1PFCA

Molecular-replacement structure of guinea pig igg1 p*fc(prime) refined at 3.1 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
111
structure length
111
Chain Sequence
RTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IGG1 PFC' FC
publication title Molecular-Replacement Structure of Guinea Pig Igg1 Pfc(Prime) Refined at 3.1 Angstroms Resolution
pubmed rcsb
source organism Cavia porcellus
molecule tags Immunoglobulin
total genus 8
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 1981-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pfcA00
1CLZL 5HD8C 5DJ2B 4Z78A 4NZUL 1BIHA 4OZGB 3H2WA 4N5ED 4YQXL 2F5BH 2DYPB 3LMJL 5FCSH 1WGOA 3GSRB 4IMKC 2WP3O 5JW4M 4QNPE 2FSEA 3R1GH 4LCCC 4P5KB 4R4FH 4AM0B 1FYTD 1D5IH 2R4RL 4OJFL 3FCTB 3FO2A 7FABL 1RZ8B 3IKKA 2EO9A 2XKNA 5HDBF 4GRLC 3SGDH 5KW9L 4KKNA 2HFFB 1Q0YH 15C8H 1ZWIB 3QHTC 2E8ZA 1JF5A 1IC7L 5DFTA 1BP3B 5HVGB 3D6GA 2C3XA 3H0TB 2R29L 1D5MB 1P1ZA 2DBLL 3O3EA 4M7LH 4NJ9H 2CMRL 1RV6X 2WUBH 5EDXA 2Y36L 4HPOL 2CPCA 4QXTB 4G3YH 3S4SB 1CLYH 1J5OH 1EHLH 4LPXA 2AEQL 5DD6B 3D0VB 4LNRA 3BD3A 4NQCE 2A9NH 4H26B 2G75A 5TDPB 1UC6A 4Y1AE 3MREB 3G9AB 5GPRA 1IGTA 1NBYA 3E3QC 3WUWB 5KSUB 5BV7B 4L3EA 1YMMA 4FQCH 2PTUA 5I2IB 4Z7VB 1B0GA 3T1FA 4DFIA 1A47A 2JB6B 3DUSB 1EEYB 5DJ8A 5F6IB 5INCA 3X12B 5IR1B 5J4MA 3CIQA 3B2UD 4S1SL 4EDXA 3BIAX 4OLYH 5DJZB 4WI4A 2GTZA 1DBJH 1YEFL 5I8OH 3QDAA 1MRFL 3ZYOA 1LD9A 3DURB 4WFHE 4GKSA 2D03L 5HGDA 3BOVA 3ARGA 4X9BA 3QIWD 4YDIL 4YZFF 5SX5K 2RJMA 3VFOB 1B0RA 5D2NB 3ZE2F 4LVNB 4HS6A 4HGKC 4CGTA 3VDBA 1JF1B 1S7UB 4KY1L 3S8WA 4WJ5A 3QIWB 5CZVH 4ODHH 1JHLH 1GL4B 3B9KA 3LOWA 2XOTA 4AG4H 5ID1A 3GSNA 4Y4FA 2CDEA 4OZFA 3L3DA 4MD5B 4XMLL 4PY7B 4ZFOB 4J7RA 1B2WL 3FQUA 5HYQB 3MLVL 4Z7WF 2DQHL 1BQUA 3VH8A 3T0BA 1JK8B 4P46C 2ADFH 4NKIH 3QBTB 4EUPB 1M7IB 3RWGB 4G8FB 1XGRA 5IQ7L 5ALCH 5DMIL 5IW1B 1AFVH 4FA8A 4OIBA 4PJIB 5FAAA 5HHOD 3EJYC 4AH2B 3QEHB 4QRTA 2ZSVA 1DQMH 3LKOA 4NFBA 1FSKC 3EYQD 2VZTA 2YUXA 5HHOB 3MODL 4MWFB 4JO3L 1HH6A 4K7PY 4WEBH 1MAMH 5GZOC 3QG7H 2X1XR 5IJKC 3NA9H 4BH7B 1UQSA 1A6AA 2H6PB 4QRRB 2NZ9C 3ARDD 4IHOA 4I0KA 5ACMA 3SO3C 1OWWA 1KB5B 3TO2B 4FRWA 5GS0D 1P5UA 1C8PA 2ARJQ 1QA9A 4NQEE 2VAAB 2FD6H 3IETA 5E8EB 4F8TA 5ADOH 2XN9A 3KPSD 4F37F 2Z31A 3GO1L 4JO4L 4OM0H 1EX0A 5I8CA 2GEEA 2C3VA 1RD6A 3KPSB 2FBJH 1CT8B 2OYPA 2B1AH 1UYWL 4PRIA 4F3FA 3D2UA 5M95B 3IFOA 3DVNB 2AJZB 1DCLA 4C4KT 1HOCB 3ZE1E 3U9UB 4NQXA 2W9LA 2YC1A 3IDXH 1CDJA 4X7CC 5IB4B 4QHLB 3BDYH 3IDJA 1TCRB 3UBXB 4P2OC 3HE7A 1CQYA 5F6HI 1KCKA 3MLSH 2CLRB 1MLBB 3FL7A 3ULVH 4S2SB 3V0VB 4X99A 5D7JD 1DBAL 4CN1A 1DQLH 4XBPB 3BRDA 1AJ7L 4G7YH 1KEGL 1GZPA 5DUBB 5C09A 5IMMA 3CCHA 4NNYA 4HH9A 4XX1G 5D7JB 3BEVB 5FYKD 3O3DA 3UTSB 3EO0B 5DD1L 2XICA 2VZ1A 3IRZA 4AK1A 3GSXB 3WNOA 1H15B 2P1YA 3FT3A 2XY2A 4LGPB 5SWSA 1OAKH 2DYPA 4M93B 1CG9B 2B4CL 2UWEA 1MFEH 4V1DE 5EU3B 4YE4L 3KYNB 1EJOL 5E2UH 1LP9F 4WU7B 4EIGB 4P9HC 4P5KA 2DI9A 5CSGA 3FB7A 3ZE0E 1RZ8A 2C4FU 1NUGA 1CR9H 3IDIA 2PNDA 4QHMB 5KANI 4FTVD 2EC9U 3DUHA 4NGHL 4JDZB 3DXAA 2GJZB 4KJPD 3QXDA 1ZWIA 3CD4A 5CINH 1E27B 3HUJB 1C16B 3H0TA 4FTVB 2Q86B 1D5MA 2Y06H 3QR2A 1NFIB 4OLZH 5D96C 4YHIB 4L5FH 2EZ0C 4PGBB 2GTWB 5TF1L 4YAQB 1WT5A 5FA3B 5IKCA 3V6OC 2E9WA 1BJ1J 3D0VA 4X80H 5EOTB 5I19L 1A1MA 4LGRB 1OSPH 4QF1B 1IILE 4KKCD 1T1XB 3TJEH 5TDPA 1CD0A 3MREA 1OAXH 1QFUH 5MP6H 4KJQC 3KXFE 4PRPD 5T33L 3WUWA 1UWGH 1JF6A 1UH2A 3AFLA 1PVHA 1IM3B 1FNEA 2JJUA 4TVPH 2OR9H 1EPFA 1W72L 4OZIE 2F58L 4XPBH 2JB6A 4PRPB 4M5ZH 3S36H 3DUSA 1VA9A 3I75B 4RGND 1KC5L 4PJDB 5GRVL 4IJ3B 1VADA 5B38G 4MDIB 2IG2L 4YJZL 2IADB 5DJZA 3BMVA 1FRGH 1Q9OA 3MRBA 4RGNB 1CLOH 3LKRB 3EOBB 3SKMB 4LQFH 5L8KB 4GG6F 1EZVY 3I9GL 1TQCC 5HGGS 2WLYA 3ARGC 3TT3L 3WFDH 3JV4A 5KJRH 4ERSH 4BUGA 4ISVA 3D39A 2WINB 1UACL 5TE6L 4LDOB 4LLUA 4HT1L 5TDNA 1JF1A 1A9BA 3B9KC 4Y19A 1E0OB 4JRXA 4U33A 1RJZB 2X41A 2F53E 5IMKA 4O2EA 3QRGL 4MD5A 5GSVB 4PY7A 4ZFOA 2LVEA 4MD4B 1MQKL 4QXUH 4HKBB 2AQ2A 4HPYL 3VFVA 4UNTA 3FO0L 5LBSL 3QUMH 5JW3H 4HBQA 4JFPB 3RKDD 4M6MH 1T21A 3K7UA 4R4NC 3RWJB 4EUPA 5C2BH 3CPLA 1IEAA 2JLLA 3N85H 2SEBB 2Y5EA 2CLVA 2JB5H 2EYTB 5IW1A 3L3JB 5T5NG 4PJIA 2G9HB 1I8LA 3QEHA 3VGGA 1IL1B 4ZTOH 2H1PH 4YXLH 1IGFH 2VC2H 1F4WL 1A7PL 1H3GA 2D3VA 3BP6B 4PJ5D 5KS9B 1CD1B 2H2SC 1ZGLM 4KKLC 3FFCE 2P47B 4F2MA 4XCCH 1PX4A 1TMCB 3EJJX 4TTDD 5JZ7C 1J0ZA 1NC4A 4BH7A 2C5DC 1JYVA 5CEZL 1NCNA 4BZ1L 1ETZB 4QRRA 1WFUA 5M7QA 2O26U 2QSQA 3MOBH 2WLZA 4MCZB 1UJ3B 2AERT 4X6BA 3ZDXF 2G2RB 1KB5A 2IH1A 5F72S 4OAWA 1RK0B 3KYKH 4JFFE 3V6ZA 5C0FB 3C6LD 4Z6AT 2FO4B 3ZT6A 2VAAA 2HFGH 2IQAB 5FDYA 2CR6A 4OGXH 2Z31C 4K9EH 3O3AA 2CIIB 4HKXA 1ONQB 2VISA 3C6LB 4PP1D 1U42A 4K7FA 1FZJB 3GIVB 1CT8A 3VD9A 3GJFB 4GMTL 5LGHH 4OGAD 2YMXH 5EO9B 2C7UB 1H8NA 1BVZA 2Y25A 1C5BL 2N7AA 5I66B 2AJZA 5I9QC 3HI1B 3HE7C 3HMXH 1J1OH 3GBLA 3BN9C 4LFHD 3AS3A 2VUOA 3UBXA 1Y0LB 4ODWB 4EEEA 4MVBD 3GI9H 2DQFB 3OKNA 1HILB 5DHVH 4KKBD 4KRLB 1KJ3H 5C92A 3K4AA 4ONFH 4LCWA 4P2RD 1YC7A 2FIRT 5I18H 4KGLA 1VHPA 1FL5B 1Z0MA 5DUBA 3QDGE 1I1CA 3KWWA 4X9HA 5IESH 1QRNB 3UPCA 2QADC 2VR4A 4HS8L 3BEVA 3AAZA 1RJLB 4P2RB 3UTSA 2UVEA 3QDJD 1TZHB 1Z9LA 3ECBB 4LLQB 1LDSA 4K7PX 4DEPB 1CF8H 5IEKA 3FB5B 3GSXA 4FN0A 5JW4N 1MPAH 1H15A 2A6DA 1CGSH 1HHHB 5K93A 4UIKL 1QSED 1XGTB 4KAQL 4RNRB 4EBQH 4KK6D 3SN6N 3CFDB 3KYNA 4WU7A 1U8IB 1CFVL 3HR6A 3MBEA 4MB5A 4QRPE 5KSAD 1QSEB 1FN4B 3H9SD 4ONGL 1G0XA 2VR9A 2VLKA 3EOAB 3MRHB 2BNUB 3I84A 1NC2D 3Q5TA 2IPKB 3GMOA 2GJZA 4PB0L 4X4YB 1E27A 4X7FC 5KSAB 3GHEL 3L95B 4NKMA 2E27H 2Q86A 1BFVH 1NC2B 3MLZL 1NDGB 3MRKA 2X4SB 5ALBL 1WT5C 2GTWA 1ZGLB 3A6BH 3GMPB 3PGCB 1RJYA 3FB6B 5IG7B 3TWCL 5C0CD 3F7RA 4XPTL 1IGJB 3QEQD 2AGJL 3NCJL 4FS0A 1T1XA 1XCQB 1JPST 3HZYB 5I15L 5C0CB 3LRSB 1MFNA 3QPXH 5LAXB 2DWDB 3O4LA 4YHZH 4G6MH 4HV8B 1IM3A 4XPGH 1QEWA 4XPAH 2VDKH 1G9ML 3KPTA 2NTFA 2R4SH 2KDGA 1QG3A 3F6LA 3FO1B 3RVVD 3OHXB 4GRWH 3I75A 5TGBB 4AEFA 1SVCP 3KS0H 1HEZA 2OZ4L 3UCRA 5T3ZE 1P7HL 2F19L 3K46A 3HI6L 4YPJA 2JJVA 3TN0A 3B2UC 2X05A 2IADA 3ULSB 4QYOB 3MUJA 3BKMH 1AY1L 3MRRB 3NFSL 1TITA 4BZYA 3SKMA 4QT5B 5CZXD 3GMLB 4ESKA 1KTDB 2GFBA 4LBEA 4NJAH 5TQ2H 1WICA 3TNMA 5D2NC 4R96B 1PAMA 4OLXL 3F8UB 5DMKB 3SDCD 2WINA 4NFCA 5KSBE 4L4JA 4GAJH 1Q9WA 1H3PH 2XXMB 3QCTL 1NGPL 1T2JA 2P43B 3OPZL 4PG9B 3MLXH 3FAWA 4X6FB 1DBBH 2BNRE 1RJZA 2AXGB 3SDCB 2YOCA 5H37G 2MFNA 3MRNB 5T5FL 1OGTB 3FJTA 5CMAB 3WDJA 2ED9A 4D9RE 4MD4A 5HPMA 5JHDD 4JZNB 1C08B 4HC1H 1P4IH 2P24A 4RFNB 5C0GB 3FOLB 4X4XB 4YDLB 3ZKND 3B4NA 3BQUD 4YPGB 4HFWA 4ODVL 5DYOA 4JO1L 5DD0H 1YEGL 2VZUA 3BN3B 1RURL 2SEBA 1YDPB 1VEPA 2DD8H 1HK6A 1S78D 5EZIL 2EYTA 2F54D 4ELMA 3VD5A 1I8LC 2X70B 3BQUB 5GGSB 4NUGL 1U36A 3L3JA 1T22A 3P9MB 1OP3H 4Y5XB 4XVJL 3RU8L 1IL1A 3OKMB 4EQ2A 3ZYZA 4XAWL 2F54B 3BP6A 5KS9A 3DX8A 1CD1A 5I1JH 1BPVA 1JGDB 4PJBF 4BK4A 2CXKA 2R2BB 2PCPB 2CUHA 4KHXL 3M8OH 4KTDH 5DQ9A 5BVPH 2PKDA 4WU5B 3BXNB 4K3DH 2D7OA 4U7KA 2N56A 2I27N 5DVOA 2GT9B 3GK8H 1I8KB 3O6KL 4OLVH 1NBVH 3SE8H 2R15A 3RTQD 3VD3A 2VOTA 4IOFC 2G2RA 1HINH 4JKLA 3GSUB 1IGML 1QBAA 2NY5L 3CU1A 2DM3A 4YR6B 3D48R 4MJ5B 3DVIA 5FM5M 2IH3A 4H0GA 1UB5B 5J1SC 5JOPE 4NZUH 1U8OB 4HHAB 5H35B 1KUMA 4PJXF 4XPFL 2CIIA 4I9WD 1ONQA 1AGEB 4U0RB 5E5MB 3RHWK 1YMHB 3GIVA 1K4DB 1KPRB 4KI1A 3MV11 2R4RH 4OJFH 2J6EA 1TJIL 3GJFA 1JZ2A 7FABH 4OZHE 3EHBD 3DO3A 5ITFB 5GRUL 2C7UA 1JPFA 3MLPA 1P53A 1INQB 5A3ID 4MNGE 2A73A 4WV1A 5F1IB 4Y2DD 4X8XA 2DKSA 1S9YA 5LWYH 1AD9A 2J4WH 5DZLA 1JBJA 1QYGL 2DBLH 5MENE 4ODWA 4EZMA 2IMMA 4XCEA 2UWEF 2DQFA 4Y2DB 2Y36H 1X5FA 2DKUA 1UEMA 4FG6C 1X4YA 2EXYD 2A9ML 2EDDA 3QFJA 2CO7B 4F58L 1SEQL 3MR9B 1KELL 5FYJU 1LO0H 2D0HA 4GAFB 3C6SA 4JHAL 3UPRB 5DWUL 1QRNA 4JFOB 1WEJH 1F3RB 1UWEL 2BZDA 2B0SL 1RJLA 4KJWD 4P2RA 4RIRA 5CGTA 1CICD 5D1ZD 4X5WB 1TZHA 3CK0L 1DR9A 4PIRF 3FB5A 5F9OL 3LY6A 2ITDB 4M93C 1HHHA 1BQHG 5BV7L 1CICB 1XGTA 4RNRA 5D1ZB 5GRXG 1XMWA 3MBEC 4LASH 1A1NB 1U8IA 4S1SH 3FQTB 1DLHA 5I73B 4NWUL 1YPZA 1MIEH 1DSFL 2AJXH 3ABZA 1DBML 5KVFH 1RUPH 4PBVC 3KLSA 2NX5A 3ARFD 3MRHA 4L8DB 5EORH 3V2AR 3G5YB 3P9LA 1M71B 2ZUQB 3LKQB 1QO3A 1U41A 1MRFH 1RIUL 1MHCB 5D1XD 1A5FH 5IVXE 4Z7VF 2H3NB 5D70L 3ARFB 5I1HL 2D03H 3VXMB 3ZL4H 5D7LB 1NC2A 3PWLB 4GAGL 1HHGB 1ZGLA 3W5NA 2W0LA 1B6DA 4HIJA 4J6RL 5F88B 5IG7A 4OUOA 3NGBB 1YYLH 3G04B 1G1YA 1IGJA 4FQQA 3O2DL 1KEML 1YN7B 3LRSA 1QFOA 3D3VB 3QQNA 1S7SB 4XMLH 5DMYA 2NY4C 4NUJB 3U7WH 4KKCC 4JPVL 2P8PA 3CSYB 4MXQC 3ARBB 2JTDA 1HSAB 3MLRL 3MLVH 4H1LG 3IF1B 3SKNA 2DQHH 4OV6F 4PY8I 3UYPA 4X5XA 3KG5A 4KQ4L 1B6UA 3FO1A 3C60B 4XCNA 2YN3A 4YHNA 4K8RH 5ANME 4IJ3C 3VDAA 1EDQA 4F9PA 3PWJB 1LHZA 3NIDE 1A7RH 4RGNC 1I9JL 2L7UA 4QYOA 2BCKB 4TUOB 3IDNA 3CSGA 5CJXC 5EO1B 3VFRB 2CGRH 4QT5A 3WDHA 4QRQB 3GMLA 3S36X 3EKCA 4JN2B 1M7DB 3F7VB 2FH8A 3MODH 4JO3H 4FABL 4R96A 5LJYH 1DUYA 3O11A 5DMKA 3RDTD 4OIIL 3V6BR 3EDEA 4OKDA 5IW6A 4NBXB 2DLFL 3DROA 4HIEB 1MELA 2OJZL 5DT1L 5ITBL 1RIHH 4PJIF 4JRYE 1C7TA 4ZSOE 3RDTB 5DQJA 4NWTH 5C3TA 2HLFC 2ERJC 4PJGB 1KJ2H 1KTRL 2FNBA 4JZNA 3CUPB 3JSSA 3BJ91 3GO1H 4WTWA 4PJCB 3BIBX 5FV2A 1B4JL 4JO4H 1U8MA 5C0GA 3FOLA 4ZS7L 5GS0L 4LRIA 3VCLA 1I7ZB 1CXHA 1UYWH 3ARQA 2DB8A 4YDKH 1YDPA 3T3MF 2YXFA 5HHNA 2X70A 4QHNB 5GGSA 1MWAB 3P9MA 4UV4H 3VXNB 2NY3D 4GG8B 2VXUL 2FATL 3ARXA 3G6JA 4WI2A 5DS8B 4XMPH 2F54A 4RBPK 1A2YA 1S9WB 4XPHL 2R0ZL 1JGDA 1P6FA 3TCXA 1B4RA 1ZAGA 4QGYA 2NY3B 3QNYB 4JZJA 2PCPA 3VMOA 3JV6B 1BOGA 4WU5A 1HKFA 1S7VB 5GQBA 3L5WA 3UROR 5GSRA 4RFEB 1XGPB 4BQCA 1DBAH 2FYYB 1UJ3C 1U95A 1W0WB 5E6ID 1KYOJ 1KEGH 1KENH 4YHOL 4QRUB 4ZAKD 4LNVA 5I8EA 2YPVL 4PJHE 1AGFA 3GSUA 3OG6B 5DRZA 3DGGA 4YR6A 1IAOA 5DD1H 4MJ5A 5E6IB 4JFZL 1KCSL 4JFQA 4IOIA 4ZAKB 5FF6B 4P59H 1UB5A 3MV7D 3MV9E 1U8OA 3LKPB 4HHAA 5H35A 1HH9B 4UNUA 4GAYB 4KV5E 4OFPA 2W0FA 1AGEA 2B4CH 3BP5B 4M5YL 1G7PB 1E4JA 4YE4H 1EJOH 1YMHA 3WIHA 4CMMB 3MV7B 5FYKL 4L8BB 3MJ6A 1MOEA 2Q20A 1VFAA 5DD5L 4PP1C 3RWEA 1R5IB 2AJUL 1T4KB 5ITFA 5CHNA 4ZO7A 4ONOA 4TNWK 3UYRL 2W91A 3WLWD 1EO7A 1GOHA 4WV1C 5J11C 1INQA 2EYSB 2WIMA 4HLZH 4PJ8A 1CGTA 4NGHH 3RZCA 5F1IA 3KPNB 1BX2B 4UT6L 5F89B 5SWZA 2IANA 2BRRL 2OI9B 4PRHB 3U7YL 2YZ8A 3WHE0 3TIDB 1CVRA 3JV0A 2MQCA 5FUCE 5HPOA 5B39G 3QISA 5TF1H 3H7BB 1JNNL 4P99A 5F7HA 4MVBC 4P5TB 1SY6H 4KKBC 2I07B 5BOZG 1OP5H 4R97B 4JHZA 5I19H 5HHME 1VFMA 3K81A 2OR8A 1U8PA 4ZUVB 2R2HA 1MAJA 3HUJF 4JN1L 2YEZB 3RY4A 1FFPB 1TVBB 2DS4A 4BSJA 4X5WA 3WIIL 3EYFB 3DRQB 1AGDA 3GHBL 4Y16B 3SEPA 1FVDB 1L0XA 4O58L 2NCMA 1T2XA 4GXUM 1CIDA 1W72H 2ITDA 3OGCB 4KTYA 3GMQB 3OB0H 2F58H 3GRWL 2HJLA 4Q6IB 1JTTA 2VUYA 3HZMA 3BD5A 4XAKE 2AABL 1A6WH 1LEIB 1AC0A 1JYXA 2AP2A 1A3RH 1KC5H 3MGOB 1VERA 4I0CC 1F4YH 1AXSA 2FBOJ 3EIFA 3RVTC 2IG2H 4JFEE 4L8DA 3G5YA 5FDWB 2PUQT 1IARB 1ROWA 5KSAC 3N1MC 1M71A 2VH5L 2ZSWA 3LKQA 3U48A 5GXBB 3I9GH 1MHCA 5E8OB 1H3VA 4N8VG 4N1HB 2X4QB 4X8JB 2H3NA 3ARFA 5DGRA 5C0BA 3TT3H 3VXMA 5FECA 5D7LA 5E9DD 1N3NB 2PO6A 3U46B 3PWLA 3IT8D 3PIQB 2YUZA 2WQRA 3F12A 5EH1A 2DQGL 3E6FB 3QYCA 1UACH 4PJDF 3SE9L 2ZUUA 5CSZA 3R06B 5JDSA 2V2TA 4ZOBA 5E0QA 3ARRA 4LEOA 1ORSA 1D5XA 4PFEA 4E0RB 4XNQA 3KPRE 4P3DA 6CGTA 1YN7A 5F1SA 4I2XA 3S88L 2CRZA 2MKWA 3D3VA 3BPOB 5D8JH 4NUJA 1MQKH 2ZNXA 5I30H 4LSQH 2BSSA 2XTJD 3OKYA 4LIQH 5TE7L 1K3IA 3CSYA 3ARBA 2AV7A 4HPYH 4MHHG 1HSAA 3FO0H 5LBSH 1QR4A 1F6AA 4G6AD 4JGUA 4K94L 4OGZA 4Z18A 1R5VB 1TQBC 3C60A 4QHKJ 4F9PC 2BOCA 2AQ1A 2DQJL 2DQDL 5IB2B 4XHJD 3VFGL 1FORL 3PWJA 4ETYA 5JMOC 3TFKD 2R1WB 3Q6GH 4KK8D 3RVVC 1XF5B 3ZTNL 3RY6A 1QD0A 2AKRA 3MV8D 3CFCL 4HK0A 4TUOA 4JPWL 3BHBA 4OLUL 5FM4A 1F4WH 1A7PH 3CXDL 2I9TB 1IAII 1S9VB 5CBAB 5HGBA 1EHNA 1J1XH 3V8CA 2Z8WC 1F45A 3TO4B 3QQ3A 2X1QA 5CEZH 2FJHB 4L9LB 4BZ1H 3KLAB 2DLEA 4P5MA 4P4KA 3MRDB 4X6EA 1IJ9A 2WAHA 1A3LH 1U3YA 3S96B 1FPTH 5DRNA 5TE4H 3WS6A 4WO4A 3MJ7B 4JVWA 1GAFL 3NVQA 3QG6B 5KS9F 1UH3A 1F4HA 1I7TB 2VXSH 2EDHA 1S3KL 3CUPA 4HMDA 1RSFA 2NY0D 1V3MA 3CVHB 4YHYB 1EO8L 1ORQB 1XFPA 2FDBP 3MRLB 4YDLC 4PJCA 3OKLB 3ULVE 4LRIC 4LSTL 1KNOA 4GMSL 1VACB 3EGSB 2NY0B 4NP4H 4AEIL 1I7ZA 2MHAA 3LKNA 3O3BB 3ZKNC 1JI2A 1MHHA 3BQUC 3HLAB 3HG1E 3BZFB 2DM7A 1C5BH 2Y07L 1U2CA 3PV7A 4PTUB 4QHNA 2MTPA 4GG8A 2V2XB 4WWKD 5D1QD 3RWDA 1S78C 4FQXD 5DS8A 4JZJC 2K7PA 3QP3A 3EZJB 5EWIL 4WWKB 4FMKA 4UILL 5D1QB 5GGVL 3B83A 3V5DA 1A21A 3D0LA 4FQXB 1JP5A 4G6KL 1S7VA 3QFDA 3WNPA 4XNYH 1AKJD 4D2NA 3WS3B 3O6FA 1V7MH 3AM8C 5HYFA 2APXA 4PJ9A 1HQRB 3U7AA 4QRUA 5HI5C 3O0RL 1INDH 1HDMB 1DFBL 1N6VA 3QXVA 3AROA 4HS8H 2XN9E 3D85D 4RAUB 4ZUWB 4PTTA 4NHUB 3R8QA 2NPLX 1EMTL 5E6IA 5K9QI 5ICZB 4JFDE 4ZAKA 3RNKA 2YSSA 3EO1B 1ZVSB 1DLFL 3DSNA 1J1PL 2FRGP 5E2JA 3D85B 3LKPA 5DFVD 5LCVL 3ZT5A 4GAYA 1YA5A 4KAQH 1FCCA 2BP3A 4HGWA 4LOUD 4KZDL 1CFVH 4H5SA 4CDHA 3SPVB 1WAAA 3BKYL 1G0YR 1R5IA 4MNQE 1FBIL 4I48B 5E5RB 2NY7L 4GBXA 4WHDA 2VXTH 3GUTA 2EYSA 4KPHL 4P2QB 5GS2D 1OGAD 3UC0L 1T1ZB 3CDGB 4U3CA 3KPNA 2Z4QA 1R5WB 3P4LA 5A3IC 5BS0A 1DVFA 3HTLX 5JW4R 4PRHA 1OGAB 3MLZH 3TIDA 1YEEL 4FFZL 4Y4KB 2FX8H 3THML 4J3WA 8CGTA 1IC1A 1JFQL 5IB5A 3WNKA 4L4VD 2JJTC 1YPZF 5HSFA 2VKXA 2BVPB 4FZEL 4P5TA 4TUKL 4YDVA 5IHBA 4X7SL 5JLZA 5KVDH 3VXUA 4XPTH 2R23A 1JHTA 1W0YT 3AXLB 2AGJH 3RFZC 4L4VB 1SJEB 2P7TB 2W60B 1NEUA 1TVBA 4GQPH 3P4NA 2NY6D 5T3XE 4OCXL 2MPAL 3DRQA 4Y16A 3PXHA 4KJWC 5EFIB 2KPNA 4OZFH 2X09A 2YK1L 3OGCA 1G9MH 2VLRD 1YJDL 3GMQA 3REVA 4GS7C 4Q6IA 5I73C 5CD3B 4LEXL 5FO8A 5IWLA 3I02B 1MI5A 3MGOA 4K3JL 2VLRB 5EG6C 2F19H 3HI6H 1FQ9C 1Q0XL 2VZVA 3SJVB 3P4MB 1BZ9B 2A0LC 4UDUA 1AY1H 3QIBA 4JQVA 1SBSL 5GJSL 3ARFC 4X6DA 4M9OA 3D25B 3VFPB 4X8JA 1BD2D 4WENB 5EBWA 2PO6C 2PYEE 2BVEA 3ZKMC 4N1CA 1N3NA 2CRIA 2DICA 4J3TA 4PLJD 3B9AA 3PIQA 4C56D 2KL6A 3LZFL 3UTTB 5MERB 3PWUB 3O6MH 1MCSA 3E6FA 3NGBC 3FN3A 5IK3A 3RWIB 2X9XA 1RZIA 5DJ0B 1G7MB 2X5PA 4DZBA 3H9ZA 1NGPH 3DMMB 3SDXE 5EB9A 2J8UA 4C56B 1ZLWK 4MD0B 4WI6A 3GZKA 1CL7L 1JTPA 5DQDL 1T7ZA 1IM9D 4O5LL 5D7SL 1R3HA 2IAMD 2ZUSA 1ZANH 1YEIH 3ARBC 3PHSA 5DR5L 3RZWA 1YY9D 4QOKD 4ORGB 3O81A 5BZWB 3BDBA 4HMEA 4MQXD 5DI8B 3C60C 4R8WH 5DFWH 2IAMB 5ID0A 1R5VA 5E2VL 4QOKB 3V6FB 2G5RA 1YEGH 2ICWJ 1YEHL 1JHKL 4JE4B 1RURH 5IB2A 2V9TA 1F4XL 5MI0B 2QKIB 5EZIH 4D8PB 4BQ8A 4XNMA 2R1WA 1RZFL 3RY6C 1XF5A 4IMLA 4XVJH 3BH8B 1CGWA 3RU8H 3NIGE 3ZTJH 1OAZL 1I8MB 4XAWH 2RFXB 3FFDA 4ZUSB 4PRDB 2P49B 5HYEA 2I9TA 4HIIA 1KBGH 2YKLH 5CIPH 3O8XD 3TO4A 3VXRB 4JRXE 3DO7B 3NH7L 3TBYB 5I0DA 43CAB 1AR1C 2FJHA 4P4KC 5GGTA 2VABB 2QHRL 4RAVB 3MRDA 4GLRI 2IALB 3O8XB 3G5XA 1EFXA 3QIUD 4TNVF 4PGEB 1IGMH 4WO4C 1GPOL 3A67L 3MJ7A 2PXYA 3QG6A 4KDTA 3U83A 1L7TL 1I7TA 3QIUB 4D94A 3CVHA 2YD5A 1ORQA 3LSOB 3H6JA 3M17B 3RVWC 3OKLA 4LSUH 3W0WE 2V5MA 4U1MB 5C07A 5IF0A 4C57C 4OZFG 4CKVX 4ZOEA 5JW4Q 5TH2A 3EGSA 1ZLVH 1TJIH 1UWXH 5MEOB 5K9KA 1UG9A 5GRUH 4LLYB 1YC8A 3HLAA 5CWSB 2APWA 1T7VA 1ZHKB 2P44B 4XP6L 4PTUA 3VH8G 5C9KA 3ARZA 3DHJA 4JM4L 5F6HJ 1LO5B 3C5SB 3G5ZA 5FYJE 1TJHL 3OBAA 4Y5YB 1T83A 2NY3C 3WDIA 4D0CB 1QYGH 4NKQB 2ATKB 4WWKA 3MUZ1 3F65A 1IEBA 5EZLA 4OF8A 2DRUA 1JZ7A 5IFJB 1BHGA 5FGBA 4FQHB 2A9MH 1MCQA 1P9MC 4BQ9A 4PJ9C 3SCMA 3P4OA 3KPLB 1KELH 2DI8A 4NM4L 3VRJB 4JHAH 3IFNH 4ZS6D 5J89A 5DWUH 1HDMA 2A74B 1AGBB 1MHEB 4MA8L 3VDCA 5L2JB 5E6IC 5FUOL 2XI9A 4RAUA 4U6YB 2UZYB 4NHUA 4ZAKC 1U8KB 4A6YA 1U93B 1XF4A 1ZT4A 5ICZA 2E7CA 3CK0H 2BSRB 3EO1A 4XT1C 4PJEA 4K2UL 4U0QB 4OFDA 1YYML 4HSQA 1AD0A 3LH2L 5EPMA 5BV7H 5KSVB 1HYSC 4O9HH 5DRWB 4J4PA 4AT6B 4IS6B 3BSZL 3QRFM 5EU6A 1FL3A 4CJ1A 4DKAA 4N0UA 4E41D 5C0IB 1X9QA 4NWUH 1PKQA 2BY2A 1DSFH 4Y88A 2HT2D 1QSVA 1LMKA 4GBXC 4I8DA 2DL2A 1DJSA 5EULV 4P2QA 4E41B 3OR6A 3TBVB 4UQ2A 5CKGA 1DVFC 4NQCD 1RIUH 1GIGL 4DCQB 2XFXB 5HYJE 1HXYB 5D70H 3PNWA 1DE4B 4LCWE 5BO1L 1OGAA 1FIGH 4XC1L 3ZKQD 4CMHB 4DAGH 5F3BA 3QHFH 4GAGH 4Y4KA 4QEGA 4NQCB 3CVIH 3PP4L 1TXKA 4L9DA 5C0JA 4Y1AB 5B38B 5DK0B 4P5TC 3HB3D 4J6RH 3RVXD 3ILPA 3JWNC 3RIAF 3RI5F 3O2DH 4RZCA 3AXLA 4DZ8A 4L4VA 3BGFB 4W6YB 1CDBA 1KEMH 4YHKL 1QBML 2V5RA 2L4OA 1T0NB 1SJEA 1NFDE 2BK8A 2P7TA 1HE7A 1QKZH 4Y16C 1PQZB 2DTML 2BY1A 1MVFA 5ACZA 5EFIA 3MLRH 2NNAA 4LSVH 5IOPB 4Q6IC 1G6RB 4HUWB 4KQ4H 5F1OB 4NN7C 5DJXB 1HXMB 3I02A 2ESVE 4YDJB 5IVZB 3QDME 2O5XH 4EUPH 1WVZA 4AZ8A 3SJVA 3P4MA 2MKLC 3QIBC 2W65B 4JQVC 3VI4E 1ADQL 2P8MA 1UZ6E 4M48H 4CVXB 7CGTA 5DZOA 4F7EB 1SHMA 3D25A 4FABH 3PWNB 1BMGA 1SYSB 3JTTA 3QT2A 1T04A 4WUUE 1KJVB 5E2TL 4U1JB 2Z92A 1FG9C 3I3BA 4OIIH 3U30B 4QXWA 4TULH 5FGSA 1K2DA 3PWUA 2UYLB 4ZXBD 3UTTA 3WV0A 3MROB 4G9FD 4ZPVA 3RWIA 3NACL 2DLFH 5DT1H 3DMMA 1MCLA 4MD0A 1FFRA 4S0SD 3O4LE 3X11B 4ZXBB 1I1RA 2XZQH 3F5WB 2YBRB 1WLHA 4UU9A 1CDUA 4NPYB 1A4KB 2DLHA 2XZCL 3BPOC 1KB5H 4ZFFA 2C1OA 2CUMA 1YNTB 5F3HB 3RUGE 3ULUE 3MC0A 3LQZB 4EI5D 1WWAX 1OD9A 1F00I 4EVNB 4X0KB 3BRGC 3VI3F 1MY7A 4LLWA 4YBQC 1B4JH 5EA0L 5CJ5A 2AXJA 4LHUG 3KYAA 1M05A 4ZS7H 3RJQB 4EI5B 2EDJA 3CMOL 3R0NA 4UOW0 1EK3A 1MCBA 4M1CD 5BW7A 1IGYA 2VXUH 3L3OB 1CFSA 3BH8A 4XCYB 2FATH 4FFWD 4PJGF 3STBA 1FGVL 5DA4A 1MWAL 4BQ6A 2R0ZH 1QLEL 4NQED 4PRDA 1T5XB 4WGWB 4PJCF 3TO4C 2QSVA 3VG0H 3DX9A 1XF3B 4C54A 1MVUA 2ZOKB 3VXRA 4APQD 4L9LC 3TBYA 4CU8A 3TYFB 4XVUD 4NQEB 4WFFE 4RAVA 2IALA 4ZO8A 1XGUA 4OQTA 2YPVH 4APQB 4HIHB 4PGEA 2PXYC 2ENYA 2QQLL 4Q97A 4KDTC 1RVFL 2RBLA 1BVKB 2XWJB 4JFZH 4WY7L 1D6VL 1H5BA 1KCSH 3EDJA 3GKWL 4J3UA 1KYOK 3FONB 2VZSA 3CC5A 3QIUA 4QO1A 4UUJA 4NDMB 4AENA 3EYSH 4MB4A 1U8NB 1P7QD 2ENSA 1JRHH 3LSOA 2WBJD 2WP3T 3MFFA 2YS4A 2YD9A 4ELME 3K80A 4XZUA 5CD5D 2NY0C 4JB9L 5FYKH 1P7QB 5DD5H 5MEOA 4NO5B 4LLYA 2WBJB 3UYRH 4LPCA 2DJ4A 4IDJH 5DO2D 1ZHKA 3Q3GA 1RUML 1AIFA 1LO5A 4JLRB 5JXEA 4UT6H 3S3JA 1T83C 5DDHB 1SMAA 3W39A 4RMUA 4Y5YA 3U7YH 4WWKC 3QQ9D 5D1QC 1KIQB 1MCFA 1EVTC 4FQXC 2Y72A 3WLBB 2X10A 2ZCHL 2N4IA 2DM2A 2HRPL 5FGBC 1JNNH 1DZBA 1JZ6A 4RX4A 1LGVA 5IB3A 5IFJA 4XP9L 1BFOB 4JPIB 5HDQH 1UM4L 1EGJL 2VITA 3EZ8A 3KPLA 4D0DB 5CILL 1T0PB 5EC1A 2AK4A 3C8KA 3FTGA 3ZDYF 1MHEA 4MJ4A 1R3JB 4JN1H 4U6YA 4V1DB 2Z9TA 3WIIH 1WWBX 5D2LE 4KXZI 1I1YB 5ICXA 3U0PA 2BSRA 1QLFB 5MHSE 4O58H 3BRFA 1RZGA 4M43H 3KYOB 4J4PC 4Y8AA 5JIHA 5FUZH 3B3IB 5GRJL 3VFSA 5I71B 3GRWH 4ODBD 5DRWA 4ZYKA 2NXYB 4TSCH 4LLVA 2AABH 2EXWC 2P4AB 4W4OC 1HSBA 3T4YB 4L3AA 5D5MB 2PETA 3VXOB 3V4VL 3GNMH 4N90E 1U8HB 3DTXB 2P5EE 2VH5H 3REWB 1FAKT 2XFXA 1F2XK 3T4AA 3PGDA 4YFLI 3KXFD 1DQQB 4Y4KC 1D5BB 1WCBB 4U1IA 1X7QB 5DJCA 1NGWB 3QI9B 4PBXA 5E4EC 2HVJA 5LG1A 5CSBA 1CFQB 1LVEA 4Y1AA 5B38A 2D0GA 5DK0A 4NKDB 4TSAL 2E5EA 3KXFB 3SE9H 4Y8DC 1PZ5A 2WQ8A 4MNHB 4FQPA 4YNYB 4M7LT 4OZIB 3MNVB 3NBNA 2UV3A 2HJFA 2X40A 2OX5A 3LVEA 3W81A 5FKPB 1EH9A 2A6IB 4X6DF 4KC3B 1DQDL 2D7TL 1AQKH 3O4OB 3FT4B 5TE7H 1KIPB 4KUZL 12E8H 5ISZE 5D9SA 2YA2A 4RDQG 1XR9B 1FNSL 1G6RA 2DIBA 4OFIA 3DX7B 2NX5E 3S3PA 1DN0A 1QFWL 2H2PC 4U1KA 5FB8B 2DQJH 2DQDH 4OBRA 3HFML 1JGLL 2ZUVA 3QZWG 1OPGL 3VFGH 1FORH 4YDJA 3FQNA 5A2FA 3MNZB 4KHTL 3RWFB 3H9HB 1KPVA 4CVXA 1JGVH 1F11A 4OLUH 1UEYA 5F7NC 3CNKA 3CXDH 3BUYB 1NCWH 4RISH 2HKFL 4EN3D 3PWNA 3K2MC 2E9BA 4P57A 1KXQE 4CVZB 3T08A 1KJVA 3BP7B 1IT9H 1V7NL 2UYLA 1LO2L 2QJDA 2HTLD 4EN3B 3DMMC 1RZJL 2HN7B 4BSWA 2GJ6E 4F7MA 2BC4B 5DSCB 1EEZA 1JPTL 4IRJD 1GAFH 4QWWD 3VXTB 2YPLA 4ZOAA 5F3HA 3LQZA 4WNQB 1FG2B 1S3KH 2V7HB 1DANT 5F7DA 4IRJB 4LAQL 3S7GA 2IAMC 4X0KA 2DQIL 5DJAB 4HX1A 4HK3J 4K3HA 4G9DB 4GMSH 5AUMB 4QY8A 2OR7A 1C1EL 4MQXC 3STLB 5F9WB 4AEIH 1IAMA 1WIPA 2NLJA 1NJ9B 5BW7C 3IXTB 4LLDA 3L5HA 2Y07H 5AG8A 1HHIA 2BNQD 2J6EH 3GJFH 1KCVL 4XB8A 4ODUA 2IPTL 3L3OA 4WUKL 1XF1A 4KVCL 4HDIA 1KACB 2GHWB 2ZPKL 3BISA 2DQTH 3OX8B 2QEJA 1LO3L 3CDCA 5A40E 3IDGA 2BNQB 2HLAB 2YXMA 1GZQA 4HWEL 3U6RA 1Q94B 5EWIH 5GGVH 4Q74A 1XF3A 4ZFZB 3FRUA 4NN5B 5EBLB 5F1NB 1XF2A 3PP3K 3TZVB 3TYFA 1SJHB 4U1HA 3ILQD 3JZ7A 1OAUL 1JCKA 1RJCA 3O0RH 5JPMA 3NIFF 4APQA 4HIHA 4ZO6A 1SVZA 1H5BC 3V7MA 2AEWA 2XWJA 5DEGA 1CZ8L 1EMTH 3QIUC 3ARVA 4RGMB 3QA3A 3N1QC 1KPUA 1DLFH 4MXVF 3BVNB 4X6CE 5FYKU 2F8OA 1J1PH 5KBNC 1I7RA 3S6CA 4KJYB 5LCVH 4P23A 3RA7L 4N68A 1OP3K 1JNHB 1DN2A 4LCYB 5AD0A 4KZDH 4GXVL 1J8HD 2ZZUT 2BY0A 1I9EA 2YHGA 1SEBB 4I0PD 3V5KB 4NO5A 2NY7H 1RULL 1J8HB 5JXEC 3UC0H 1EUTA 1Q9KB 2VMFA 4MCYA 4MSWB 4I0PB 3JV5A 4Y5YC 1BQHB 5DDHA 4IRSD 3TH2T 4LF3B 2BSTB 2EEBA 5ESQB 1I4FB 1R24A 1OARH 1YEEH 3BWAB 2LTQC 3WLBA 3KJ6H 4JG0H 1MAKA 3TIEB 2QR0B 4NSKB 4TUKH 4FZEH 4GRMB 1ZHNA 2BXZA 1X5XA 4L4TE 5T1KD 4RWHA 1JWUB 4PR5B 2JCCE 1Z9MA 3F6IA 3H42L 3JWOC 4PV9B 4HCRL 4V1DA 1NMBL 2VE6B 4OCXH 2MPAH 5T1KB 2XIDA 2EDTA 1J7VR 2H26A 2YK1H 1ES0A 3OKKB 4Z8FL 4KRNA 1TENA 4QTHB 3AS0A 2F74A 4LEXH 3T4YA 3C5JB 4GKOA 4BA8A 5DHYA 3T0ED 4K3JH 4NQSB 4M1DL 4PLKC 5C08E 1Q0XH 2E7MA 2IANE 4PD4J 2VR5A 3HR5B 3L7FA 2HT2C 2CXGA 1TTFA 3T0EB 1SBSH 4H1LB 2HAZA 1BLNB 3RX8A 2NR6C 5F96L 4CMHC 5SV4A 3GSQA 3MO1B 3ARED 1WCBA 3QI9A 3VGAC 1NCUA 2D31B 3LZFH 1CFQA 4AMKL 4NKDA 3OGOE 5I1LB 2O5YL 1WCQA 2OTWA 3BGFC 3HB3C 2R0KL 4OZIA 1CL7H 3MNVA 5DQDH 4XNXH 4NC2B 3GGWB 3TA3D 5DR5H 4L1DA 3VFWB 3CFIC 1QFHA 15C8L 5E8NA 1GHFL 4HWZB 3UXFA 1MRCL 4Z76B 4ZDHB 1QSFA 2BFVH 3TA3B 5TDOB 1JZ4A 5CGMA 1ZOXA 1QR1B 1JPGB 1U6AL 5CEZE 1NANH 2WUBL 1JHKH 3RL1A 1VSCA 4D3CL 5I8KH 3VFMB 3TEUA 1CLYL 1RZFH 1EHLL 2LU3A 2BNRD 1LQSR 1E4XL 2VN4A 1OAZH 4CU7A 1E4WL 3DV6B 4WVRA 5DF0A 5J13B 4H25B 4XTRD 5GGVY 2X7LA 3BUYA 4DUVA 3Q5YA 3QUYD 3ROLA 1QTYT 1FFQA 4BFEA 2BNRB 3PV6A 4CVZA 3U30C 3NH7H 3UTQB 4FQCL 2F53A 1WBZA 3SGDI 4PBWD 3BP4B 1HZHL 3AU1B 2FJGB 3P73B 2X1PA 3QUYB 1JYWA 5KVMC 3V5HB 4EXKA 4OKVB 3QWRA 2GUOB 2OCFD 3ZDZE 5JQHC 5A16A 4O02L 5A2KH 1NAKL 1SJXA 4OLYL 4WEMB 1L7TH 3E6HB 4WNQA 1N5AB 1DBJL 1X6LA 3VE0B 1HWHB 2EDEA 5HGHA 5DJAA 2DIAA 3MACL 2OM5A 4EI5C 4OUUB 1BECA 4KMLB 4DKEL 3WFHA 2YD1A 4JKMA 5DMGD 3IXTA 1WZ1L 3FFCA 5ETUA 1RK1A 3GMMA 4O4YH 3I6KB 4JM4H 3G6AB 4PRNB 3SKOB 4ODHL 1JHLL 1TJHH 2PF6A 4XNZB 3OX8A 2DLTA 3WCYA 5KANG 4K8RD 5E1HB 1F97A 3VWJD 2HLAA 4FFWC 4OFYD 1Q94A 3IDUA 1MJUH 5JOPD 3UO1H 5EBLA 5F1NA 1I3RB 1NDMA 3OJ2C 4K55A 4JFFA 3TZVA 3CFKB 3KDMB 2WSKA 4QCIB 5JOFB 3F7PC 3OKEA 2OL3B 4APQC 3BW9B 1SYVB 1IQWL 4NKIL 4UIMA 4P3WA 3L3HB 5FGCB 4MA8H 4U1GB 5FUOH 4LSSL 3QNXA 3MLUH 4WW1B 5C6TL 1AFVL 5B39B 1HHJB 3BVNA 1YYMH 4OZHB 4AY0A 3B8YA 4DVBB 5A43C 4KJYA 3LH2H 3PGFL 3JWOL 4G8GA 1MCKA 3BSZH 4MNGB 5MEND 4LCYA 3HN3A 5CCKH 3VWKD 4WEBL 3ORJA 1KXTB 2ZUWA 3QG7L 3NA9L 2PYFB 5MENB 2YWYA 3DI3B 4LARH 1VFUA 2FJFB 3W9DA 2CR3A 3VWKB 5GZND 4QNPF 3LN4A 4QKXB 5IBUB 5HD8D 5DO2C 1KJ2B 2X9WA 5E4IA 5IHUL 1WF5A 4LF3A 2BSTA 1KF9B 4XP4L 4XC1H 1RHHA 3CZFB 1F02I 3QDGA 1PW3A 2EKSA 4PGCB 1MJJA 2V7NA 4EIZC 3HE6B 1C12B 4FXLA 3BPNB 5KOMC 5KVGL 2C3GA 1KN4H 1QSZA 2JKXA 4NSKA 2WBKA 1T03H 2Y23A 3OWEA 2LABA 4GRLD 4WEUD 4U2YA 3N1FC 1JWUA 4N8VB 2X4UB 4LCCB 1QBMH 4YHKH 1MLCB 4HUVB 4GT7A 1YEDB 4PV9A 4U6XB 1XGQA 2DTMH 4GRLB 2OTUA 2VE6A 5T1KA 3UDWA 4MA1B 2A77L 1NGZA 3NZ8B 1I9IH 4QRPA 5I71C 3HZVB 1LE5A 1IZKA 2NXYC 1ZS8B 3DVFA 5DUPL 3WXVL 4QTHA 2W59A 1NEZG 4HWBA 1IC4H 4R7NB 3T8XB 1G6RL 5L6YH 1FE8L 3C2SA 3TCLA 4KI5E 3PQYD 4JDVA 1ADQH 3Q6FA 5GGSY 3V52H 4CJ0A 1BZ7A 4K07A 4H1LA 3AGVA 4MQ7B 5DJ6B 1BLNA 4RFOL 5CS7A 1U91B 3QI9C 1CFNB 3PQYB 2ZJSL 4L29A 5EZOH 1XH3B 3L5IA 2O61B 3T0DA 5E2TH 2CKBA 3LHPL 3WKNA 4LGSB 3NACH 3CH1A 5I1LA 2YWZA 1MFEL 1QVOA 4WFGE 1YY8B 3OB0K 4WDIB 4NYLB 5FO9B 1G0DA 1NUNB 1TCMA 3O4OC 1CR9L 5ANMB 3DX6B 4NKOA 5MEPA 5L2KD 1S8DA 1H3TA 5GRVK 4O00A 5EBMA 5CINL 3RBSA 4F33A 2XA8L 4HWZA 1P84K 1NCCL 4ZDHA 2LE9A 5L2KB 5T5NF 4FFYH 1QR1A 3WJJA 4A2LA 3T65B 4JVUA 3K4DA 3NPZB 1FIEA 5AZEL 1Z5LA 4LRNL 2XYCA 2ADGB 43C9A 1PBYA 3GI8L 5HHVL 1FGVH 5KSBA 1FL6A 3DV6A 1MWAH 4H25A 3GJEA 4LSPH 1BJ8A 1HCVA 1QLEH 1QFUL 5CEYA 1BOYA 1UWGL 4ZSOB 2EH7L 1N2RB 4Z7UB 4NN6B 2R1YA 4GG6B 1FV1A 4P46D 1G9EA 4OZGE 3BP4A 3X13A 2FECL 3AU1A 3P73A 3QUYA 3IVKB 3S36L 3V5HA 3SKUD 2GUOA 3O2WL 2HTLC 2QQLH 5IVOA 5E00B 4R9HA 4W68A 2R2EB 1DBKH 3GKWH 1FO0B 1CK0L 1FRGL 3GFUA 1N5AA 1FYTE 1Z0NA 3QUZB 1WV7T 3S35H 4POZC 5GZOD 1UKQA 1CYGA 4JB9H 2Y7QB 5KJRL 3X3FL 1A64A 4ERSL 4JHBA 4TSBL 1KCUL 5I17A 4DKFL 4GW4B 1TVHA 1ZEAL 4IEFB 1QBBA 3I6KA 1AP2B 3L3IB 1DQJB 3G6AA 3MCKB 3SKOA 3AMKA 1N0XL 5J12B 1T3FB 5GGRA 5E94A 1WIUA 1LO4L 5TFSL 4LLMB 3MJGX 3QJHB 4PJHB 2ZCHH 4XH2A 2HRPH 4QXUL 3ZE1F 3TZVC 2GK2A 5EO0B 4XP9H 3CFKA 1T66C 1UM4H 5JW3L 3MLWL 4QXGL 3CFBB 4M6ML 5CILH 3WIFA 1U3HA 4Q9QL 1CFTB 3TVMD 5IUSA 4HJGB 4RGMC 3P30H 3T1WA 2EC8A 3HC0B 1M4KA 4WTZA 5FEBA 5K9OB 1HHJA 2AJ3A 5JTWA 3KYMB 4X98A 4DW2H 3TVMB 4FZ8L 4P2OD 4YXLL 4ZTOL 1OF2B 4Y0GA 4D9LL 1FDLL 4MNGA 5INDA 2R1XA 3QJFB 5A2JH 1IQDA 3JUYA 2PTTB 2GKIA 1FVEB 3EJZC 5D2NE 5FOJA 3VXSA 3PWVB 1FZKB 1CTNA 2L0DA 4JANB 4JJ5B 5EU7E 4KVNL 1MCIA 1KT2B 5DK2A 1UXSB 3ZE0F 3KYKL 4I18A 1NUDA 3MRFA 3CZFA 3LN5A 3FO9A 4Z78B 4OLWL 4R90L 3E2HC 1BEYL 4OGXL 3WO4C 3HE6A 1C12A 1UB6B 5D5MF 4YO0A 2WWKO 4M8VA 4TSAH 2UUDK 1CD9B 1GGYA 1A1OA 3GBNH 2FSEB 4MZ3A 4YXHH 4PJEE 4U4BA 2X4UA 3FN0H 2XKNB 2YMXL 4HXAH 3UDWC 3SGEH 1FHGA 3Q2CA 4JFED 4NRYA 2D7TH 5T1DH 1X5KA 1N7ML 4KUZH 4PGDA 3NZ8A 3GSOA 1PKQE 3HZVA 1FNSH 3WMSA 4JFEB 1ZS8A 3O2VL 1P1ZB 1JWMA 2A6JB 3O3EB 5L0QB 5HHOE 3WNMA 1QFWH 3GI9L 2QTEA 4RRPA 1KIRA 1OPGH 5D96B 5F7WC 5IVXA 3RGVA 2AJSL 4OZIF 4KHTH 4ONFL 4FQ2L 4LPTA 4M62H 3LPGA 1VGEL 4N5UA 4KJQD 4LNRB 1YMMD 5DJ6A 3KPRD 4XNUL 1OTTD 4KRPB 2HKFH 1IGTB 2ZNWA 1U91A 4EDWH 3C5ZA 1XH3A 3W2DL 1YMMB 2QSTA 2HA1A 4H8WC 3KPRB 3T1FB 1LO2H 3TH4T 1BWMA 5DJ8B 5INCB 4UT7L 5C6PB 3UMTA 3VFNB 3KPSE 1JPTH 4EDXB 4WDIA 5FO9A 4PV8A 4I5BA 5ANMA 3DX6A 4U6HB 2GITB 4MAUL 1EV2E 3ARGD 3WD5H 1JZ5A 1X5IA 5I1EL 4TRPH 3TA3C 1LD9B 2DQIH 3MRCA 3RHWF 4HJ0D 3OJDB 1B88A 4JAMA 1E28B 3WJJC 5HGDB 1BFVL 3L3KA 3NCBB 4YC2C 3CVHH 1K3ZA 4XCFH 3B9KD 4HS6B 3BO8A 4WTXA 4Y4FD 1MCNA 1MRDH 1KCVH 4KVCH 5J13C 2ZPKH 2C9AA 3FHQA 5ID1B 3GSNB 4M1GH 1NGYA 4Y4FB 2CDEB 1A6ZB 4OZFB 2B8OT 4BKLA 3QPXL 4HWEH 1D9KB 4M03A 1PFCA 4JRYA 1P2CB 4ZSOA 3M1BA 1N2RA 3CAFA 3FQUB 5I16A 3I3EA 4XPGL 5DTFA 3QUYC 5FYKE 3CX5J 2VDKL 5B4MD 3VH8B 1OAUH 2QQNL 1F3JA 3S5LG 1CXLA 4E5XA 1OVZA 3HG1D 5EN2A 2R69L 2NY1B 3LV3B 1HCFX 1JPSH 3Q48A 4OIAA 1FO0A 2H2SD 5FHBL 2EIDA 6FABH 3BKML 4QRTB 3HG1B 1U8LA 2ZSVB 5ERWA 3QUZA 4NOBA 3BMWA 4Y4HD 1MREL 4FTVE 3ET9F 4GXVH 4KDVA 1W8NA 1GOFA 2GSGB 4Y4HB 1G1CA 3B6SB 1UQSB 3LEVL 1UCBL 1GGCH 2FH6A 1AP2A 1UKSA 4IHOB 4XNZC 3QUKA 3KNBB 3MCKA 1G7QA 4JFHD 4OD2A 4LCIL 2XN9D 3OXSA 3BKJL 2FEEL 1UXWA 1X44A 2NTSP 1QA9B 2UZIL 4NO0D 3W11C 4BH8A 3IETB 2XN9B 3B9VA 4WFEE 4M02A 3TC9A 5JHLL 2QV2A 4PRID 5CLTA 2YUVA 4NO0B 3D2UD 2W0KA 4PRPE 1A6PA 5I8CB 3EO9H 3MV9A 3GEWB 2Z91B 4MJIE 1KFAH 3PF2A 4PS4L 1CFTA 4PJDE 4PRIB 4F3FB 3H42H 3D2UB 4HCRH 4FNLL 3ZKSD 3B9EA 3IFOB 5HXMA 2KZWA 5KTEL 3HE7D 3OR7A 3BN9D 1LILA 4NQXB 3TVMA 2OK0H 1MJ7H 1OF2A 4Z8FH 3EFFA 5C0RH 5I1JL 5F9AC 4GKNA 3PWPA 3TPUB 5C09D 2ADJB 4YLQT 4K3DL 3UTPD 5EUKA 1QNZL 4I4WB 4M1DH 3OQ3B 3UZVB 3BDXA 2QADD 3PWVA 3WXWL 2E7LA 4JJ5A 5C09B 5IMMB 3SE3C 3CCHB 5K33A 4KFZC 4NNYB 2VWEE 2H9GA 4I18C 1F3DH 1UXSA 3O3DB 5IM7A 3MJ8A 5SWSD 5EUOA 4B0MM 1TIUA 3OAYH 3HE6C 5JDJA 3BPNC 5IHZA 2VKWA 2AK4E 3FT3B 4AMKH 1UB6A 1EEUA 3MXVL 2XV6B 5SWSB 2BSED 4N0CC 3FQRA 2O5YH 2UWEB 4XVTL 4GQ9H 2R0KH 1CE1L 3DXAD 4S1RL 1WBYB 3DJ9A 3FB7B 4MA1C 3IDIB 3NCMA 3P9WB 1MIMH 3DXAB 3HPLA 3QXDB 2ICES 1GHFH 3GBML 1MRCH 1P4BH 4NNPL 4UBDD 4JKPL 5LWYL 2J4WL 4JFEA 3VW3L 1G7HB 1G7LA 2A6JA 1RHFA 1U6AH 4LDEB 2LAGB 4RSVA 1MCEA 2BVYA 4TTGA 5SWQB 4NQDE 4D3CH 3B5TA 4PJ5E 4DKDC 2OJEB 2FGWH 5IKCB 4JQXA 4XWGL 1LO0L 4ORZC 1E4XH 1A1MB 1KG0B 2HMIC 1E4WH 2APTA 1XZ0B 1WEJL 2ID5A 2VDML 3DWTA 4LHUB 3C5ZC 5DRXA 2MJWA 2PW1B 5DVKA 1JGUL 1AO7E 4U1SA 5JNYA 1FNEB 3KPRA 1HZHH 5TPWH 3FQXB 5FCUL 1YZZA 3EDDA 4LASL 3VFNA 1MIEL 2AJXL 1VADB 4X5LA 5KVFL 3JVGA 1FNFA 1EVUA 4O02H 1RUPL 1NAKH 4JRWA 5EORL 1RFDL 4U6HA 1JV5B 2GITA 1Q9OB 3MRBB 2AEPH 2ED7A 3D39D 3MACH 1A5FL 1FJ1B 3OJDA 1E28A 3ZL4L 3U9PH 3LKSB 5F1KC 3JV4B 3QXUA 4Y19D 4DKEH 3LPFA 4JRXD 4ISVB 4TNWF 2H8PA 3D39B 1WZ1H 4LLUB 3JTSA 2CJUL 5TDNB 3WFZA 1A9BB 1YYLL 4Y19B 2OBGA 4JRXB 3L6FB 5FM8A 1NUFA 1EBAA 4LAJH 3MTRA 3PE9A 5IMKB 4O2EB 3MRJB 3EYOA 5T1LA 1A6ZA 1CDYA 1D9KA 4NN6C 4PP2A 3U7WL 1P2CA 4BK5A 1FFOA 1PY9A 4NBYB 3VFVB 1VDGA 1QHOA 1VPOL 4PLOB 4J1UA 3QDJE 2E7BA 1T21B 2EH8L 1IQWH 5KN5A 4K8RL 2YPLE 3CPLB 1IEAB 1UCTA 2V5YA 2J8HA 2CLVB 4LSSH 2OL3L 5C6TH 1QSEE 1TVDA 4R26H 3LV3A 3VRIB 1A7RL 3AB0B 1R3IL 3MRPB 1MFBL 2ICWI 1Y18B 5DEFB 3QUZC 4NO3B 2CGRL 3PGFH 3HG1A 3JWOH 2BJMH 1NC4D 3H9SE 4YUEL 4F57L 1L7IH 2M2DA 4QRRD 4F2MB 4RQQB 4AL8L 2QBWA 3MFGB 1J12A 4XRCB 2GSGA 1NC4B 4IOFD 4Y4HA 4OF3A 3B6SA 3IDYC 4GKZB 1G7JA 4X6BB 4K71B 4I13B 4QHUA 5J12C 1RIHL 5JIKA 3KNBA 3S35X 1G6VK 3OKOA 2IH1B 1A02N 4PRAA 4OZHF 5IHUH 4OAWB 4NFDA 3W82A 3V6ZB 4NWTL 4XP4H 5C0CE 3UJTL 5IIEA 1KJ2L 3QEQE 5F44A 4YFDB 3O3AB 1DTUA 5KVGH 2C26A 4HKXB 2VISB 4UDTB 4JFDA 3DUUB 4NO0A 5F8RC 4K7FB 3E8UL 2Z91A 3SQOL 3HKFA 3QQ4B 2CDGA 4YDKL 1IEHA 4JFYB 1NCBL 2F5AH 2IFFL 1F90L 1LNUB 3MXWH 1XCTA 2A77H 1TFHA 2C3WA 4UV4L 3TVMC 1XGYL 4DK6A 4MNQA 5HYJD 4E9LA 5IQ9A 1HI6B 5DUPH 4XMPL 3WXVH 4LCWD 1WFTA 1U8QB 4FG6D 4DOHB 1BF2A 1WC7A 2XA3A 3OKNB 3TPUA 2ADJA 1G6RH 5HYJB 4LP4A 3O6LL 4I4WA 4LCWB 5FUCC 2E7LC 2H45A 1FE8H 1UM6L 3UTSD 4W6WB 2DM4A 3IGAB 4TN9A 4NC1E 1KENL 3KWWB 4RFOH 3AAZB 1RY7B 1D5ZA 1I9RL 2ZJSH 1I7UB 3GKZA 5IBLC 3CLFL 5J3HC 4P59L 2AQ3A 5IEKB 5E08L 3QZWB 3RWHB 2A6DB 2HT3D 3LHPH 3MBED 3WEXB 1NFDB 1GYAA 3JBG7 5IVXF 3VU2A 2VLKD 5K59E 4U3XA 3MCG1 5JHDE 2JJSA 2EDQA 3MBEB 1WBYA 2VIRA 2Q7YB 2VLKB 4YGVB 4R7DA 5I1AA 3GMOB 3ISWA 3DIFB 2XA8H 1JVKA 4GH7B 1NCCH 3G5VA 2DF3A 5L0QC 4NKMB 1G7HA 3VG9C 4WUUD 3MRKB 5F93C 4L8SA 4OV5B 5SWQA 1LEGA 3SQBA 2E3VA 4YK4C 2A1WL 1RJYB 2PYEA 4JQXC 1QBLL 4Z0BH 1CDCA 5AZEH 3RBGA 1SY6L 2OJEA 4LRNH 2PW2A 4WUUB 1XR8B 3KPMB 2GQHA 4G6JL 3X3GL 3O4LD 3GI8H 5HHVH 3ZYJA 1KG0A 2NY4D 3L5JA 4KRPC 4MXQD 1XZ0A 4LHUA 5ESVA 2Q8AH 2PW1A 3NIDF 3RAJH 3ULUD 1VFOA 3FRPG 4NM8L 3SDXA 2EH7H 3O4LB 1W8OA 2NY4B 3R0MA 1OTTC 1OLLA 3TT1H 1QEWB 2Q87A 3RJDA 3FQXA 4C59B 2NTFB 3TN0D 1T80A 3O2WH 1ZSDA 3LB6C 4Z77B 4ODXB 1A6WL 1N4XL 2ICEB 5E99H 1A3RL 5EOCH 3JVGC 1HEZB 4XVSL 2OSLA 1F4YL 3T2OA 1QSFE 3TN0B 5C71A 4FQLL 1CK0H 3KGRA 1JV5A 1TTUA 4P2CG 4UTBH 4BUHA 1I1AB 4Z7UF 1I1FA 1ERNA 5CJ8A 2VSDA 4XP1L 5K9QG 4HBCL 2GFBB 3FHAA 2GK0A 2ZWLT 3N9GH 1FJ1A 2EDNA 1QHPA 5BRZA 1MCRA 2C3HA 4LBEB 4NO2A 1DANU 3LKSA 5BMFH 3X3FH 2O5ZL 3TNMB 4HJ0C 4TSBH 1K8DB 1KCUH 4DKFH 1ZEAH 1Q9WB 2VDQH 5FHAH 1KCRH 2HLFD 3NMEA 3L6FA 1N0XH 4Y4FC 3BH9B 2Y1VA 3TP4A 1D9KC 3MRJA 1LO4H 5TFSH 4GW1B 5D8JL 5DD3L 4ELKB 2ERJB 2EDBA 5HPMB 5I30L 4LSQL 1XAUA 4LIQL 2D7QA 4OSUL 3HNTL 1PSKL 1XIWD 2P24B 3MLWH 4QXGH 1WISA 3HC3H 4HFWB 3HMXA 1A14L 3DHMA 4MDJA 5DYOB 2XPGA 1YNLL 5B4MC 4Q9QH 3ULVC 1P6AB 2CLZB 1XIWB 1BBJA 4NNXA 1EFQA 2NY1C 4JHWL 1UJTA 5DHVA 3VFUA 3C08H 2I5YH 3LAFA 4ELMB 3W0WA 3Q6GL 1G84A 1T22B 3VRIA 3MRPA 1Y18A 4FZ8H 5DEFA 1S7RA 4PJHF 4NO3A 2RB8A 4D9LH 4HG4K 1FDLH 3DX8B 2AAVA 3HMWH 1IRAY 1S7TA 3QCUL 4RQQA 1TTGA 5DQ9B 1J1XL 2VLME 2GI7A 3RKPA 1ZV5A 4Q0XL 3RGHA 4XRCA 4Y4HC 1YQ2A 4NHCL 5HHPA 2COQA 3UX9B 1T0MB 4KV5F 5E1AA 3OG4B 4YHML 2LFGA 3CMGA 4GKZA 2D4DA 4KVNH 1A3LL 1FPTL 4HMCA 5JMRA 1VCAA 5TE4L 4ZPTA 5EBGA 3HZKB 2N1KA 1FFNB 3TV3L 4KUCF 5HI3C 2IH3B 1CDHA 3LEYL 3P40A 4OLWH 4R90H 2VXSL 4U1LB 2ORBL 1BEYH 5CBEA 2CIKB 4UDTA 2E7HA 2GCYB 3MJ9A 3DUUA 5D2LB 1C5CL 2PN5A 5HHQB 3BAEL 1N59B 3ZMRA 3QQ4A 3MQIA 3L7EA 4NP4L 1MHPH 4JFYA 1JPFB 4IBLT 2XKUA 4G8GE 1LNUA 1N7MH 2A73B 4P9HL 4WV1B 5FIEA 4NZDA 5J11B 3U4AA 2EE2A 3MZGB 1PX3A 4YGAB 5BVJB 1S9YB 4HF5L 4XHQA 1AD9B 1HI6A 1NGQH 3O2VH 3QFJD 1U8QA 4XCEB 3WO3B 5HYJA 1QRND 2AJSH 4XNYL 4FQ2H 2DMKA 3QFJB 2Z93B 5H37H 1VGEH 3VJ6A 3LQAC 1J05B 1V7ML 3IGAA 5CJOL 3C6SB 1INDL 5BQ7B 4XNUH 4RIRB 1I7UA 3GM0A 1U58A 3IAPA 3W2DH 3QZWA 3RWHA 3NCYP 3WEXA 1NFDA 4YFEA 2X4TA 5D6CB 2JJSC 2NX5D 4UT7H 2Z8VC 4M7JL 5L88H 3O9WA 3RVTD 1DLHB 4DTGH 1NBZA 1YPZB 3T2PA 5GIRB 3G6DL 5GRZA 1NKRA 2W1NA 2HTKC 4M6AA 2Q7YA 2NX5B 3ZHDA 4YGVA 2VXTL 4PGJA 1J9CT 4MAUH 3P9LB 2I26N 2ESVA 1QO3B 3DIFA 5I1EH 5LQBH 3QDMA 1HIML 2HKHH 5JXAH 4L8SC 3QHZH 4UBDC 2X4RA 2FX8L 4OV5A 2UY7A 1PJ9A 3MUHL 4CN4A 3NN8A 4HIJB 1RIVH 3EFDL 4HC1A 5DHXB 4ZOCA 4D0BA 5KVDL 2GJ6D 2WIIB 4WUUA 1XR8A 2EDLA 3KPMA 4FQQB 2DJUA 4P0DA 3CXHJ 2DMBA 2GJ6B 1NLDL 1LK2A 4DFHA 1IAKA 2P8PB 3GSNL 4JR9H 3SKNB 1N6UA 4X5XB 4P2YA 3RUGA 2QQNH 4XCNB 1TETL 4YHNB 4Z77A 3MV7E 4ODXA 1PYWB 2ICEA 1TQBB 1AXTL 4WCYL 3EBAA 3MRGA 4J8RA 3CX5K 1UVQA 4UQ3B 1KJMA 2XNAA 1PY4A 2R69H 3M07A 3D69A 3KR3L 2EDFA 5DVNA 1FGNH 5FHBH 4R4BB 3IDNB 5J6GA 1I1AA 1CGUA 3MUGA 4CL7A 5IP4A 5JA9A 4M00A 2DQCL 1KLFA 1MREH 4KGJA 2ZG3A 3WL9B 5A1AA 4NRXA 4DGYL 1DUYB 3O11B 4TNVK 5KG9A 1K8DA 1RUAL 3O6ML 5IW6B 3LEVH 2FL5A 2IF7A 3B5HA 3DROB 4AQOA 1UCBH 1T20A 2DMCA 4MQTB 4LCIH 2EICA 5DQJB 2E6PA 3BH9A 3BKJH 4MS8C 3VXPB 5A2IH 1NCTA 1SMOA 2D7PA 2UZIH 1MF2L 1NBQA 2FHFA 4GW1A 3CLEL 4XBGA 1ZANL 1YEIL 2A83B 4ELKA 3SGKA 5JA8B 4M7KL 3QULA 4MAYA 5JHLH 3CFJA 3WJLA 1PEZA 1U8MB 4R8WL 4X6CB 4HWNA 3P0VL 3VCLB 4PS4H 2CLZA 1UZ8A 1XIWA 3DRTB 4H88L 1NLBH 4FNLH 1LK3L 5HHNB 3AB0C 2O93L 5SV3A 4UNVA 5KTEH 1FLRH 4ZMAT 3H3PL 4MZ2A 3G6JB 3V0AC 1VEMA 2ZG1A 4JY4A 1A2YB 4G80A 5IJVA 5JW5B 4JZJB 3PL6A 1KBGL 1BOGB 2YKLL 3BI9X 1QNZH 3L5WB 1K4CA 3MA7A 5GSRB 5J9PA 5HI5D 3IU4L 4HWBH 5CAYB 1T0MA 4CADB 1U95B 3WXWH 4K71C 4L4TD 2ADIA 1OT1A 4OB5H 5E9DE 3QEGH 1ZHBA 1J10A 4EOWH 3I2CL 5I8EB 1AGFB 1WFOA 1MY5A 5E8DL 1EZVX 5DRZB 3DGGB 3WHXA 1XEDA 1IAOB 2XWTA 3HZKA 1FFNA 1NEZB 4L4TB 4JFQB 2AV1A 3LQAL 35C8H 4H1LH 4IOIB 4RCAA 4DQOH 4HS3A 4PUBL 4U1LA 4DUXA 2JCCB 1ZHLB 2CK0L 2BOBB 3MXVH 4YBLB 2W0FB 1X5GA 2CIKA 2GCYA 4UTAL 5D2LA 4XVTH 4LSUL 2X4PA 4J12A 3FZUC 5HHQA 1N59A 2XTJE 1I85A 4PJ8D 1CE1H 3RZCD 4S1RH 1VFAB 3RWEB 5CHNB 5SWZD 2IAND 5JORB 2ICWA 4X9FA 2JK5A 4PJ8B 1CGYA 2AXFA 2GY5A 2J5LB 3RNQA 3RZCB 3GBMH 2XZAH 4NNPH 5SWZB 1LE9A 4JKPH 5BVJA 2IANB 3BEWB 4RBPH 3VW3H 3VXSE 2P5EA 4GUPB 4H0IA 1Q72H 3MV8E 4KK5D 2X4OA 2EIZA 3AC0A 1KSRA 2AXHA 3BGMA 1P5VA 4MX7B 2Z93A 4XWGH 1J05A 4N0FA 3IFNL 4B7LA 3C2AL 3U4EB 4UAOB 1U8PB 5BQ7A 5I76B 1I75A 2VDMH 2R2HB 5TJWK 1TPXB 4DGIL 5I1DB 2IBBA 1JGUH 2WW8A 2WK2A 1AGDB 1KXVC 4JFXA 4OCRL 2EDXA 2MCPL 5FCUH 4O9HL 3OMZA 4LPUA 3O9WC 2AK1L 2HJLB 1T89A 1WSST 1LEKB 5D6CA 3HZMB 1S5IL 2HT3C 5I1CL 4GS7B 5ISZA 2OTPA 1H8OA 5GIRA 2A0LD 2XG4A 3KJ4B 5E56A 2EDKA 3ROOA 2JIXA 1AXSB 2K3TA 4BQBA 1QFPA 5FYLD 1RFDH 5C0BD 3VXMD 5BCAA 3OXRB 5D7LD 2PO6D 4J2XA 2ZSWB 2VDNL 3ZKMD 2X4NA 4LHJB 5AZ2L 1D3CA 1E6JL 5C0BB 4UMGA 3ZT7A 5FECB 4DAGL 1FIGL 1B3JA 2PO6B 3JUZA 3QHFL 32C2A 3CVIL 3F12B 1NPUA 5FOBA 5L7XH 5B8CA 2CJUH 3MMEA 5CSZB 2WIIA 3D3VD 5JDSB 2V2TB 4HULB 3HNVL 3D9AL 4LEOB 1ORSB 1YECH 1D5XB 3ARBD 4XNQB 4P3DB 4ALAL 4I2XB 3J7HA 1CN4A 2GJ6A 2YD2A 3BIKB 1JYNA 1QKZL 3WE6A 5K9JH 3KPQA 1BJ1H 2BSSB 3C60D 3NAAL 1JJUA 2AV7B 3NIGF 1OOAA 3D18B 3ULUC 4LSVL 1L0YA 1F6AB 1VPOH 4ZFOL 3ESVF 2EH8H 4W81A 1MFAL 4PREB 2BOCB 1F5WA 2NW3A 2BVOA 1PYWA 4JY5H 2DOCA 2OL3H 3TN0C 4UQ3A 2O5XL 2IMNA 3RIFK 4FFVC 2MNUA 1R3IH 4X7DC 1Q9LB 1I1AC 3WFBL 1MFBH 1TNNA 2AKRB 4R4BA 4HK0B 1BM3H 3BHBB 4M48L 3NCEB 5HI4C 4LCUB 4YUEH 1RUQL 4F57H 1OB1B 5HGBB 4TPRL 1AR1D 3WL9A 4P4KD 4AL8H 3LS5L 3QQ3B 5EU5B 4TULL 4UB0L 4N9OB 4ODSH 2PR4H 2ITCA 1JWSB 4WO4D 4X9GA 4P5MB 4P4KB 4X6EB 4JM2B 1KLUA 4KK9D 2J1KA 1OD7A 5DRNB 2XZQL 1OQOA 3VXPA 4WO4B 3I6GB 4U2ZA 2VERN 3LS4H 3UJTH 4P4RA 3SGKC 1KB5L 2HG5A 4MAYC 2A83A 3TBSA 3RVWD 3WJLC 1AH1A 2GSIA 4MLSA 1ZMYA 1BIIA 1S9KC 4Z7QE 4ZNEA 2GY7B 1BVLA 1W0VA 4X6CA 2BVUA 1KNOB 3E8UH 2EE9A 1XIWC 3SQOH 3SDDB 4JREB 4W4NA 1VGKA 2MHAB 3LKNB 3DRTA 1NCBH 3RVUC 2VLRE 1MHHB 2IFFH 1F90H 3KAAA 4F8QA 3L9RA 1XGYH 3RWDB 4U1NA 3SKJL 4B50A 2FX9L 2VRAA 2G60L 3PL6C 3IXAA 3O6FD 5JW5A 3HPJB 3V5DB 3VG0L 4PJ9D 2B2XL 3D0LB 4Z7OE 4J3XA 3QFDB 3O6LH 1BQLH 1M7XA 1AQDB 2YRPA 1UM6H 2DWEB 2Y6SD 1BD2E 1W72A 3O6FB 4CADA 2FB4L 4WHTA 2N7BA 5ENWB 5DJDB 1UH4A 3QWOA 4PJ9B 2IJ0C 4X7EC 4C56E 5BXFA 3SDYH 2ZKHH 4OD1L 4PTTB 3MLYL 2DQUL 3WYRA 4BFGA 4OT1H 1I9RH 3MGAA 1NEZA 4L4TA 3HNSL 3CLFH 3V8OA 3RNKB 2YSSB 1HYSD 5E08H 3LDBB 1AI1H 1KGCE 2JCCA 1ZHLA 3EYSL 4G8EA 2BOBA 1JRHL 5HGAB 3PG2A 4ENEC 1I85C 3S34L 3FQWA 4GBXD 4HGWB 5F8QC 4H5SB 3UJIL 1FZOA 1AGCB 2BMKA 4RDQF 1NSNL 5BS0D 5JORA 1DVFD 4GBXB 1EO5A 4Z7NE 4KI5D 3GIZL 4IDJL 4PRHD 3GUTB 2HRLA 3BESR 1LDPH 3UBXI 2Z4QB 3PWPE 2X89A 1E6OL 1QRKA 5C08A 5BS0B 3BEWA 1DVFB 5IJKA 1MCPL 2NY2C 3WFCH 1NFDF 4P5TD 2BDNL 1O0VA 4GUPA 3IJHB 3VXUD 3CFEA 4I1NB 3Q0HA 5KAQG 2FLRT 4WTZG 5IB5B 2A1WH 1QBLH 3FT2B 4DK3A 5IFAL 3STZA 5C1MB 4MX7A 4YDVB 5HDQL 1P4LA 5JLZB 3HAEG 3VXUB 3NFNA 5EUOE 4U05A 2R23B 4G6JH 1JHTB 2ZCKL 3X3GH 3FN9A 3BYTA 4Y16D 1JRHI 1K85A 3U4EA 5I76A 1U8JA 5I1DA 1MH5A 4NM8H 3P4NB 5GGRY 3VI4F 4OD3L 1UZ6F 5JUEL 4M43L 1MI5D 4CBPA 1T89C 2F9BT 5FUZL 4CW1B 2ICCA 3OSKA 3REVB 1ACZA 3TJHD 1LEKA 4TSCL 1Y6NR 5GGQL 2K7QA 1N4XH 1A9EA 1RI8A 5FO8B 5GS1A 1WBXB 4XX1E 4Q9RL 3QIBD 1MI5B 2B39A 4NN7B 3ULUL 1T1YB 4XVSH 1X5YA 4IIQB 4JQIH 1D6EA 4FQLH 3ZO0A 3GNML 4WHCA 2HJKB 3FOMB 2X9YA 2C4XA 3OXRA 3BYYA 4FXGA 4UDUB 3V0WH 3QIBB 5DURB 9CGTA 4MGXA 4XP1H 4X6DB 2DDQL 4HBCH 2B7DT 1FO0H 4JO2H 5EBWB 3G08A 1RU9L 4HAGA 3T0XA 4S1DD 5B22A 3S5LB 3ULUF 2O5ZH 3RUGF 2JF1A 3CX2A 3EW3B 2HT4C 5IK3B 4LKXA 1RZIB 4HUMB 4DZBB 5E8PB 3H3KA 1BWWA 3OJVC 2J8UB 4EI6A 4RRPG 1S7WA 5AAWA 4XC3H 3HI5H 3TNNA 1R3HB 3BIKA 4ACPA 2EECA 5DD3H 1AQKL 4YBQD 4OSUH 5AYUL 2Y5TA 3HNTH 12E8L 2VJXA 3T0WA 2W9EL 1PSKH 3SDAA 3VGBA 3D18A 2WM0A 3HA0A 1YN6A 2FZ3B 3AUVA 2HH0H 5ID0B 2Q6WB 4HKZA 4GFTB 1A14H 5F9JA 3WNNA 1FYTB 1YNLH 4PREA 2HVKA 4PG2A 4JHWH 4PJ7E 4OCLC 2QLVB 4XNMB 5JIPA 4IMLB 4E41E 1Q9LA 5IW3A 4F80A 4GOSA 3TO4D 1JGVL 4U31A 1UM5L 4WHYG 1ZTXL 4F9LA 4LCUA 3FFDB 2CDFB 4RISL 1OB1A 1NCWL 3QCUH 1H9VA 4HIIB 1F6FB 1OAYL 3V6OA 1JN6A 4Q0XH 1YQVL 4PYGA 1EFXD 5EU5A 4NHCH 4NZTL 1IT9L 3W5MA 1BFTA 1JWSA 4J3OC 2PXYD 4YHMH 2B4CC 3KPPA 4ELMF 4JM2A 3G5XB 3GB7B 1EFXB 3KS0J 1ZLWH 1RMFH 5ECJE 2XACC 4KU1A 2OMBA 3S9DB 5F97E 3TV3H 2PXYB 3I6GA 3U36A 3LEYH 5C07D 2ORBH 2VL5B 5DA0B 4BFIA 1CGVA 1CLCA 4XBEH 4UV7L 3ES6B 3B43A 1C5CH 5ESAB 4YIQA 5C07B 5IF0B 3BAEH 5E70A 3CJJA 5TH2B 2MCG1 3P3YA 2GIYA 1J11A 3SDDA 4D9QD 5K9KB 2JJWA 2APFA 4PRBA 4XP5L 4JJHA 2RQ8A 1Q1JL 5D7IE 5GGUB 4OI9A 2J6EL 4P9HH 3V79C 3G5ZB 1URLA 5D7KD 5HYSA 2MSPA 2DQTL 4HF5H 4LVHC 3SCMD 1S9XB 1L9NA 5D2LF 3HPJA 1IEBB 5EZLB 4PB9L 1S5HB 3EYUL 1MFDH 1DQTA 1QQDB 1AQDA 1PDKA 1YEKH 1YEJL 2DWEA 3QDHA 3SCMB 1HN1A 3P4OB 5C7XL 5CJOH 5ENWA 5DJDA 5C0NC 3C87A 5CGYD 4G9FE 5E7FA 2DKMA 5HY9A 5M94B 4A6YB 1XF4B 2OZ4A 4J4PD 1ZT4B 4OZ4A 5EU6D 4N8PA 4PJEB 2AW2A 5DLML 4YBLC 3RWCB 2EXWD 3IJSA 4B53A 1AD0B 4P3CL 5EPMB 1ZXQA 4BYHA 5HGAA 2LAAA 2VZ3A 5EU6B 1FL3B 4M7JH 4N0UB 4P2QD 5C70A 1PKQB 3G6DH 2B5IB 1AGCA 5J6HA 5L8JB 4PJ8C 3T2QA 3QNZB 2J5LC 3RZCC 1T6VN 5GJTH 3OR6B 4UQ2B 4Y4KD 1HIMH 4KH2A 3BKCH 3PNWB 3PJSA 2WWMC 2XKSA 4TVPE 3OZ9L 4JVPA 5F3BB 3IJHA 4F7TB 1S7QA 1OARL 5CP7A 3KJ6L 5E4EB 5C0JB 4JG0L 3JXAA 3EFDH 3OKDA 5HJ3B 3FT2A 3ARDB 4KK5C 4AYFA 3OAYK 2KZ1B 3ILPB 4UAOC 4RZCB 4DZ8B 1TPXC 3I6LD 4PJBA 1U9KA 1NLDH 2E6JA 3BPCA 4NZRL 1TZGH 3GSNH 5ACZB 1YUHA 1KLGA 1M6OA 1OTUC 3CXHK 4UZGA 2NNAB 2H2PD 3VRLE 4LDLB 4R6UA 1O5DT 4CW1A 5SX4H 5GS1C 3SJVD 1TETH 3LRGA 1AXTH 2P5WE 1WBXA 3KJ4C 3B9DA 4WCYH 4G42A 5CIPA 1A0QL 2VLJA 1T1YA 4YXKH 1IAIM 5B3JE 4IIQA 3KR3H 2VDRL 2HJKA 3FOMA 5F7FA 4PJXA 2P8MB 4LL9A 1EUUA 1OL0A 3UTTD 3A6OA 2DQCH 4L1HA 1GOGA 4X83A 3JTTB 4DGYH 3S5LA 1T04B 1ITCA 3DMMD 2Z92B 4BM7A 1K2DB 1RUAH 4K3EL 4ZPVB 1BGXH 2Q76B 5E8PA 5DJ2A 2J88H 4OZGA 1OCWL 2ZCLL 4HK3N 4XNXL 4UU9B 3F58L 4OFKA 5ABDE 2DQEL 2X2YA 1LWRA 3GSRA 1GGBL 1MF2H 4XWOD 3CLEH 2C1OB 4ZFFB 4KQ3H 4I3GA 3SDAC 4M7KH 3T3PE 4LVEA 4AM0A 2RIKA 3O45B 1OAQL 3FCTA 3DI2B 2FZ3A 4LLWB 2BFVL 4O2FB 1BAFH 5FA4B 4DUWA 2Q6WA 5IBTH 1M05B 2HFFA 1BBDH 1FYTA 3P0VH 4PG2C 5C0DB 3HS0B 4YBHA 5D5ME 1ZLSH 4X4ME 1N64H 4H88H 4Q2ZB 3G9VA 5I8KL 1LK3H 1NMCB 2YRLA 1IGYB 3ESUF 5C0AE 3H3PH 5BRZE 1CFSB 5D72L 4KMQA 4F9LC 4QXTA 3VXRD 1ULVA 3S4SA 3LEXB 2CDFA 5DD6A 4U7MA 5LKNA 3DX9B 1CL7I 4X6CF 4WFED 1MVUB 4H26A 3OJMB 3IU4H 3IAQA 1QOKA 1V3JA 4JM2C 5KSUA 4MJID 1XGUB 2CD0A 3GB7A 3WS6C 3I2CH 5I2IA 4Z7VA 1I8IB 5E8DH 4S1QL 3G6JF 4U6VL 3K8MA 3UTZB 1H5BB 4KK9C 1EEYA 3LQAH 1NANI 4M61B 1QUNA 3MRQB 4MJIB 4PUBH 3X12A 5IR1A 3CC5B 4UUJB 2WWKT 2VL5A 4AENB 2CK0H 1ACYL 1CU4L 2P8LB 3ES6A 3GSWB 4UTAH 3MFFB 2DBJA 4XZUB 5ESAA 3SDDC 4M9PA 4JREC 1GH7A 4FQ1L 5JXED 5T3XH 3DURA 3QPQC 5HVHC 3WIHL 1CQKA 2FEDC 2M1KA 4Y5VB 4ZUTB 3Q3GB 5GGUA 4O4YL 1AIFB 2EDWA 3DSFH 3VFOA 5D2NA 3NPSB 3W39B 2JCCF 3O2DA 4RX4D 4GJTB 1AR2A 1S7UA 4XGZB 2NXZD 3QIWA 1S9XA 1MJUL 3UO1L 1S5HA 2AK4D 2LTQB 3O6FC 2DN7A 1IKFL 5IB3B 1G9MC 1QQDA 3FKUS 2LV4A 2DL9A 4W6XB 2NXZB 2VITB 3X14B 1R0AH 1ZE3C 1CCZA 5EC1B 2AK4B 2Y6SC 1F6LL 3C2AH 3C8KB 3FTGB 5GS3A 5HYQA 2MWCA 1BREA 3MLUL 4DGIH 3LDBC 1JK8A 5ICXB 2BVQB 3U0PB 5ICYB 1M7IA 3RWGA 4G8FA 1G7IB 4OCRH 1RZGB 5JO5B 3RWCA 1DL7L 3MBXL 2MCPH 1MJ8H 3VFSB 2AK1H 3BUTA 4ZYKB 4QGTA 5C3LD 1A6VL 1S5IH 2OS7A 4LLVB 5I1CH 4PLKD 4AH2A 2C1PB 1HSBB 3MX0A 5CCKL 4NQDD 4FQJH 4X4ZA 4WRLA 3U79A 4RGOL 5HHOA 3QNZA 4LARL 4MWFA 4DN3L 5I75B 4ZODA 2X44D 2NR6D 1KB9J 3C09C 4UI2A 4NQDB 2VDNH 4PJ5B 5AZ2H 4KI5C 4XI5D 4Y1AD 1E6JH 3T4AB 3PGDB 1TZIB 2H6PA 2BNQE 2MOVA 1AO7D 5DJCB 4U1IB 4PJFE 2HVJB 4JDTH 4F7TA 3TO2A 5FYLL 4KTEH 3VGAB 1KN4L 5HJ3A 4GRWE 3ARDA 1AO7B 1T03L 1Z6JT 1PZ5B 1OQXA 1CS6A 1R6V