFD 4DXFA 3OW7A 1RD9D 3PIO3 3IL8A 1ET9A 3PUVA 3H6MA 1OXSC 4TSSA 3J7AF 5BN3A 3H91A 3RUZA 3Q22A 4P2CB 1A3TA 2BA1A 4BA1I 1I4PA 3LX0A 1NAPA 1SNOA 2RBMA 3JAME 3C3LA 2FFKB 1H9JA 1JQYD 3K57A 1F9PA 4QF4A 2A69C 2F0QA 3NWTA 2F0WA 1X3PA 3H09A 4A3FB 4FXGC 4RGOS 1BOSA 1JWMD 2Z4HA 1TWGB 1O80A 3SR1A 1NSNS 2XIWA 2R7ZB 1DZ1A 1LO5D 2NTSA 4OO1G 1BNZA 1B4OA 4IURA 5IGCA 3K5OA 1U4MA 3PIP3 2F0GA 5C4JB 1QJOA 5JEAG 1W6KA 4IUVA 3SVMA 4Q5VA 3DWAA 2J0TD 3I91A 3CRKC 4KI0A 3CQZB 1G6ZA 4BA2I 4K6LA 2NUCA 2L0CA 5M5WB 1X32A 2AQ1B 3HOZB 3C1FA 2F3WA 3FRPB 1E2ZA 1RJTA 1J8IA 5FKAC 3V2TA 2EY1A 3A54A 3K7AB 2XVSA 4ZKCB 2RDHA 1E2WA 4ID6A 2KCCA 1TWHB 3SHLA 1A6XA 3K0YA 3D4RA 1S5ED 5I9OA 4C1NI 2SEBD 2F0FA 3QOLA 1WTQA 5KNDA 4PV1C 1Q12A 3BVMA 3K59A 1R4PB 3CU7A 3MFGA 1SNMA 5EKKA 4RCNA 1Q1BA 1NR2A 3NQIA 4HMJA 5EGTA 2B2UC 2DY8A 1PZID 3HS0C 1SNDA 1F2MA 3MFYA 2PPBC 4G7OC 3MC0B 3CHBD 4KKUA 4G7HC 1EYCA 4IFDJ 3G6JB 1QNUA 4PMWA 3TSSA 1PFNA 5C0XI 2R61A 3RD4A 1F2LA 4MIUA 1U4PA 4K8IA 1QCBD 1F9QA 1OXXK 2DY7A 3E6ZX 1STBA 2GA4B 3GTKB 2L11A 2F0MA 1RCVD 3KBXA 1GJXA 1YNJC 1IL8A 3D8GA 3R93A 3H0GB 1BCPF 3MVVA 3JAML 3SK6A 4M1UB 1CZWA 1SBBB 4S3SA 2F4IA 2YYZA 4IUNA 3BYYB 1EL0A 2F0SA 3WOEA 2BA0A 4PQXA 1SFOB 5ELCA 3K5LA 1UEAB 1CK1A 2X69A 2Q8TA 3EVQA 3OHXC 1IKMA 5D65A 3T56B 1O7YA 1QNKA 5EBDA 1STAA 3MZ5A 3BVZA 5JAVA 3S2HB 2F0IA 3FEWX 2V4DA 4HAEA 5T1GA 3QOJA 2EYHA 1Q90A 2EVBA 2WB1B 2IX0A 1HA5A 1PMRA 1B2TA 1STNA 3K6OA 1A15A 2WKCA 4FF2A 2I46A 4HN7A 3OSOA 3OMGA 2PZWA 1AZPA 3I8ZA 4IN3A 2RA4A 1TKWB 4A3JB 3EFXD 3S9WA 4IZ8A 3FPUB 1TR5A 2PW7A 5FO9B 2SDFA 3VR6A 1LACA 2H1EA 2VB3X 3WOFA 3TZDA 1O7ZA 3NK9A 1I50B 2PCFB 5K36G 3GTQB 4TRDA 2F0NA 2E75C 4ME5A 5J1ZA 2B2VA 1G291 4PNYA 3Q6SA 1QWYA 3HEJA 2NZ1D 1EY7A 3T51B 2XRSD 1PFMA 1EIHA 5IT9E 1BCPD 2RSOA 1JORA 1TWFB 2AWNA 1CQVA 3W3AA 2KJXA 1BXTA 4ZAIA 2L12A 4DN4M 1PTOF 1SNPA 2D5DA 2LS01 3TP6A 1ZYRD 3IKJA 5C3WA 2KUMA 5KYLA 4X3TA 3H3VC 1L0YB 2KCNA 4XQNA 1FNUA 2NN6I 3TMEA 3VA7A 4XQQA 3S15B 2Y0SB 1KLGD 2CW0D 3HKZB 1R4QB 2EOTA 4WRDA 5A2QE 1H9SB 2X6LA 2IPKD 4LK1C 1RF2D 1GUTA 5JOBA 1TT2A 3X3NA 1FD7D 3HOUB 2BDNA 2L1BA 4HCSA 1JWSD 1T5XD 2FMCA 4A3DB 3LWEA 2JA5B 2A73B 4OO1H 1NR4A 1SNCA 2PMZB 3GTGB 4L6TB 1ICWA 2RKSA 3Q24A 2JP1A 4K8JA 2QILA 3RZDB 2OXPA 3O13A 3D6CA 4MHEA 4IUQA 2ICEC 1SMYC 5M5XB 2L55A 4KJNA 2JA6B 3E5SA 1D2BA 4C3HG 3NP8A 4RHRA 3T4AC 4CHTB 1KAAA 2OEOA 4H0LC 3I4NB 5C0XG 2BE5C 3NBIA 1ILQA 3U9OA 4Y7NB 3P20A 1CTMA 3F2UA 2M9VA 3QG1A 2I07B 1AZQA 4A3BB 2PYKA 4Z9CB 2IWHA 4MN3A 4HSPA 2AQ3B 3NTHA 2VB2X 4IUPA 4ZUIA 1LTID 2A68C 4Q0FA 1PYWD 1DD2A 1Q3LA 1PTOC 4IALA 5JPNC 1CA6A 4F8MA 1D5MC 5E4XA 4K14A 4QUFA 3PO2B 1PFBA 2EY2A 2EY5A 5FK9C 1LTGD 1UUPA 4B9WA 4EQNA 3S2DB 1S5FD 1GXDC 1HTLD 2EYFA 4BS9A 2LY7A 1CHPD 1Y8PB 2MUYA 1PZJD 1LT6D 1EOTA 2Z1CA 1YNNC 2AWOA 1TS4A 3TP8A 3NUCA 3M4YA 1SE2A 1WTPA 4XXEA 2B2TA 2DN8A 1S5CD 4NMZA 2A5HA 5M3FB 3KLRA 3FVQA 1GOZA 1TVXA 3MA2B 5I2XA 4C3IB 4A3KB 1XYIA 4E6IA 1STGA 3EROA 3VR4A 2LMCB 4FO2A 3GD7A 4XYQA 3J80E 3MHBA 3QB3A 1VDZA 1PTOB 2MGSA 1ET6A 1JICA 5C44B 1R9TB 3VYRA 1WTXA 3NXWA 1KDAA 2XN9C 3MEHA 1C8CA 1BUVT 1OXUA 3HGBA 5K5PA 3VYSA 1D5XC 4F88A 1VF5C 3A8KE 4DFAA 1JWUD 1W6JA 1I6VC 2IJ0A 5CV8A 4KJOA 2NVTB 1A2UA 1LTTD 4JK1C 5G3LD 5KEEA 4U673 3MAQA 2A69D 5CR3A 2E2HB 4DU9A 4CKBA 1SYBA 2A6HC 3I90A 2NN6G 2K7VA 3V96A 1LTAD 4B08A 2K32A 5K36H 1EWCA 2KQ3A 2MP1A 2D62A 1ENAA 4CBVA 1DCZA 1Y8OB 5JJZA 1I4GA 2B2VC 2NVXB 2NB0A 2HCIA 5LL6S 2Q8IB 3DWPA 1G91A 3GTOB 1NCVA 4OHJA 5IGDA 2EYLA 1SYDA 2MHVA 4BWGB 1SE3A 4IFDI 1ZXTA 3N6RA 4WORA 5C6AA 1WD0A 4NKLA 3D4DA 4DNTB 4RH6A 3HRZC 1E2VA 2MPMA 3TP7A 1DYQA 3W2DA 1FYCA 2IX1A 4IQZA 4C2MB 2ICIA 3SK8A 3SK5A 3FMCA 4HMIA 1K83B 1MBYA 2IX3A 2IT1A 2SNMA 1IHZA 2A6EC 1CT1D 2D2CC 3S1MB 1HPCA 3I4MB 1PXUA 3J80L 2O2LD 1Y1WB 3G7LA 2M2LA 4K6DA 1KLUD 3QJYA 3K5NA 4BBSB 3BDLA 2O4XA 1GUNA 4DAYA 3NE5B 2F1MA 3I72A 3MXGA 1MI2A 2K5QA 1DONA 5KNBA 4A3EB 1II3A 2E74C 4H7BA 1D1KA 4F87A 4HTHA 2K6AA 4RGTA 1TWAB 1YNJD 5HURA 1V1OA 1I3QB 5C0XH 5FLXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCV A;  3P7J A;  3DEP A;  1XYI A;  2X6G A;  2RSN A;  2L4N A;  1MGS A;  2L12 A;  3MTS A;  2MJ8 A;  4ZAI A;  4DN4 M;  2K03 A;  3F2U A;  1CM9 A;  5CBE E;  3N52 A;  1ML0 D;  1ZXT A;  1DOL A;  4X3S A;  5EPK A;  1WTV A;  2EPB A;  1RHP A;  1WTQ A;  1RTN A;  2KEC A;  1EIG A;  3IL8 A;  1WTR A;  1AZQ A;  2R3Z A;  1U4L A;  2KUM A;  4OIK A;  1J9O A;  4R9W A;  5CMD A;  1E0B A;  2B2T C;  3H91 A;  2X69 A;  2B2W A;  2MGS A;  4O42 A;  2Q8T A;  4RA8 A;  4X3T A;  2EE1 A;  1WD0 A;  1HHV A;  1DOM A;  1WTO A;  1WTW A;  5D65 A;  4MN3 A;  1IKM A;  1O7Y A;  1WVL A;  4IUP A;  2B2W C;  1JIC A;  1QNK A;  1NR2 A;  2K04 A;  3ONA B;  2B2U A;  1HFN A;  1SSO A;  4XDX A;  1WTX A;  1MSH A;  2N55 A;  4IUT A;  1GUW A;  1XX8 A;  1F9S A;  2MPM A;  2B2U C;  2DY8 A;  4HAE A;  1Q3L A;  1MSG A;  1NAP A;  2NWG A;  3IFD A;  1C8C A;  5T1G A;  4R8I A;  3DM1 A;  5AFW A;  2EOT A;  2FFK B;  1CA5 A;  1CA6 A;  3QO2 A;  4X3U A;  2D9U A;  2X6L A;  2KOL A;  1WD1 A;  1ESR A;  1B2T A;  5EJW A;  1A15 A;  1F9P A;  2RVL A;  4HSV A;  1F9R A;  5E4X A;  4QUF A;  1X3P A;  4XT3 B;  1ROD A;  4HED A;  4ZK9 B;  5D14 A;  1PFB A;  1IKL A;  1AZP A;  1PFN A;  2J7Z A;  1PLF A;  2RA4 A;  3I8Z A;  2BDN A;  2K1B A;  4ZLT F;  1BO0 A;  4ZKB B;  3GV6 A;  1O80 A;  3DEO A;  2L1B A;  1DOK A;  5EPJ A;  2XIW A;  4HCS A;  1F2L A;  1U4P A;  1QE6 A;  1DZ1 A;  3LWE A;  5COY A;  2FMM A;  2HDM A;  4CJ0 B;  1F9Q A;  1QG7 A;  1S4Z A;  1AP0 A;  1BNZ A;  1VMC A;  1B4O A;  5EKI A;  1NR4 A;  5DNF A;  4CJ1 B;  4IUR A;  2DY7 A;  2N88 A;  3FPU B;  1HFG A;  1U4M A;  2K01 A;  2L11 A;  3D6W A;  4IUU A;  4NW2 A;  5E4W C;  3UI2 A;  1SAP A;  1HA6 A;  3G7L A;  2K05 A;  1VMP A;  2M2L A;  4OIJ A;  1HUM A;  1ICW A;  2VXW A;  2SDF A;  3KBX A;  1G2S A;  1X3Q A;  1EQT A;  2HCC A;  2Q8R E;  2H1E A;  2CVR A;  4IUV A;  1IL8 A;  1LV9 A;  2JP1 A;  4RAU C;  1O7Z A;  1SDF A;  3TZD A;  3SVM A;  3FDT A;  2K28 A;  3I90 A;  1BBX C;  3I91 A;  3R93 A;  2L9H A;  3HP3 A;  1EOT A;  1HUN A;  1B50 A;  5CBA E;  1G6Z A;  3MWY W;  1HRJ A;  4MHE A;  1KNA A;  3I3C A;  1BF4 A;  4LMQ D;  4IUQ A;  1X32 A;  1B3A A;  1MI2 A;  2FHT A;  2KED A;  1JE4 A;  1KNE A;  5EPL A;  1DON A;  1RTO A;  2IL8 A;  2JYO A;  2MP1 A;  2NYZ D;  4CJ2 C;  1WTP A;  4UAI A;  2B2T A;  5COR A;  5T1I A;  2KVM A;  2KEE A;  1RJT A;  2HUG A;  1J8I A;  2FIN B;  1G2T A;  2B2V A;  4XT1 B;  2FJ2 A;  1M8A A;  3GV3 A;  5EQ0 A;  5JJZ A;  1PDQ A;  2B2Y A;  3Q6S A;  4QUC A;  4ZKC B;  1B53 A;  2B2V C;  2NZ1 D;  1ILP A;  2B2Y C;  1PFM A;  1EL0 A;  1TVX A;  2HCI A;  3TN2 A;  4X3K A;  1EIH A;  2HDL A;  2RSO A;  1ILQ A;  3KUP A;  4U68 A;  4RWS C;  1G91 A;  1U4R A; 
#chains in the Genus database with same CATH topology
 1HR0 L;  2JA7 B;  1IW7 C;  3C46 A;  2RHS B;  1DM0 B;  1I94 L;  1WTH A;  1KAB A;  1K8O A;  1TII D;  3M4O B;  1IYV A;  4LFC L;  2B8F A;  3ULP A;  1A0I A;  3F2D A;  5CMD A;  3AFQ A;  1VQP A;  4O42 A;  1V9P A;  1GUW A;  1FNW A;  2HIV A;  4K0K Q;  2UXB Q;  2K04 A;  2F0P A;  5E3F A;  4A76 A;  3CC2 A;  1XMQ Q;  1YI2 A;  4L5T A;  1LM0 A;  1GUS A;  1TS5 A;  4A3I H;  3EJI A;  1TY2 A;  2E76 C;  3DM1 A;  2KOL A;  5I9P A;  1FR3 A;  5EJW A;  4B3T Q;  3KLS X;  3SE0 A;  5HGQ A;  1LT5 D;  2CHB D;  1EZ6 A;  4OXP A;  3T1H Q;  4BY1 H;  4O2D A;  4JI4 Q;  2J7Z A;  1VF7 A;  4ZLT F;  5DAU A;  3M3Y B;  2F0J A;  4RFB A;  3SEB A;  2BH8 A;  2R92 H;  2AMC B;  2YU9 H;  4JBW A;  3BYT B;  2JN4 A;  4QB4 A;  5CV4 A;  3DM3 A;  5DNF A;  5ELF A;  1HFG A;  1EY6 A;  1XNR L;  2K01 A;  3UI2 A;  4BY7 B;  1GO3 E;  5E4W C;  1PRT C;  5IOD A;  4OIJ A;  2VXW A;  1QUQ A;  2CVR A;  2WB1 E;  5KNC A;  1BBX C;  5I6Y A;  3SDZ A;  2L9H A;  2F0D A;  3D3R A;  1FGU A;  3AMU A;  1VQD A;  5IGG A;  3AU7 A;  4PZ8 A;  1ASZ A;  5IGB A;  2OT2 A;  1K8A C;  3A8J E;  4KD3 A;  2EJF C;  2EYM A;  3TDQ A;  2EYJ A;  4DV1 L;  3S1Q B;  1D6E C;  2G9H D;  4DV2 L;  5IOC A;  4RKL A;  3GV3 A;  5EQ0 A;  1PDQ A;  3WWV A;  2UUC L;  3TRZ A;  3TN2 A;  4X3K A;  2HDL A;  1SEB D;  3R8B A;  3RZO H;  3ZYY X;  4AQY Q;  4KY6 A;  1M90 C;  2NVQ B;  4DNR B;  2X6G A;  1BDO A;  4DR1 L;  4ZUJ A;  3CCS A;  4FF4 A;  1AEX A;  2JK8 A;  2XGT A;  4JI1 L;  1AFP A;  4M8A A;  5EPK A;  2KA7 A;  4KN7 C;  1EIG A;  4DR5 Q;  1MD2 D;  4XTC S;  2KCM A;  1HQM C;  4R9W A;  1UNS A;  3M7G A;  1HHV A;  4RA8 A;  2CWP A;  3R2T A;  5DEH A;  4EVO A;  1WTW A;  1IYJ B;  5NUC A;  1SSO A;  1VQ5 A;  3S14 H;  3EQL C;  1HQR D;  4K5V A;  4L8J A;  2OF1 A;  1BBW A;  4HJ9 A;  2JA8 G;  4R1J A;  2EIF A;  4A3C G;  1MSG A;  3L0O A;  5DM6 3;  1EYA A;  2QCP X;  2HHH L;  1CA5 A;  1PH5 A;  1VQ6 A;  1E7Z A;  4JYA Q;  3NWS A;  3A0J A;  2JA8 B;  1KTK A;  3NBH A;  5IGE A;  2Y0S G;  1FNV A;  4OGQ C;  3NTK A;  5LHY 1;  2JEB I;  1X3G A;  3ERQ A;  3HKZ G;  4HR7 B;  4YHH L;  1TU2 B;  3VR5 A;  2NVY B;  2MQH A;  1BO0 A;  3A74 A;  4V0B A;  4DNI A;  4MZ9 A;  2J4X A;  2F0V A;  1B7Y B;  2VNU D;  4J6H A;  3TRE A;  4FF1 A;  4PG3 A;  1AP0 A;  4K5X A;  4IFD G;  2IHF A;  3CCR A;  4KKS A;  1V8Q A;  4A3F H;  1SAP A;  4YIJ A;  4FYD A;  5ISR A;  1ESF A;  1TWG H;  2F0O A;  1G2S A;  4DR6 Q;  3T16 A;  4LUZ A;  4JI6 Q;  2R7Z H;  2WFW A;  3PGZ A;  3CW2 C;  3TS2 A;  4DXG A;  2JA5 G;  5CBA E;  2KBN A;  3MWY W;  2E5L L;  3ND8 A;  3I3C A;  4ZYS A;  2DNC A;  4XQJ A;  2LKV A;  4JVZ A;  3OPO A;  5C4H A;  2YTV A;  5C4J H;  4L63 B;  5IWA Q;  3V05 A;  2FIN B;  1H9R A;  1WFQ A;  4JI5 L;  2E2J B;  4G4K A;  3NSW A;  2Z6K A;  3ULJ A;  1EIY B;  3OIQ A;  3CQZ H;  1O78 A;  1JCK B;  4DF7 A;  5JEA H;  1JE5 A;  5M5W H;  5CYU A;  3HOZ H;  4ZRZ A;  5CV6 A;  4A3M G;  1A2T A;  2TSS A;  2JA6 G;  1VQC A;  3ND9 A;  4LUV A;  1CKM A;  1I4Q A;  5JVG 3;  1PA6 A;  1MGS A;  1EYD A;  1B9M A;  1IBM L;  1SMY D;  3K7A H;  4ILW A;  1VQM A;  4A3M B;  1MKH A;  5CBE E;  3K7U C;  1LTR D;  4PZ7 A;  3SK4 A;  3I4N G;  3J7Y W;  3JAM c;  1TWH H;  1WTR A;  3U4Z A;  2VQE L;  3FP9 A;  2XSC A;  1E0B A;  3G48 A;  1CKN B;  2A19 A;  4B9X A;  2F03 A;  3K80 C;  5M5Y B;  2BE5 D;  1HFN A;  1TQO A;  3ONA B;  4IUT A;  4HIO A;  1K0S A;  3BS1 A;  1KC8 C;  4KLK A;  2K14 A;  3M85 A;  4A3B G;  2VUM B;  2EYO A;  2E2D C;  1ESR A;  5IP7 H;  2ZJQ A;  1NY4 A;  4LF5 Q;  4DUY L;  4HIK A;  5KIX A;  1DJR D;  3BZC A;  1K8M A;  3VR3 A;  3K5M A;  2SOB A;  5JEA J;  4EGV A;  3DEO A;  2ZXO A;  4GS3 A;  2A68 D;  3GO5 A;  4QMG A;  3D0F A;  1TXY A;  2R93 B;  2F4V L;  1WCM G;  1PTO D;  5COY A;  2F3V A;  2HDM A;  3DLL A;  2HQE A;  4JG2 A;  2HIX A;  1B1Z A;  1T5E A;  4CJ1 B;  5I2Y A;  3AB9 A;  3I70 A;  4DV7 L;  2K50 A;  2EXZ A;  4KD4 A;  1HA6 A;  1SXT A;  2P5Z X;  4IUU A;  4C3J G;  1WCM B;  2K33 A;  3DWQ A;  3RN2 A;  3KF8 A;  1SN8 A;  5IT9 L;  4UY8 C;  4JI8 Q;  2K28 A;  1HUN A;  1WI5 A;  3BVG A;  4HIM A;  4C3J B;  2B29 A;  1Z47 A;  3BZD B;  1IBK L;  1FVI A;  3GTK H;  1KNE A;  3VA5 A;  2UU9 L;  1K73 C;  4JI0 Q;  4CJ2 C;  4DR7 L;  3P1H A;  1JJ2 A;  4GOP C;  1TWC B;  5T1I A;  2I5H A;  3CCE A;  1CQF A;  3IFT A;  4GKK L;  3H0G H;  1V1Q A;  1LT3 D;  3I55 A;  2I5M X;  1XXG A;  2AKW B;  3PUY A;  5CV7 A;  3J81 E;  4DV0 L;  1V43 A;  3LNN A;  4RGM A;  3RLO A;  4OL7 A;  5IP9 H;  1YNN D;  2MO1 A;  3DEP A;  2F3I A;  4BBR B;  3OOC A;  2MJ8 A;  4IJL A;  4KV6 A;  1GHK A;  5A2Q L;  4KN4 C;  5KYI A;  5M3F G;  4EQO A;  4ALP A;  1PV4 A;  3MXU A;  4QCL A;  5IYD G;  3PMF A;  3RNU A;  4R4Q A;  2F0L A;  4ODG A;  1JR0 D;  1BQQ T;  1VQF A;  1HNZ Q;  3T13 A;  2B2W A;  2EE1 A;  5FJ8 G;  4GLV B;  1MJC A;  1H9S A;  4C3I G;  4A3K G;  2G5D A;  2L5T A;  1JB3 A;  5HY6 A;  1FJG Q;  4DAP A;  5LMN Q;  1PH2 A;  2O5J C;  3RR5 A;  3KYH C;  4PMC A;  1SFO H;  2B39 A;  1LT4 D;  1JOO A;  2BH2 A;  3PUX A;  2NWG A;  1ONL A;  5AFW A;  2OWO A;  2TMP A;  2A1A A;  4P73 A;  5JVH 3;  4X3U A;  4YWL A;  1E1O A;  3AFP A;  1LTL A;  1VQE A;  3ER0 A;  1B8A A;  2H4O A;  3URY A;  5C44 G;  2RVL A;  3HFZ B;  4HJA A;  3AEV A;  1HCZ A;  4ABN A;  1CKO A;  2JSO A;  3I4L A;  3HG9 A;  4TKO B;  4XT3 B;  3S2H H;  2JA9 A;  1QOH A;  4HED A;  5HGT A;  1C9O A;  1EIF A;  3TP5 A;  1N32 Q;  2Z8L A;  1EU4 A;  1N36 Q;  5L37 A;  3J7Z C;  4X62 Q;  3ITP A;  3OIP A;  4DR4 Q;  1VCI A;  3RMH A;  1SE8 A;  1T9H A;  2HQL A;  4LW1 A;  3E3X A;  1DXM A;  4AYB E;  3DMU A;  1X3E A;  3UE0 A;  3UDG A;  3S1R B;  3BDC A;  2LFN A;  5IYC H;  2JE6 I;  2K05 A;  3I7F A;  4A3J H;  3KDF B;  3CCM A;  4UAI A;  3J81 i;  1X3Q A;  2Q8R E;  4DV3 Q;  2GVB A;  4H44 C;  1EY9 A;  1C4Q A;  1JOK A;  5D3D A;  4GOP B;  1K3B C;  3IAY A;  4CGY B;  2HD3 A;  2WII B;  3VYU A;  1ENF A;  4KHP Q;  3E0E A;  2BOS A;  5CV9 A;  4LMQ D;  4NXM L;  4ULL A;  1ENC A;  2KED A;  2Z0S A;  3VYT A;  2NYZ D;  1X65 A;  5COR A;  4DR2 Q;  1LAB A;  5F2D A;  1HZB A;  2FJ2 A;  1M8A A;  1I50 H;  1I5F A;  2B3G A;  1N34 L;  3P75 A;  2ZTE A;  5E1F A;  2EJM A;  3RN5 A;  1KDC A;  1EWH A;  1OXV A;  4CKC A;  2A6H D;  1CSQ A;  3GDE A;  3GTQ H;  3S17 B;  2YTX A;  4X66 L;  1EFI D;  4U68 A;  1U4R A;  1EQV A;  3P7J A;  2B8G A;  5BN4 A;  1B9N A;  5FO8 B;  4FF3 A;  4FVM A;  2CWA A;  2K03 A;  2K5N A;  1G6P A;  1D1I A;  3N52 A;  3WDN A;  1DOL A;  3NEL A;  1RTN A;  1X3F A;  3LWU A;  4GKJ L;  4QIW B;  2R3Z A;  4ZQ3 A;  3A55 A;  1YJN A;  1RKN A;  1JB7 A;  1TWF H;  2F0H A;  3OTO L;  3H15 A;  1S5B D;  1O7L A;  2RQX A;  1WVL A;  4I65 A;  3BJU A;  3I56 A;  1MSH A;  1Q8I A;  2N55 A;  3PO3 G;  3CME A;  2PO4 A;  5I4D A;  1V1P A;  1SJH D;  4IPD A;  5IYB H;  1SYC A;  4R8I A;  1NNX A;  1QZG A;  2D9U A;  4LF8 L;  3VR2 A;  4QQB X;  1EEI D;  3PO3 B;  3C2P A;  4RGN A;  3A7A B;  2DJG C;  5C3E G;  2K5D A;  3J81 L;  3R2I A;  3S15 H;  4ZK9 B;  3NQT A;  1IXR A;  4C56 C;  3OWE B;  4EQP A;  1CI3 M;  1PLF A;  2K1B A;  2EY6 A;  2YTY A;  3KJO A;  3GV6 A;  1GUO A;  1L1O A;  1GHJ A;  4N9T A;  5C3E B;  5FO7 B;  3CPF A;  5LL6 X;  4JV5 L;  1EFW A;  3L9A X;  2N3S A;  1QG7 A;  2EYP A;  4DR3 Q;  1Q1E A;  3B6Y A;  2VW9 A;  2O5I C;  4P75 A;  4IFD H;  4KY7 A;  3HOU H;  2KHI A;  1OO9 B;  1PRT F;  1VQI A;  2XNA C;  4RAU C;  3I4M G;  4A3D H;  2QEJ C;  5D3I B;  1GUG A;  4RCO A;  2JA5 H;  2A6E D;  1EZ8 A;  1BF4 A;  5ELB A;  3GTG H;  4IPC A;  2WAQ B;  3OWF A;  1SNQ A;  1UAP A;  1PHJ A;  4A3G G;  1HTP A;  4KHZ A;  2DGY A;  2B2Y A;  5LMN W;  2PZT A;  3RZD H;  3GQB A;  2WP8 J;  1YBY A;  1PH9 A;  4DK3 C;  4C1N K;  4DPG A;  4A3G B;  1ZKO A;  2HT1 A;  3PUZ A;  2ID0 A;  4PMB A;  3DUZ A;  1U0L A;  1VS0 A;  3KUP A;  4A3E G;  5M5X H;  4R8N A;  3U50 C;  5CC4 A;  3FKI G;  4GN4 B;  4L5Q A;  2JA6 H;  4JI7 L;  1H9K A;  3D31 A;  3OMC A;  4LF4 Q;  1B44 D;  4JI3 Q;  3M9B A;  2EPB A;  1X56 A;  1SE4 A;  2KEC A;  2WIN B;  3FKI B;  3I4N H;  1U4L A;  3PUW A;  4JBJ A;  2XRQ D;  3GTJ B;  2ATW A;  2GN5 A;  3W5O A;  1RDP D;  1Y8N B;  3R3O A;  1WTO A;  1I6H B;  1CSP A;  3H3V H;  1C0A A;  4Y7N H;  3DHQ A;  2EXD A;  3HOV G;  3A7L A;  2RDF A;  3GTL B;  3KLS A;  4KTA A;  1JMC A;  3BU2 A;  4RKB A;  4RMF A;  1IW7 D;  1N33 L;  4BXX G;  1K3R A;  1PH1 A;  3KF6 B;  5M9O A;  4A3B H;  3QO2 A;  3HOV B;  3KJP A;  2UXC L;  2QKI C;  5TSS A;  3HOY B;  4HSV A;  5GAG C;  2LXK A;  2EDG A;  1ROD A;  5GAE C;  1EY4 A;  2QDB A;  4YY3 Q;  1JC7 A;  2XWB B;  4KKT A;  5ELE A;  1KRS A;  2NTT A;  2ZJR A;  1H9M A;  2A8V A;  4WFN 3;  4CJ0 B;  3ULL A;  5EKL A;  1P16 A;  4AQY L;  2MO0 A;  3PO2 H;  1PVO A;  3DXJ C;  4KK7 A;  4P74 A;  1VMP A;  4C3J H;  1HUM A;  4CDD C;  1KRT A;  1EQT A;  4DK0 A;  5E7N A;  3FDT A;  2C9O A;  3X3M A;  3S2D H;  2AHO B;  3HP3 A;  1Q81 C;  1QB5 D;  1B50 A;  1QIL A;  5C0X J;  2F0U A;  4YCU A;  1Y1V G;  5M3M B;  2Z6B A;  1Z6H A;  3MXP A;  2PZU A;  5KRU A;  1XWE A;  4I7Z C;  1TS2 A;  2FHT A;  4K2K A;  4XYO A;  4BY7 G;  1RIP A;  1HH2 P;  3T1Y Q;  3NTI A;  5C3X A;  5KGU A;  2K5V A;  1Q8K A;  4K5W A;  1NE3 A;  3A8I E;  1Y1V B;  2KEE A;  3KOJ A;  1PRT D;  2Z4I A;  2UUA Q;  2JXM B;  1OXT A;  3GP7 A;  4GLA C;  4B3M L;  3RLF A;  1N9W A;  3CXC A;  3CRL C;  3A5Z B;  4CDF C;  3MXN A;  3M4Q A;  4GZY C;  2L4N A;  4LJZ C;  1KHI A;  4TVA B;  4LF6 Q;  1S72 A;  3Q0A A;  1XNQ L;  3S16 B;  4QL5 A;  2VQF L;  1ML0 D;  4X3S A;  5M3F H;  4NDX A;  3SXH A;  1WJJ A;  1HR0 Q;  3CCQ A;  3C1E A;  1J9O A;  1HXY D;  1I94 Q;  2B2T C;  1X6O A;  3I73 A;  1PFS A;  3NPP A;  1A63 A;  3QWN A;  5FJ8 H;  4C3I H;  4A3K H;  2B2W C;  2ALY B;  1PZK D;  2ES2 A;  3FHW A;  4XDX A;  1NUC A;  4FXD A;  2ASB A;  1JOQ A;  2PI2 A;  4DR6 L;  2F0T A;  4YWM A;  5DM7 3;  1PH3 A;  3BZK A;  4JI6 L;  4YWK A;  1PTO H;  3CMA A;  2B63 G;  1QVG A;  1G8Z D;  4J8Q A;  5C44 H;  1R9T H;  2QGQ A;  2UXD L;  1VQ8 A;  3STB C;  3CF5 A;  5D14 A;  1CZG A;  5IGF A;  2B63 B;  4DK1 A;  3F2B A;  1D5Z C;  3UDX A;  1XPR A;  2OCE A;  4GNX A;  2DJF C;  3EA6 A;  3H94 A;  1F77 A;  1SMX A;  4LAA A;  4FXK C;  5BN5 A;  3GTP B;  2QW7 A;  1Z7T A;  5EKI A;  2NBF A;  1W3S A;  4DGZ A;  4X65 Q;  1Y14 B;  2IW3 A;  3NHH A;  1A3U A;  1NJI C;  2NVT H;  4RG1 A;  5FOB B;  1SDF A;  4FNF A;  3PF4 A;  1K8G A;  5FLX L;  1I4X A;  1GM5 A;  1BCP C;  2PW5 A;  2F0E A;  1SYG A;  1PRT B;  1SYF A;  1B3A A;  2ENB A;  2PNR C;  1JE4 A;  1AH9 A;  1RTO A;  2E2H H;  1ZYR C;  2SNS A;  5ELD A;  2Y0S E;  1XTC D;  3U9S A;  1TY0 A;  3HKZ E;  1B53 A;  3J80 c;  2AQ2 B;  3J7A V;  4DV1 Q;  4LFB L;  1ICF B;  1C48 A;  4NB3 A;  4OX9 Q;  4DV2 Q;  5JJK A;  2AUJ D;  4KY5 A;  3HOX G;  2NN6 H;  1VQ9 A;  4JBM A;  4RWS C;  2Q2I A;  3E9I A;  2CW0 C;  4L5R C;  2UUC Q;  4LF5 L;  3HOW G;  2RSN A;  4J1M A;  1KQS A;  4OO1 I;  1M1K C;  5C4X B;  1S5D D;  1L0X B;  4G57 A;  1AN8 A;  3HOX B;  3GTM B;  4TQU S;  2NVX H;  1WTV A;  1RHP A;  3D4W A;  5DLQ E;  4WJ3 M;  4IOC A;  3HOW B;  1AE3 A;  4OIK A;  4MNO A;  4B3S L;  4RHS A;  4F7X A;  4DV4 L;  4JI1 Q;  3GTO H;  1EOV A;  2B2U A;  1W2B A;  2PMZ E;  1LYL A;  4H13 C;  1XX8 A;  1F9S A;  4DV5 L;  1STE A;  1K0R A;  1M4V A;  4OEM B;  1PYS B;  3L7Z C;  4V19 0;  3Q23 A;  5LMU Q;  4NXN L;  4R4C A;  1WD1 A;  4O0A A;  1ZEQ X;  4A93 B;  1F9R A;  3RLN A;  1STH A;  1I4H A;  2HHH Q;  1EY0 A;  1IKL A;  4FP5 D;  2JEA I;  2VUM G;  3BDO A;  2D0P A;  2IHE A;  3S1N B;  5EPJ A;  2WV6 D;  2RDG A;  1L1O C;  4C2M H;  2E2I B;  4O1N A;  4YHH Q;  3ICE A;  2DUD A;  5J22 A;  1VMC A;  1BCP B;  1K83 H;  2N88 A;  1EY5 A;  1BR9 A;  2K5W A;  2CKZ B;  4N9P A;  4NW2 A;  3D6W A;  1IYU A;  5EBC A;  3KK7 A;  1K9M C;  4WJW A;  1AW7 A;  3CCU A;  3L3O C;  2HCC A;  2DNE A;  1LV9 A;  2R93 G;  1S40 A;  2R7F A;  1X55 A;  4APV A;  3S1M H;  4C3H B;  3I4M H;  2L15 A;  4K2L A;  4HJ8 A;  1HJP A;  1KNA A;  3KBG A;  1HR0 W;  3T53 B;  3G71 A;  1Y1W H;  1QVF A;  2BDO A;  1AE2 A;  1LTB D;  4BBS H;  5LMN L;  1A3V A;  3E0J A;  5CGK A;  2E5L Q;  2F0K A;  1KDB A;  1B3Q A;  1ILP A;  2B2Y C;  1NBW A;  4UDU C;  2R6G A;  4L5S A;  2CQA A;  5JPM C;  4JI5 Q;  1SJE D;  4LF7 L;  4A3E H;  4A3I G;  2ZT9 C;  1NTG A;  1FGB D;  4KMU C;  1LTS D;  1CM9 A;  2KHS A;  1EY8 A;  1TWA H;  5FLM G;  5G3L F;  1CFM A;  2CCZ A;  2Q2T A;  3FPP A;  1Y69 U;  4A3I B;  1CHQ D;  2C5C A;  3K81 C;  1I3Q H;  1SR3 A;  1UWV A;  4XIG S;  1IBM Q;  1V1P B;  1DOM A;  1KL9 A;  4BBR G;  4DA2 A;  2JA7 H;  2WKD A;  2QEX A;  1I4R A;  5C4Z A;  2ZXR A;  2VQE Q;  1JJG A;  2EJG C;  3M4O H;  3HOV H;  4HCE A;  4BY1 B;  3HZX A;  3A56 A;  2QF7 A;  2PQE A;  4LFA L;  2G9D A;  2ZTC A;  3IFD A;  3M7N A;  4BXX H;  1EYG A;  3E9H A;  2R7D A;  3F2C A;  2R92 B;  1STY A;  2YU9 B;  5C5M A;  2PQA A;  1L1O B;  3NEM A;  4KHP L;  1GKH A;  4NP5 A;  2Z9H A;  1VQJ A;  1TS3 A;  2M00 A;  1YIT A;  5EAY A;  4ZKB B;  3VDY A;  4CKE A;  1DOK A;  1F2Y A;  2A74 C;  4DUY Q;  4DAV A;  1QE6 A;  2FMM A;  2XWJ B;  1S4Z A;  2BCO A;  4UHV A;  4Y52 H;  5J39 A;  5A35 A;  5C5L A;  3I2Z A;  3M3Y H;  4KHV A;  1SYE A;  1U9R A;  2IY5 B;  4DV7 Q;  4YCW A;  3TZU A;  1HRJ A;  2ZXP A;  1EU3 A;  2WAC A;  2AUK A;  3PV0 A;  1XMO L;  3RZO B;  5EPL A;  4A3L G;  3CCV A;  2IL8 A;  2JYO A;  4BY7 H;  5IIF A;  3K58 A;  4AYB G;  3CKI B;  3QIA A;  2KVM A;  3TBI B;  2HUG A;  4DUZ L;  3BG3 A;  4DAY B;  1OTC A;  4XT1 B;  1G2T A;  4JI2 L;  1IBK Q;  1LLR D;  1Q46 A;  4QUC A;  3TQY A;  2UU9 Q;  4AYB B;  4G7Z C;  1F2Z A;  2E8G A;  1SRU A;  5CV5 A;  5ELO A;  5I6W A;  3S1Q H;  3MTS A;  4DV0 Q;  3S14 B;  2EZV A;  1EEF D;  1E24 A;  4H02 A;  2ZM6 L;  1J6Q A;  4DXF A;  3OW7 A;  1RD9 D;  2VS1 A;  3PIO 3;  1J5E L;  3IL8 A;  1ET9 A;  3PUV A;  4LNQ A;  3H6M A;  1OXS C;  4TSS A;  3J7A F;  5BN3 A;  3H91 A;  3RUZ A;  3Q22 A;  3PF5 A;  4P2C B;  2NVQ H;  1A3T A;  2BA1 A;  4BA1 I;  3G4S A;  1I4P A;  3IRB A;  3LX0 A;  1NAP A;  1SRO A;  1SNO A;  2RBM A;  3JAM E;  3C3L A;  2FFK B;  1H9J A;  2CQO A;  1JQY D;  3K57 A;  1F9P A;  4QF4 A;  1WYD A;  4HJ7 A;  2A69 C;  2F0Q A;  2R7Z G;  3NWT A;  2F0W A;  1X3P A;  3H09 A;  5AJ3 L;  1GD7 A;  2JJQ A;  4A3F B;  4FXG C;  4RGO S;  1BOS A;  1JWM D;  3GTP H;  2Z4H A;  1TWG B;  1O80 A;  3SR1 A;  1NSN S;  2XIW A;  4QIW E;  2R7Z B;  4LWC A;  1YIJ A;  4GNX C;  1DZ1 A;  2JA8 H;  1LO5 D;  2NTS A;  4OO1 G;  1BNZ A;  4A3C H;  1B4O A;  2PNH A;  1IBL L;  4IUR A;  5IGC A;  2UUB L;  3K5O A;  3F1Z A;  4DAM A;  1U4M A;  3PIP 3;  2NVY H;  2F0G A;  3AQQ A;  5C4J B;  1QJO A;  5JEA G;  1W6K A;  4IUV A;  3SVM A;  4Q5V A;  3DWA A;  2J0T D;  3I91 A;  3M4P A;  4B3R Q;  3CRK C;  3TS0 A;  4KI0 A;  1XPO A;  3CQZ B;  1G6Z A;  4BA2 I;  4K6L A;  1D7Q A;  2NUC A;  2L0C A;  4WJ4 A;  5M5W B;  1X32 A;  2AQ1 B;  3HOZ B;  3LGJ A;  1QUQ B;  3C1F A;  2F3W A;  3FRP B;  4JBK A;  1E2Z A;  1RJT A;  1J8I A;  5FKA C;  3V2T A;  2EY1 A;  1YEZ A;  3A54 A;  3K7A B;  3TEH B;  1UE1 A;  2XVS A;  1QZH A;  4ZKC B;  2RHQ B;  4X64 L;  2RDH A;  1E2W A;  4ID6 A;  2KCC A;  1TWH B;  3SHL A;  2WAQ G;  1MIU A;  1A6X A;  3EN2 A;  3K0Y A;  3J81 j;  3D4R A;  1N34 Q;  2MNA A;  1UE7 A;  1S5E D;  5I9O A;  4C1N I;  5IT9 c;  1A62 A;  1K28 A;  2E2J H;  2SEB D;  4K0K L;  3JC6 6;  2UXB L;  2F0F A;  4YY3 L;  2PI2 E;  3QOL A;  1VQB A;  5IP7 G;  1D8L A;  1HNX Q;  1WTQ A;  5KND A;  1XMQ L;  4PV1 C;  1Q12 A;  3BVM A;  3K59 A;  1R4P B;  3PIO A;  3CU7 A;  3MFG A;  4AH6 A;  1SNM A;  5EKK A;  4RCN A;  1Q1B A;  2Z6K C;  1NR2 A;  1HNW Q;  3NQI A;  4GKJ Q;  1EWI A;  4A3M H;  4HMJ A;  5EGT A;  2B2U C;  4B3T L;  2DY8 A;  1PZI D;  3CCL A;  3HS0 C;  1SND A;  3T1H L;  1F2M A;  3MFY A;  2PPB C;  4G7O C;  4JI4 L;  3MC0 B;  2KCT A;  3CHB D;  4KKU A;  5M5Y H;  4G7H C;  1EYC A;  4IFD J;  3G6J B;  1QNU A;  5IY0 A;  2VZA A;  4PMW A;  2ZTD A;  3TSS A;  1PFN A;  5C0X I;  4LF8 Q;  2R61 A;  2KHJ A;  2NZO A;  3KDF A;  2VUM H;  4CDC C;  3RD4 A;  1F2L A;  4R4O A;  4MIU A;  1U4P A;  1HZ9 A;  4K8I A;  4GOP A;  3HOY G;  1QCB D;  4JPB W;  3NBH B;  1F9Q A;  4DK6 C;  1OXX K;  2DY7 A;  3E6Z X;  3H0G G;  1STB A;  2GA4 B;  4FDB A;  3GTK B;  2L11 A;  2F0M A;  1RCV D;  3KBX A;  1GJX A;  1YNJ C;  4LF9 Q;  3PIP A;  1IL8 A;  1XTD A;  1Q82 C;  2R93 H;  3D8G A;  3R93 A;  3H0G B;  2K4K A;  1BCP F;  3MVV A;  3JAM L;  3SK6 A;  4M1U B;  4HJ5 A;  1CZW A;  1SBB B;  5BR8 Q;  2LSS A;  4S3S A;  1WCM H;  4NPS A;  1P8L A;  2F4I A;  2YYZ A;  4IUN A;  5M3M G;  3BYY B;  1EL0 A;  2F0S A;  2VY3 A;  3WOE A;  1PH6 A;  1PH7 A;  2JQO A;  4JW0 A;  4DR5 L;  4AIM A;  1TWC H;  2BA0 A;  4PQX A;  1SFO B;  5ELC A;  3K5L A;  5FLM H;  1UEA B;  4DV6 Q;  1CK1 A;  4JI7 Q;  2X69 A;  2Q8T A;  3EVQ A;  3OHX C;  1IKM A;  5D65 A;  3L2P A;  3T56 B;  1O7Y A;  2WB1 G;  1QNK A;  4BBR H;  5EBD A;  1STA A;  3MZ5 A;  3BVZ A;  5JAV A;  4ZCK A;  3S2H B;  2F0I A;  1E1T A;  4JYA L;  3FEW X;  1YJ9 A;  2V4D A;  1JT8 A;  4X65 L;  4OWW B;  4HAE A;  2K5H A;  3QOJ A;  2EYH A;  1Q90 A;  2EVB A;  2WB1 B;  5T1G A;  1XPU A;  2IX0 A;  1L0W A;  1HA5 A;  1PMR A;  1BKB A;  5IYC G;  3PSI A;  2OTL A;  4A3J G;  1STN A;  1SLJ A;  1B2T A;  3K6O A;  1A15 A;  2WKC A;  1N33 Q;  1YHB A;  4FF2 A;  2I46 A;  3CC4 A;  5IYD H;  4HN7 A;  3K8A A;  5GAD C;  3OSO A;  3OMG A;  2PZW A;  1AZP A;  3I8Z A;  4IN3 A;  2RA4 A;  1TKW B;  4A3J B;  4LFC Q;  2UXC Q;  1Q7Y C;  1S3O A;  2CH4 A;  3EFX D;  3KLW A;  3S9W A;  4IZ8 A;  4OX9 L;  4UP7 A;  3FPU B;  1TR5 A;  2PW7 A;  3ERS X;  5FO9 B;  2SDF A;  3VR6 A;  4I7A A;  1BBU A;  1LAC A;  2H1E A;  2VB3 X;  3STB D;  3TZD A;  1O7Z A;  3WOF A;  3NK9 A;  1I50 B;  2PCF B;  1YJW A;  5K36 G;  5IWA L;  3J81 c;  3K0X A;  1A8V A;  1RL2 A;  3GTQ B;  4TRD A;  1ASY A;  3UDI A;  2F0N A;  3S1R H;  3KF8 B;  4A3L H;  4GN3 B;  2E75 C;  4ME5 A;  5J1Z A;  1G51 A;  2D0O A;  2B2V A;  1B70 B;  1G29 1;  4PNY A;  3Q6S A;  1QWY A;  3HEJ A;  2NZ1 D;  1EY7 A;  4LUO A;  3T51 B;  2XRS D;  1PFM A;  1EIH A;  5IT9 E;  1BCP D;  2RSO A;  1WOC A;  1TWF B;  2AWN A;  5LMU L;  1CQV A;  1JOR A;  3W3A A;  1XNR Q;  2KJX A;  1BXT A;  5IYB G;  4EQ5 A;  1YVC A;  4ZAI A;  2L12 A;  2OQ0 A;  4DN4 M;  4B3M Q;  1PTO F;  1SNP A;  2D5D A;  2LS0 1;  3TP6 A;  5GRO A;  4J15 A;  1ZYR D;  3IKJ A;  5C3W A;  3S17 H;  2KUM A;  2N8N A;  3KF6 A;  5KYL A;  4X3T A;  3H3V C;  1XNQ Q;  1L0Y B;  2KCN A;  4XQN A;  1FNU A;  2VQF Q;  2NN6 I;  3TME A;  1HZC A;  3VA7 A;  2I5L X;  5C4X G;  4XQQ A;  1EQQ A;  1IZ6 A;  3S15 B;  2Y0S B;  2PQA B;  1KLG D;  3A5U A;  2CW0 D;  4YCV A;  3HKZ B;  3U58 A;  2EQS A;  1R4Q B;  2EOT A;  4WRD A;  5A2Q E;  1H9S B;  2X6L A;  3HOU G;  2IPK D;  2N78 A;  4LK1 C;  1RF2 D;  1GUT A;  5JOB A;  4DR1 Q;  1TT2 A;  3X3N A;  1FD7 D;  4A3D G;  3HOU B;  2BDN A;  1UE6 A;  3AYH B;  2L1B A;  2Q2U A;  4HCS A;  1JWS D;  2UXD Q;  1T5X D;  2FMC A;  4A93 G;  1L2F A;  3PO3 H;  3LWE A;  4A3D B;  2JA5 B;  1MJE A;  2A73 B;  4OO1 H;  4JOI A;  4JI8 L;  1NR4 A;  1SNC A;  1IL2 A;  2PMZ B;  3GTG B;  3UE1 A;  1CUK A;  4L6T B;  3OYY A;  4OWT B;  1ICW A;  2RKS A;  5C3E H;  1GVP A;  1LUZ A;  3Q24 A;  2JP1 A;  4K8J A;  4UPA A;  2QIL A;  3RZD B;  4JI0 L;  2GVA A;  2OQK A;  2OXP A;  3O13 A;  1YNX A;  3D6C A;  4MHE A;  4IUQ A;  2ICE C;  1SMY C;  5M5X B;  1JJC B;  2L55 A;  4KJN A;  2JA6 B;  4A4I A;  3E5S A;  1D2B A;  4P72 A;  4R4I A;  2RCF A;  4C3H G;  4POG A;  3NP8 A;  4RHR A;  3T4A C;  4CHT B;  4UP9 A;  1KAA A;  2OEO A;  1UEB A;  4H0L C;  3I4N B;  5C0X G;  3U4V A;  2BE5 C;  3NBI A;  1ILQ A;  3CCJ A;  3U9O A;  4N8F A;  4Y7N B;  3P20 A;  1HNZ L;  3KFU A;  4LFB Q;  1CTM A;  3F2U A;  3CAM A;  2CFM A;  2M9V A;  1U5K A;  5J3B A;  1PH4 A;  2QA4 A;  3QG1 A;  1FJG L;  1O7I A;  2I07 B;  1AZQ A;  4A3G H;  4OEL B;  4A3B B;  2PYK A;  3W1B A;  4Z9C B;  1DGS A;  2IWH A;  4MN3 A;  4HSP A;  2AQ3 B;  3NTH A;  2VB2 X;  4IUP A;  5IE8 A;  1X9N A;  4ZUI A;  1LTI D;  4GN5 A;  2A68 C;  4Q0F A;  1PYW D;  1Q86 C;  4B3S Q;  2RF4 A;  1DD2 A;  1Q3L A;  4OWX B;  4DV4 Q;  1PTO C;  4IAL A;  5JPN C;  3FKI H;  1CA6 A;  3PO2 G;  3GTJ H;  1I6H H;  1N32 L;  1N36 L;  4DV5 Q;  4F8M A;  4QGU A;  4X62 L;  1D5M C;  1PYB A;  5E4X A;  4DR4 L;  4IOA A;  4K14 A;  4BY1 G;  4QUF A;  3GTL H;  3PO2 B;  1PFB A;  2EY2 A;  2EY5 A;  5FK9 C;  4NXN Q;  1LTG D;  4R4T A;  1UUP A;  3EBE A;  2R92 G;  4QY7 A;  4B9W A;  4EQN A;  3S2D B;  1S5F D;  1H95 A;  3QR8 A;  1GXD C;  1E22 A;  4IJH A;  3HOY H;  4DV3 L;  4N8X 1;  1HTL D;  3NEN A;  2NZH A;  2EYF A;  4BS9 A;  2LY7 A;  1CHP D;  1Y8P B;  2MUY A;  1PZJ D;  1LT6 D;  1EOT A;  4DR2 L;  4ME3 A;  3HKS A;  2Z1C A;  1YNN C;  2AWO A;  1TS4 A;  3TP8 A;  2CH4 W;  3NUC A;  3M4Y A;  1SE2 A;  1WTP A;  4XXE A;  2B2T A;  2DN8 A;  1S5C D;  4NMZ A;  2F4V Q;  2A5H A;  5M3F B;  3KLR A;  3FVQ A;  5M3M H;  1GOZ A;  1TVX A;  3MA2 B;  4MTK A;  5I2X A;  1EQR A;  4MTN A;  1KIX A;  3G6E A;  4C3I B;  3SGI A;  2VL6 A;  4A3K B;  1XYI A;  1STG A;  1Y1V H;  3ERO A;  3VR4 A;  4E6I A;  3OW2 A;  3CD6 A;  1VQH A;  2LMC B;  4FO2 A;  3GD7 A;  1VQL A;  4XYQ A;  3W1G A;  4IPG A;  5FLX c;  5H1S E;  3J80 E;  4LF7 Q;  3MHB A;  3QB3 A;  3Q8D A;  2QDL A;  1VDZ A;  1PTO B;  1Z9F A;  1BVS A;  2MGS A;  1VQK A;  1ET6 A;  4DR7 Q;  4IPH A;  1NMF A;  1JIC A;  5C44 B;  1R9T B;  3VYR A;  1WTX A;  2ZJP A;  3NXW A;  1HZA A;  2F52 A;  1KDA A;  4GKK Q;  1CKN A;  3S16 H;  2XN9 C;  4PZ6 A;  3MEH A;  4JC0 A;  1C8C A;  1BUV T;  4OON A;  2XTI A;  1X54 A;  4B3R L;  1OXU A;  3HGB A;  5K5P A;  3VYS A;  4LFA Q;  3PCO B;  1D5X C;  4F88 A;  1VF5 C;  3A8K E;  3UDF A;  4DFA A;  1JWU D;  1W6J A;  1I6V C;  2IJ0 A;  4DR3 L;  2K75 A;  4DKA C;  5CV8 A;  4KJO A;  2NVT B;  1A2U A;  1EUJ A;  1LTT D;  1KAW A;  4JK1 C;  5G3L D;  5KEE A;  1VQ7 A;  4U67 3;  4A3F G;  3MAQ A;  3PQI A;  2A69 D;  2B63 H;  5CR3 A;  2E2H B;  4DU9 A;  3EIV A;  4CKB A;  1SYB A;  2RCN A;  2A6H C;  3I90 A;  2NN6 G;  2K7V A;  3V96 A;  4P71 A;  1HNX L;  1LTA D;  4B08 A;  2K32 A;  1UE5 A;  5K36 H;  1EWC A;  5JJI A;  2KQ3 A;  3ZJY C;  2MP1 A;  2D62 A;  3J80 i;  1HNW L;  1ENA A;  4CBV A;  1DCZ A;  1Y8O B;  4QJF A;  5GQO A;  5JJZ A;  1XMO Q;  3F8T A;  1FL0 A;  1I4G A;  2B2V C;  2NVX B;  2NB0 A;  3HOZ G;  2HCI A;  5LL6 S;  4IO9 A;  3I4O A;  4LF4 L;  4DUZ Q;  4CDE C;  2Q8I B;  4JI2 Q;  3MEF A;  4JI3 L;  3DWP A;  1C7Y A;  3J7A 5;  4GLX A;  1G91 A;  3GTO B;  1NCV A;  4JCV E;  4OHJ A;  5IGD A;  2EYL A;  1SYD A;  2FXQ A;  1XJV A;  2MHV A;  4BWG B;  1MHW C;  1SE3 A;  1QVC A;  4IFD I;  1ZXT A;  2H5X A;  3N6R A;  4NXM Q;  5JJL A;  4WOR A;  5C6A A;  3MXN B;  1WD0 A;  2N49 A;  4POF A;  1YHQ A;  4NKL A;  2ZM6 Q;  3D4D A;  4DNT B;  4RH6 A;  1J5E Q;  3HRZ C;  1VQG A;  5C4X H;  1E2V A;  3CPW A;  2MPM A;  1KXL A;  3HOX H;  3GTM H;  3TP7 A;  1DYQ A;  3W2D A;  1FYC A;  3JAM i;  4LF9 L;  2IX1 A;  3HOW H;  4IQZ A;  4C2M B;  2MFI A;  4X66 Q;  2ICI A;  3SK8 A;  2KEN A;  3SK5 A;  2OTJ A;  3FMC A;  4HMI A;  1K83 B;  1VQ4 A;  5BR8 L;  2I0Q A;  2WAQ E;  1MBY A;  2IX3 A;  2IT1 A;  1YZ6 A;  2SNM A;  2V1C C;  2YV5 A;  1N8R C;  1IHZ A;  1PH8 A;  2A6E C;  1Y1W G;  1CT1 D;  2D2C C;  5AJ3 Q;  3OTO Q;  3S24 A;  3S1M B;  1HPC A;  3I4M B;  4A93 H;  1PXU A;  4BBS G;  3J80 L;  4A75 A;  3CP0 A;  2O2L D;  3CC7 A;  4JOI C;  1Y1W B;  3G7L A;  2M2L A;  4K6D A;  1KLU D;  3QJY A;  4GNX B;  3K5N A;  4BBS B;  3S1N H;  3H3V I;  3BDL A;  3T1Y L;  1IBL Q;  2O4X A;  1GUN A;  4DAY A;  2UUB Q;  3NE5 B;  2E2I H;  2F1M A;  2C35 B;  4DV6 L;  3I72 A;  4UP8 A;  3MXG A;  1MI2 A;  1VQN A;  2UUA L;  2K5Q A;  1DON A;  1YHA A;  5KNB A;  4A3E B;  1NMG A;  1II3 A;  2E74 C;  4H7B A;  1KD1 C;  1D1K A;  4F87 A;  1VQO A;  4HTH A;  4JV5 Q;  1E3P A;  2K6A A;  2LXJ A;  4RGT A;  1TWA B;  1YNJ D;  5GAH C;  4C3H H;  2JA7 G;  4HID A;  5ELN A;  1VQA A;  2Q2H A;  5HUR A;  4LF6 L;  1V1O A;  1I3Q B;  2K52 A;  5C0X H;  5IP9 G;  5FLX E;  4X6A H;  4X64 Q;  4EX5 A; 
#chains in the Genus database with same CATH homology
 2JA7 B;  1IW7 C;  3C46 A;  1DM0 B;  1K8O A;  1KAB A;  1TII D;  3M4O B;  1IYV A;  2B8F A;  5CMD A;  4O42 A;  1GUW A;  1FNW A;  2K04 A;  2F0P A;  5E3F A;  1GUS A;  1TS5 A;  3EJI A;  1TY2 A;  2E76 C;  3DM1 A;  2KOL A;  5I9P A;  1FR3 A;  5EJW A;  3KLS X;  3SE0 A;  1LT5 D;  2CHB D;  1EZ6 A;  2J7Z A;  1VF7 A;  4ZLT F;  5DAU A;  3M3Y B;  2F0J A;  4RFB A;  3SEB A;  4JBW A;  3BYT B;  4QB4 A;  5CV4 A;  5DNF A;  5ELF A;  1HFG A;  1EY6 A;  2K01 A;  3UI2 A;  4BY7 B;  5E4W C;  1PRT C;  5IOD A;  4OIJ A;  2VXW A;  2CVR A;  5KNC A;  1BBX C;  5I6Y A;  3SDZ A;  2L9H A;  2F0D A;  3D3R A;  3AMU A;  5IGG A;  3AU7 A;  5IGB A;  2OT2 A;  3A8J E;  4KD3 A;  2EJF C;  2EYM A;  3TDQ A;  2EYJ A;  3S1Q B;  1D6E C;  2G9H D;  5IOC A;  4RKL A;  3GV3 A;  5EQ0 A;  1PDQ A;  3TN2 A;  4X3K A;  2HDL A;  1SEB D;  3R8B A;  3ZYY X;  4KY6 A;  2NVQ B;  4DNR B;  2X6G A;  1BDO A;  4ZUJ A;  4FF4 A;  1AEX A;  1AFP A;  4M8A A;  5EPK A;  2KA7 A;  4KN7 C;  1EIG A;  1MD2 D;  4XTC S;  1HQM C;  4R9W A;  1UNS A;  3M7G A;  1HHV A;  4RA8 A;  3R2T A;  5DEH A;  4EVO A;  1WTW A;  5NUC A;  1SSO A;  3EQL C;  1HQR D;  4K5V A;  4L8J A;  2OF1 A;  1MSG A;  5DM6 3;  1EYA A;  2QCP X;  1CA5 A;  3NWS A;  2JA8 B;  1KTK A;  3NBH A;  5IGE A;  4OGQ C;  1FNV A;  3NTK A;  5LHY 1;  2JEB I;  3ERQ A;  4HR7 B;  1TU2 B;  3VR5 A;  2NVY B;  1BO0 A;  4V0B A;  2J4X A;  2F0V A;  2VNU D;  4J6H A;  4FF1 A;  1AP0 A;  4K5X A;  4IFD G;  4KKS A;  1V8Q A;  1SAP A;  4YIJ A;  4FYD A;  5ISR A;  1ESF A;  2F0O A;  1G2S A;  3T16 A;  4DXG A;  5CBA E;  3MWY W;  4ZYS A;  3I3C A;  3ND8 A;  2DNC A;  4XQJ A;  2LKV A;  3OPO A;  5C4H A;  4L63 B;  3V05 A;  2FIN B;  1H9R A;  2E2J B;  4G4K A;  3NSW A;  3OIQ A;  1O78 A;  1JCK B;  4DF7 A;  5JEA H;  5CYU A;  4ZRZ A;  5CV6 A;  1A2T A;  2TSS A;  3ND9 A;  5JVG 3;  1I4Q A;  1MGS A;  1EYD A;  1B9M A;  1SMY D;  4ILW A;  4A3M B;  5CBE E;  1LTR D;  3SK4 A;  3J7Y W;  1WTR A;  2XSC A;  1E0B A;  4B9X A;  2F03 A;  5M5Y B;  2BE5 D;  1HFN A;  1TQO A;  3ONA B;  4IUT A;  3BS1 A;  3M85 A;  2VUM B;  2EYO A;  2E2D C;  1ESR A;  5KIX A;  1DJR D;  1K8M A;  3VR3 A;  3K5M A;  2SOB A;  5JEA J;  4EGV A;  3DEO A;  2ZXO A;  2A68 D;  3GO5 A;  4QMG A;  2R93 B;  1PTO D;  5COY A;  2F3V A;  2HDM A;  2HQE A;  1B1Z A;  1T5E A;  4CJ1 B;  5I2Y A;  3AB9 A;  3I70 A;  4KD4 A;  2EXZ A;  1HA6 A;  1SXT A;  4IUU A;  4C3J G;  1WCM B;  2K33 A;  3DWQ A;  3KF8 A;  5IT9 L;  2K28 A;  1HUN A;  3BVG A;  4C3J B;  1Z47 A;  3BZD B;  1KNE A;  3VA5 A;  4CJ2 C;  3P1H A;  1TWC B;  5T1I A;  1CQF A;  3IFT A;  1LT3 D;  1XXG A;  3PUY A;  5CV7 A;  3J81 E;  1V43 A;  3LNN A;  4RGM A;  4OL7 A;  1YNN D;  3DEP A;  4BBR B;  3OOC A;  2MJ8 A;  4KV6 A;  1GHK A;  5A2Q L;  4KN4 C;  5KYI A;  4EQO A;  3MXU A;  4QCL A;  3PMF A;  2F0L A;  4ODG A;  1JR0 D;  1BQQ T;  3T13 A;  2B2W A;  2EE1 A;  1H9S A;  4C3I G;  2L5T A;  1JB3 A;  4DAP A;  2O5J C;  4PMC A;  2B39 A;  1LT4 D;  1JOO A;  3PUX A;  2NWG A;  1ONL A;  5AFW A;  2TMP A;  5JVH 3;  4X3U A;  2H4O A;  3URY A;  2RVL A;  1HCZ A;  4ABN A;  2JSO A;  3I4L A;  3HG9 A;  4TKO B;  4XT3 B;  4HED A;  1QOH A;  5HGT A;  3TP5 A;  2Z8L A;  1EU4 A;  3ITP A;  3OIP A;  1VCI A;  3RMH A;  1DXM A;  3DMU A;  3S1R B;  3BDC A;  2LFN A;  2JE6 I;  2K05 A;  4UAI A;  1X3Q A;  2Q8R E;  4H44 C;  1EY9 A;  1C4Q A;  1JOK A;  5D3D A;  3IAY A;  4CGY B;  2WII B;  3VYU A;  1ENF A;  2BOS A;  5CV9 A;  4LMQ D;  4ULL A;  1ENC A;  2KED A;  3VYT A;  2NYZ D;  5COR A;  1LAB A;  5F2D A;  2FJ2 A;  1M8A A;  3P75 A;  5E1F A;  2EJM A;  1KDC A;  1EWH A;  1OXV A;  4CKC A;  2A6H D;  3S17 B;  1EFI D;  4U68 A;  1U4R A;  1EQV A;  3P7J A;  2B8G A;  5BN4 A;  1B9N A;  5FO8 B;  4FF3 A;  4FVM A;  2K03 A;  1D1I A;  3N52 A;  3WDN A;  1DOL A;  1RTN A;  3LWU A;  4QIW B;  2R3Z A;  4ZQ3 A;  3A55 A;  1RKN A;  2F0H A;  1S5B D;  1O7L A;  2RQX A;  1WVL A;  4I65 A;  1MSH A;  1Q8I A;  2N55 A;  2PO4 A;  5I4D A;  1V1P A;  1SJH D;  1SYC A;  4R8I A;  2D9U A;  3VR2 A;  1EEI D;  3PO3 B;  3C2P A;  4RGN A;  3A7A B;  2K5D A;  3J81 L;  3R2I A;  4ZK9 B;  3NQT A;  4C56 C;  3OWE B;  4EQP A;  1CI3 M;  1PLF A;  2K1B A;  2EY6 A;  3GV6 A;  1GUO A;  4N9T A;  1GHJ A;  5C3E B;  5FO7 B;  5LL6 X;  3L9A X;  1QG7 A;  2EYP A;  1Q1E A;  2O5I C;  4IFD H;  4KY7 A;  1OO9 B;  1PRT F;  2XNA C;  4RAU C;  2QEJ C;  5D3I B;  1GUG A;  4RCO A;  2A6E D;  1EZ8 A;  1BF4 A;  5ELB A;  2WAQ B;  3OWF A;  1SNQ A;  1UAP A;  1HTP A;  4KHZ A;  2B2Y A;  2PZT A;  3GQB A;  2WP8 J;  4C1N K;  4A3G B;  1ZKO A;  3PUZ A;  2ID0 A;  4PMB A;  3DUZ A;  3KUP A;  4R8N A;  5CC4 A;  1H9K A;  3D31 A;  3OMC A;  1B44 D;  2EPB A;  1SE4 A;  2KEC A;  2WIN B;  3FKI B;  1U4L A;  3PUW A;  2XRQ D;  3GTJ B;  1RDP D;  1Y8N B;  3R3O A;  1WTO A;  1I6H B;  3DHQ A;  3A7L A;  2RDF A;  3GTL B;  3KLS A;  4KTA A;  4RKB A;  1IW7 D;  5M9O A;  3QO2 A;  3HOV B;  2QKI C;  5TSS A;  3HOY B;  4HSV A;  2EDG A;  1ROD A;  1EY4 A;  2QDB A;  1JC7 A;  2XWB B;  4KKT A;  5ELE A;  2NTT A;  1H9M A;  4WFN 3;  4CJ0 B;  5EKL A;  3DXJ C;  4KK7 A;  1VMP A;  1HUM A;  1EQT A;  4DK0 A;  3FDT A;  2C9O A;  3X3M A;  3HP3 A;  1QB5 D;  1B50 A;  1QIL A;  5C0X J;  2F0U A;  5M3M B;  1Z6H A;  3MXP A;  2PZU A;  5KRU A;  1XWE A;  4I7Z C;  1TS2 A;  2FHT A;  4K2K A;  4XYO A;  3NTI A;  5C3X A;  5KGU A;  4K5W A;  3A8I E;  1Y1V B;  2KEE A;  1PRT D;  2Z4I A;  2JXM B;  1OXT A;  3GP7 A;  3RLF A;  3CRL C;  3MXN A;  4GZY C;  2L4N A;  4LJZ C;  3Q0A A;  3S16 B;  1ML0 D;  4X3S A;  4NDX A;  3SXH A;  1J9O A;  1HXY D;  3C1E A;  2B2T C;  3I73 A;  3NPP A;  3QWN A;  2B2W C;  1PZK D;  4XDX A;  1NUC A;  4FXD A;  1JOQ A;  2F0T A;  5DM7 3;  1PTO H;  1G8Z D;  4J8Q A;  5D14 A;  1CZG A;  5IGF A;  2B63 B;  4DK1 A;  1D5Z C;  3EA6 A;  3H94 A;  1F77 A;  4LAA A;  4FXK C;  5BN5 A;  3GTP B;  1Z7T A;  5EKI A;  2NBF A;  4DGZ A;  2IW3 A;  3NHH A;  1A3U A;  5FOB B;  1SDF A;  4FNF A;  5FLX L;  1I4X A;  1BCP C;  2PW5 A;  2F0E A;  1SYG A;  1PRT B;  1SYF A;  1B3A A;  2ENB A;  2PNR C;  1JE4 A;  1RTO A;  1ZYR C;  2SNS A;  5ELD A;  1XTC D;  3U9S A;  1TY0 A;  1B53 A;  2AQ2 B;  3J7A V;  1C48 A;  2AUJ D;  4KY5 A;  2NN6 H;  4RWS C;  2CW0 C;  2RSN A;  4J1M A;  4OO1 I;  5C4X B;  1S5D D;  1L0X B;  4G57 A;  1AN8 A;  3HOX B;  3GTM B;  4TQU S;  1WTV A;  1RHP A;  3D4W A;  3HOW B;  4OIK A;  4RHS A;  4F7X A;  2B2U A;  4H13 C;  1XX8 A;  1F9S A;  1STE A;  1M4V A;  3L7Z C;  4V19 0;  3Q23 A;  1WD1 A;  1ZEQ X;  4A93 B;  1F9R A;  1STH A;  1I4H A;  1EY0 A;  1IKL A;  4FP5 D;  2JEA I;  3BDO A;  3S1N B;  5EPJ A;  2WV6 D;  2RDG A;  2E2I B;  4O1N A;  5J22 A;  1VMC A;  1BCP B;  2N88 A;  1EY5 A;  1BR9 A;  2K5W A;  4N9P A;  4NW2 A;  3D6W A;  1IYU A;  5EBC A;  3KK7 A;  4WJW A;  1AW7 A;  3L3O C;  2HCC A;  2DNE A;  1LV9 A;  4C3H B;  4K2L A;  1KNA A;  3KBG A;  3T53 B;  2BDO A;  1LTB D;  1A3V A;  3E0J A;  5CGK A;  2F0K A;  1KDB A;  1ILP A;  2B2Y C;  4UDU C;  2R6G A;  2CQA A;  5JPM C;  1SJE D;  2ZT9 C;  1FGB D;  4KMU C;  1LTS D;  1CM9 A;  2KHS A;  1EY8 A;  5G3L F;  1CFM A;  3FPP A;  1Y69 U;  4A3I B;  1CHQ D;  2C5C A;  4XIG S;  1V1P B;  1DOM A;  4DA2 A;  2WKD A;  1I4R A;  5C4Z A;  2ZXR A;  2EJG C;  4HCE A;  4BY1 B;  3HZX A;  3A56 A;  2QF7 A;  2PQE A;  2G9D A;  3IFD A;  3M7N A;  2R92 B;  1STY A;  2YU9 B;  5C5M A;  4NP5 A;  1TS3 A;  2M00 A;  4ZKB B;  4CKE A;  1DOK A;  1F2Y A;  2A74 C;  4DAV A;  1QE6 A;  2FMM A;  2XWJ B;  1S4Z A;  2BCO A;  5J39 A;  5A35 A;  5C5L A;  4KHV A;  1SYE A;  1U9R A;  3TZU A;  1HRJ A;  2ZXP A;  1EU3 A;  2WAC A;  2AUK A;  3PV0 A;  3RZO B;  5EPL A;  2IL8 A;  2JYO A;  5IIF A;  3K58 A;  3CKI B;  3QIA A;  2KVM A;  3TBI B;  2HUG A;  3BG3 A;  1G2T A;  4XT1 B;  1LLR D;  4QUC A;  4AYB B;  4G7Z C;  1F2Z A;  5CV5 A;  5I6W A;  3MTS A;  3S14 B;  2EZV A;  1EEF D;  4DXF A;  3OW7 A;  1RD9 D;  3PIO 3;  3IL8 A;  1ET9 A;  3PUV A;  3H6M A;  1OXS C;  4TSS A;  3J7A F;  5BN3 A;  3H91 A;  3RUZ A;  3Q22 A;  4P2C B;  1A3T A;  2BA1 A;  4BA1 I;  1I4P A;  3LX0 A;  1NAP A;  1SNO A;  2RBM A;  3JAM E;  3C3L A;  2FFK B;  1H9J A;  1JQY D;  3K57 A;  1F9P A;  4QF4 A;  2A69 C;  2F0Q A;  3NWT A;  2F0W A;  1X3P A;  3H09 A;  4A3F B;  4FXG C;  4RGO S;  1BOS A;  1JWM D;  2Z4H A;  1TWG B;  1O80 A;  3SR1 A;  1NSN S;  2XIW A;  2R7Z B;  1DZ1 A;  1LO5 D;  2NTS A;  4OO1 G;  1BNZ A;  1B4O A;  4IUR A;  5IGC A;  3K5O A;  1U4M A;  3PIP 3;  2F0G A;  5C4J B;  1QJO A;  5JEA G;  1W6K A;  4IUV A;  3SVM A;  4Q5V A;  3DWA A;  2J0T D;  3I91 A;  3CRK C;  4KI0 A;  3CQZ B;  1G6Z A;  4BA2 I;  4K6L A;  2NUC A;  2L0C A;  5M5W B;  1X32 A;  2AQ1 B;  3HOZ B;  3C1F A;  2F3W A;  3FRP B;  1E2Z A;  1RJT A;  1J8I A;  5FKA C;  3V2T A;  2EY1 A;  3A54 A;  3K7A B;  2XVS A;  4ZKC B;  2RDH A;  1E2W A;  4ID6 A;  2KCC A;  1TWH B;  3SHL A;  1A6X A;  3K0Y A;  3D4R A;  1S5E D;  5I9O A;  4C1N I;  2SEB D;  2F0F A;  3QOL A;  1WTQ A;  5KND A;  4PV1 C;  1Q12 A;  3BVM A;  3K59 A;  1R4P B;  3CU7 A;  3MFG A;  1SNM A;  5EKK A;  4RCN A;  1Q1B A;  1NR2 A;  3NQI A;  4HMJ A;  5EGT A;  2B2U C;  2DY8 A;  1PZI D;  3HS0 C;  1SND A;  1F2M A;  3MFY A;  2PPB C;  4G7O C;  3MC0 B;  3CHB D;  4KKU A;  4G7H C;  1EYC A;  4IFD J;  3G6J B;  1QNU A;  4PMW A;  3TSS A;  1PFN A;  5C0X I;  2R61 A;  3RD4 A;  1F2L A;  4MIU A;  1U4P A;  4K8I A;  1QCB D;  1F9Q A;  1OXX K;  2DY7 A;  3E6Z X;  1STB A;  2GA4 B;  3GTK B;  2L11 A;  2F0M A;  1RCV D;  3KBX A;  1GJX A;  1YNJ C;  1IL8 A;  3D8G A;  3R93 A;  3H0G B;  1BCP F;  3MVV A;  3JAM L;  3SK6 A;  4M1U B;  1CZW A;  1SBB B;  4S3S A;  2F4I A;  2YYZ A;  4IUN A;  3BYY B;  1EL0 A;  2F0S A;  3WOE A;  2BA0 A;  4PQX A;  1SFO B;  5ELC A;  3K5L A;  1UEA B;  1CK1 A;  2X69 A;  2Q8T A;  3EVQ A;  3OHX C;  1IKM A;  5D65 A;  3T56 B;  1O7Y A;  1QNK A;  5EBD A;  1STA A;  3MZ5 A;  3BVZ A;  5JAV A;  3S2H B;  2F0I A;  3FEW X;  2V4D A;  4HAE A;  5T1G A;  3QOJ A;  2EYH A;  1Q90 A;  2EVB A;  2WB1 B;  2IX0 A;  1HA5 A;  1PMR A;  1B2T A;  1STN A;  3K6O A;  1A15 A;  2WKC A;  4FF2 A;  2I46 A;  4HN7 A;  3OSO A;  3OMG A;  2PZW A;  1AZP A;  3I8Z A;  4IN3 A;  2RA4 A;  1TKW B;  4A3J B;  3EFX D;  3S9W A;  4IZ8 A;  3FPU B;  1TR5 A;  2PW7 A;  5FO9 B;  2SDF A;  3VR6 A;  1LAC A;  2H1E A;  2VB3 X;  3WOF A;  3TZD A;  1O7Z A;  3NK9 A;  1I50 B;  2PCF B;  5K36 G;  3GTQ B;  4TRD A;  2F0N A;  2E75 C;  4ME5 A;  5J1Z A;  2B2V A;  1G29 1;  4PNY A;  3Q6S A;  1QWY A;  3HEJ A;  2NZ1 D;  1EY7 A;  3T51 B;  2XRS D;  1PFM A;  1EIH A;  5IT9 E;  1BCP D;  2RSO A;  1JOR A;  1TWF B;  2AWN A;  1CQV A;  3W3A A;  2KJX A;  1BXT A;  4ZAI A;  2L12 A;  4DN4 M;  1PTO F;  1SNP A;  2D5D A;  2LS0 1;  3TP6 A;  1ZYR D;  3IKJ A;  5C3W A;  2KUM A;  5KYL A;  4X3T A;  3H3V C;  1L0Y B;  2KCN A;  4XQN A;  1FNU A;  2NN6 I;  3TME A;  3VA7 A;  4XQQ A;  3S15 B;  2Y0S B;  1KLG D;  2CW0 D;  3HKZ B;  1R4Q B;  2EOT A;  4WRD A;  5A2Q E;  1H9S B;  2X6L A;  2IPK D;  4LK1 C;  1RF2 D;  1GUT A;  5JOB A;  1TT2 A;  3X3N A;  1FD7 D;  3HOU B;  2BDN A;  2L1B A;  4HCS A;  1JWS D;  1T5X D;  2FMC A;  4A3D B;  3LWE A;  2JA5 B;  2A73 B;  4OO1 H;  1NR4 A;  1SNC A;  2PMZ B;  3GTG B;  4L6T B;  1ICW A;  2RKS A;  3Q24 A;  2JP1 A;  4K8J A;  2QIL A;  3RZD B;  2OXP A;  3O13 A;  3D6C A;  4MHE A;  4IUQ A;  2ICE C;  1SMY C;  5M5X B;  2L55 A;  4KJN A;  2JA6 B;  3E5S A;  1D2B A;  4C3H G;  3NP8 A;  4RHR A;  3T4A C;  4CHT B;  1KAA A;  2OEO A;  4H0L C;  3I4N B;  5C0X G;  2BE5 C;  3NBI A;  1ILQ A;  3U9O A;  4Y7N B;  3P20 A;  1CTM A;  3F2U A;  2M9V A;  3QG1 A;  2I07 B;  1AZQ A;  4A3B B;  2PYK A;  4Z9C B;  2IWH A;  4MN3 A;  4HSP A;  2AQ3 B;  3NTH A;  2VB2 X;  4IUP A;  4ZUI A;  1LTI D;  2A68 C;  4Q0F A;  1PYW D;  1DD2 A;  1Q3L A;  1PTO C;  4IAL A;  5JPN C;  1CA6 A;  4F8M A;  1D5M C;  5E4X A;  4K14 A;  4QUF A;  3PO2 B;  1PFB A;  2EY2 A;  2EY5 A;  5FK9 C;  1LTG D;  1UUP A;  4B9W A;  4EQN A;  3S2D B;  1S5F D;  1GXD C;  1HTL D;  2EYF A;  4BS9 A;  2LY7 A;  1CHP D;  1Y8P B;  2MUY A;  1PZJ D;  1LT6 D;  1EOT A;  2Z1C A;  1YNN C;  2AWO A;  1TS4 A;  3TP8 A;  3NUC A;  3M4Y A;  1SE2 A;  1WTP A;  4XXE A;  2B2T A;  2DN8 A;  1S5C D;  4NMZ A;  2A5H A;  5M3F B;  3KLR A;  3FVQ A;  1GOZ A;  1TVX A;  3MA2 B;  5I2X A;  4C3I B;  4A3K B;  1XYI A;  4E6I A;  1STG A;  3ERO A;  3VR4 A;  2LMC B;  4FO2 A;  3GD7 A;  4XYQ A;  3J80 E;  3MHB A;  3QB3 A;  1VDZ A;  1PTO B;  2MGS A;  1ET6 A;  1JIC A;  5C44 B;  1R9T B;  3VYR A;  1WTX A;  3NXW A;  1KDA A;  2XN9 C;  3MEH A;  1C8C A;  1BUV T;  1OXU A;  3HGB A;  5K5P A;  3VYS A;  1D5X C;  4F88 A;  1VF5 C;  3A8K E;  4DFA A;  1JWU D;  1W6J A;  1I6V C;  2IJ0 A;  5CV8 A;  4KJO A;  2NVT B;  1A2U A;  1LTT D;  4JK1 C;  5G3L D;  5KEE A;  4U67 3;  3MAQ A;  2A69 D;  5CR3 A;  2E2H B;  4DU9 A;  4CKB A;  1SYB A;  2A6H C;  3I90 A;  2NN6 G;  2K7V A;  3V96 A;  1LTA D;  4B08 A;  2K32 A;  5K36 H;  1EWC A;  2KQ3 A;  2MP1 A;  2D62 A;  1ENA A;  4CBV A;  1DCZ A;  1Y8O B;  5JJZ A;  1I4G A;  2B2V C;  2NVX B;  2NB0 A;  2HCI A;  5LL6 S;  2Q8I B;  3DWP A;  1G91 A;  3GTO B;  1NCV A;  4OHJ A;  5IGD A;  2EYL A;  1SYD A;  2MHV A;  4BWG B;  1SE3 A;  4IFD I;  1ZXT A;  3N6R A;  4WOR A;  5C6A A;  1WD0 A;  4NKL A;  3D4D A;  4DNT B;  4RH6 A;  3HRZ C;  1E2V A;  2MPM A;  3TP7 A;  1DYQ A;  3W2D A;  1FYC A;  2IX1 A;  4IQZ A;  4C2M B;  2ICI A;  3SK8 A;  3SK5 A;  3FMC A;  4HMI A;  1K83 B;  1MBY A;  2IX3 A;  2IT1 A;  2SNM A;  1IHZ A;  2A6E C;  1CT1 D;  2D2C C;  3S1M B;  1HPC A;  3I4M B;  1PXU A;  3J80 L;  2O2L D;  1Y1W B;  3G7L A;  2M2L A;  4K6D A;  1KLU D;  3QJY A;  3K5N A;  4BBS B;  3BDL A;  2O4X A;  1GUN A;  4DAY A;  3NE5 B;  2F1M A;  3I72 A;  3MXG A;  1MI2 A;  2K5Q A;  1DON A;  5KNB A;  4A3E B;  1II3 A;  2E74 C;  4H7B A;  1D1K A;  4F87 A;  4HTH A;  2K6A A;  4RGT A;  1TWA B;  1YNJ D;  5HUR A;  1V1O A;  1I3Q B;  5C0X H;  5FLX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...