1PFJA

Solution structure of the n-terminal ph/ptb domain of the tfiih p62 subunit
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
108
structure length
108
Chain Sequence
b'MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TFIIH basal transcription factor complex p62 subunit
publication title TFIIH contains a PH domain involved in DNA nucleotide excision repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1pfjA00
1AWEA 4EMOA 3SUZA 1GG3A 3X23A 1EVHA 1V5MA 2COFA 4GZUA 4YL8A 4KHAA 2D10A 3P6AA 2YVCA 3PP2A 2I5FA 1FHXA 2PZ1A 4A6FA 2RSGA 2EMSA 3T06A 1FGYA 2I1JA 4HAVB 2D9WA 3FEHA 4DXAB 1X1GA 3KRXA 2OQBA 2KGXB 4HATB 2CRFA 2J0KA 4F7GA 1BTKA 1P6SA 1H10A 2M38A 2N0YA 3U8ZA 4CHMA 5J3TA 2VRWB 4B6HA 3NSUA 1V61A 5J3QA 1MIZB 5KCVA 2HE7A 2YF0A 1TJ6A 2D9YA 2D9ZA 1UPRA 2DHKA 1RRPB 5JHGA 2YRYA 1U5EA 4HDOA 4DX90 4HAZB 1U27A 1M7RA 1MK9B 4C0AA 5EFXA 1IRSA 1PMSA 2RLOA 1XCGA 1U2BA 3KSYA 3P7ZA 2JP2A 2AEHA 4MT7A 5JP4A 2GCLA 5DH9B 3KRWA 5DHFB 1ZSQA 3DXCA 1QC6A 1V5UA 1SGHA 1V88A 4HHVA 5DI9B 4HAWB 1K5DB 5HE1A 4K2OA 4KVGB 2NZ8B 3BJIA 1XKEA 4IOYX 1K5GB 1WVHA 2DLWA 1UNPA 1Z87A 2L1CA 4K17A 1B55A 1NI2A 3AU5A 4DX8A 1RJ2A 4GMVA 3WYFB 1UNRA 2Q13A 3PSCA 3ULCA 2MKRA 5GOWB 2LULA 4Y94A 5DIFB 5C6RA 3MDBC 3ZVRA 4IFSA 1DYNA 3ODOA 5CLLB 2RNRB 2EJ8A 2D9XA 3SV1A 1X05A 3GYOA 3D8DA 3QIJA 1NU2A 4Z2NA 2D2QA 2Y8GA 1NTYA 2IFSA 2COAA 3RCPA 1WJ1A 4HB2B 5C5BB 2DX1A 2D9VA 4GMXB 4PQ0A 4EKUA 1MIXA 2QKMA 2ADZA 2P0HA 2W2WA 1ZC4B 2DYQA 3HQCA 4GN1A 3VOQA 5LONB 2DKQA 1EF1A 5HE0A 2ROVA 2CY5A 4YONA 2RUKB 5CLQB 2GJYA 1OMWA 2LG1A 3CIKA 2H7EA 2K2JA 2E2XA 1UPQA 2EMTA 1WJMA 3ODXA 1XODA 1P3RA 2GS0A 2DA0A 4EJNA 3N7CA 4HAXB 4ZRJA 3TFMA 1U5GA 4WJ7A 1N3HA 1OY2A 1ZC3B 3D8FA 1EGXA 2ZPYA 4A5KA 3BINA 1UEFA 2YT1A 3PEGA 1U29A 1OQNA 1W1DA 2Y7BA 4L6EA 3LJUX 5HE2A 2K2UA 4GPTB 1U5FA 3PVLA 1BWNA 4MK0A 2YT0A 1KZGA 2DKPA 2GCJA 1FOEA 1FHWA 1X1FA 4HB4B 3TVVA 4PNKA 2LYDA 2Z0QA 4HAUB 2YS1A 4TYZA 4KAXB 1X86A 2YS5A 2ELBA 5LOPB 2D4QA 2P0FA 4HB3B 5KQ4A 1X11A 2L2IA 1V89A 1KZ7A 2M14A 2P8VA 2HTHB 2X18A 3ZDTA 4HAYB 5FI1A 1FB8A 2AL6A 5D3WA 5KQ1A 1UNQA 2I5CA 3A8PA 3SYXA 1EAZA 5DHAB 3KY9A 1XD4A 1P5TA 2DX5A 3TW1A 2MDXA 2R0DA 1LB1A 1XX0A 2COCA 2DHJA 3DXEA 3MPXA 2P0DA 1LW3A 2EC1A 2MFQA 1MK7B 3ULBA 2G35A 3ML4A 4IAPA 2RVBB 1FGZA 1PLSA 1DDVA 1ZM0A 3AJ4A 4A6FB 4H8SA 1SHCA 5D3YA 1ISNA 1E5WA 3FSSA 4ZRIA 1MAIA 3PVUA 1NTVA 2LKOA 5D3VA 1BTNA 2YS3A 2BCJA 3VIAA 3WA0A 2K00A 5HE3A 4DBBA 1GC6A 2VKIA 1I2HA 3GYPA 3CXBB 1BAKA 3DXDA 1Y19B 2DYNA 2DHIA 5C16A 2N23A 3AU4A 1KI1B 3UZTA 5C5BA 2DTCA 2W2XD 1J19A 3HW2B 5JLJB 3A8QA 1PFJA 5D3XA 3F0WA 2XQNM 3FM8C 4P7IA 1GC7A 2FJLA 2D11A 5C79A 1U5DA 4A6KA 1DROA 1QQGA 3OANA 4F7HA 3HK0A 1V5PA 4WVFB 2J0MA 3PVWA 1MPHA 1Q67A 2UZRA 2NMBA 2UZSA 1DDMA 5D27A 2CAYA 4HB0B 1TQZA 2H7DA 4BBKA 1WI1A 4WSFA 1XR0B 3U7DA 1W1GA 2V76A 4Z2MB 4ZRKA 5FI0A 4K81A 1Y5OA 2DN6A 4K2PA 2UVMA 3G9WA 1I7AA 2ROZB 2I1KA 3D8EA 1DBHA 4CHJA 2Z0PA 2CY4A 2KUPA 2OTXA 1WGUA 3PZDA 1FAOA 4MY6A 2LOXA 1J0WA 4TKNA 3PG7A 5J3YA 1FHOA 3F5RA 4NY0A 3KZ1A 4KHBB 3QBVB 1DDWA 3M1IB 2ELAA 3A98B 1MKEA 4F7UP 2VSZA 2MWNB 3V5WA 2J0JA 4D0NB 2IYBA 3IVFA 5L81A 1WGQA 4CYEA 3QWMA 1H4RA 4HDQA 2Y8FA 2J59M 1ZVRA 1W1HA 3ODWA 2Z0OA 5JHHA 4NSWA 4KHOA 2CODA 1M7EA 1WG7A 3SO6A 2KCJA 2LOZA 4A6HA 2DFKA 2YSZA 3O96A 1AQCA 2R09A 4XWXA 2QKLA 3SNHA 3TO1A 3TCAA 1TXDA 2W2XC 2RGNB 4GXBA
chains in the Genus database with same CATH superfamily
4QJ4B 1AWEA 4EMOA 3SUZA 1GG3A 3X23A 1EVHA 1V5MA 2COFA 4GZUA 4YL8A 4KHAA 2D10A 3P6AA 2YVCA 3PP2A 2I5FA 1FHXA 2PZ1A 4A6FA 1ZYIA 2RSGA 2EMSA 3T06A 1FGYA 2I1JA 4HAVB 2D9WA 2Z14A 3FEHA 4DXAB 1X1GA 3KRXA 2OQBA 2KGXB 4HATB 2CRFA 2J0KA 4F7GA 1BTKA 1P6SA 1H10A 2M38A 2N0YA 3U8ZA 4CHMA 5J3TA 2VRWB 4B6HA 4OT1A 3NSUA 1V61A 5J3QA 1MIZB 5KCVA 2HE7A 2YF0A 3DCXA 1TJ6A 2D9YA 2D9ZA 1UPRA 2DHKA 1RRPB 5JHGA 2YRYA 1U5EA 4HDOA 3HSAA 4DX90 4HAZB 1U27A 1M7RA 1MK9B 4C0AA 5EFXA 1IRSA 1PMSA 2RLOA 1XCGA 1U2BA 3KSYA 3P7ZA 2JP2A 2AEHA 4MT7A 5JP4A 2GCLA 5DH9B 3KRWA 5DHFB 1ZSQA 3DXCA 1QC6A 1V5UA 1SGHA 1V88A 4HHVA 5DI9B 4HAWB 1K5DB 5HE1A 4K2OA 4KVGB 2NZ8B 3BJIA 1XKEA 4IOYX 1K5GB 1WVHA 3HIEA 2DLWA 1UNPA 1Z87A 2L1CA 2R2YA 4K17A 1B55A 5I2MA 1NI2A 3NWDA 3AU5A 4DX8A 1RJ2A 4GMVA 3WYFB 1UNRA 2Q13A 3PSCA 3ULCA 2MKRA 5GOWB 2LULA 4Y94A 5DIFB 5C6RA 3MDBC 3ZVRA 4D6WA 4IFSA 1DYNA 2K49A 3ODOA 5CLLB 2RNRB 2EJ8A 4CSQA 4KHBA 2D9XA 3SV1A 1X05A 3GYOA 2KIGA 3D8DA 3QIJA 1NU2A 4QXAB 4Z2NA 2D2QA 2Y8GA 1NTYA 2IFSA 2COAA 3RCPA 2YT2A 1WJ1A 4HB2B 5C5BB 2DX1A 2D9VA 4GMXB 4PQ0A 4EKUA 1MIXA 2QKMA 2ADZA 2P0HA 2W2WA 1ZC4B 2DYQA 3HQCA 4GN1A 3VOQA 5LONB 2DKQA 1EF1A 5HE0A 2ROVA 2CY5A 3NWFA 4YONA 2RUKB 5CLQB 2GJYA 3NWAA 1OMWA 2LG1A 3CIKA 2H7EA 2K2JA 2E2XA 1UPQA 2EMTA 1WJMA 3ODXA 1XODA 1P3RA 2GS0A 2DA0A 2K8EA 4EJNA 3N7CA 4HAXB 4ZRJA 3TFMA 1U5GA 4WJ7A 5I2SA 1N3HA 1OY2A 1ZC3B 3D8FA 1EGXA 2ZPYA 4A5KA 3BINA 1UEFA 2YT1A 3PEGA 1U29A 4QJ5B 1OQNA 1W1DA 2Y7BA 4L6EA 3LJUX 5HE2A 2K2UA 2ZKMX 4GPTB 1U5FA 3FVCA 3PVLA 1BWNA 4MK0A 2YT0A 1KZGA 2DKPA 2RRFA 2GCJA 1FOEA 1FHWA 1X1FA 4HB4B 3TVVA 4DIXA 4PNKA 2LYDA 2Z0QA 2NBVA 4HAUB 2YS1A 4TYZA 4KAXB 1X86A 2YS5A 2ELBA 5LOPB 2D4QA 2P0FA 4HB3B 2KUQA 5KQ4A 1X11A 3NW8A 2L2IA 1V89A 1KZ7A 2M14A 2P8VA 2HTHB 2X18A 4L1RA 3ZDTA 4HAYB 5FI1A 4GOUA 1FB8A 2AL6A 5D3WA 5KQ1A 1UNQA 5IRSA 2I5CA 3A8PA 3SYXA 1EAZA 5DHAB 3KY9A 1XD4A 1P5TA 2DX5A 3TW1A 2MDXA 2R0DA 1LB1A 1XX0A 2COCA 2DHJA 4GNKB 3DXEA 3MPXA 2P0DA 1LW3A 2EC1A 2MFQA 1MK7B 3ULBA 2G35A 3ML4A 4IAPA 2RVBB 1FGZA 2KR0A 1PLSA 1DDVA 1ZM0A 3AJ4A 4A6FB 4H8SA 1SHCA 5D3YA 1ISNA 1E5WA 3FSSA 4ZRIA 1MAIA 3PVUA 1NTVA 2LKOA 5D3VA 1BTNA 2YS3A 2BCJA 3VIAA 3WA0A 5M4YB 2Z59A 2K00A 5HE3A 4DBBA 1GC6A 2VKIA 1I2HA 3GYPA 3CXBB 1BAKA 3DXDA 1Y19B 1MI1A 2DYNA 2DHIA 4OSNA 5C16A 2N23A 3AU4A 1KI1B 3UZTA 5C5BA 2DTCA 2W2XD 1J19A 3HW2B 5JLJB 3U12A 3A8QA 1PFJA 5D3XA 3F0WA 2XQNM 3FM8C 4P7IA 1GC7A 2FJLA 2D11A 5C79A 1U5DA 4A6KA 1DROA 1QQGA 3OANA 4QJ3B 4F7HA 3HK0A 1V5PA 4WVFB 2J0MA 3PVWA 1MPHA 1Q67A 2UZRA 2NMBA 2UZSA 1DDMA 4HSIA 5D27A 2CAYA 4HB0B 1TQZA 2H7DA 4BBKA 1WI1A 4WSFA 1XR0B 3U7DA 1W1GA 2V76A 4Z2MB 4ZRKA 5FI0A 2GUMA 4K81A 1Y5OA 2DN6A 4K2PA 2UVMA 3G9WA 1I7AA 2ROZB 2I1KA 3D8EA 1DBHA 4CHJA 2Z0PA 2CY4A 2KUPA 2OTXA 1WGUA 3PZDA 1FAOA 4MY6A 2LOXA 1J0WA 2Z4DA 3A58A 4TKNA 3PG7A 5J3YA 1FHOA 3F5RA 4NY0A 3KZ1A 4KHBB 2Z13A 3QBVB 3B77A 1DDWA 3M1IB 2ELAA 3A98B 1MKEA 4F7UP 2VSZA 2MWNB 3V5WA 1T77A 2J0JA 4D0NB 2IYBA 3IVFA 5L81A 1WGQA 4CYEA 3QWMA 1H4RA 4HDQA 2Y8FA 2J59M 1ZVRA 1W1HA 3ODWA 2Z0OA 5JHHA 4NSWA 4KHOA 2CODA 1M7EA 1WG7A 3SO6A 5LG4B 2KCJA 2LOZA 4A6HA 2KIEA 2DFKA 2YSZA 3O96A 2FJUB 1AQCA 2R09A 4XWXA 2QKLA 3SNHA 3TO1A 3TCAA 1TXDA 2W2XC 3OHMB 2RGNB 4GXBA
chains in the Genus database with same CATH topology
1AWEA 4EMOA 3SUZA 1GG3A 3X23A 1EVHA 1V5MA 2COFA 4GZUA 4YL8A 4KHAA 2D10A 3P6AA 2YVCA 3PP2A 2I5FA 1FHXA 2PZ1A 4A6FA 2RSGA 2EMSA 3T06A 1FGYA 2I1JA 4HAVB 2D9WA 3FEHA 4DXAB 1X1GA 3KRXA 2OQBA 2KGXB 4HATB 2CRFA 2J0KA 4F7GA 1BTKA 1P6SA 1H10A 2M38A 2N0YA 3U8ZA 4CHMA 5J3TA 2VRWB 4B6HA 3NSUA 1V61A 5J3QA 1MIZB 5KCVA 2HE7A 2YF0A 1TJ6A 2D9YA 2D9ZA 1UPRA 2DHKA 1RRPB 5JHGA 2YRYA 1U5EA 4HDOA 4DX90 4HAZB 1U27A 1M7RA 1MK9B 4C0AA 5EFXA 1IRSA 1PMSA 2RLOA 1XCGA 1U2BA 3KSYA 3P7ZA 2JP2A 2AEHA 4MT7A 5JP4A 2GCLA 5DH9B 3KRWA 5DHFB 1ZSQA 3DXCA 1QC6A 1V5UA 1SGHA 1V88A 4HHVA 5DI9B 4HAWB 1K5DB 5HE1A 4K2OA 4KVGB 2NZ8B 3BJIA 1XKEA 4IOYX 1K5GB 1WVHA 2DLWA 1UNPA 1Z87A 2L1CA 4K17A 1B55A 1NI2A 3AU5A 4DX8A 1RJ2A 4GMVA 3WYFB 1UNRA 2Q13A 3PSCA 3ULCA 2MKRA 5GOWB 2LULA 4Y94A 5DIFB 5C6RA 3MDBC 3ZVRA 4IFSA 1DYNA 3ODOA 5CLLB 2RNRB 2EJ8A 2D9XA 3SV1A 1X05A 3GYOA 3D8DA 3QIJA 1NU2A 4Z2NA 2D2QA 2Y8GA 1NTYA 2IFSA 2COAA 3RCPA 1WJ1A 4HB2B 5C5BB 2DX1A 2D9VA 4GMXB 4PQ0A 4EKUA 1MIXA 2QKMA 2ADZA 2P0HA 2W2WA 1ZC4B 2DYQA 3HQCA 4GN1A 3VOQA 5LONB 2DKQA 1EF1A 5HE0A 2ROVA 2CY5A 4YONA 2RUKB 5CLQB 2GJYA 1OMWA 2LG1A 3CIKA 2H7EA 2K2JA 2E2XA 1UPQA 2EMTA 1WJMA 3ODXA 1XODA 1P3RA 2GS0A 2DA0A 4EJNA 3N7CA 4HAXB 4ZRJA 3TFMA 1U5GA 4WJ7A 1N3HA 1OY2A 1ZC3B 3D8FA 1EGXA 2ZPYA 4A5KA 3BINA 1UEFA 2YT1A 3PEGA 1U29A 1OQNA 1W1DA 2Y7BA 4L6EA 3LJUX 5HE2A 2K2UA 4GPTB 1U5FA 3PVLA 1BWNA 4MK0A 2YT0A 1KZGA 2DKPA 2GCJA 1FOEA 1FHWA 1X1FA 4HB4B 3TVVA 4PNKA 2LYDA 2Z0QA 4HAUB 2YS1A 4TYZA 4KAXB 1X86A 2YS5A 2ELBA 5LOPB 2D4QA 2P0FA 4HB3B 5KQ4A 1X11A 2L2IA 1V89A 1KZ7A 2M14A 2P8VA 2HTHB 2X18A 3ZDTA 4HAYB 5FI1A 1FB8A 2AL6A 5D3WA 5KQ1A 1UNQA 2I5CA 3A8PA 3SYXA 1EAZA 5DHAB 3KY9A 1XD4A 1P5TA 2DX5A 3TW1A 2MDXA 2R0DA 1LB1A 1XX0A 2COCA 2DHJA 3DXEA 3MPXA 2P0DA 1LW3A 2EC1A 2MFQA 1MK7B 3ULBA 2G35A 3ML4A 4IAPA 2RVBB 1FGZA 1PLSA 1DDVA 1ZM0A 3AJ4A 4A6FB 4H8SA 1SHCA 5D3YA 1ISNA 1E5WA 3FSSA 4ZRIA 1MAIA 3PVUA 1NTVA 2LKOA 5D3VA 1BTNA 2YS3A 2BCJA 3VIAA 3WA0A 2K00A 5HE3A 4DBBA 1GC6A 2VKIA 1I2HA 3GYPA 3CXBB 1BAKA 3DXDA 1Y19B 2DYNA 2DHIA 5C16A 2N23A 3AU4A 1KI1B 3UZTA 5C5BA 2DTCA 2W2XD 1J19A 3HW2B 5JLJB 3A8QA 1PFJA 5D3XA 3F0WA 2XQNM 3FM8C 4P7IA 1GC7A 2FJLA 2D11A 5C79A 1U5DA 4A6KA 1DROA 1QQGA 3OANA 4F7HA 3HK0A 1V5PA 4WVFB 2J0MA 3PVWA 1MPHA 1Q67A 2UZRA 2NMBA 2UZSA 1DDMA 5D27A 2CAYA 4HB0B 1TQZA 2H7DA 4BBKA 1WI1A 4WSFA 1XR0B 3U7DA 1W1GA 2V76A 4Z2MB 4ZRKA 5FI0A 4K81A 1Y5OA 2DN6A 4K2PA 2UVMA 3G9WA 1I7AA 2ROZB 2I1KA 3D8EA 1DBHA 4CHJA 2Z0PA 2CY4A 2KUPA 2OTXA 1WGUA 3PZDA 1FAOA 4MY6A 2LOXA 1J0WA 4TKNA 3PG7A 5J3YA 1FHOA 3F5RA 4NY0A 3KZ1A 4KHBB 3QBVB 1DDWA 3M1IB 2ELAA 3A98B 1MKEA 4F7UP 2VSZA 2MWNB 3V5WA 2J0JA 4D0NB 2IYBA 3IVFA 5L81A 1WGQA 4CYEA 3QWMA 1H4RA 4HDQA 2Y8FA 2J59M 1ZVRA 1W1HA 3ODWA 2Z0OA 5JHHA 4NSWA 4KHOA 2CODA 1M7EA 1WG7A 3SO6A 2KCJA 2LOZA 4A6HA 2DFKA 2YSZA 3O96A 1AQCA 2R09A 4XWXA 2QKLA 3SNHA 3TO1A 3TCAA 1TXDA 2W2XC 2RGNB 4GXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWE A;  4EMO A;  3SUZ A;  1GG3 A;  3X23 A;  1EVH A;  1V5M A;  2COF A;  4GZU A;  4YL8 A;  4KHA A;  2D10 A;  3P6A A;  2YVC A;  3PP2 A;  2I5F A;  1FHX A;  2PZ1 A;  4A6F A;  2RSG A;  2EMS A;  3T06 A;  1FGY A;  2I1J A;  4HAV B;  2D9W A;  3FEH A;  4DXA B;  1X1G A;  3KRX A;  2OQB A;  2KGX B;  4HAT B;  2CRF A;  2J0K A;  4F7G A;  1BTK A;  1P6S A;  1H10 A;  2M38 A;  2N0Y A;  3U8Z A;  4CHM A;  5J3T A;  2VRW B;  4B6H A;  3NSU A;  1V61 A;  5J3Q A;  1MIZ B;  5KCV A;  2HE7 A;  2YF0 A;  1TJ6 A;  2D9Y A;  2D9Z A;  1UPR A;  2DHK A;  1RRP B;  5JHG A;  2YRY A;  1U5E A;  4HDO A;  4DX9 0;  4HAZ B;  1U27 A;  1M7R A;  1MK9 B;  4C0A A;  5EFX A;  1IRS A;  1PMS A;  2RLO A;  1XCG A;  1U2B A;  3KSY A;  3P7Z A;  2JP2 A;  2AEH A;  4MT7 A;  5JP4 A;  2GCL A;  5DH9 B;  3KRW A;  5DHF B;  1ZSQ A;  3DXC A;  1QC6 A;  1V5U A;  1SGH A;  1V88 A;  4HHV A;  5DI9 B;  4HAW B;  1K5D B;  5HE1 A;  4K2O A;  4KVG B;  2NZ8 B;  3BJI A;  1XKE A;  4IOY X;  1K5G B;  1WVH A;  2DLW A;  1UNP A;  1Z87 A;  2L1C A;  4K17 A;  1B55 A;  1NI2 A;  3AU5 A;  4DX8 A;  1RJ2 A;  4GMV A;  3WYF B;  1UNR A;  2Q13 A;  3PSC A;  3ULC A;  2MKR A;  5GOW B;  2LUL A;  4Y94 A;  5DIF B;  5C6R A;  3MDB C;  3ZVR A;  4IFS A;  1DYN A;  3ODO A;  5CLL B;  2RNR B;  2EJ8 A;  2D9X A;  3SV1 A;  1X05 A;  3GYO A;  3D8D A;  3QIJ A;  1NU2 A;  4Z2N A;  2D2Q A;  2Y8G A;  1NTY A;  2IFS A;  2COA A;  3RCP A;  1WJ1 A;  4HB2 B;  5C5B B;  2DX1 A;  2D9V A;  4GMX B;  4PQ0 A;  4EKU A;  1MIX A;  2QKM A;  2ADZ A;  2P0H A;  2W2W A;  1ZC4 B;  2DYQ A;  3HQC A;  4GN1 A;  3VOQ A;  5LON B;  2DKQ A;  1EF1 A;  5HE0 A;  2ROV A;  2CY5 A;  4YON A;  2RUK B;  5CLQ B;  2GJY A;  1OMW A;  2LG1 A;  3CIK A;  2H7E A;  2K2J A;  2E2X A;  1UPQ A;  2EMT A;  1WJM A;  3ODX A;  1XOD A;  1P3R A;  2GS0 A;  2DA0 A;  4EJN A;  3N7C A;  4HAX B;  4ZRJ A;  3TFM A;  1U5G A;  4WJ7 A;  1N3H A;  1OY2 A;  1ZC3 B;  3D8F A;  1EGX A;  2ZPY A;  4A5K A;  3BIN A;  1UEF A;  2YT1 A;  3PEG A;  1U29 A;  1OQN A;  1W1D A;  2Y7B A;  4L6E A;  3LJU X;  5HE2 A;  2K2U A;  4GPT B;  1U5F A;  3PVL A;  1BWN A;  4MK0 A;  2YT0 A;  1KZG A;  2DKP A;  2GCJ A;  1FOE A;  1FHW A;  1X1F A;  4HB4 B;  3TVV A;  4PNK A;  2LYD A;  2Z0Q A;  4HAU B;  2YS1 A;  4TYZ A;  4KAX B;  1X86 A;  2YS5 A;  2ELB A;  5LOP B;  2D4Q A;  2P0F A;  4HB3 B;  5KQ4 A;  1X11 A;  2L2I A;  1V89 A;  1KZ7 A;  2M14 A;  2P8V A;  2HTH B;  2X18 A;  3ZDT A;  4HAY B;  5FI1 A;  1FB8 A;  2AL6 A;  5D3W A;  5KQ1 A;  1UNQ A;  2I5C A;  3A8P A;  3SYX A;  1EAZ A;  5DHA B;  3KY9 A;  1XD4 A;  1P5T A;  2DX5 A;  3TW1 A;  2MDX A;  2R0D A;  1LB1 A;  1XX0 A;  2COC A;  2DHJ A;  3DXE A;  3MPX A;  2P0D A;  1LW3 A;  2EC1 A;  2MFQ A;  1MK7 B;  3ULB A;  2G35 A;  3ML4 A;  4IAP A;  2RVB B;  1FGZ A;  1PLS A;  1DDV A;  1ZM0 A;  3AJ4 A;  4A6F B;  4H8S A;  1SHC A;  5D3Y A;  1ISN A;  1E5W A;  3FSS A;  4ZRI A;  1MAI A;  3PVU A;  1NTV A;  2LKO A;  5D3V A;  1BTN A;  2YS3 A;  2BCJ A;  3VIA A;  3WA0 A;  2K00 A;  5HE3 A;  4DBB A;  1GC6 A;  2VKI A;  1I2H A;  3GYP A;  3CXB B;  1BAK A;  3DXD A;  1Y19 B;  2DYN A;  2DHI A;  5C16 A;  2N23 A;  3AU4 A;  1KI1 B;  3UZT A;  5C5B A;  2DTC A;  2W2X D;  1J19 A;  3HW2 B;  5JLJ B;  3A8Q A;  1PFJ A;  5D3X A;  3F0W A;  2XQN M;  3FM8 C;  4P7I A;  1GC7 A;  2FJL A;  2D11 A;  5C79 A;  1U5D A;  4A6K A;  1DRO A;  1QQG A;  3OAN A;  4F7H A;  3HK0 A;  1V5P A;  4WVF B;  2J0M A;  3PVW A;  1MPH A;  1Q67 A;  2UZR A;  2NMB A;  2UZS A;  1DDM A;  5D27 A;  2CAY A;  4HB0 B;  1TQZ A;  2H7D A;  4BBK A;  1WI1 A;  4WSF A;  1XR0 B;  3U7D A;  1W1G A;  2V76 A;  4Z2M B;  4ZRK A;  5FI0 A;  4K81 A;  1Y5O A;  2DN6 A;  4K2P A;  2UVM A;  3G9W A;  1I7A A;  2ROZ B;  2I1K A;  3D8E A;  1DBH A;  4CHJ A;  2Z0P A;  2CY4 A;  2KUP A;  2OTX A;  1WGU A;  3PZD A;  1FAO A;  4MY6 A;  2LOX A;  1J0W A;  4TKN A;  3PG7 A;  5J3Y A;  1FHO A;  3F5R A;  4NY0 A;  3KZ1 A;  4KHB B;  3QBV B;  1DDW A;  3M1I B;  2ELA A;  3A98 B;  1MKE A;  4F7U P;  2VSZ A;  2MWN B;  3V5W A;  2J0J A;  4D0N B;  2IYB A;  3IVF A;  5L81 A;  1WGQ A;  4CYE A;  3QWM A;  1H4R A;  4HDQ A;  2Y8F A;  2J59 M;  1ZVR A;  1W1H A;  3ODW A;  2Z0O A;  5JHH A;  4NSW A;  4KHO A;  2COD A;  1M7E A;  1WG7 A;  3SO6 A;  2KCJ A;  2LOZ A;  4A6H A;  2DFK A;  2YSZ A;  3O96 A;  1AQC A;  2R09 A;  4XWX A;  2QKL A;  3SNH A;  3TO1 A;  3TCA A;  1TXD A;  2W2X C;  2RGN B;  4GXB A; 
#chains in the Genus database with same CATH topology
 4QJ4 B;  1AWE A;  4EMO A;  3SUZ A;  1GG3 A;  3X23 A;  1EVH A;  1V5M A;  2COF A;  4GZU A;  4YL8 A;  4KHA A;  2D10 A;  3P6A A;  2YVC A;  3PP2 A;  2I5F A;  1FHX A;  2PZ1 A;  4A6F A;  1ZYI A;  2RSG A;  2EMS A;  3T06 A;  1FGY A;  2I1J A;  4HAV B;  2D9W A;  2Z14 A;  3FEH A;  4DXA B;  1X1G A;  3KRX A;  2OQB A;  2KGX B;  4HAT B;  2CRF A;  2J0K A;  4F7G A;  1BTK A;  1P6S A;  1H10 A;  2M38 A;  2N0Y A;  3U8Z A;  4CHM A;  5J3T A;  2VRW B;  4B6H A;  4OT1 A;  3NSU A;  1V61 A;  5J3Q A;  1MIZ B;  5KCV A;  2HE7 A;  2YF0 A;  3DCX A;  1TJ6 A;  2D9Y A;  2D9Z A;  1UPR A;  2DHK A;  1RRP B;  5JHG A;  2YRY A;  1U5E A;  4HDO A;  3HSA A;  4DX9 0;  4HAZ B;  1U27 A;  1M7R A;  1MK9 B;  4C0A A;  5EFX A;  1IRS A;  1PMS A;  2RLO A;  1XCG A;  1U2B A;  3KSY A;  3P7Z A;  2JP2 A;  2AEH A;  4MT7 A;  5JP4 A;  2GCL A;  5DH9 B;  3KRW A;  5DHF B;  1ZSQ A;  3DXC A;  1QC6 A;  1V5U A;  1SGH A;  1V88 A;  4HHV A;  5DI9 B;  4HAW B;  1K5D B;  5HE1 A;  4K2O A;  4KVG B;  2NZ8 B;  3BJI A;  1XKE A;  4IOY X;  1K5G B;  1WVH A;  3HIE A;  2DLW A;  1UNP A;  1Z87 A;  2L1C A;  2R2Y A;  4K17 A;  1B55 A;  5I2M A;  1NI2 A;  3NWD A;  3AU5 A;  4DX8 A;  1RJ2 A;  4GMV A;  3WYF B;  1UNR A;  2Q13 A;  3PSC A;  3ULC A;  2MKR A;  5GOW B;  2LUL A;  4Y94 A;  5DIF B;  5C6R A;  3MDB C;  3ZVR A;  4D6W A;  4IFS A;  1DYN A;  2K49 A;  3ODO A;  5CLL B;  2RNR B;  2EJ8 A;  4CSQ A;  4KHB A;  2D9X A;  3SV1 A;  1X05 A;  3GYO A;  2KIG A;  3D8D A;  3QIJ A;  1NU2 A;  4QXA B;  4Z2N A;  2D2Q A;  2Y8G A;  1NTY A;  2IFS A;  2COA A;  3RCP A;  2YT2 A;  1WJ1 A;  4HB2 B;  5C5B B;  2DX1 A;  2D9V A;  4GMX B;  4PQ0 A;  4EKU A;  1MIX A;  2QKM A;  2ADZ A;  2P0H A;  2W2W A;  1ZC4 B;  2DYQ A;  3HQC A;  4GN1 A;  3VOQ A;  5LON B;  2DKQ A;  1EF1 A;  5HE0 A;  2ROV A;  2CY5 A;  3NWF A;  4YON A;  2RUK B;  5CLQ B;  2GJY A;  3NWA A;  1OMW A;  2LG1 A;  3CIK A;  2H7E A;  2K2J A;  2E2X A;  1UPQ A;  2EMT A;  1WJM A;  3ODX A;  1XOD A;  1P3R A;  2GS0 A;  2DA0 A;  2K8E A;  4EJN A;  3N7C A;  4HAX B;  4ZRJ A;  3TFM A;  1U5G A;  4WJ7 A;  5I2S A;  1N3H A;  1OY2 A;  1ZC3 B;  3D8F A;  1EGX A;  2ZPY A;  4A5K A;  3BIN A;  1UEF A;  2YT1 A;  3PEG A;  1U29 A;  4QJ5 B;  1OQN A;  1W1D A;  2Y7B A;  4L6E A;  3LJU X;  5HE2 A;  2K2U A;  2ZKM X;  4GPT B;  1U5F A;  3FVC A;  3PVL A;  1BWN A;  4MK0 A;  2YT0 A;  1KZG A;  2DKP A;  2RRF A;  2GCJ A;  1FOE A;  1FHW A;  1X1F A;  4HB4 B;  3TVV A;  4DIX A;  4PNK A;  2LYD A;  2Z0Q A;  2NBV A;  4HAU B;  2YS1 A;  4TYZ A;  4KAX B;  1X86 A;  2YS5 A;  2ELB A;  5LOP B;  2D4Q A;  2P0F A;  4HB3 B;  2KUQ A;  5KQ4 A;  1X11 A;  3NW8 A;  2L2I A;  1V89 A;  1KZ7 A;  2M14 A;  2P8V A;  2HTH B;  2X18 A;  4L1R A;  3ZDT A;  4HAY B;  5FI1 A;  4GOU A;  1FB8 A;  2AL6 A;  5D3W A;  5KQ1 A;  1UNQ A;  5IRS A;  2I5C A;  3A8P A;  3SYX A;  1EAZ A;  5DHA B;  3KY9 A;  1XD4 A;  1P5T A;  2DX5 A;  3TW1 A;  2MDX A;  2R0D A;  1LB1 A;  1XX0 A;  2COC A;  2DHJ A;  4GNK B;  3DXE A;  3MPX A;  2P0D A;  1LW3 A;  2EC1 A;  2MFQ A;  1MK7 B;  3ULB A;  2G35 A;  3ML4 A;  4IAP A;  2RVB B;  1FGZ A;  2KR0 A;  1PLS A;  1DDV A;  1ZM0 A;  3AJ4 A;  4A6F B;  4H8S A;  1SHC A;  5D3Y A;  1ISN A;  1E5W A;  3FSS A;  4ZRI A;  1MAI A;  3PVU A;  1NTV A;  2LKO A;  5D3V A;  1BTN A;  2YS3 A;  2BCJ A;  3VIA A;  3WA0 A;  5M4Y B;  2Z59 A;  2K00 A;  5HE3 A;  4DBB A;  1GC6 A;  2VKI A;  1I2H A;  3GYP A;  3CXB B;  1BAK A;  3DXD A;  1Y19 B;  1MI1 A;  2DYN A;  2DHI A;  4OSN A;  5C16 A;  2N23 A;  3AU4 A;  1KI1 B;  3UZT A;  5C5B A;  2DTC A;  2W2X D;  1J19 A;  3HW2 B;  5JLJ B;  3U12 A;  3A8Q A;  1PFJ A;  5D3X A;  3F0W A;  2XQN M;  3FM8 C;  4P7I A;  1GC7 A;  2FJL A;  2D11 A;  5C79 A;  1U5D A;  4A6K A;  1DRO A;  1QQG A;  3OAN A;  4QJ3 B;  4F7H A;  3HK0 A;  1V5P A;  4WVF B;  2J0M A;  3PVW A;  1MPH A;  1Q67 A;  2UZR A;  2NMB A;  2UZS A;  1DDM A;  4HSI A;  5D27 A;  2CAY A;  4HB0 B;  1TQZ A;  2H7D A;  4BBK A;  1WI1 A;  4WSF A;  1XR0 B;  3U7D A;  1W1G A;  2V76 A;  4Z2M B;  4ZRK A;  5FI0 A;  2GUM A;  4K81 A;  1Y5O A;  2DN6 A;  4K2P A;  2UVM A;  3G9W A;  1I7A A;  2ROZ B;  2I1K A;  3D8E A;  1DBH A;  4CHJ A;  2Z0P A;  2CY4 A;  2KUP A;  2OTX A;  1WGU A;  3PZD A;  1FAO A;  4MY6 A;  2LOX A;  1J0W A;  2Z4D A;  3A58 A;  4TKN A;  3PG7 A;  5J3Y A;  1FHO A;  3F5R A;  4NY0 A;  3KZ1 A;  4KHB B;  2Z13 A;  3QBV B;  3B77 A;  1DDW A;  3M1I B;  2ELA A;  3A98 B;  1MKE A;  4F7U P;  2VSZ A;  2MWN B;  3V5W A;  1T77 A;  2J0J A;  4D0N B;  2IYB A;  3IVF A;  5L81 A;  1WGQ A;  4CYE A;  3QWM A;  1H4R A;  4HDQ A;  2Y8F A;  2J59 M;  1ZVR A;  1W1H A;  3ODW A;  2Z0O A;  5JHH A;  4NSW A;  4KHO A;  2COD A;  1M7E A;  1WG7 A;  3SO6 A;  5LG4 B;  2KCJ A;  2LOZ A;  4A6H A;  2KIE A;  2DFK A;  2YSZ A;  3O96 A;  2FJU B;  1AQC A;  2R09 A;  4XWX A;  2QKL A;  3SNH A;  3TO1 A;  3TCA A;  1TXD A;  2W2X C;  3OHM B;  2RGN B;  4GXB A; 
#chains in the Genus database with same CATH homology
 1AWE A;  4EMO A;  3SUZ A;  1GG3 A;  3X23 A;  1EVH A;  1V5M A;  2COF A;  4GZU A;  4YL8 A;  4KHA A;  2D10 A;  3P6A A;  2YVC A;  3PP2 A;  2I5F A;  1FHX A;  2PZ1 A;  4A6F A;  2RSG A;  2EMS A;  3T06 A;  1FGY A;  2I1J A;  4HAV B;  2D9W A;  3FEH A;  4DXA B;  1X1G A;  3KRX A;  2OQB A;  2KGX B;  4HAT B;  2CRF A;  2J0K A;  4F7G A;  1BTK A;  1P6S A;  1H10 A;  2M38 A;  2N0Y A;  3U8Z A;  4CHM A;  5J3T A;  2VRW B;  4B6H A;  3NSU A;  1V61 A;  5J3Q A;  1MIZ B;  5KCV A;  2HE7 A;  2YF0 A;  1TJ6 A;  2D9Y A;  2D9Z A;  1UPR A;  2DHK A;  1RRP B;  5JHG A;  2YRY A;  1U5E A;  4HDO A;  4DX9 0;  4HAZ B;  1U27 A;  1M7R A;  1MK9 B;  4C0A A;  5EFX A;  1IRS A;  1PMS A;  2RLO A;  1XCG A;  1U2B A;  3KSY A;  3P7Z A;  2JP2 A;  2AEH A;  4MT7 A;  5JP4 A;  2GCL A;  5DH9 B;  3KRW A;  5DHF B;  1ZSQ A;  3DXC A;  1QC6 A;  1V5U A;  1SGH A;  1V88 A;  4HHV A;  5DI9 B;  4HAW B;  1K5D B;  5HE1 A;  4K2O A;  4KVG B;  2NZ8 B;  3BJI A;  1XKE A;  4IOY X;  1K5G B;  1WVH A;  2DLW A;  1UNP A;  1Z87 A;  2L1C A;  4K17 A;  1B55 A;  1NI2 A;  3AU5 A;  4DX8 A;  1RJ2 A;  4GMV A;  3WYF B;  1UNR A;  2Q13 A;  3PSC A;  3ULC A;  2MKR A;  5GOW B;  2LUL A;  4Y94 A;  5DIF B;  5C6R A;  3MDB C;  3ZVR A;  4IFS A;  1DYN A;  3ODO A;  5CLL B;  2RNR B;  2EJ8 A;  2D9X A;  3SV1 A;  1X05 A;  3GYO A;  3D8D A;  3QIJ A;  1NU2 A;  4Z2N A;  2D2Q A;  2Y8G A;  1NTY A;  2IFS A;  2COA A;  3RCP A;  1WJ1 A;  4HB2 B;  5C5B B;  2DX1 A;  2D9V A;  4GMX B;  4PQ0 A;  4EKU A;  1MIX A;  2QKM A;  2ADZ A;  2P0H A;  2W2W A;  1ZC4 B;  2DYQ A;  3HQC A;  4GN1 A;  3VOQ A;  5LON B;  2DKQ A;  1EF1 A;  5HE0 A;  2ROV A;  2CY5 A;  4YON A;  2RUK B;  5CLQ B;  2GJY A;  1OMW A;  2LG1 A;  3CIK A;  2H7E A;  2K2J A;  2E2X A;  1UPQ A;  2EMT A;  1WJM A;  3ODX A;  1XOD A;  1P3R A;  2GS0 A;  2DA0 A;  4EJN A;  3N7C A;  4HAX B;  4ZRJ A;  3TFM A;  1U5G A;  4WJ7 A;  1N3H A;  1OY2 A;  1ZC3 B;  3D8F A;  1EGX A;  2ZPY A;  4A5K A;  3BIN A;  1UEF A;  2YT1 A;  3PEG A;  1U29 A;  1OQN A;  1W1D A;  2Y7B A;  4L6E A;  3LJU X;  5HE2 A;  2K2U A;  4GPT B;  1U5F A;  3PVL A;  1BWN A;  4MK0 A;  2YT0 A;  1KZG A;  2DKP A;  2GCJ A;  1FOE A;  1FHW A;  1X1F A;  4HB4 B;  3TVV A;  4PNK A;  2LYD A;  2Z0Q A;  4HAU B;  2YS1 A;  4TYZ A;  4KAX B;  1X86 A;  2YS5 A;  2ELB A;  5LOP B;  2D4Q A;  2P0F A;  4HB3 B;  5KQ4 A;  1X11 A;  2L2I A;  1V89 A;  1KZ7 A;  2M14 A;  2P8V A;  2HTH B;  2X18 A;  3ZDT A;  4HAY B;  5FI1 A;  1FB8 A;  2AL6 A;  5D3W A;  5KQ1 A;  1UNQ A;  2I5C A;  3A8P A;  3SYX A;  1EAZ A;  5DHA B;  3KY9 A;  1XD4 A;  1P5T A;  2DX5 A;  3TW1 A;  2MDX A;  2R0D A;  1LB1 A;  1XX0 A;  2COC A;  2DHJ A;  3DXE A;  3MPX A;  2P0D A;  1LW3 A;  2EC1 A;  2MFQ A;  1MK7 B;  3ULB A;  2G35 A;  3ML4 A;  4IAP A;  2RVB B;  1FGZ A;  1PLS A;  1DDV A;  1ZM0 A;  3AJ4 A;  4A6F B;  4H8S A;  1SHC A;  5D3Y A;  1ISN A;  1E5W A;  3FSS A;  4ZRI A;  1MAI A;  3PVU A;  1NTV A;  2LKO A;  5D3V A;  1BTN A;  2YS3 A;  2BCJ A;  3VIA A;  3WA0 A;  2K00 A;  5HE3 A;  4DBB A;  1GC6 A;  2VKI A;  1I2H A;  3GYP A;  3CXB B;  1BAK A;  3DXD A;  1Y19 B;  2DYN A;  2DHI A;  5C16 A;  2N23 A;  3AU4 A;  1KI1 B;  3UZT A;  5C5B A;  2DTC A;  2W2X D;  1J19 A;  3HW2 B;  5JLJ B;  3A8Q A;  1PFJ A;  5D3X A;  3F0W A;  2XQN M;  3FM8 C;  4P7I A;  1GC7 A;  2FJL A;  2D11 A;  5C79 A;  1U5D A;  4A6K A;  1DRO A;  1QQG A;  3OAN A;  4F7H A;  3HK0 A;  1V5P A;  4WVF B;  2J0M A;  3PVW A;  1MPH A;  1Q67 A;  2UZR A;  2NMB A;  2UZS A;  1DDM A;  5D27 A;  2CAY A;  4HB0 B;  1TQZ A;  2H7D A;  4BBK A;  1WI1 A;  4WSF A;  1XR0 B;  3U7D A;  1W1G A;  2V76 A;  4Z2M B;  4ZRK A;  5FI0 A;  4K81 A;  1Y5O A;  2DN6 A;  4K2P A;  2UVM A;  3G9W A;  1I7A A;  2ROZ B;  2I1K A;  3D8E A;  1DBH A;  4CHJ A;  2Z0P A;  2CY4 A;  2KUP A;  2OTX A;  1WGU A;  3PZD A;  1FAO A;  4MY6 A;  2LOX A;  1J0W A;  4TKN A;  3PG7 A;  5J3Y A;  1FHO A;  3F5R A;  4NY0 A;  3KZ1 A;  4KHB B;  3QBV B;  1DDW A;  3M1I B;  2ELA A;  3A98 B;  1MKE A;  4F7U P;  2VSZ A;  2MWN B;  3V5W A;  2J0J A;  4D0N B;  2IYB A;  3IVF A;  5L81 A;  1WGQ A;  4CYE A;  3QWM A;  1H4R A;  4HDQ A;  2Y8F A;  2J59 M;  1ZVR A;  1W1H A;  3ODW A;  2Z0O A;  5JHH A;  4NSW A;  4KHO A;  2COD A;  1M7E A;  1WG7 A;  3SO6 A;  2KCJ A;  2LOZ A;  4A6H A;  2DFK A;  2YSZ A;  3O96 A;  1AQC A;  2R09 A;  4XWX A;  2QKL A;  3SNH A;  3TO1 A;  3TCA A;  1TXD A;  2W2X C;  2RGN B;  4GXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...