1PERL

The complex between phage 434 repression dna-binding domain and operator site or3: structural differences between consensus and non-consensus half-sites
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The complex between phage 434 repressor DNA-binding domain and operator site OR3: structural differences between consensus and non-consensus half-sites.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*AP*GP*TP*AP*CP*AP*GP*TP*TP*TP*TP*TP*CP*TP*TP*G
total genus 21
structure length 63
sequence length 63
chains with identical sequence R
ec nomenclature
pdb deposition date 1993-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1perL00
4O8BA 4JCXA 1WH8A 4X4FA 3QWGA 4MCTA 5A7LA 1QP4A 2AXZA 2EF8A 2LYRA 4J1XA 2D5VA 3CROL 3BS3A 1EFAA 2PUFA 1PNRA 1S7EA 3OQMA 3FYMA 3GBFA 3F52A 3SCFA 2PUBA 2BNNA 2PUEA 1DWKA 2LYPA 3DNVB 2WUSR 4I6RA 2A6CA 1Y9QA 3ZKCA 3OMTA 1PRUA 1QQAA 1WIZA 1NERA 2IUOA 2MQKA 3FYAA 3KJXA 1B0NA 3G7DA 4J1WA 3JXCL 1R69A 2ICPA 1BDHA 2CSFA 2AXUA 2LYSA 1UXCA 4FN3A 1JH9A 2L49A 3KZ3A 2XSDC 1RPEL 3OQOA 2BNMA 3FMYA 2O4AA 2FJRA 1AU7A 1E3OC 2AWIA 2AXVA 4PU3C 4I8TA 4Z5HA 2O38A 1RZSA 1OSLA 3U3WA 2LYLA 2B5AA 4Z5DA 2OR1L 4JQDA 4GHJA 3F51A 4X4BA 2PUCA 2JCGA 3B7HA 1ZZCA 3GN5B 4GQMA 1ZUGA 1PRVA 1ZS4A 2R63A 2EBYA 1LMB3 2ICTA 1RZRD 1PRAA 2WIUB 1R63A 1ZZ9A 3PXPA 4X4GA 2KEJA 1ZPQA 4FBIA 1IC8A 1ZVVA 2CROA 3ZHMA 1QQBA 3OP9A 2KEKA 3F6WA 1WH6A 4PU4C 2LYQA 3QYXA 3EUSA 1PERL 4Z5CA 4IWRA 1L1MA 2KZ8A 2JVLA 3LFPA 1JWLA 1QP0A 3SCHA 2PUGA 2LYKA 2KPJA 2IVGA 3R1FA 4I6TA 2AUWA 4OB4A 1O4XA 4Z58A 1YSEA 4Z59A 2LYJA 1CJGA 4X4EA 1RZRA 4PU7A 3LISA 4YG1A 1WETA 1QP7A 2HSGA 2HINA 1X2LA 4F8DA 1CQTA 1VPWA 1LCDA 2IV1A 2KEIA 1ZAYA 3SCGA 2L8NA 3BD1A 2XCJA 3S8QA 5K98B 1ZZ6A 2O49A 2GRMA 2PIJA 1UTXA 2XI8A 3G5GA 3CLCA 1NEQA 1QPZA 3QQ6A 2EWTA 4IVZA 2XJ3A 3GN5A 2PPXA 3H5TA 3QF3A 3RZZA 3ZHIA 2PE5A 1JFSA 1JFTA 2R1JL 2OFYA 3D1NI 2IVBA 1SQ8A 1Y7YA 2BJCA 1RIOA 1OCTC 3CECA 2IVQA 3JXDL 1ZZBA 1DW9A 4YG4A 4X4IA 4X4HA 2LCVA 3VK0A 4PU8A 1ADRA 4YG7B 4NDWA 2H8RA 1LCCA 3L1PA 4IA8A 1GT0C 2MEZA 3HZIB 2PUDA 3UFDA 3OQNA 2XIUA 2GZUA 2BNOA 3O9XA 1X57A 1LLIA 4JCYA 4Y42A 4YBAA 3KXAA 4YARA 4X4DA 3IVPA 1XWRA 2AW6A 2IU7A 1HF0A 2GRLA 3TRBA 1POUA 2PUAA 1ZZ8A 3JXBC 1LQCA 4I6UA 4MCXA 4X4CA 3BDNA 1BDIA 1ZZ7A 3MLFA 1UXDA
chains in the Genus database with same CATH superfamily
4X4FA 3QWGA 2JQEA 4EKIA 3DM5A 3BS3A 2LNMA 1PNRA 3NXHA 3OQMA 2BNNA 5DRTA 3DNVB 2A6CA 1Y9QA 3ZKCA 4Q2JA 1PRUA 1B0NA 2XXPA 2ICPA 4EK9A 2LYSA 1UXCA 2L49A 2PXUA 3OQOA 2BNMA 2FJRA 2AWIA 2AXVA 4PU3C 4I8TA 4OBMA 1RZSA 2VEOA 1OSLA 2LYLA 4GHJA 2M4HA 3GN5B 4GQMA 1ZUGA 1ZS4A 2ICTA 3A9XA 2MXDA 1ZZ9A 2KEJA 1IC8A 2KEKA 1WH6A 1PERL 1L1MA 3NROA 4Z58A 4Z59A 1QZXA 1DULA 4YG1A 4F8DA 1CQTA 2IV1A 2KEIA 3S8QA 1ZZ6A 3QOWA 3CLCA 3ZHIA 5DTQA 3QF3A 1JFSA 3D1NI 1SQ8A 3GUUA 4DE8A 1OCTC 2BJCA 3CECA 3R09A 1DW9A 4X4HA 3VK0A 4YG7B 4NDWA 4ER5A 1LCCA 2HFZA 2MEZA 3UFDA 3OQNA 2XIUA 3SR4A 3O9XA 4JCYA 4YBAA 4X4DA 1HF0A 3TRBA 4X4CA 1ZZ7A 5A7LA 4O8BA 4JCXA 1WH8A 4ER0A 2AXZA 2HCNA 2EF8A 1S7EA 2PUBA 3FYMA 2PUEA 2LYPA 2WUSR 4I6RA 3KJXA 2CSFA 1AU7A 4Z5HA 2ODRD 3G0TA 4JQDA 2JCGA 1PRVA 2EBYA 1LMB3 2WIUB 2HCSA 3PXPA 1ZVVA 2CROA 4PU4C 3QYXA 3EUSA 4Z5CA 4IWRA 3LFPA 1QP0A 2PUGA 3SCHA 2KPJA 2LYJA 3LQXA 4PU7A 1WETA 2HINA 3A9ZA 3SCGA 2PXQA 2PIJA 2XI8A 1NEQA 1QPZA 1NW3A 3RZZA 2IVQA 4X4IA 2LCVA 1ADRA 3A9YA 4IA8A 5JUWA 1GT0C 2GZUA 4EZIA 3KXAA 2LLVA 4I6UA 4MCXA 3ME5A 3BDNA 1UXDA 4EQZA 3CROL 2PUFA 3SCFA 3F52A 1DWKA 4ER3A 2YBDA 1QQAA 1NERA 1WIZA 2IUOA 3FYAA 3M9LA 3VWSA 3G7DA 4J1WA 3JXCL 4FN3A 1RPEL 2XSDC 2O4AA 1E3OC 2O38A 4ER7A 2OR1L 3F51A 3B7HA 1ZZCA 1RZRD 1PRAA 4X4GA 1ZPQA 4FBIA 2LLWA 3ZHMA 1QQBA 1HQ1A 2V3CC 2LYQA 2JVLA 1JWLA 5GAGi 3R1FA 3TELA 1QP7A 2PXTA 1U2ZA 1LCDA 2L8NA 3BD1A 1QB2A 2XCJA 5K98B 2GRMA 2PXEA 3KL4A 1UTXA 3G5GA 4EKGA 2PXFA 3ZPXA 3GZCA 2XJ3A 3H5TA 1JFTA 2R1JL 2J7WA 3GZDC 2XXAA 4YG4A 2H8RA 3L1PA 5DSXA 4Y42A 2PXVA 3QOXA 1XWRA 2PUAA 1LQCA 2PXPA 3TFLA 1BDIA 3OWQA 4MCTA 1QP4A 2LYRA 4J1XA 2D5VA 1EFAA 4DE9A 3GBFA 3OMTA 2MQKA 3PE5A 1R69A 1BDHA 2AXUA 1JH9A 3KZ3A 3FMYA 3U3WA 2B5AA 4Z5DA 2PXKA 2PUCA 4X4BA 2L1PA 2R63A 1MFQC 1R63A 3OP9A 3F6WA 3NDBB 3SX0A 3TEPA 3NZLA 2KZ8A 2LYKA 2IVGA 4I6TA 2AUWA 4OB4A 3OKZA 1O4XA 2J7UA 1YSEA 1CJGA 4X4EA 1RZRA 5DTRA 3LISA 3MEJA 2HSGA 1X2LA 1VPWA 3GZDA 2PXBA 1ZAYA 2PXLA 2O49A 5DRYA 4WVLA 5DTMA 3QQ6A 2EWTA 4IVZA 3GN5A 4HRAA 2PPXA 2PXDA 2PE5A 2OFYA 2IVBA 1Y7YA 1RIOA 3JXDL 1ZZBA 3UWPA 4ER6A 4PU8A 3HZIB 2PUDA 5GAHi 2BNOA 2XXQA 1X57A 1LLIA 4YARA 3IVPA 5DT2A 2FFHA 2AW6A 2IU7A 2GRLA 1POUA 1ZZ8A 3QFIA 3JXBC 3MLFA
chains in the Genus database with same CATH topology
4O8BA 4JCXA 1WH8A 4X4FA 3QWGA 4MCTA 5A7LA 1QP4A 2AXZA 2EF8A 2LYRA 4J1XA 2D5VA 3CROL 3BS3A 1EFAA 2PUFA 1PNRA 1S7EA 3OQMA 3FYMA 3GBFA 3F52A 3SCFA 2PUBA 2BNNA 2PUEA 1DWKA 2LYPA 3DNVB 2WUSR 4I6RA 2A6CA 1Y9QA 3ZKCA 3OMTA 1PRUA 1QQAA 1WIZA 1NERA 2IUOA 2MQKA 3FYAA 3KJXA 1B0NA 3G7DA 4J1WA 3JXCL 1R69A 2ICPA 1BDHA 2CSFA 2AXUA 2LYSA 1UXCA 4FN3A 1JH9A 2L49A 3KZ3A 2XSDC 1RPEL 3OQOA 2BNMA 3FMYA 2O4AA 2FJRA 1AU7A 1E3OC 2AWIA 2AXVA 4PU3C 4I8TA 4Z5HA 2O38A 1RZSA 1OSLA 3U3WA 2LYLA 2B5AA 4Z5DA 2OR1L 4JQDA 4GHJA 3F51A 4X4BA 2PUCA 2JCGA 3B7HA 1ZZCA 3GN5B 4GQMA 1ZUGA 1PRVA 1ZS4A 2R63A 2EBYA 1LMB3 2ICTA 1RZRD 1PRAA 2WIUB 1R63A 1ZZ9A 3PXPA 4X4GA 2KEJA 1ZPQA 4FBIA 1IC8A 1ZVVA 2CROA 3ZHMA 1QQBA 3OP9A 2KEKA 3F6WA 1WH6A 4PU4C 2LYQA 3QYXA 3EUSA 1PERL 4Z5CA 4IWRA 1L1MA 2KZ8A 2JVLA 3LFPA 1JWLA 1QP0A 3SCHA 2PUGA 2LYKA 2KPJA 2IVGA 3R1FA 4I6TA 2AUWA 4OB4A 1O4XA 4Z58A 1YSEA 4Z59A 2LYJA 1CJGA 4X4EA 1RZRA 4PU7A 3LISA 4YG1A 1WETA 1QP7A 2HSGA 2HINA 1X2LA 4F8DA 1CQTA 1VPWA 1LCDA 2IV1A 2KEIA 1ZAYA 3SCGA 2L8NA 3BD1A 2XCJA 3S8QA 5K98B 1ZZ6A 2O49A 2GRMA 2PIJA 1UTXA 2XI8A 3G5GA 3CLCA 1NEQA 1QPZA 3QQ6A 2EWTA 4IVZA 2XJ3A 3GN5A 2PPXA 3H5TA 3QF3A 3RZZA 3ZHIA 2PE5A 1JFSA 1JFTA 2R1JL 2OFYA 3D1NI 2IVBA 1SQ8A 1Y7YA 2BJCA 1RIOA 1OCTC 3CECA 2IVQA 3JXDL 1ZZBA 1DW9A 4YG4A 4X4IA 4X4HA 2LCVA 3VK0A 4PU8A 1ADRA 4YG7B 4NDWA 2H8RA 1LCCA 3L1PA 4IA8A 1GT0C 2MEZA 3HZIB 2PUDA 3UFDA 3OQNA 2XIUA 2GZUA 2BNOA 3O9XA 1X57A 1LLIA 4JCYA 4Y42A 4YBAA 3KXAA 4YARA 4X4DA 3IVPA 1XWRA 2AW6A 2IU7A 1HF0A 2GRLA 3TRBA 1POUA 2PUAA 1ZZ8A 3JXBC 1LQCA 4I6UA 4MCXA 4X4CA 3BDNA 1BDIA 1ZZ7A 3MLFA 1UXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8B A;  4JCX A;  1WH8 A;  4X4F A;  3QWG A;  4MCT A;  5A7L A;  1QP4 A;  2AXZ A;  2EF8 A;  2LYR A;  4J1X A;  2D5V A;  3CRO L;  3BS3 A;  1EFA A;  2PUF A;  1PNR A;  1S7E A;  3OQM A;  3FYM A;  3GBF A;  3F52 A;  3SCF A;  2PUB A;  2BNN A;  2PUE A;  1DWK A;  2LYP A;  3DNV B;  2WUS R;  4I6R A;  2A6C A;  1Y9Q A;  3ZKC A;  3OMT A;  1PRU A;  1QQA A;  1WIZ A;  1NER A;  2IUO A;  2MQK A;  3FYA A;  3KJX A;  1B0N A;  3G7D A;  4J1W A;  3JXC L;  1R69 A;  2ICP A;  1BDH A;  2CSF A;  2AXU A;  2LYS A;  1UXC A;  4FN3 A;  1JH9 A;  2L49 A;  3KZ3 A;  2XSD C;  1RPE L;  3OQO A;  2BNM A;  3FMY A;  2O4A A;  2FJR A;  1AU7 A;  1E3O C;  2AWI A;  2AXV A;  4PU3 C;  4I8T A;  4Z5H A;  2O38 A;  1RZS A;  1OSL A;  3U3W A;  2LYL A;  2B5A A;  4Z5D A;  2OR1 L;  4JQD A;  4GHJ A;  3F51 A;  4X4B A;  2PUC A;  2JCG A;  3B7H A;  1ZZC A;  3GN5 B;  4GQM A;  1ZUG A;  1PRV A;  1ZS4 A;  2R63 A;  2EBY A;  1LMB 3;  2ICT A;  1RZR D;  1PRA A;  2WIU B;  1R63 A;  1ZZ9 A;  3PXP A;  4X4G A;  2KEJ A;  1ZPQ A;  4FBI A;  1IC8 A;  1ZVV A;  2CRO A;  3ZHM A;  1QQB A;  3OP9 A;  2KEK A;  3F6W A;  1WH6 A;  4PU4 C;  2LYQ A;  3QYX A;  3EUS A;  1PER L;  4Z5C A;  4IWR A;  1L1M A;  2KZ8 A;  2JVL A;  3LFP A;  1JWL A;  1QP0 A;  3SCH A;  2PUG A;  2LYK A;  2KPJ A;  2IVG A;  3R1F A;  4I6T A;  2AUW A;  4OB4 A;  1O4X A;  4Z58 A;  1YSE A;  4Z59 A;  2LYJ A;  1CJG A;  4X4E A;  1RZR A;  4PU7 A;  3LIS A;  4YG1 A;  1WET A;  1QP7 A;  2HSG A;  2HIN A;  1X2L A;  4F8D A;  1CQT A;  1VPW A;  1LCD A;  2IV1 A;  2KEI A;  1ZAY A;  3SCG A;  2L8N A;  3BD1 A;  2XCJ A;  3S8Q A;  5K98 B;  1ZZ6 A;  2O49 A;  2GRM A;  2PIJ A;  1UTX A;  2XI8 A;  3G5G A;  3CLC A;  1NEQ A;  1QPZ A;  3QQ6 A;  2EWT A;  4IVZ A;  2XJ3 A;  3GN5 A;  2PPX A;  3H5T A;  3QF3 A;  3RZZ A;  3ZHI A;  2PE5 A;  1JFS A;  1JFT A;  2R1J L;  2OFY A;  3D1N I;  2IVB A;  1SQ8 A;  1Y7Y A;  2BJC A;  1RIO A;  1OCT C;  3CEC A;  2IVQ A;  3JXD L;  1ZZB A;  1DW9 A;  4YG4 A;  4X4I A;  4X4H A;  2LCV A;  3VK0 A;  4PU8 A;  1ADR A;  4YG7 B;  4NDW A;  2H8R A;  1LCC A;  3L1P A;  4IA8 A;  1GT0 C;  2MEZ A;  3HZI B;  2PUD A;  3UFD A;  3OQN A;  2XIU A;  2GZU A;  2BNO A;  3O9X A;  1X57 A;  1LLI A;  4JCY A;  4Y42 A;  4YBA A;  3KXA A;  4YAR A;  4X4D A;  3IVP A;  1XWR A;  2AW6 A;  2IU7 A;  1HF0 A;  2GRL A;  3TRB A;  1POU A;  2PUA A;  1ZZ8 A;  3JXB C;  1LQC A;  4I6U A;  4MCX A;  4X4C A;  3BDN A;  1BDI A;  1ZZ7 A;  3MLF A;  1UXD A; 
#chains in the Genus database with same CATH topology
 4X4F A;  3QWG A;  2JQE A;  4EKI A;  3DM5 A;  3BS3 A;  2LNM A;  1PNR A;  3NXH A;  3OQM A;  2BNN A;  5DRT A;  3DNV B;  2A6C A;  1Y9Q A;  3ZKC A;  4Q2J A;  1PRU A;  1B0N A;  2XXP A;  2ICP A;  4EK9 A;  2LYS A;  1UXC A;  2L49 A;  2PXU A;  3OQO A;  2BNM A;  2FJR A;  2AWI A;  2AXV A;  4PU3 C;  4I8T A;  4OBM A;  1RZS A;  2VEO A;  1OSL A;  2LYL A;  4GHJ A;  2M4H A;  3GN5 B;  4GQM A;  1ZUG A;  1ZS4 A;  2ICT A;  3A9X A;  2MXD A;  1ZZ9 A;  2KEJ A;  1IC8 A;  2KEK A;  1WH6 A;  1PER L;  1L1M A;  3NRO A;  4Z58 A;  4Z59 A;  1QZX A;  1DUL A;  4YG1 A;  4F8D A;  1CQT A;  2IV1 A;  2KEI A;  3S8Q A;  1ZZ6 A;  3QOW A;  3CLC A;  3ZHI A;  5DTQ A;  3QF3 A;  1JFS A;  3D1N I;  1SQ8 A;  3GUU A;  4DE8 A;  1OCT C;  2BJC A;  3CEC A;  3R09 A;  1DW9 A;  4X4H A;  3VK0 A;  4YG7 B;  4NDW A;  4ER5 A;  1LCC A;  2HFZ A;  2MEZ A;  3UFD A;  3OQN A;  2XIU A;  3SR4 A;  3O9X A;  4JCY A;  4YBA A;  4X4D A;  1HF0 A;  3TRB A;  4X4C A;  1ZZ7 A;  5A7L A;  4O8B A;  4JCX A;  1WH8 A;  4ER0 A;  2AXZ A;  2HCN A;  2EF8 A;  1S7E A;  2PUB A;  3FYM A;  2PUE A;  2LYP A;  2WUS R;  4I6R A;  3KJX A;  2CSF A;  1AU7 A;  4Z5H A;  2ODR D;  3G0T A;  4JQD A;  2JCG A;  1PRV A;  2EBY A;  1LMB 3;  2WIU B;  2HCS A;  3PXP A;  1ZVV A;  2CRO A;  4PU4 C;  3QYX A;  3EUS A;  4Z5C A;  4IWR A;  3LFP A;  1QP0 A;  2PUG A;  3SCH A;  2KPJ A;  2LYJ A;  3LQX A;  4PU7 A;  1WET A;  2HIN A;  3A9Z A;  3SCG A;  2PXQ A;  2PIJ A;  2XI8 A;  1NEQ A;  1QPZ A;  1NW3 A;  3RZZ A;  2IVQ A;  4X4I A;  2LCV A;  1ADR A;  3A9Y A;  4IA8 A;  5JUW A;  1GT0 C;  2GZU A;  4EZI A;  3KXA A;  2LLV A;  4I6U A;  4MCX A;  3ME5 A;  3BDN A;  1UXD A;  4EQZ A;  3CRO L;  2PUF A;  3SCF A;  3F52 A;  1DWK A;  4ER3 A;  2YBD A;  1QQA A;  1NER A;  1WIZ A;  2IUO A;  3FYA A;  3M9L A;  3VWS A;  3G7D A;  4J1W A;  3JXC L;  4FN3 A;  1RPE L;  2XSD C;  2O4A A;  1E3O C;  2O38 A;  4ER7 A;  2OR1 L;  3F51 A;  3B7H A;  1ZZC A;  1RZR D;  1PRA A;  4X4G A;  1ZPQ A;  4FBI A;  2LLW A;  3ZHM A;  1QQB A;  1HQ1 A;  2V3C C;  2LYQ A;  2JVL A;  1JWL A;  5GAG i;  3R1F A;  3TEL A;  1QP7 A;  2PXT A;  1U2Z A;  1LCD A;  2L8N A;  3BD1 A;  1QB2 A;  2XCJ A;  5K98 B;  2GRM A;  2PXE A;  3KL4 A;  1UTX A;  3G5G A;  4EKG A;  2PXF A;  3ZPX A;  3GZC A;  2XJ3 A;  3H5T A;  1JFT A;  2R1J L;  2J7W A;  3GZD C;  2XXA A;  4YG4 A;  2H8R A;  3L1P A;  5DSX A;  4Y42 A;  2PXV A;  3QOX A;  1XWR A;  2PUA A;  1LQC A;  2PXP A;  3TFL A;  1BDI A;  3OWQ A;  4MCT A;  1QP4 A;  2LYR A;  4J1X A;  2D5V A;  1EFA A;  4DE9 A;  3GBF A;  3OMT A;  2MQK A;  3PE5 A;  1R69 A;  1BDH A;  2AXU A;  1JH9 A;  3KZ3 A;  3FMY A;  3U3W A;  2B5A A;  4Z5D A;  2PXK A;  2PUC A;  4X4B A;  2L1P A;  2R63 A;  1MFQ C;  1R63 A;  3OP9 A;  3F6W A;  3NDB B;  3SX0 A;  3TEP A;  3NZL A;  2KZ8 A;  2LYK A;  2IVG A;  4I6T A;  2AUW A;  4OB4 A;  3OKZ A;  1O4X A;  2J7U A;  1YSE A;  1CJG A;  4X4E A;  1RZR A;  5DTR A;  3LIS A;  3MEJ A;  2HSG A;  1X2L A;  1VPW A;  3GZD A;  2PXB A;  1ZAY A;  2PXL A;  2O49 A;  5DRY A;  4WVL A;  5DTM A;  3QQ6 A;  2EWT A;  4IVZ A;  3GN5 A;  4HRA A;  2PPX A;  2PXD A;  2PE5 A;  2OFY A;  2IVB A;  1Y7Y A;  1RIO A;  3JXD L;  1ZZB A;  3UWP A;  4ER6 A;  4PU8 A;  3HZI B;  2PUD A;  5GAH i;  2BNO A;  2XXQ A;  1X57 A;  1LLI A;  4YAR A;  3IVP A;  5DT2 A;  2FFH A;  2AW6 A;  2IU7 A;  2GRL A;  1POU A;  1ZZ8 A;  3QFI A;  3JXB C;  3MLF A; 
#chains in the Genus database with same CATH homology
 4O8B A;  4JCX A;  1WH8 A;  4X4F A;  3QWG A;  4MCT A;  5A7L A;  1QP4 A;  2AXZ A;  2EF8 A;  2LYR A;  4J1X A;  2D5V A;  3CRO L;  3BS3 A;  1EFA A;  2PUF A;  1PNR A;  1S7E A;  3OQM A;  3FYM A;  3GBF A;  3F52 A;  3SCF A;  2PUB A;  2BNN A;  2PUE A;  1DWK A;  2LYP A;  3DNV B;  2WUS R;  4I6R A;  2A6C A;  1Y9Q A;  3ZKC A;  3OMT A;  1PRU A;  1QQA A;  1WIZ A;  1NER A;  2IUO A;  2MQK A;  3FYA A;  3KJX A;  1B0N A;  3G7D A;  4J1W A;  3JXC L;  1R69 A;  2ICP A;  1BDH A;  2CSF A;  2AXU A;  2LYS A;  1UXC A;  4FN3 A;  1JH9 A;  2L49 A;  3KZ3 A;  2XSD C;  1RPE L;  3OQO A;  2BNM A;  3FMY A;  2O4A A;  2FJR A;  1AU7 A;  1E3O C;  2AWI A;  2AXV A;  4PU3 C;  4I8T A;  4Z5H A;  2O38 A;  1RZS A;  1OSL A;  3U3W A;  2LYL A;  2B5A A;  4Z5D A;  2OR1 L;  4JQD A;  4GHJ A;  3F51 A;  4X4B A;  2PUC A;  2JCG A;  3B7H A;  1ZZC A;  3GN5 B;  4GQM A;  1ZUG A;  1PRV A;  1ZS4 A;  2R63 A;  2EBY A;  1LMB 3;  2ICT A;  1RZR D;  1PRA A;  2WIU B;  1R63 A;  1ZZ9 A;  3PXP A;  4X4G A;  2KEJ A;  1ZPQ A;  4FBI A;  1IC8 A;  1ZVV A;  2CRO A;  3ZHM A;  1QQB A;  3OP9 A;  2KEK A;  3F6W A;  1WH6 A;  4PU4 C;  2LYQ A;  3QYX A;  3EUS A;  1PER L;  4Z5C A;  4IWR A;  1L1M A;  2KZ8 A;  2JVL A;  3LFP A;  1JWL A;  1QP0 A;  3SCH A;  2PUG A;  2LYK A;  2KPJ A;  2IVG A;  3R1F A;  4I6T A;  2AUW A;  4OB4 A;  1O4X A;  4Z58 A;  1YSE A;  4Z59 A;  2LYJ A;  1CJG A;  4X4E A;  1RZR A;  4PU7 A;  3LIS A;  4YG1 A;  1WET A;  1QP7 A;  2HSG A;  2HIN A;  1X2L A;  4F8D A;  1CQT A;  1VPW A;  1LCD A;  2IV1 A;  2KEI A;  1ZAY A;  3SCG A;  2L8N A;  3BD1 A;  2XCJ A;  3S8Q A;  5K98 B;  1ZZ6 A;  2O49 A;  2GRM A;  2PIJ A;  1UTX A;  2XI8 A;  3G5G A;  3CLC A;  1NEQ A;  1QPZ A;  3QQ6 A;  2EWT A;  4IVZ A;  2XJ3 A;  3GN5 A;  2PPX A;  3H5T A;  3QF3 A;  3RZZ A;  3ZHI A;  2PE5 A;  1JFS A;  1JFT A;  2R1J L;  2OFY A;  3D1N I;  2IVB A;  1SQ8 A;  1Y7Y A;  2BJC A;  1RIO A;  1OCT C;  3CEC A;  2IVQ A;  3JXD L;  1ZZB A;  1DW9 A;  4YG4 A;  4X4I A;  4X4H A;  2LCV A;  3VK0 A;  4PU8 A;  1ADR A;  4YG7 B;  4NDW A;  2H8R A;  1LCC A;  3L1P A;  4IA8 A;  1GT0 C;  2MEZ A;  3HZI B;  2PUD A;  3UFD A;  3OQN A;  2XIU A;  2GZU A;  2BNO A;  3O9X A;  1X57 A;  1LLI A;  4JCY A;  4Y42 A;  4YBA A;  3KXA A;  4YAR A;  4X4D A;  3IVP A;  1XWR A;  2AW6 A;  2IU7 A;  1HF0 A;  2GRL A;  3TRB A;  1POU A;  2PUA A;  1ZZ8 A;  3JXB C;  1LQC A;  4I6U A;  4MCX A;  4X4C A;  3BDN A;  1BDI A;  1ZZ7 A;  3MLF A;  1UXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...