1PF3A

Crystal structure of the m441l mutant of the multicopper oxidase cueo
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
486
structure length
463
Chain Sequence
RPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMLLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Labile Regulatory Copper Ion Lies Near the T1 Copper Site in the Multicopper Oxidase CueO.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 133
structure length 463
sequence length 486
ec nomenclature
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pf3A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pf3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pf3A03
3FS9A 2HX8A 4TXVB 1QNIA 2CUAA 2HLEB 4WTQA 4KO7A 4BWUA 1SNRA 3FPXA 3TBBA 2DY2A 1FWXA 3AG1B 4GY4A 2Q5BA 1NIDA 1EZLA 1OCCB 2IWKA 2DWTA 4DP7X 3S3BB 4G7QB 2YAPA 4NB7A 1CYXA 1KBVA 2PPCA 2PP9A 4DP1X 2IDTA 4G71B 4HHWA 4DPBX 3EH4B 5I6KA 1BQRA 1CUOA 1ZDQA 3MBWB 2AVFA 2HX7A 1KBWA 3MX0B 4G72B 4HAKA 4DP2X 5I28A 2HX9A 1AQ8A 1E5YA 2YAEA 1DYZA 2XV2A 1KV7A 1OOWA 3SBRA 5PAZA 5I6LA 4A2HA 3JT2A 2VW4A 4F2EA 1J5DA 1OE2A 4Q8BA 3FQ1A 3ASOB 3IN2A 1ZIBA 3T71A 1E5ZA 3T6XA 1ASQA 4EF3A 2OV0A 1XB3A 2BZ7A 1AZNA 3QJUB 2BWDA 2FT6A 3S8FB 3N55A 1AZCA 1L9RA 1URIA 2I7SA 2ZOOA 3X2QB 4WKXA 5D4IA 4NERA 2TSBA 2W8CA 3OQRA 4HCIA 4PAZA 1ILUA 1F56A 2YAQA 1AS7A 1GS6X 4E9TA 1JZGA 1JZFA 1NIFA 1BYOA 2FQDA 3U25A 4GP5B 3EHBB 3G5WA 1E30A 2IWFA 3IBOA 5B3SB 1PF3A 2ZXWB 3SBPA 1AZUA 2J56A 4AKOA 1M56B 1NPJA 2DWSA 2GHZA 2GBAA 3V9CA 4YSEA 4JKNA 4DP0X 2UX7A 2CBPA 1J9QA 1BAWA 1A8ZA 3OD3A 1IKOP 4M3HA 2AFNA 4YSOA 3X1FA 3FYIB 5AFAA 1JZIA 4JHUA 1JXDA 3BVDB 4HCFA 1WS7A 3FSWA 2VW7A 2W88A 4YSUA 2BO0A 4BK5C 1J9RA 2E86A 2IAAC 2XV0A 3QJSB 1V54B 2X88A 3CVBA 1E67A 1SF3A 3FU9A 3T6ZA 1OF0A 1ZIAA 3NSDA 5B1JA 2VW6A 5EHFA 2BZCA 1E65A 1NTDA 2PP7A 1KDIA 2XU9A 3ABGA 5I26A 2YXWA 5D4HA 1PNDA 3FU7B 5I6MA 4N4YB 2HRGA 2FQGA 1GS7A 2QPDB 4A2GA 3NJHA 4A2FA 2R7EB 1WA1X 3BQVA 1JZJA 3FT0A 2UXTA 2PCYA 5PCYA 4KNTA 2QDWA 5I5IA 2MTAA 3QJRB 1TKWA 3X1NA 1BXVA 3FSZA 2BWIA 4KO5A 1OCOB 4AZUA 5FC9A 4KO9A 3X1BA 5B1BB 2XUWA 3X1GA 1TEGA 3WNIA 1GY1A 1GW0A 1L9PA 2HRHA 3KW7A 4W1TA 1GS8A 3GXUB 3S3DB 1VLXA 2RACA 2DV6A 4E9SA 3SBQA 4KO6A 4KOBA 3UADA 2JXMA 3ABLB 2LLNA 2XXGA 1AZRA 1N70A 3WIAA 1W6WA 3ZX1A 3NSFA 1PMYA 2VMJA 1JZHA 2BW5A 2EIKB 4MFHA 1MG2C 3CVCA 4DPCX 3TBCA 3PXLA 4DP4X 1A4CA 1BYPA 3NSYA 1JOIA 1SHXA 3ABKB 1M57B 2BP8A 2H3XC 1SF5A 3OM3B 5AKRA 2DYRB 3KW8A 1PZAA 1XMEB 4FAAB 1JERA 2DYSB 2HXAA 3AG2B 3L45A 3TASA 2GSMB 2UXFA 4DP6X 1IC0A 1OE1A 2IDSA 2XWZA 5I5JA 6PAZA 7PCYA 2EIJB 3UAAA 1SFDA 4YSQA 1JVLA 3UABA 3H4HA 1ADWA 5AZUA 4UF7C 3EH3B 1R1CA 4GYBA 4BXSV 6PCYA 3NJIA 1L9SA 3T9WA 1JXGA 1SFHA 1ET5A 3WKQA 1PLBA 2B3IA 4L0PB 4QKTA 2XX1A 4E9RA 2XX0A 4A68A 1YLBB 2FQFA 3FSVA 4GP8B 3S8GB 3HEIB 4YSSA 5I6PA 2FT8A 4E9YA 3DKHA 7PAZA 2YAHA 1MDAA 1A65A 1KGYE 3NP3A 3AY2A 4HHGA 3CDZB 3ZBMA 1HFUA 4BDVB 4M4RB 1CYWA 2EIMB 4X4KA 3UACA 4A2DA 2FJSA 1ILSA 5E9NA 4KOCA 2PPAA 1X9UA 1JVOA 1AG6A 2YXVA 4YSTA 4YSCA 3FU7A 1V55B 3PCYA 2GI0A 4A66A 8PAZA 2QPEB 2UXGA 4YSDA 4NAJA 3PAVA 5LDUA 1J5CA 3D12B 1A4BA 5I5MA 4YSRA 3FPYA 1AIZA 1AR1B 1A4AA 4A2EA 5B7EA 1JZEA 2WO2B 5F7AA 2BP0B 1KCBA 3OMAB 3FQ2A 2WO3B 5ANHA 3NYKA 4YSPA 1NIEA 3PPSA 1NWOA 5B1AB 3QJTB 1DZ0A 3DTUB 1AACA 3JTBA 3NJFA 2YAOA 2IH9A 4YSAA 1TEFA 2J57A 5I6NA 4UAHA 4DPAX 3X1EA 1FFTB 1RCYA 2ZONA 5D4JA 4P5SA 2XLLA 2ZWNA 1JXFA 1AS6A 3CVDA 3DIVA 5F7BA 4ENZA 4ZK8A 1PY0A 1ASPA 5B1JC 3HB3B 3FSAA 3WNJA 2IDFA 2BHFA 4KNSA 2FWLB 2PP8A 1TU2A 2OCCB 3H56A 2FQEA 4AI7A 2FTAA 2GB2A 1WS8A 2GC4C 1NDTA 2Y1AA 2YQBA 1OCZB 2A3TA 4CSPA 1X9RA 3C75A 1RKRA 4G7SB 3QJVB 5B7FA 4GP4B 2XV3A 2XXFA 2JFCA 3GYRA 4RH4A 3QQXA 4DP9X 1PNCA 3AW5A 4Q89A 1PLAA 2VM3A 4E9WA 1PAZA 4HALA 2VM4A 4A67A 1FA4A 3AZUA 1N68A 1SJMA 2PCFA 2H5UA 1QLEB 1I53A 1BXAA 3TU6A 2YAMA 3NJKA 4YVUA 2BW4A 3UGEA 1L9OA 2IWEA 1NIAA 3IN0A 2VSMB 1MZZA 3NJNA 3OMNB 2EILB 2BP0A 4PCYA 1V10A 1PZCA 4UANA 3NT0A 4BXVA 4GXFA 3FYEB 3CZUB 1AAJA 1CURA 4W9ZA 3PAZA 1GY2A 1KDJA 1ID2A 3ASNB 2J55A 1WA0X 9PCYA 5I6OA 1MZYA 2HZHA 1AG0A 3N2JA 3OMIB 3ZDWA 4F7KA 3RYMA 1AANA 1WA2X 2VN3A 1GYCA 1UATA 3NP4A 2J5WA 4E9VA 2CAKA 4HZ1A 2IH8A 2WSDA 4FA7B 1AOZA 4AX3A 1HAWA 2NRDA 4HIPA 1ZV2A 5A7EA 1BEXA 3WKPA 2I7OA 2VSKB 4BDVA 1NINA 3CDZA 1KYAA 4DP8X 1AZBA 1PCSA 1IBYA 1ZPUA 1BQKA 3WG7B 1GR7A 2PLTA 3PAUA 2PPDA 1IUZA 1OE3A 1ETJA 1MG3C 2Y69B 3ZIYA 3ERXA 1ZDSA 1ET7A 2MRYA 2AZAA 1RZPA 1OV8A 1WAEA 1T5KA 1IBZA 5B1KA 2AZUA 2CCWA 2CALA 2YARA 3T6WA 3S3CB 3AG3B 1CC3A 1L9QA 4E9QA 1B3IA 1OCRB 1W8EA 1SDDB 3EH5B 3NJJA 1ET8A 2H47C 2IDQA 2Q9OA 1BXUA 1M9WA 1NZRA 1A3ZA 2I85A 2P80A 4G70B 1GSKA 1XB8A 3NJGA 4G7RB 1QHQA 4P5RA 4AKQA 5B7MA 4QLWA 3CG8A 2BP8B 2XVBA 3NSCA 3FU8A 3PLYA 2YAFA 2FNWA 1J9TA 3UAEA 1SDDA 5TK4A 3ABMB 3SQRA 4F2FA 4JHVA 1L9TA 3IE9A 2AANA 4BWTA 1ASOA 1RZQA 2IDUA 3AG4B 5TK2A 2JKWA 4CSZA 4DP5X 1J9SA 1W6LA 3GDCA 2TSAA 3V9EA 2X87A 2QT6A 2P80D 2OJ1A 3NJLA 3T6VA 2FT7A 4N8UA 4K9JA 1XB6A 3TA4D 1NIBA 4AKPA 2UX6A 3WI9A 3EF4A 1PZBA 1PLCA 4E9XA 1SHWA 1NPNA 3NJMA 4YVNA 2B08A 2UXVA 1HAUA 4HCGA 3QJQB 2EINB 2XYBA 2GC7C 2N0MA 1EHKB 1NICA 3QPKA 3FQYA 2GIMA 1BQ5A 2PPEA 4BWWA 1NWPA 3IEAA 2R7EA 3H4FA 4KNUA 4YL4A 5IY5B 2CJ3A 1AS8A 2PPFA 2QDVA 1KCWA
chains in the Genus database with same CATH superfamily
2BH0A 4EN3B 3LNGA 3CCHB 4L8CA 4BHUA 2NY2C 3DIFB 4M02A 3STZA 1Z5LA 3PY9A 1YO4A 1GGBL 1VEMA 3B37A 3S2AA 3LNEA 5JLZA 1BAFH 4W93A 2VERN 1WG3A 3AB0B 1UVQB 4IJ3B 5AVSB 2GTZB 2GTZA 4LPWA 3VRIB 3HZMB 4OLYL 5HGHA 3SD2A 3V8OA 2IDTA 1T66C 2H0PA 4CBPA 3ARFB 1A7NL 1FE8L 4ZOEA 3LPWA 1BQRA 1AZVA 3MBWB 1BW8A 1UASA 3DMMB 3MV9B 4Y19A 3MCLL 3MGOB 5EEYA 5IROA 1DYZA 5ICXA 1SY6A 5DUBA 2XTJE 1JK8B 3BWUF 3JT2A 2AJYL 2XTJC 2H8PA 4PTTB 3IDNA 3KGRA 3RGVA 3FQ1A 3CXDL 1OM3H 3PP3H 3D08A 3IN2A 1TTBA 1BVNP 3CXFA 4QI3A 5AOZA 2ZYHA 3TIEB 4DUWA 3KXFB 5KVFL 3CU1A 3BO8A 3P0VH 2O6FA 3BZEB 2AK4A 5FIEA 3T3MB 4JZOA 3L3JA 4YDIL 4NO2B 2XG4A 2EDKA 5AOKA 5DC9B 4HP5A 4K3JL 1TNNA 2YRZA 4N2MA 4P2RA 2UYLB 4B5EA 4F37K 3SGKA 4PAZA 3KD4A 1ZT7B 4JZNA 3TFKD 4G9DA 5J3HC 4DTGL 4MXQC 1R46A 4YAQB 4G43B 3EHBB 4HS6A 4A7SA 1E30A 2E74C 4R90L 3QPXH 4Y89A 4OKDA 3VFNA 1IC7H 1VFMA 1IGYA 5MI0B 2EUXA 3QNZA 1T4KA 2L8AA 3PHSA 3C09C 5E00A 2BSSA 4R4NC 4XRCB 5CEXA 2P24A 1BAWA 2VLLA 4APXB 1FZJB 2CR3A 2VDNL 2Y1YA 1ZVNA 3BKJL 1MXGA 1DBKL 3B2UD 4WKZA 2NY2B 1QUNA 1SLXA 2DMBA 3S0PA 3TBVA 2QMJA 3ETSA 3LSOB 2YOAA 1AR2A 1MHEA 3MCLH 1IQWH 3UYPB 1CD1B 2CGRH 4NQCB 3EO0A 3MXWH 3LRSB 3QRGL 3VJ6A 12E8L 1V8HA 3EAKA 2BC4A 1PIGA 4HSAC 3RVWD 2B1AL 1NTDA 3P4OB 4W6WB 2HT4C 4EUPB 5F7DB 4KQ0A 4PREB 1CD9B 3POCA 4G5ZL 1IAIH 5DWUH 3U36A 3DV4A 3DETD 3T4YB 1RQ5A 1BIIA 2J20A 4BZYA 1J0IA 3MCYA 4Y9FA 4ZTOH 1S7WA 3O3EB 4QWWD 2N1KA 5FHBH 1WAAE 5D1ZD 3SO3C 1MFEL 3RY4A 4P5MA 3MA9L 1UCBL 1FJ1A 4ZXBD 3QC5X 2XWTA 5JR1H 3MLPA 3DVGB 4MQ7B 1UM4L 4AZUA 4FFWD 1JMXA 5JNYB 1IAII 4WI6A 4P46C 4NZ8A 2WXPA 3TS8A 1HZLA 1K8IB 5IK3B 3S37L 5BRZA 4KDVA 3ARSA 3H85A 4JRWA 1TEYA 4W1TA 5KS9F 3O6MH 3MRHA 2VR3A 4JE4B 5EIVA 1RJZA 1P7QD 4LOEA 1BJMA 3CUPB 1XR8A 5T5FA 3G6AB 2ESVB 1YPZF 2DQCL 3UADA 4Y1AA 2YIHA 4EIGB 4NUGH 1CZ8L 4LBEA 2OX5B 5KBMA 3NIDF 5GGVL 4LCCC 4NLHA 5E9DA 1T80A 2ID5A 1I7UA 3MOAL 3L1EA 4U1KB 2HA1A 3PNWA 3ATDA 1UHVA 3ARBB 5F6IB 2EDHA 1BYPA 1U3HC 2H3KA 2RIKA 4POUB 4YK4C 2HRPL 5DC0A 1YEIH 1NLDL 2G9KA 3MLSH 1TYRA 1GMIA 4FA6A 4JFTA 1R0AH 5E5RB 2Z8WC 3TVMB 2O30A 5EUOE 3A21A 2EP6A 4OCLC 3WN5A 3RWCA 1CF8H 5LWYL 2WXMA 4K07A 4MJIB 2E6PA 2OPCA 2PYED 1BVLA 2VH5L 4JUTA 2AI0H 3FO1B 2VDKB 2VQ1B 1YECL 3EH3B 3QCVL 1MI5B 4IS6A 3MU3A 5IVOA 3MACL 4BXSV 3SKOA 4QHUA 4KXAA 2ETWA 3SPGA 3CXHK 4G83A 4AQ1B 4DCQA 3P11L 1KC5H 1XH0A 25C8H 4X6BA 5LVEA 2VZSA 3BH8A 5EORL 2A73B 3C12A 4NFCA 5ETUB 4N8CH 4LCCB 4MCYA 4PJ8B 4XB3A 1JV5B 5CNHA 4IJ3C 5HGGS 1I85A 4ONGH 4QY8B 4CVXB 5D1QC 5I8EA 4D9LH 5DO8A 4YZWA 4L4TA 4ZYKB 3RWHA 5HI3D 1B6UA 3AY2A 1EJOL 4HHGA 4Q0XH 2P8LB 3IU3B 3NCYS 3GJFA 5ACLA 2EIMB 3UACA 3BE1H 3IKKA 4P2CG 4X4XA 3D25B 4KOCA 1EZVY 5JIPA 1C7SA 3FN0L 1J0JA 4MSWA 3QQ4A 1XZ0B 4AK1A 4C54A 4YSCA 4X5WB 3OZ9L 3V4PH 3VGBA 8PAZA 3KPNA 1X5AA 3RZWA 1MCJA 4Z7WB 1BZEA 3D12B 4U2YA 3QEQA 1PCXA 3DI2B 1P5UA 4HS8L 1J12A 1QYGH 3VD0A 3JWOH 3DX7A 3NA9H 1YEFH 4TLTA 1AIZA 3B5TA 4N68A 4QJ5B 5CJOL 3SE8H 2ZT9C 5DD6A 2R4SL 3A6BL 3DBSA 3K46A 3FQ2A 4HW6A 4QCIB 1LK3H 4XCEB 3ULAB 5J9PA 1FDLL 1WZMA 3MRJB 3INUH 2QADC 1AACA 1N8ZA 4N0CC 1JPGA 1IEBA 2VL5A 2DLGA 2NTFB 2XFGB 1EVTC 3X1EA 2DQUH 3VI4B 3BFQG 1ZLSL 1IGYB 1NDMA 3UBXG 5B22A 5IBTH 5A2AA 3U4EB 5ACZA 4I3RH 4IMLB 3ZDYE 4AT6A 5DVNA 5D8JL 2DEWX 4ODHH 3AGVA 4G3YH 1CN4A 3WNNA 1PKQA 3GMLA 2IO5A 2GK2A 3SSGA 3VO0A 3ZZQA 3UXFA 1UM5H 5BO0D 3QR1A 3T2LA 1WK0A 3PWVA 4HUUB 1I75A 4PJ9B 1IM3D 2XA8L 2AF2A 3CSYA 2BNRA 5E6ZA 2YQBA 4MNHA 2D9QB 1ODAA 4JFED 5KJRH 5EO0A 2SEBB 1DQJB 1CXIA 1QHOA 1RKRA 4JDTH 1LP9E 4NO2A 4A1RA 1QLRA 2XDHA 2ED6A 5KW9L 3ASWA 5JXAL 4L18A 2XXFA 4HUNB 5C08A 4F24A 4HBCH 4KMQA 4Z7UF 2EE9A 2EO1A 3ULUE 2E0PA 2AXWA 5ADOL 3B7YA 4X80L 4R97B 1KLFA 2MIZA 2NUTB 5IF0B 2A4CA 5SWZE 4FQIH 4BKSC 4MB3A 1QSFD 4ONOA 4PJCB 3MJ6A 4XCCH 3BUPA 1QLEB 1ZT1B 1X9LA 1OAZH 1ID5I 2YAMA 1MDTA 4YHLL 4LIQE 1G7JA 4LRNL 3UCRA 3C8KA 5D7JC 5F96L 3D18B 1H6FA 3V0VA 4IU3A 4NQCD 3NJNA 1P4BL 1UKSA 3HR5A 1NCAL 1AQKH 1E4XL 4DGUA 1V10A 4I0PA 3QIWA 4Y2LA 1FNEB 1GA2A 2RQEA 4LLAA 5IQMA 2MKLC 2YSSB 2K6ZA 4PGEB 1E2WA 4P4RB 2OSWA 1MAKA 1F1AA 1TJHL 5EG6C 2QQNL 5C08D 5D7KE 5DFVC 3HNVL 1UXWA 1MZYA 4NN5B 3TN0D 1PEZA 2LQRA 4WEMB 1CGXA 5FF6B 4OJDH 4P5TB 1WA2X 4OFDA 4GXVH 4ZX4A 4QYAA 4QRTB 4JY6B 1DJWA 2F5AL 2E9BA 4FA7B 4PJGE 5CFHA 5B3JF 5FFLA 3MLXL 4ICXA 1JNLL 4IDLA 5C7ZA 3VW3H 4I8DA 5DTFA 3OF6A 3CDZA 3T3PF 5TE4H 1OHZA 2QLVB 3BH9B 4I3SL 3DNKA 1S7WB 3O3EA 4Z7QB 3RWGA 4GXUM 3FULA 3DYMA 1CLCA 1TQBB 2KHAA 3V0DA 4AGPA 3SO5A 5I15L 2J6EH 4AMXA 4Z77A 4MMXA 5TH2B 2RMNA 8CGTA 1H3PH 2JIXA 1ITBB 2BM3A 1UYWL 4HG4K 1BLIA 3WY4A 3TNNB 1RZPA 1J8HA 1K4CB 4L3CB 3VG9B 3QJXA 5AAMC 1T5WB 2XWJB 5GS0D 2YARA 4XCYA 3VXSB 5LQBL 2YGOA 3KJ4B 3MKKA 3D4YA 5EZIL 1RZ8B 2YZ8A 5ACMA 2YUXA 1F02I 5FYKH 1SJXA 1A6UH 4P06A 4H4NA 4HPOH 1FORL 2H47C 2ICWJ 1MLBA 1M3JA 4HHAB 4P4KD 2R4SH 2VISB 2WNKA 1OW0A 3QZWB 4G70B 4LCWE 1F4XH 3HG1A 3MKGA 4BQ8A 2VLLB 5DC4B 2ZSVA 4NHUA 3FU8A 4UT9A 4Z7VF 3RKDD 2DLHA 3LRLA 5DDHA 4JO1L 4G11A 1HQRA 4R7XA 2Z91A 3ABMB 3SQRA 3C6LA 3B2DC 4JHVA 3R8BB 2DMHA 4LKXA 3FRUA 5IHBA 3L5IA 4UQBA 4E68A 3L8QA 2XVGA 4L5FH 1HX0A 4PGBA 3DX4A 3QYMA 1M7UA 2X87A 2VDOL 1PY9A 4MNHB 3S96A 2X4UB 5L9DL 4I1PA 1KG0A 4OQ1A 4BELD 4IKLA 4F5CE 4OCWH 4B0MB 5CXPA 4CVWA 4JGNA 3CVIH 2LLGA 1JSYA 3BEWA 2WXNA 3KWVA 4GKNA 1XCTA 3QWNA 4NN5C 3TH2T 5M95B 1A5FL 3HS0B 5H35B 3NGBC 4QXTA 3EFFB 1CQYA 4Y16B 3Q6GL 3VMNA 5CAYB 3JWDC 4PRAB 4Y8AA 3PP4H 4PRIA 3WXVH 1YJDL 1A0QL 2HLAB 2VUKA 2QQKL 3SEPA 1YEDA 2ORBL 1QSZA 4LCUA 5DQDL 1NWPA 5AW7B 4G9FD 1AYRA 3QEGH 4X50A 4KRMB 4XVUD 3VDCA 4XBEH 1JK8A 3VDBA 3H54A 1TJMA 3KXFE 4H7VA 4IRJD 4XB8A 4NXSA 3ARGD 3BHBA 1SVBA 5GZOC 3NZ8B 4ANUA 4N6RB 2BRQA 4OLYH 3W56A 3A6BH 1SBSH 4Y4KB 4OTXH 5HGHB 1A7RH 4P3CH 1HH6A 4CNIB 1HKFA 3GSQB 4G8AC 4GAJL 3OC8A 1JZ5A 1SOKA 4HGWA 5I24A 5KBDA 1T2XA 2M2DA 1G7JB 1ACCA 1JPFB 2PW2B 1AQ8A 1G7MA 4B53A 1AGFB 2WUBH 3BN9D 4GO6B 3CCHA 1A6WL 1OOWA 3QG7L 3QJFB 4N90E 4J5VA 1XH2A 5I6LA 3AABA 5D9SB 4AWJC 5GGVH 1J5DA 3GLDA 2Y2WA 3P0VL 4U49A 1RPUA 5D71H 3WV0A 1KGUA 1GVIA 1KGWA 3TT1L 1JDAA 5AW9B 4LLDB 1DN0A 1YN6A 1VFAB 3QFJE 1D9KA 4FNQA 2W95A 4XNZC 1GAFL 3QULA 2BWDA 2WQUA 1UQSB 3X3FH 4HCRH 5DEGA 5F71A 4L37A 4NCC2 1URIA 3PXHA 3G08B 4LVNC 4F57H 1KPUB 4LQ1A 5HHOA 4NQDB 1KGCD 2EVJA 3ZO9A 3K8KA 1CI3M 3RVXD 1F56A 1A7NH 1FE8H 3FO2A 5MHSE 4IEFB 1OGAB 3PWVB 4HUUA 1MJUH 1FL3B 1Q1JH 1QO3B 4OF8A 5IJVB 1KT2A 2JK5B 3A4AA 2O61A 4MQXD 1KIRA 4IOIB 3ZZLA 3DJRA 3LH8A 5TDOB 3O45A 4RWYL 3CPLB 4MJIA 2C9SA 2WWKO 2BMKB 2OTUA 4RFEB 1IC5L 4U31A 4MXVE 2CGYA 1E40A 4HIXH 5EU3B 5SV3A 1WCQA 1INDH 1BD2E 2E9IA 2DPKA 1FYTE 1FSKC 3VVVA 3CFKA 5C0DB 1OAUL 3GSOB 4OSUL 1SBBA 4U1SA 3U2SA 1YY9C 4PJ7F 1NFDE 2IBZX 4YEFA 1KEGH 1R4XA 4FG6D 3MXWL 2G75A 2W0FA 1YEKL 2P5ED 3JSSA 3Q6FB 1IQDB 1U8CB 1YMHB 3KVDD 3RTQD 3ARDB 3CMGA 4KDWA 4EDWL 1OAXH 4NJ9H 4RGMB 1J11A 3BI9X 2NY4B 3PL6B 4WU7B 1S3KH 5CCGE 2H32B 3FU9A 1SF3A 4M8QB 3UTZA 7CGTA 3OKEB 4FXGC 5DD3L 5GS0C 4ZJ9A 3HG3A 2AQ2A 4F7PB 1WZAA 2E7CA 4AMKH 2NDFA 1ZTXH 2DJUA 5C0CE 2ZUWA 5B38G 1QVOB 1KBGH 4L5FL 4TVSa 1BD2D 3BIKA 4ZZFA 5I6MA 3TEYA 1HS6A 3RAJL 5E99L 1MKFA 1K5NA 2ZG1A 1UA6H 3BP6B 4LARL 4Y4HC 4UT7L 1HT6A 1XEUA 2HWZL 3GRGA 5DQ9A 5DQ9B 1HZKA 2NY1D 1U6AL 5LUMA 4D9QD 5K69A 2IJ0C 3KH4A 2LU7A 1VA9A 4KO5A 3CIAA 4LRIC 5T5FH 2X1XR 1B9KA 1OCOB 4U6VH 1UZ6E 4ECNA 1NAKL 1SZNA 1XCXA 5DJ6A 1A3RH 4WY7H 3WNIA 3PJLA 2HRHA 2V5SA 3NOIA 4DVBA 3QXTA 4WI4A 2NX5B 4ZAKB 2B1OA 5IJCC 1NA8A 3MO1A 3US1A 4BKLB 4J28A 4JZJA 3HE6A 3UTZB 3NH7H 3RGVD 3IGKA 4F7CB 2C1PB 4P05A 3GBNL 3C2AL 1N0LA 4LLWB 3ME0B 3H6AA 1PMYA 3TVMC 4QKXB 1JGIA 1JZHA 3O3AA 1OSEA 3NFSL 3TV3L 5TF0A 2NY6C 2PWEA 4M6OH 5D7EA 1JI1A 1DHKA 2JIXD 1BHGA 3MGTB 1JNLH 4U0RB 1SRDA 4U1SB 1M57B 5ENWA 3K6SB 2KMWA 1ZPLA 5IR1B 3BRFA 3E8UH 3O3UN 2PO6B 5FPIA 3WNPA 4KJYB 4R90H 1T83A 2EDFA 1TSRA 1HWGB 5ANMA 3MLZL 5I1KH 3IS1X 2QSQA 1S7RA 1IAKB 2IDSA 4PQXA 2XWZA 3DIDA 4GKZA 4TN9A 5I5JA 4S1RH 2H9GB 5BOZG 1SLVA 2VC2L 5GGTA 3QRFM 4WI2A 2VDPL 4JPIB 4TPRL 1ZWIA 5EZIH 3D3VD 3F83A 4JGMA 1N0XL 3HMXL 3MTRA 5CU5A 3G6JE 4AH2B 2W59A 4LCWB 2Y36H 2AAAA 3HAEB 4N85A 5C0RL 5T1DH 2EKSB 3N06B 3HG1D 2GJ6D 4GRWH 4NP4L 4PJ5B 1ZTMA 1CXFA 4HWUA 2XG4B 4Q0XL 2MNJB 3BKYL 3GXFA 2LFEA 3ATBA 3LEXA 4JG5A 3UZQB 5FFOA 1JNNL 3LXBA 1OGSA 2W65B 1A65A 3DWTA 4LNVA 3L3GB 4CC4C 3B9VA 1D9KB 4L8SB 4QAMB 1S7XB 1A4KA 1BCIA 2DJMA 2J6WA 2BSBA 2OL3H 1CYWA 3MI6A 3WXWL 3F65A 4BBWA 1C08B 3LHAA 2APXA 2IG2L 3BVXA 2L0DA 3P3SA 5FO8A 4Z5RB 4QOKD 1JVOA 2OR7A 1AR1C 1DANT 1MWAH 2CDFA 4IBQA 1CLOL 2VH5H 1RZFH 5JW5B 4ODSL 3V8CA 3PFQA 4QD2E 3UTTB 3LZQA 5IZ7A 1T7XA 3OL2A 4PJBB 5AW1B 2YPKA 2QQQA 3AS1A 4P5KB 4ZBJA 1F4AA 3B2XA 1UM4H 5C86A 1AXSB 3QZBA 2H6OA 3NJXA 1BQHA 1MI5D 1CDHA 3HBPA 4N6RA 1A3LL 4Y1AD 4CSSA 2QKSA 2WXJA 3O4LE 1NWOA 1QUNB 2DLFL 1X9QA 4FCAA 1IL1B 1JGEA 4JO2L 4UTCA 5IQLA 3WO4C 4G7VL 4L4TD 4HAFA 4PJ8D 5CR8A 3BW9A 4EI0A 3V6FB 4NUGL 1NGXB 4DPAX 3HI1B 5KG9B 1FFTB 1NOFA 4LFHD 1THAA 1WBYA 5D70L 2NXYC 1VKXA 1OP4A 5B38B 5F7BA 3BOVA 2WYHA 1F3DH 4WW2C 3SCMC 4RISL 1NC2B 1WSST 5I1HL 3IDXL 3MV8D 1I9EA 1MLCB 2YZ1A 2BHFA 3PWUB 1EHLL 1I1CA 2F5BL 4JFXA 3HAEA 3O2WL 4MD0B 3VXSD 2A74B 1DDHA 1DDHB 3TEXA 1QSEA 2GC4C 2K3TA 2X41A 4DGIL 1T6VN 2FDBP 1CICA 2XN1A 4XN5A 3S35X 4YHZL 4CBZA 5KSUB 3PGDB 5ESVB 4F3FA 2XBDA 3VDAA 2E8YA 5C0IA 2YSTA 2Z31D 3Q7JA 3ZTJG 1J1XH 3DSFH 1NGWA 3AW5A 3IE4A 1ZLUH 3ROOB 5KS9E 5L8LB 5IR1A 4Z3EA 5K9OB 2CXGA 1TQVA 4BM7A 1N68A 4P9HC 1ROCA 5C0CA 4FTDA 4ONGL 3LIUA 43CAA 3I9IA 1FORH 2VISA 1MCIA 3QZWA 4XR8C 4Z7QF 3ARQA 1BFVL 3ZYZA 5HP5A 4RZCB 1BAGA 1JGDB 3NJKA 5C0NC 3GXIA 5F1NA 2OR9L 4OZFH 3WS3B 4ZMLA 4JO2H 3P9LB 2FO4B 3RGBA 5JA8B 2EO9A 3B43A 5IJDC 5IT2H 1T7VA 1JTTA 2WLKA 3HZMA 5FX3A 1PX3A 4AXWA 1YHPA 1ZLEA 4UIMA 4J39A 3VD3A 2DWDA 2Y5QA 4XVSH 5D70H 2E7BA 3BZDA 3CFJB 3W9EB 5D6CB 1Z5LB 5SWZD 1ZHLA 5DHVB 1S6NA 3RX8A 3VI4F 2J55A 4QRQA 3T08A 4AIXA 4F93B 4FP8H 2FHCA 3FK3A 4MMZB 1IC5H 4LSSL 1KENL 1FZMB 1GYCA 4Z7VA 3WELA 4E9VA 2VXQL 3CTTA 2FH6A 2VDML 3KPMA 4NFBA 4S1QH 1K2DB 4WU5B 4AX3A 2A38A 5CZVL 1E4XI 1RIUL 4DKEL 2I7OA 4XOCA 5I1EH 3L4VA 2EH7L 2G9HA 3U79A 4P3DB 1TZAA 2A9MH 4YHLH 4YMPA 4IK7A 4NZJA 2CIKA 3EKCA 5FA3B 3SYOA 3ALXA 1ES0B 5JIKA 4QT5A 5SWQA 4P5TA 2PPDA 3GI9L 5A6LA 1OE3A 2Y7MA 3RKPA 4L5FE 3T04D 5J3HD 3GGWA 4NBXB 2XBZA 4LBAA 5I66A 4XMXA 4OLXH 4JFOA 1RZGB 3KDMB 4DUXA 3D0AA 5ICUA 2UY7B 1TMQA 5D6DA 1L9QA 4PJXF 3FQRB 4X83A 2MPAL 2ZNWA 2QSTA 5KJRL 4M1DL 2VZVA 4JDZA 3U9PH 2ERJB 3L4XA 1BG1A 2CUIA 1SPDA 4GAJH 2J44A 5DI8B 3E9TA 5ITBL 3MJ8B 1AP2B 4JO4L 4QGYA 3TBSA 2OFQA 1FNHA 3ZT7A 4QLWA 3CG8A 1J87A 5EBMA 2V7NA 1N12A 1RI8A 3E80A 2A9CA 4G8IA 5SX4H 4G6KL 4GS7C 2WMPB 1QFUL 4UNVA 5JHBA 5L0QC 2ADYA 3TZVA 3MACH 4D8PA 2HKFL 4IBSA 3ATAA 1AJ7L 5EBLB 4DUVA 3VA6A 2R1YB 2X6VA 5K9JH 3VM7A 2DBLL 2H3NA 3D7PA 4XX1G 4OCYL 4OH2A 4KZEL 3QFJD 2Y3NA 5E51A 1ADQL 5EO0B 3IRPX 5E0QA 1SVZA 1GIGH 1LO5B 3ZIMA 3LAFA 3CSYB 3V5KB 5E2UL 4PJIA 4TSCH 3A5VA 1U8IB 1XB6A 1NIBA 4FL4C 4Z7NF 1BWWA 2TRHA 1GGTA 3HE6D 3N43F 2BP5M 5DS2A 3TCXA 4ADGA 5TPWH 3NN8A 3L7FA 3RI5K 3NJMA 5K5YA 2KC0A 2O6PA 2WBKA 5FA4B 3LH2H 3ZDYF 3VQ2C 2L04A 3QR0A 1KMGA 5GSVB 3P9MB 5LNEA 4JVWA 3HG0A 3APMA 2DQJL 2VR4A 5D1XD 1AQDA 3UG4A 3ZTDC 1NUNB 4P4KB 1CE6B 2G3NA 1AS8A 3HS9A 5EOQH 1QFHA 2R29A 1ITCA 2BHZA 3N9GL 4I18B 2BVYA 2ZUYA 2R29L 3A4EA 3IPEA 1LP9F 2HMID 5D1QA 3QDME 3WKML 3MV7A 2JI2A 4KO7A 3MRGA 2F8VA 4JQIL 4XCEA 3FOLA 2M8XA 2DWXA 4PW3A 4RDQF 2E7LC 1NIDA 1NAKH 1T7YA 2C5DC 4ZMOA 2PCXA 2DYPD 1OARL 3GSUB 4DP1X 4FCHA 3DX7B 1M2VB 3T2NH 2W9EL 4A7QA 3ZKND 1ML0A 3H9HB 3MX0B 4U1LB 3D39D 5LN4A 3NFPB 3U82B 4AQ8A 4NKOA 4BD4A 4XP9L 5JHDE 4MA8H 4HLJA 4LSUH 4UM9A 2VJ8A 5SWSA 4ZUWB 4CN1A 3ULUH 1P7QA 1XCQA 1I4FA 4A2HA 1XZ0A 2VW4A 4L48A 2QZ5A 4QPEA 3II1A 3AXLA 1XGUA 1MCHA 5DZLA 3K5RA 2NYZA 3FT2B 4YUEH 2NNAB 5FAAA 4AUUA 5JDJA 2OTUB 2BMKA 5EU3A 5GSVA 3ZHKA 4KHTH 3OSKA 5E6ID 3WNMA 3EO9H 2V9QA 2B0SL 2F8OA 4JHZA 5HPOA 2XZQL 4BRVA 1Z2KA 5C6TL 3UTPE 2IF7A 1CK0L 4XOEA 1DEDA 3NN8B 3MUJA 3O6KL 4W9JC 3WJJC 5GS0L 4P23A 4JNXA 3T09A 2W9DL 1S9YA 1OGAA 4FQQB 1A3LH 4L0ZA 1ZSDA 4GRMA 1ILUA 2VSDA 4XWOC 3GSNL 3ECQA 5B3JE 2VJXA 5EU7E 3VXME 3LS5L 4TULH 3UJJH 1NCBL 5BW7C 4QHKI 1JXKA 5DS1A 5CBEB 1WBZB 5FM8A 1K85A 5AVWB 5TQ0L 2PW1B 1E9OB 5EDSA 4POYA 5DJYB 5BQ7A 4R7NB 1VFAA 4LLYA 1Y1DA 4QYOA 1GZQB 5CP7A 4HUVA 2JLLA 5GGUB 1RP9A 4F7TB 1WIUA 2GQHA 2GBAA 5DDHB 1SM3L 1QW9A 4JO5A 2NNFA 5KVDE 3QNYB 2D31A 2AJZA 3RJQB 3JZ7A 4DN4L 5HYJA 3WGVB 4ABWA 1DVSA 4OFYA 5TGBA 1ZLWH 3VI3A 1L9NA 5AYTA 5E94B 4PWKA 7FABL 1J8RA 4F57L 4Q4EA 1D5RA 5D7IE 5HPMA 4O00A 4HXAL 1TVHB 2BINA 1J9RA 2FLRT 3FQRA 2ZCHL 2MTPA 1EXUA 1T1XA 4XXDA 4WO4C 4NNPL 3HC4L 3MTXA 4J3UA 3ZMEA 2YC1B 1EAPA 3QXAB 1KTCA 1MH5A 4PCTA 1OP5K 3SYPA 4PRHE 3WFCL 3BVWA 4X8XA 1M6OB 2DIEA 4MJHA 1GZHA 4WEUD 5IMLA 3MDJA 4IBTA 2EYTB 5I26A 2HYMA 4R4BA 5BVPL 3II3A 3BFOA 3ECVA 2WN2A 1MCWM 4YDVA 5I0WA 5SWQB 1WFTA 3K0WA 4KTDH 5F7KC 4Z7IA 3T1FA 1BF5A 1FFPB 3FBKA 4LNRA 2X42A 4UV4H 1I1FB 3FTZA 1GCYA 3HE7C 3QQ3B 5C09A 3PNRB 5AZ2H 3VCLA 3FONA 1RV6X 1TPXB 2EIDA 2OR9H 3BSZL 4M4PA 1IMHC 4XNAA 1DDTA 1Y1UA 5GRZA 3BQUB 4J3VA 4QXVA 4ZSOA 2BIHA 2D7MA 4M9OA 1K9TA 2H4EA 4RAHA 4QRBA 5AG8A 4P48A 1BEYH 4XVOA 3UIYA 4BCZA 3WFEL 2ZCLL 4JVPA 1HH9A 4GUQA 2BC4B 2UVEA 4CN6A 4J6RL 5JQ6H 5KVEH 3SDXA 4BFEA 3HR5B 5D1ZC 4HJSA 4U3HA 2XXMB 3VD2A 3UYOD 2HT2D 5ESQB 3C6LB 3Q2LA 2VMJA 1BQSA 2VT0A 3D18A 1AO7D 4IBLT 5C8JA 1JDCA 1W0VA 1EHAA 1CFBA 4M6NH 3EOBB 4UUJA 4C56E 1FYTB 1QSFE 2HWZH 4FJ6A 4GKOA 1BJ1J 4X42A 5JDSA 5EOTA 3TIDB 3P4MB 3CBJB 2VOTA 2NUTA 1D5MB 3QDJB 1Y0LA 1J1XL 3DSFL 4GJTB 1A7PH 5HYFA 2O1AA 1XMEB 3R06B 3RG1C 3FQUB 3L45A 1EZUA 4S0SD 4RGOL 1IC0A 2OZ4L 3MODL 5ESQA 5C07A 3W38A 2R8SH 4X8JB 5K59F 3B8SA 4YSQA 4OU3A 3QWRD 4JFEE 4PV8A 3ES6B 2N01B 3LZRA 4ODVL 1TQCC 1YMMB 4NJ9L 4BA8A 1DFBH 2ADJB 2B3IA 3IXAB 4PJ9A 4QKTA 4N1HB 1NFKA 3NZHL 1EERB 1K6QL 5AYUL 3CLFH 4Y19D 3FSVA 3S8GB 2GT9B 3L4ZA 2J4WH 2FT8A 4JFFB 3B6SB 4X5RA 4Z1PA 1XT5A 3BVVA 4OD3L 1DUZB 1T3FB 2NYKA 1C12A 4P9ML 3CDZB 4E9LA 2N7SA 3TA3C 1SEBB 3ZKMC 1HTYA 3ZKQD 4R7DA 1N2RB 2C3VB 2ENYA 3D1MC 1VIWA 1VESA 1BM7A 2JJUA 5D55A 2VL5B 4LSDA 1L7TH 4Q2ZA 2YXVA 3ULVE 1B4RA 1MQ8A 3OAZK 2X05A 2YPLD 1AI1H 2F1BA 4FJZA 3IB4A 1AXTH 4WF7A 4GQZA 5DR5L 1IBGL 1NBCA 1TVBA 1OTUC 1ZRUA 3FUIA 4XNZB 1MJJA 4K15A 5FXCH 5E4OA 4Z7AA 5B39B 5JOPD 3CSGA 1EAPB 3QXAA 2CHNA 4CKQA 4LDEB 3WMQA 4WWKA 2W81C 4BUGA 1EZSA 1IM3A 1JZEA 2Q76A 5B7EA 1SN5A 4P5KA 2EJ1A 3R4RA 3SQBA 4XZUA 5HD8D 3U0WH 1OT1A 5J1TC 4TNVF 3WLWC 4OIBA 1OTSD 1U8NB 1M05B 3GZQA 4H26A 4HXAH 3MRDA 3QHFH 3MUY1 2KERA 2WCGA 3LJ3A 2EDLA 1ZT1A 5FGCE 2Q7AA 4ZMQA 2Z0UA 1SEQL 2P1YA 3MC0A 4WUUA 5ID1B 2VABB 2DICA 1OK0A 4OCSL 2NT0A 4C56A 4JPVH 5CN3A 1HK6A 1UA3A 2VE6A 5CEZL 4PV9B 5JXED 3ZL2A 1JXFA 1ZA3B 3O6FD 1PBYA 1E9PA 5C0AA 1SQMA 2UZXB 1P5VA 2BERA 3FSAA 3MYJA 4F15B 5BJTA 4BK5A 3QUYD 5I1EL 4PJ5A 3HW7A 4RAUB 3GUTB 5T1KB 3SKMA 4LCIH 2R4RH 1TCRA 3O4OB 3OLIA 1VFOA 1A6TB 1NDTA 2Q7YB 3OGOE 2V8MA 3BPLB 4KKQA 1MI5A 3O41B 1CGSH 1GZPA 3BAEH 1V3KA 4FXGB 4XPFH 2PYFA 5DXWA 5C0AD 5FO7A 1FAIH 4EN3D 4ESKA 3ZE0E 4LL4A 1GGBH 1R5IA 3OWEA 5DUMH 3WN5B 4AYEC 3I50H 3T0WA 4HIQA 4YEEA 3KL0A 2V3DA 5DWPA 2VM4A 4IHOA 3VFOB 1QLFA 3GMOA 2EC9T 1VRSA 1E2ZA 1F90H 3EGSA 2DMGA 4PJEE 3KM1A 1CL7L 5F0LB 3QAZC 4UM9B 1ZEAH 4P23D 2HJKA 3AS0A 5CSZB 3RZCB 5GS0H 3MLTB 3NIFE 5CU9A 2ATPA 3BAKA 4AM0A 1WIOA 2XRAL 3LIZA 3EOTH 5F7EH 3KWUA 3HE6B 3OKMB 2ESVA 3L1OH 1ETZB 3QDJD 4HJ1A 2GY5A 1QEXA 4K8RL 2X4OA 1ZLSH 5BVPH 1A2YA 3ARGA 5D7JA 3V6OC 4BZ1H 4M3KB 5EIIA 1S9XA 5FK9B 1WA0X 1WTLA 3IDYB 3DARA 3PQYB 4R8WL 4PPTA 4YO0A 3RVVC 1MCBA 4D94A 3FTWA 1AMXA 1TQWA 3DHPA 5T3XL 3GMMB 1KYDA 1QPPA 2WSDA 4HIIB 1G5AA 3D25A 1A6ZA 3P73A 4XP9H 4IU2B 3QSKB 1XFPA 5IB4B 2APSA 5F6HJ 4X7TB 4POZD 2AJVL 4Z7UA 3V0HA 3BP6A 4K5PA 3CFIC 1NDGA 3MA7B 1OD7A 2G2NA 1GR7A 3FUKA 1IUZA 4JKPH 5DRNB 3OHXB 3PQYA 3TEUA 3ZK0A 5LB1A 2ZCLH 3ERXA 3ARGB 5ILTL 2DQMA 3PIQA 2QPSA 5FYKL 3IETA 5J12B 3KPRA 2IPTH 3FCBA 1ZVSA 2P9RA 2HKAA 2BJML 1L7TL 2Y7LA 5A2KH 5B1KA 2AZUA 5DJAB 4UQAA 5ADPH 3RHWK 3S3CB 5C07E 1UD2A 4E9QA 2LE9A 4WWNA 5TE6H 2YPLB 2O93L 2B2XH 3OMZA 1YMHA 4OZFG 5GS3A 3UOAB 2ODHA 2IDQA 3X17A 1Q94A 4O02A 4QO1A 3C8DA 3L16A 3WHE1 4O4YL 4OZGF 5JHDA 4TRPL 5DMKA 2KPWA 1BZ9A 3BMWA 2NW3A 2V7NB 3GHEH 5EU5A 2HVKA 4LXFA 2B39A 4YPGB 1CICD 1RIVL 3UERA 3E6FA 1X5FA 2WLZA 2R2CA 2EEDA 3ARBA 1GOFA 3VFVB 1KN4L 1T0PB 2CO1A 2Z4QB 3ZRCC 5D6DC 4RFEA 4AQ8C 2K9UA 4J3XA 2Z8VC 3IJHA 1RPKA 1YDPB 3N3EA 4JAMB 1HN1A 1WAAF 1XH1A 4HKBB 3CGTA 1DQDH 2B5IB 5B1CA 4MDIB 3P30L 1J1OL 3NJLA 2OJ1A 2Q2LA 2Q7YA 3UMTA 15C8H 4H8HA 1ZT7A 4XP5H 1I3VA 1HWHB 1JG9A 4AKPA 3VYNA 2J88L 3EF4A 1D5XB 3JWNG 2OL3L 5GRVK 1J0HA 1TYJA 5E8DL 3V6OE 1S3KL 2EXSA 2LAGB 2VN4A 1YY8B 2X38A 4JCLA 4BK8A 1A9VA 2WQAA 4N8VG 5DHEA 4BSVA 3KR3L 1KZQA 5HXMA 3SJVB 4X4YB 2CMRL 1PZ5B 3LNFA 4AIEA 5I1IH 2EQDA 5ADOH 4MNQB 3GLZA 3O3DB 1B0RA 1ZA6B 2ADIB 4PBDA 4YX2H 1BQ5A 5H94A 1LDPH 1W72H 3DUUA 1KFGA 4W9FC 4YR6A 3ZVVA 1ZT4A 2MHAA 1XF1A 2EC9U 2HTKC 4Z7VB 1YNKH 1BOGB 4JO3L 2ZG3A 4R2GC 4TPRH 1IAIM 2WXLA 1UXMA 1XSJA 4HEMA 5AVTB 4KPHL 1R24B 3KGTA 4G7YL 3BCFA 2R2EB 1N64L 4AZ8A 1CFSB 2L4OA 4PJHF 5IROC 4HGWB 4RRPA 4QTHB 1RUKL 1I31A 1GCFA 2B1AH 3S3BB 2GCYB 2APVA 3BAYA 1JPEA 4GBXB 1RJCA 4N2LA 5IGXL 2DKUA 3BGMA 4HHWA 5AALA 4DPBX 3EH4B 3WYRA 5D7LD 5DU7A 4PSPA 5FOJA 1OXYA 2YQGA 3NIGF 3V7MA 4PJAB 3T3PE 4ZQTA 4Z0XB 3WY1A 2V3EA 3BPLC 5CLTA 1CVRA 2YK1H 3ARWA 2DIBA 5KYXA 2H0EA 1QPXA 3Q5YA 1K72A 1IVTA 4JQIA 3ROOA 4EI5C 3T2OA 1MHHA 3KYKL 2FR4A 2E7DA 4NKQB 4UQ3B 4ZMZA 2ITFA 2VN5A 4OD1L 4AV4A 4HKZA 1ORSA 1L9MA 4QWWC 4YDZA 5DJ0A 2GUOA 4F3FB 3VFTA 5I16B 5IB3B 3U2JA 3UAJD 2C4FU 4HGKC 3OZLA 5JHLL 4G43A 4TSBH 3BUTA 2LU3A 3IVKB 5JOFA 2D0GA 4XVJL 1TTUA 1F3JA 2EE0A 4LL9A 2VDQL 4G9DB 2ITDA 2P7TA 3AGWA 1IGFH 4J23A 4XPTL 3W2DL 3A6OA 1WCBA 5E2TL 3V95A 2B4CC 4EAEA 1U3HD 2WHVA 1Q0YH 2G3XA 3UTSA 4YNYB 2VNCA 4PJFA 1DLHB 3ZYIA 4RMVA 3D9AL 1MCPH 2JKJA 3CDGA 1U8OB 3G5WA 3KL5A 3AUWB 4I0KA 2GUOB 4JJ5A 4H20H 4Z7VE 5C07B 1WFJA 2WUCH 3RL1B 1PF3A 3HE7B 1QG3A 3QQDA 5CGBA 6TAAA 5B38A 2GJRA 4TTDC 1CIDA 5IMOB 5BVJA 3TLRA 2AJSL 2IAMC 3DO7B 2GSIB 4OIIL 2QTEA 1FGNH 5ISZA 3F6LA 1GOGA 5IBUB 1I8LC 5JHLA 1NBZB 1QD0A 3H7LA 4KK9C 4PJXE 1CE1H 4M7ZC 5H4YA 3TPUB 1KFAH 2D7OA 5F2FA 2XV0A 2QTVA 1QRNB 1XR9B 5KTEH 4D0DA 4N0UB 2X88A 5EU4B 1DBKH 4L8BB 1T5WA 3WTUA 3CMOH 1KC5L 1KENH 1E65A 4NT6A 3W81A 4DPRA 2PWDA 4JFFD 2AQNA 1RU9L 2XY1A 4XMZA 3T77B 1XF2A 2GSGA 3RUGB 2YXWA 2NXZC 4QHNB 3RX5A 3D4GA 5DUML 4EN3A 2AV1B 5IHHA 4CADB 4FNRA 3OKDB 2Y5EA 3NJHA 1C8PA 1WA1X 5D2LA 4UB0H 4OGZA 1CR9H 4DTGH 3K80A 1TJXA 4PLJC 4UOJA 3QDGE 4H13C 1TKWA 4JFYB 1BXVA 1B4JL 4X6CB 4Z7NE 5C0BD 4XNXL 1A6VH 2ZCZA 4KK8D 3OHMB 4M7LT 5FC9A 2HFEB 5HI3C 3VD1A 4ZI8A 4Z7UE 4PLKC 4H5SA 4NM4H 4K94H 4JJOA 1NLBH 4R96A 4A7VA 2HKHL 1WD9A 4JDVB 4DETA 2RACA 1M6UA 3UTTD 5BRQA 4ETYA 5CFAA 4H0GA 2CWRA 3DPBB 4GUPA 1G5GA 4HFUH 4LSQL 5LXGH 1S7SB 4EBQL 4IU3B 1Q9WA 4X6DE 3HZKA 3MN8A 2C9UA 1CFTA 2NXZB 1XGQB 2OJZH 4MFHA 4DGYL 4M29A 3UO8B 5GS1A 1J0KA 3MLZH 2XKSA 3FRPB 5T1JA 1Q8MA 1SF5A 3U0WL 3AWEA 2EABA 2F15A 2WQWA 5EBWA 1AE6L 4PJ5E 1MWAA 5C0BA 3MZTA 3ARFD 3UTOA 3WL9A 1WBXA 1JMZA 1IJNA 2WTOA 2WVSA 3M8OL 5GGUA 3K1KC 3TASA 5K1JA 4IBUA 2UXFA 1MY5A 1CGUA 5C08B 3LKQA 4BQ9A 1JPSL 4ZTPH 2F5AH 5FO9A 3NK3A 3UAAA 2CJSA 2I25N 1JVLA 2JXMB 5GRJL 1UOLA 2IWGA 3H4HA 4N2GA 4F1SA 4JZJB 5DHMC 2XA8H 3US9A 3B2UC 4OJFH 2D0FA 6PCYA 1U91A 1OB0A 4Q52A 1XGPB 1IM9A 3QFJB 4PV1C 4GMTL 2Y25A 1UD5A 5GSRA 1ZHBA 4M62H 1DVYA 5E4IA 3VU1A 3AAZA 3GHEL 1FP5A 1B3JA 1MPAL 2O5YL 4WFGD 4E9YA 1X6NA 4PJ7E 1P69B 4TRPH 2XFXB 5JIQA 3NP3A 4ONFH 2JCWA 1WZ1H 3IYLW 3LKPB 4OZGB 4U1HA 5ITFB 3U4EA 3ULSB 4X4KA 4U1NB 3VVWA 1MRFL 1N6VA 3WTYA 1FF5A 3BKJH 3LZOA 1JTOA 3T0AA 3GS7A 1CZ8H 3EG9B 5GISH 4AQEA 3P77B 3GSRB 3DTXB 5DQJA 3SGKC 1XGTB 3VG0H 1BZ7B 4X6DA 2CO7B 5A2CA 1E9QA 1KPVA 4FEIA 1V55B 1LMKA 3DRTB 3VWKC 4A66A 4MA1B 4N28A 2FIRT 5EWIH 1FV1B 1ZK9A 4W6YB 3SOBL 4Q6YA 2DQGH 3LKSA 4E5XA 2JJSA 4NI6A 1VB9A 2OCJA 1DBAL 1N5YH 4DW2L 2VDMB 2I60H 3DX1A 4G1EA 3EADA 3N44B 2R39A 1Y6KR 5HHOD 4BEIA 3RWEA 5FV1L 3CV5A 3GSXA 1PPIA 4E41E 2W07A 3RUGF 2XNAB 3FO0H 1GPOL 1C9SA 5B1AB 5KYWA 4NNXB 1BJ8A 4KVCL 4XMTA 1YNLH 4KK5D 5D7IF 2EVIA 1EJFA 2YAOA 3C6SA 3EOYG 2IH9A 3EO9L 2J57A 3GDBA 4J7RA 4U7SA 4M43H 3WENA 2ZKYA 5FR3A 2RHEA 1U3JA 4NHCL 1F4WH 1L0PA 1BFTA 1R5IB 3LKPA 5HDBB 2HJFB 4N0YL 1YAIA 4ABUA 3BWZA 4BUQA 5TPWL 5I17A 2BNQB 2DQFB 5ECJE 2DZEA 2QKIB 2R2HB 3MLYL 3MRMB 3HE6C 4KNSA 4LCCA 4MCYB 4UU9A 4I9WE 4V2CB 3RE0A 1BFOA 3ZYJA 1G9MC 4PEEA 1CFQA 3F7YA 2CO4A 4XTRD 1JWUA 1WS8A 1RXLA 4UOQA 5HVGB 4H1LA 2PCPA 4O9HL 2Z31A 2FLMA 3LVEA 2ZUUA 3IRCA 2OMVB 4M93C 2Q6WB 3C2AH 3QH3A 2D9CA 3B8YA 2QQNH 5AWNL 1RJLB 1IAMA 2JFCA 3B9KC 3FFCA 4LPYA 1RUAL 4GAYB 2IFGA 4Q6IA 4GNKB 4EVNB 2NCEA 4BK4A 4ONHB 2CDGB 1KBPA 3GNML 3MRNB 1R19A 4C56B 3VACA 1AHMA 1EA9C 2AEPH 5F7FA 3BDYL 3AU1A 2VUYA 1GH7A 1KY7A 4ZDHB 1CD8A 2DH2A 1EO7A 2WUBL 1C5DA 3MYZA 5T3XE 1UWEL 2B15A 3BLBA 1QI4A 5MHSD 4C55A 4Q58C 4UDUA 4LLQB 3LHPL 1T0MB 5ISZE 5CILH 4LVOC 3GJEA 1V7NH 1U8PA 2FD6H 2YBRB 3CZUB 3FW6A 4FX5A 4F20A 5DF0A 3VXUB 1KWGA 1IGJA 1BVKA 5T3ZD 2NZ9C 2EDYA 1AD0A 4Z23A 5MEQB 1AANA 2F54D 4LAJH 1HL5A 4LCVA 2W0PA 5HYQB 3T1WA 5E4AA 5IJKA 2J5WA 5FKPA 2YLHA 2J8HA 1A7OH 1TXKA 1D6VH 3UBHA 3QEGL 1BEXA 2G2RA 1VENA 3IKCB 4EDXA 1NINA 1JPST 4JKWA 1Q9OA 3HMXA 5BXFA 3OKDA 3G5VA 4HLZG 1IBYA 3B9AA 1ZPUA 1BQKA 3MQIA 4XNQA 5HHVH 3Q0HA 4GKLA 1IKFL 3LPPA 3W9DA 5KVEL 3OKOA 1ETJA 3B5GA 3EYUH 4N20A 2BVEA 1ET7A 2FSEB 3T8XB 5HI4D 4X7FC 2DWDB 3QI9C 5HVFB 4O58L 4OFKA 1IC4L 3ALPA 1WAEA 3ZDZB 2DD8L 3X14B 4A6YB 4N6QA 3KCPA 3CFUA 4KAQH 5EIQA 2GABA 3RPBA 4IDJL 4YIQA 4UTBH 3DOIA 3RWJB 3N04A 1MEXL 1FZKB 5FYLD 5LN8A 3ULVF 3CH8A 3QUMH 4UILL 2VR8A 1NZRA 2BFGA 2I85A 4X6FA 3ZUCA 2WBWB 1ZV9A 4ZUSB 1A6VL 3T8MA 4R4FH 1G6RH 1YEHH 5DT1H 4YS4A 2VLKA 1B4JH 3M1BA 4YH6A 4EZLA 3QT2A 4YBQD 2DL9A 1GAFH 3L95A 3SY0A 5IFJB 4RISH 2COQA 4UT6A 2X89D 3P30H 4NQSB 4U05A 4YE4H 4UT6L 3ZSSA 4JJ5B 4HPOL 3RL1A 4F5CA 5E99H 2I5YL 1HI6A 3AG4B 1JV2A 3D2UB 5F88B 3LRKA 3DSNA 3GLEA 2OSXA 1JHKH 4W68A 5DVOA 4N8UA 1DSFL 1O5DT 4NS0A 5IEKB 1AHWC 2MNWA 1WAPA 3UGXA 4O5LH 4AYGA 1GHFH 1CLYH 3L1FA 3JV0A 3V7AE 4B9FA 1EO5A 4YBLB 3EH2A 3JV4B 4U1JA 4ZSOB 1QOKA 1MLCA 2DQIH 2Z1KA 2A6JA 1A1NB 1T2QL 4Z7QE 5BXFB 5J7CC 3DUSA 4ZFOA 4LF3B 2YD1A 2QGBA 2FBJL 2ZOKB 2LFGA 3UC0H 1MW2A 3L7EB 2Z64C 4AENA 3QWOA 4A7GA 3DVNB 5A6MA 4LKCB 2VR9A 4R26L 4CC1A 3L48A 1D3CA 1TOXA 5TE7H 3DDGA 3S88L 1F00I 4M8UA 3CLWA 4YDVB 4N0FB 3CHXA 4XMLH 1FH2A 4HC1L 1NCHA 4PVLA 3UMNA 1JGUL 5B39G 1G9NL 4W6XB 5AUMA 2DY2A 1A0QH 3SOTA 4AUYA 5I6XC 3NABH 2DWTA 2KLSA 5AW3B 1HOCA 4NB7A 5ESAA 2IAMA 2E27H 1I3UA 3JWDH 2AS5M 3IMBA 2J4WL 1YYML 1ORQB 1XAUA 1UD8A 3V0VB 2MQ0A 3BGAA 3HZVB 1UWEH 2WZ0A 1KCUL 2HX9A 1H15A 2APBA 1HVXA 4WI0B 2YAEA 4ZODA 3SGEI 1I1AB 3VI3B 2CDFB 3SBRA 3QO0A 1DANU 1CDUA 2V33A 4P9HH 3ZRFC 3EIFA 4N9OB 1WITA 2ZOLA 3MRLB 4F2EA 1MNNA 3ARTA 2EYRA 4JHWH 1KB9J 5TD4A 1CF1A 3MRNA 3DUUB 4QTIL 5EO1A 4HX1A 1FO0L 2VLJE 5EFIA 2XQ0A 1XL4A 2DLIA 3MRBB 3U1SL 3N0PB 2F54E 1Z5YD 1ZXQA 2BZ7A 2FGWL 2NQDA 4R7NA 3L3GA 4Z9KB 5E2VL 5MERA 3DMMC 2QHLA 5C3TA 1HJBC 1V3MA 2WZPD 4UQDA 3MLRL 2W9LA 3F7KA 3MBEC 1DBAH 1F6AA 4FNLL 4NERA 5D4IA 5EC2B 3P4NB 1WP6A 3WJLC 3ZSTA 5GGSB 4F2MA 2RB8A 4LHQB 2VITB 4Z7NB 3WN6A 1BFOB 2WXFA 2O72A 1AO7E 3NK4A 1GS6X 1KIUB 4OLVL 4E9TA 2HG5B 4MHHG 3NGBB 3RP1A 4G3YL 4OF3A 4NWUL 3C5SA 3GPSA 4MNQE 5SX5K 5SWZA 2D0HA 4I1NB 4O58H 4AKOA 2DWSA 3UZEA 1UXLA 2F2HA 3ZKSD 5IVXA 4YSEA 4YHPB 3C9NB 3KBHE 2CGRL 5HI5D 4EUPG 3IMSA 5D7IA 2AFNA 3IDMB 3PWJA 2EIZA 2Q86A 5E2WL 2EICA 3RPIA 1FNLA 3AMKA 2R23A 3CC1A 3O0RL 3TYGL 3VXRA 3BVDB 4X9GA 1MCFA 4HOMA 1FL6B 3NESA 4WCYL 4YSUA 2F68X 4XVUC 1FG2B 5J5EA 4TF4A 3CZSA 3OJDB 1LMIA 4GRLA 4G1EB 2P5EA 3WLBA 1ZIAA 5K1NA 1BA9A 1YSOA 3CVIL 3ARZA 4OLWH 5KSBB 1JPSH 4GRWF 3MRGB 4Z7WA 2WB7A 3M07A 5A7BA 4B9ZA 2F54B 1DVQA 3OHXA 3OPZH 2I07A 5JO5A 3TZVD 3WOVA 3AU0A 4X6DB 1T04B 2E3VA 4X4XB 2FO8A 3FT0A 5C07D 2YXMA 2J8UB 4MWFA 1L5GB 3CVHB 3PHAA 3QAZB 1TNMA 4FQXD 4XCFH 3HFMH 4F92B 1RZKL 4OCRH 2WPGA 2BXZA 1J1PL 1WZ1L 2Z65C 3NA9L 5JOPE 4FQHA 1HHGA 1SBSL 4JM4L 2WJ5A 3AAZB 2F54A 3JVFC 5C70A 3V79C 1Z9NA 1AGEB 3HBZA 5CZXC 2IV8A 2ZWZA 5GSRB 5ALCL 1A2YB 2K70A 1GS8A 3BIAX 3S3DB 1VLXA 3T0VA 3UEQA 2WXRA 2TRYA 4GUCA 5DVMA 3I50L 5FECB 2IBGA 2OMNA 1LO5A 2DS4A 2E7HA 2AMGA 3MLVH 3S88H 1OSZA 2P5EB 2VQ1A 2Y3AA 1W6WA 1BQLH 2YR3A 1O6VA 4IRJB 2MCPH 1WGOA 3QUXB 4K23L 1TMCB 4E42B 2FVNA 2MFNA 3IJ7A 1H3PL 5DK2A 1H5BA 2LOEA 3TPKA 1KJVA 2Y24A 3G5XA 4FXKB 3T4AB 3U4BH 3M8OH 2ICEB 3HBQA 3HC2A 4JJHA 3M17A 2OMUB 4KTYA 2X9ZA 4TNWK 2UZIH 4XAWH 3U7YH 3VB8A 4XMUA 1XSOA 1XGZA 2YUVA 1ADQA 3U1PA 3WFHB 4OJFL 5EPMA 3ZTJH 1P84K 4P2RD 4ABVA 2CHZA 5HDOA 4JHWL 5HBBA 3IRZA 1YY9D 4CMHB 4ZMTA 1L3NA 3T3ME 4W9LC 1BIHA 3CUPA 4WO4B 1A4JB 4JDVA 2YO3A 5CEYA 2QMKA 3BKCH 4KROB 1ACZA 1NJ9A 3G08A 4A68A 5HGAA 2W9EH 2QBWA 5I6XB 1IZKA 2J5LC 5JNYA 3MPCA 2YAHA 1MDAA 4AL8L 1J5OH 1E9PB 1OKEA 1FH5H 2VKXA 5C0AB 4CVZA 4NSKA 4XGZA 4DNLA 1QPKA 3WIHH 5DEJA 1SM3H 3BD5A 1SMOA 4KHXL 5D71L 3TO4B 2D7QA 3BP5B 3VSUA 3HUJE 4Z78A 1WICA 2YD6A 3FB7B 4KY2A 3FJTA 3MJ7B 5GGSY 1X9UA 3VMOA 3RWFB 4XMLL 2D7NA 4PCSA 2IGLA 4WUUB 1MFEH 4CADA 2ESVE 3VFRA 3MNVB 4ZG1A 3WE6B 5ID1A 4YSTA 1EMTH 1AGFA 4PWHA 1M7IB 3S37X 4PREA 3MREA 3HB3D 2VMFA 5FYKE 1U8QB 4PS7A 4XOAA 1E28A 5ICYB 2E27L 4I7ZC 4J2XA 3NCJL 2VQ4A 2IH3A 3U4BL 1SLUA 2OMXA 4FYRA 3VXUD 1KCBA 2C4FT 2CA4A 4NQCA 4ZSOE 1DUYB 2ITCB 4PJBF 5CZRA 2DAVA 3AITA 3TPUA 5CP3A 3J2PA 4DQAA 3IJYB 2VDOB 3QORC 1JGDA 1CBVL 1GJWA 1TFPA 3DA0A 4LASL 2DQHH 3VFSB 4X5XA 4HU2A 1P5UC 2J12B 2GSIA 1QWUA 1W80A 2Q8AL 2F7OA 2ZONA 2NNXA 3CHSA 3PG2A 4OLEA 3ZTEA 3RDJA 2PYEA 3CVDA 1D5ZA 2NY6D 4JHAH 3DIVA 4HOZA 4BRJA 3MNZB 4ZUTB 3K2KA 5GJTL 4A7GF 5C0FB 5B1JC 5HHMD 4G42B 1OCWH 4AV5A 4NAQA 1MQKL 2DIAA 4K9EL 3FC8A 4XCFL 3W57A 2PP8A 1UD6A 2OCCB 3V52H 2AABL 1UB6A 1PJWA 4ELMF 5BS0A 3THMH 3O9WC 3CHQA 3CDCA 5AKVA 4EIZC 2FX9L 2XG5A 2CZNA 1DJYA 3GEFA 4MBOA 4RA0C 4HWBA 5FB8A 4FMKA 2CK0H 1R5WB 3Q48A 3IDJB 4YOKA 4JQIH 4ODWA 5G5DB 4YGVB 3FQUA 3UZVB 1MHPH 4ZAKD 4ZNCD 3IU4H 5AENA 4HALA 5I0ZA 5K59E 1HSAA 3ESPA 2PWFA 3LEYH 4HK3N 4AM0Q 2DB8A 3CZKA 2ZX7A 4NPKA 1ZANL 4HS3B 5FYJE 1KXTA 3KGUA 3WAJA 3QIBB 2H2PC 1NPUA 5K9QG 3C5ZD 1AGBB 2WLMA 3J7HA 5J1AB 3WTSA 1S2EA 5D8JH 3G5YA 1SDYA 1A8JH 3KEDA 3DROB 1UA7A 4JMXA 3VI3E 2D8KA 1GTNA 1OT2A 3U6XS 4BA0A 1F2QA 5D1XE 2BSED 2JTYA 1GC1H 4YXLL 3I02B 2X7LA 3GBEA 2BIOA 2YRLA 1IEHA 4L4VB 5K39B 2HZHA 2JTDA 5J89A 5JW4N 1I8UA 1UATA 3UL4A 3BSGA 3WEOA 1R3IH 1KTLB 2WINB 3OC5A 4JO4H 4LCIL 3CDYA 5ID0A 2IFFH 4RMQA 5C09B 1HESA 4Z3FA 3PABB 3WE1A 3WNKA 2C7FA 1DBBL 5FM5M 3B3BA 3FT4A 4MZ2A 3HPJB 4Y5YC 1EFXB 4XBPA 3QHZL 5DUJA 3MCKB 5ADPL 1D5XA 2PO6D 2EYTA 1D9KD 2P49B 4PHZA 1NOLA 3WU1A 4RRPM 4RBPH 5CILL 3H9ZA 4LCWA 3B56A 2X3AA 3IFPA 3LNIA 1RUMH 5KBNC 1E4XH 2LR4A 3QZWG 4RAVB 1LK2A 2VYRE 2FYYB 3LQZB 3DJ9A 1HHHA 5I2IA 5L4JA 1J8KA 2NSMA 5JHAA 2AK1L 1YDPA 4GBXD 4GINA 3EO1B 4UBDC 1JUFA 1IIKA 3NACH 1UYWH 4XP4H 3VX0A 4FD0A 4B50A 4DOHB 1M9WA 3X11A 2VDLB 3MR9A 3VWJC 1G0XA 1MRCL 2EE3A 4ZDHA 2P80A 3NJGA 4QRAA 4PUBL 2LTQC 2UZIL 2NMSA 4XAKE 1CYGA 2OSLB 1PSKH 1ZY9A 4YWGH 5MEND 5FYLL 3ETBJ 2OZ4A 1A7QL 3GBML 4YHNB 1NCIA 3C60B 1T5XA 2FNWA 1JYNA 1J9TA 2C9XA 4QO1B 4EVNA 1EEQA 3OR6A 4BZ1L 3NIFB 2CHXA 4M6OL 3TO4C 2VXQH 5K9KA 1L9TA 1I3GH 2AANA 3CFEA 3VTMA 4ES8A 4DP5X 1FVDB 3D3VB 3QI9A 1P6AB 1NAMA 2QT6A 2F74B 4J8RB 3X12B 1RULL 4QIRA 3LN5A 1PG7L 1IQWL 1VHPA 2GAZA 3PP4L 1LDSA 2IALA 4JFPB 2IXQB 4PJGB 4WCYH 1KY6A 1OGTA 3QJOA 4NPYA 4ZUUA 5GZOD 5KSAA 1F58H 1H9DA 1OY3B 2ADGB 2GTWB 4MYWB 5C09E 3ALWA 3BC9A 4ZS6D 2UWEF 3ECBA 3DETC 3DV6B 3QUZA 2WBJD 5HJGA 5EUKA 4I13B 1NSNL 4OY9A 1WWCA 2X4RB 1OQOA 2TAAA 1EHKB 1V7MH 1GW6A 2ZYSA 3RVTC 1QQDB 3BAJA 1O9VA 4HS8H 3TM6A 3QHTC 1VZGA 3KPOB 6FABL 1CGTA 3CZFB 4G7YH 1G7IA 2PPEA 5KUKA 1BREA 4HIIA 4JBSA 4NWUH 4O2EA 3PWPA 2XZAL 2XTLA 1E6OH 3DGDA 2R69L 2CKBL 1T0NA 5F3BA 4N9GB 4WI7A 4FULA 3ZR6A 4DT2A 1OZUA 3IK2A 3NFPA 5EU6E 1LNUA 2JI3A 3FUJA 1FWXA 1KPRA 3TBWB 2WKOA 1OCCB 1EZLA 1I8AA 3NPSC 3QUKB 2WTPA 3CZEA 2XIBA 4ZFQA 4GRLB 3WLBB 4M8QA 1I3RA 5HHNA 3F6JA 2ZCKH 5KBLA 3G5ZA 1JNHB 2I26N 3Q8CA 1RURH 3RPKA 5I6KA 5D72H 4W9KC 4WQOA 1L6PA 1XAKA 2HX7A 2OAAA 1IQDA 1U8CA 3TWCL 3DXAD 4G6AC 2AQSA 3J8F7 3GMQA 3B9KA 2BVOA 5KVFH 4TM9A 3TTSA 4KI5E 1I8MB 1ZGLB 3ENEA 3R0NA 2BVUA 3ARFC 4LHUD 2CO7A 4FTVA 1RZ7L 3NCBB 4FI8A 1C1EL 1IU1A 3NJVA 5GRJH 1QA9A 2ARJQ 4OSUH 3V0FA 3EGDB 3BZFA 1BD2B 2OTWB 2A83B 5L2KB 4BUHA 4M48H 4GS7B 5FUOL 1VAHA 4Y4FC 3FTVA 1ASQA 2K7QA 4EZMA 1SOXA 3LZLA 1X7QA 3VRLF 5EU6D 4P99A 1UXSB 5KVGE 1TTAA 3P3TA 4GG8A 1DQKA 3L5WA 4NRYA 3WUWB 1INQA 2WWMD 4PJ8A 1HILB 4TKWA 4WKXA 1F11A 4OI9A 5FO2A 5EZOH 1XF4A 2BIQA 5I82A 2EEAA 4P04A 1OPGH 4OZ4A 4OZGE 1HCFX 1IGCL 3APNA 2FH8A 3KNBB 3GTTA 3N1PC 1DE4B 2FQDA 1YNKL 3L3IB 4N5EC 3EF7A 1DSWA 5AB0A 3RWDB 4WHDA 3HLKA 1OSPL 1KV3A 2EKJA 3FNKA 4U0QB 4R6UA 2E46A 2WVUA 1HEZA 2HN7B 3VXNA 4W9HC 3H0TB 4H8WL 4ZO7A 2P46B 2E4FA 4PRHD 5AOIA 4MLSA 1O7SA 2D2CC 3I74A 4JKNA 3U1SH 4YHNA 1NCCL 3CFNA 3VGGA 1U93B 1J5OL 3OD3A 3QEUB 4C83B 4NKMB 1JGLH 2UY6B 3H2QA 2Z9TA 1JF1A 2I32A 3HNSL 3MROA 4KV5F 5F9DC 3H55A 4GRWB 2R2BA 5HGDA 5AFAA 1JZIA 1Q9LB 1NCOA 1UEYA 5HDQH 4D9QE 3F64A 3MLRH 3LB6D 2W88A 4WK0B 3EBGA 2ISDA 4F9PA 1V54B 1CGWA 5CCJA 4W9IC 2Q76B 3GSQA 3FCUB 4L4TE 2LVCA 3UDWC 1XR8B 2E6QA 1D5IH 1EIBA 4D3CH 3NABL 3V2AR 2QPUA 3MRFA 2KLTA 3P3RA 1AGCB 3DJZA 4NWTH 4JANA 2ILLA 3VXOA 4ERSL 5E8PB 2DM7A 4X6EA 1JNJA 4QT5B 3HHSB 2KPNA 3EOAA 3PWLA 1G7IB 2JB6A 2AEWA 5CP3H 1CTNA 2NCMA 5JUEL 1O9WA 1F2XK 1QSEE 2ZF9A 4PRIB 3RIFF 4AEFA 1NGPL 1PDKA 3D34A 4K2UL 4JRYE 5HDLA 3TO4D 3WDIA 2BFVL 2MH4A 3B2PA 4MMZA 5CJ5A 2VXSL 5EUOB 3V0WL 2W1NA 4JDEA 1BPVA 1N64H 1PL3A 1SJEA 3ILEA 5D6CA 1CG9A 4HJUA 5DJDB 5EEWA 2BWQA 1CIUA 1JD9A 4IYKA 5IV2B 2YD0A 1OAQH 4E9SA 5D1XB 4YHKH 3HC0B 3DK0A 1RHHB 4JG1L 4UMSA 2B4CL 4NUJB 3B83A 1FVDA 3QI9B 5FOBA 5DRWA 1A3RL 1VGKB 4WY7L 4LSUL 3EO0B 1N70A 1OTUD 2VN6A 3S5ZA 3LSOA 4UINL 5CMAA 3Q1SL 4ORGB 2ZSWB 1YUHB 3I6KB 2A9DA 2XQBH 1TIUA 3DO3A 3KR3H 4Y4KC 1Y0LB 3SDCA 43CAB 2OMTA 1SJHA 2EDQA 3MFGB 2WXHA 4OVUA 4OCRL 4U1MA 3QUYC 4IGBA 4Z0BH 5E5MB 4GQPH 5BVJB 3BLKA 4U3SB 4XHJC 2DQEL 1JHLL 3MUGA 3IDJA 5C0IB 1V05A 3W1ZA 1FO0H 3KLLA 4HIJB 3VFGL 4AG4L 2H2SD 4DGIH 4JN2B 1KYOK 4GKSB 2AJYH 1U3ZA 3FQNA 3EJYD 2CLZB 3HMWL 4LVHB 4LGRB 3LKRB 4UAOB 2A0LC 4EDWH 4IBZA 2A74A 2LV4A 4KKAC 1KXQE 5I0YA 5E8NB 4MD4B 1LO4H 3NIGB 4L4JA 1AO7B 1YJDC 4Y88A 4JPSA 3VFUB 4NEHB 1BX2B 1I1RA 5EEVA 2OMYB 2DYPB 1FYTD 4HK0A 1HHJA 3KYOA 2P8MA 1LEKA 4LGPB 3F04A 3ZBMA 3KXFA 3WJJA 2HT3C 1BFVH 5FLUA 4JHBA 4I89A 2PPAA 4C56D 1WFNA 2B4CH 2DD8H 1ZLVH 4XC3L 5HYQA 4KI1A 4HOXA 4JDTL 4EQ2A 4LAQL 1BVKB 5F0JB 1HOEA 3CC5A 5LDUA 3QXDA 3MRQA 3I02A 2V2TA 1ZS8A 3MV8E 3ZT5A 4YFEA 4PB0H 4Y4FB 5I15H 3BVNB 1U8MA 1TQSA 3WFCH 3VRIA 2OMWA 2X3CA 1FSKB 3KXFD 4KZ0A 5GRVL 3SGDH 4GG6F 4XXDB 2YGNA 1MNUL 5GJSH 4K5NA 1G9EA 1LD9B 3IFOB 1KN2L 4B60A 2R1XB 1YN7A 4QTFA 3VD9A 1H8NA 5T1DL 3J27A 2P5WE 1PZSA 2WJ7A 4QF1A 4M00A 3WCYA 1BOGA 1KJ2L 1QZNA 1WWAX 1J1OH 4P2RE 5I23A 4HDIA 3D4CA 5CZKA 1C08A 5L7XH 1S7QA 1HNYA 3NQIA 3V0GA 4M6MH 1DZBA 3QIWD 2ZYRA 4MVBC 4ODWB 4GW4A 2BK8A 1LEGB 4X9HA 5F1KC 2Y5TA 3H1ZA 1AC0A 4HMEA 5D7LE 2NUPB 4X6DF 5A3IC 2DQDL 1J5IA 1VEPA 4M5YL 1QI5A 5BO1H 2IPUK 1QSFA 1VEOA 5AKSA 1S9YB 5DURB 4WHYH 1INEH 4KK5C 1AI1L 2NY0D 4U1GB 2VLRA 2O26U 2C1OB 1RU9H 2JQMA 3NAAH 2H9GA 4JAMA 5E1HB 4AGMA 4PJHE 1KBKA 4BCYA 5ANMB 3NRQA 4DP9X 3FAWA 2WLLA 4P2OC 5I75C 5B3NA 4WRLA 3P0YH 1DVXA 1CCZA 1EJOH 4UOW0 3S5LA 4G59C 1K8DB 1NSNH 5CD3B 2F18A 3HOGA 4LK4A 1XCQB 3KLSA 4AMWA 4IIQC 5KSVA 1F41A 3O4LA 4ZMXA 4PD4K 1BXAA 4FFYA 1J0ZA 4NGHH 2F8IA 1JPTL 4YVUA 3IJYA 5DEZA 1PX8A 4DKFL 1KTBA 5DJXA 2F53D 4FI7A 4HIEB 3UX9B 2ITCA 3HBGA 2D7PA 3IFLH 4QHMA 5DD6B 3I75B 5A2IH 2Q7NA 1TF4A 2N7AA 4AYDC 3TA3B 1GL4B 1NMCB 3UPRA 3AC0A 1U8QA 1AAJA 5I73C 1GY2A 4K71B 1X7SA 1DQQA 5LWYH 1G9MH 2EXTA 4PRHA 5GIRA 4ZUVA 4AV0A 3L1OL 1BZ7A 1RZKH 5G2NA 2W0LA 4PJ7A 4E36A 3S5YA 2IH8A 1XF5B 3BKML 3EG9A 4FJYA 4GW1A 4ODUB 4BH8B 5CJXA 1A9BA 5GISL 1CDIA 4LRIA 2GW5A 1WC7A 4U2ZA 3CFDA 2X4RA 4ZYKA 2CCLA 5F9OH 2M83A 3ZLQC 2AEIT 3MNWA 1I1YA 1ND0A 3QFDA 5D5MA 1VADA 4WV1A 4KAQL 2Y2TA 3FQWB 2VERA 4N24A 2K4WA 2LT9A 3AREB 3TYFB 1MG3C 3NFSH 4NPYB 5GJTH 5I1HH 2W38A 2QELA 4JRXA 1KJMB 4PJCF 1FL5A 4QHMB 2CCWA 3HUJF 3T6WA 5CHNB 3AG3B 3M7FB 3PGCB 2BSDA 4ODTH 3LDBC 2UWEB 1U8HB 1UWFA 5BOPA 2RQ8A 1H3XA 4DGWC 3IGAB 3I6LD 1O9ZA 1IGCH 5AKTA 4ODBD 5JUEH 2HKFH 1TTRA 2YD5A 4K3DL 1ZHKA 3ISYA 3IS0X 4MTMA 2CKNA 3MLXH 3VSQA 3EJPA 4AGOA 3EUDA 1FN4B 1FN4A 2CRYA 2Z8SA 1NMBL 5IHUH 1QLFB 3GMOB 4YLCA 4N86A 1M71B 1U6AH 2NNCA 2Z34A 3WJMA 4Y2NA 3N41F 3BZ4B 3A4FA 2OR8A 4EIUA 1CXHA 4L3AA 5KSAC 5MI0C 1MJ8H 4IOSD 1HE8A 4FLSA 4OLZL 2W0KA 4S10A 3KYAA 4NDMB 3SGJA 1E27A 1JZ8A 2NLJB 2FJGB 2FBJH 5GGSA 5SWSE 4AQZA 3BPOC 1J05B 4TLKA 5KYYB 3GQFA 2OK0L 4PRIE 4MJ2A 4FQHB 5FYKU 3GT6A 1HAUA 3GHBH 1FFNB 4H2CA 4N22A 1JFHA 5KJ4A 4MQ7A 4WHTA 1A9EB 2AJSH 2YD4A 3FQ4A 3HG1E 4NQVB 5TF1H 4GEJA 5F7NC 2X6MA 4OCSH 1QTYT 3TBTA 4EQ3A 3NSXA 2J8UA 4MWFB 3RY5A 3ZZSA 2F6AA 2OMBA 1UCBH 3MV9E 3B2VL 3OHXC 3VFGH 1DBMH 2HAZA 1NAML 2ZOLB 3MRLA 4LEOB 2VSCA 1F42A 1M53A 3E3QE 3MRKA 3MRCA 4M5TA 1QAWA 4TXVB 1QNIA 4UMGA 2MJWA 2WD0A 2IAMD 4S1RL 2JCCA 4OM0L 3X13A 4XNUL 1UTDA 4BZ1A 3AG1B 2P8PB 2JNZA 3FFOA 2EAEA 4X98B 5DYOA 5LNGA 1JGVL 2OZNA 4G7QB 1CYXA 2K7PA 3HRZA 2IADB 3L6FA 4LESA 4ZO6A 4KZDH 4G71B 4QRRA 3LDBB 1MOEA 4HJGA 4MX7A 4KFMA 1AXTL 4PJ6A 3NZ8A 1FRGL 1BG9A 1E5UI 5DMGC 4WDIA 5I71B 3GBNH 1G94A 1G7PA 2Y7QA 5C6TH 5T3ZE 2QQKH 4I87A 3AREC 4TNVK 4FHKA 3CH1B 1DQVA 1V3LA 5IMOA 1QR1A 3QNZB 3DO4A 4NPJA 1XIWB 3EYOA 4JKPL 4EF3A 1IT9H 1C12B 2OV0A 1NGYA 3PHQB 1AZNA 1XO8A 3FUHA 1R5WA 1DVFA 1DQIA 1HHJB 1X5KA 2WYZA 5HHOE 5DK3A 4PBVC 1YYLH 4LVEA 3LXUX 3PHOB 1DLHA 5AOJA 4JN1L 4KMTL 5IQ9B 2I7SA 4OAWA 4AY0A 5DZJA 1HXMB 2K0RA 5G4OA 2DOCA 2GY7B 4NNYA 2DKMA 5DLMH 3RWIA 1NKGA 4MD0A 4TS6A 5DZVA 1E5BA 3M45A 3EJRA 2ZUQB 5E0FA 1I3GL 2V3FA 2JLPA 3HN3A 3U25A 4YHML 1DEEB 3V5HB 5MERB 3ZTNL 3SKUD 3MUGB 5JHLH 3WSQL 5DD5L 4GW5A 2P26A 1XIWA 3TL5A 1HE7A 1S7QB 5EFIB 3C6LC 3Q8AA 4JFQA 4JHAL 1G6RL 3QW9A 3D9AH 2EYRB 3RILA 1A8ZA 3V6FA 3RUGE 4HD5A 3HB3C 3EFOB 4V2BA 4YSOA 3SDCB 3X1FA 2J73A 2EACA 5GZOA 1JZDC 5BUGA 3S8WA 2YOCA 5IBLD 4I9WD 4N2DA 1MCDA 2E7LA 1A6AB 2V9TA 2YRBA 4DJMA 2J1ZA 3AMLA 4GI6A 5JPNB 15C8L 4YDJA 2OQJA 1QACA 1BFSA 4Z95H 4XP6H 4J3TA 4UTAA 5F7YC 5ANME 5J6HB 1HH9B 4QHKJ 4WNJA 1KXHA 2LVEA 1UACL 2X2HA 3WEAA 4GIOA 3BLPX 4O2CA 1SY6L 1MJ8L 1R75A 2AXFB 4G8GA 1ZE3H 1U95A 5FGBA 2YMXH 1M2OA 1HJCA 2XU9A 3STZB 4Z7OE 4JG9A 5CINH 3FUFA 4S2SB 4MQTB 1EAJA 4XH2B 1B9ZA 1DBBH 5FFGA 2HRGA 1BDYA 3BQUA 2L7EA 4A2FA 3ZHFA 1S8DA 2DLFH 1DJSA 2K4AA 3EGXB 1HZHH 2UXTA 4PH8A 4L3ED 3ZXAC 5IFAL 3CU7A 3Q8FA 2QDWA 2OTPA 1JXJA 4XNMB 1SXBA 2B59B 3X1NA 1OLZA 1OWWA 3PDOA 1ZLUK 4ZPTB 2DN7A 4AEIH 1FFPA 1U9KA 2DI8A 2BSTA 4LOVA 3RVVD 4XNBA 2PTUA 5HYEA 5JORA 3KM2A 2Q20A 2WXOA 4P2QA 5H2BA 4ZPVB 3KW7A 2IPUG 1JK9A 3ILPB 3GNMH 5DD1L 4AGLA 3Q13A 3HNTL 2ZP0T 1OZTG 4XXWA 5MP6H 3SBQA 1OP3K 2FJFB 5BRZD 4POZC 1MCOH 3BVTA 2XVLA 4HGMA 4KOBA 5HJBA 5IESH 4WNQA 5F9JA 2FYVA 1AZRA 3L5JA 4HIJA 1R47A 1PQZB 2JJSC 4LSVH 4EI5B 3IGLA 3NSFA 4NO3B 3AROA 5B8CA 4ACTA 3LS5H 4TULL 3UJJL 4BFBD 1MG2C 3P1VA 5GGRA 3BN9C 1QNZH 2R2BB 3NSYA 1TJIH 2WYTA 1JOIA 2YFNA 1RVFL 2BP8A 5T1MA 1KCKA 4I5BA 4M93B 4ZXBB 3RQ3A 1SJHB 1HNFA 3FB5A 4HWEL 1RK7A 5CZXD 4TNFA 2NYYC 5E2UH 5J0BA 3MV7E 2CG9X 5DGRA 3C87A 4B9KC 4GBXC 5DRXB 5CMAB 4GO8A 4X4ME 3BXNB 5DZNA 4F37F 3CX5K 3I9PA 3GSVB 4YIQB 1HDMB 1BMWA 3ETTA 1WBZA 3QR2A 4OF6A