1PFJA

Solution structure of the n-terminal ph/ptb domain of the tfiih p62 subunit
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TFIIH basal transcription factor complex p62 subunit
publication title TFIIH contains a PH domain involved in DNA nucleotide excision repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1pfjA00
3G9WA 1ZVRA 3D8FA 1BTNA 2RGNB 1DROA 1BAKA 2DKPA 2DX1A 1IRSA 1OQNA 2P0DA 4HDOA 1ZC3B 2MDXA 4KHOA 4K81A 1RJ2A 3WA0A 4GPTB 5GOWB 1ZC4B 1V61A 5JLJB 1DBHA 2D4QA 1E5WA 2J0KA 2GCLA 1Y19B 1WJ1A 2Y8FA 2Y8GA 4ZRJA 2NMBA 1WI1A 5EFXA 2EMSA 4HB2B 2DHKA 5HE0A 3D8EA 1GC7A 1UNPA 2COCA 2Z0QA 2Z0OA 4PNKA 3ULBA 1EAZA 3N7CA 1H4RA 3BJIA 1U27A 2ELAA 3PEGA 4GN1A 2D2QA 3AU4A 1XD4A 4YL8A 2LULA 3PSCA 2IFSA 4A6FB 5C16A 5J3TA 1UPRA 1FGZA 4K2OA 3SNHA 4IFSA 3F5RA 1UPQA 2YRYA 4F7UP 1DYNA 1OMWA 1MKEA 2MFQA 4Z2NA 2YS5A 3MPXA 2MWNB 1P6SA 5DHFB 3CXBB 3SO6A 1V5MA 2VRWB 2DYNA 5FI1A 2HTHB 5DIFB 2W2XD 2YVCA 4GMXB 2DKQA 1EGXA 1MAIA 2ADZA 2D9YA 5DI9B 3DXEA 2W2XC 4F7GA 3BINA 2Z0PA 3ODXA 1P5TA 1SGHA 3KSYA 2D9XA 2AEHA 1TXDA 1V88A 2J0JA 2NZ8B 2G35A 4XWXA 1AWEA 5LOPB 4Z2MB 2RNRB 2DX5A 1XCGA 1WGQA 3ULCA 3O96A 5CLQB 1XODA 3TW1A 2VKIA 2DHJA 3KRXA 2GCJA 4HAXB 3D8DA 4DX90 2J0MA 2CY5A 4P7IA 3PZDA 1NU2A 4IAPA 4K2PA 1TJ6A 5KCVA 3PP2A 3A8QA 2EC1A 4HDQA 4C0AA 2LG1A 1K5GB 3PVLA 1GC6A 1FGYA 1SHCA 2YF0A 2COAA 3OANA 1PLSA 2ZPYA 1MIXA 3IVFA 1W1HA 2UVMA 1W1DA 4HAWB 3VIAA 1ISNA 4PQ0A 4KVGB 5HE3A 2E2XA 1U29A 1U5FA 4Y94A 5LONB 2I1KA 1LB1A 2R09A 4HATB 3HQCA 1XR0B 3KRWA 3ZVRA 4TKNA 1Y5OA 4KAXB 3U8ZA 4EMOA 2VSZA 2EMTA 2L1CA 2R0DA 5D3VA 5HE2A 2D9ZA 4KHBB 5C79A 3HK0A 2DYQA 4GZUA 4YONA 4A6FA 5JHHA 4K17A 3ODWA 1PMSA 1FOEA 1RRPB 2YT1A 1X86A 2AL6A 2M14A 1I2HA 1V5PA 1EVHA 2K2UA 2RUKB 5DH9B 1EF1A 3CIKA 2I5FA 1FHXA 4MK0A 1XKEA 2D9VA 1QQGA 2YSZA 1FB8A 3FM8C 3TCAA 2M38A 3A8PA 1UEFA 1X11A 2DFKA 2CAYA 2DLWA 2FJLA 1NTYA 5JP4A 2IYBA 1GG3A 1K5DB 1U5GA 4GMVA 1MK9B 1W1GA 2KCJA 2PZ1A 1NTVA 3NSUA 1MK7B 5C5BB 2N23A 3PVUA 1V5UA 4KHAA 5CLLB 1N3HA 5HE1A 4HB0B 1U5DA 1BTKA 2QKMA 2H7EA 2V76A 5D3XA 3SUZA 4DXAB 1KI1B 2LOXA 1MIZB 3DXDA 1J0WA 3M1IB 4HB3B 1NI2A 2OQBA 3T06A 4CHJA 3TO1A 2GJYA 2P0FA 1UNRA 1FAOA 4HAVB 3PG7A 5D27A 3ZDTA 5C6RA 5J3QA 4ZRKA 3LJUX 2MKRA 2CY4A 1M7EA 3TVVA 1XX0A 4WSFA 2DTCA 4A6HA 4WVFB 2I1JA 3UZTA 4MY6A 5D3WA 2KGXB 1KZGA 3X23A 2LKOA 3A98B 4IOYX 3P6AA 1FHOA 2RVBB 1WGUA 4A6KA 5KQ1A 2X18A 2ELBA 2JP2A 5JHGA 2CRFA 3SYXA 2LYDA 2P8VA 1OY2A 3PVWA 4CYEA 3RCPA 1MPHA 4NY0A 2DN6A 2EJ8A 1KZ7A 1AQCA 3FEHA 1Z87A 2I5CA 2RSGA 2J59M 4TYZA 3WYFB 3SV1A 1V89A 3F0WA 4EKUA 2QKLA 2XQNM 4CHMA 2DA0A 3QWMA 5DHAB 2COFA 3GYOA 2D11A 2ROZB 2K00A 4WJ7A 4HB4B 1I7AA 2UZSA 3P7ZA 4HAYB 5L81A 1BWNA 1TQZA 3MDBC 3GYPA 2OTXA 4MT7A 2CODA 2H7DA 1J19A 2RLOA 1WJMA 4HAZB 4NSWA 1WG7A 5J3YA 2GS0A 1U2BA 1DDWA 1Q67A 1X1GA 2HE7A 3U7DA 2YS1A 1X05A 1PFJA 4H8SA 1P3RA 1WVHA 3ODOA 3QIJA 4DBBA 2ROVA 2Q13A 2KUPA 5C5BA 2Y7BA 1DDVA 2P0HA 2YT0A 1DDMA 2YS3A 3FSSA 3KY9A 4ZRIA 4HAUB 2D10A 1FHWA 2BCJA 3V5WA 3QBVB 1ZM0A 3AJ4A 5D3YA 4EJNA 1M7RA 2N0YA 3DXCA 1ZSQA 4B6HA 2L2IA 4GXBA 2UZRA 3VOQA 4A5KA 3KZ1A 2D9WA 4F7HA 1U5EA 3AU5A 2LOZA 1B55A 1H10A 1X1FA 3ML4A 5FI0A 2DHIA 4D0NB 1QC6A 4L6EA 4BBKA 4HHVA 4DX8A 2K2JA 1UNQA 1LW3A 5KQ4A 3TFMA 3HW2B 2W2WA
chains in the Genus database with same CATH superfamily
2NBVA 3G9WA 1ZVRA 3D8FA 1BTNA 2RGNB 1DROA 1BAKA 2DKPA 2DX1A 1ZYIA 1IRSA 1OQNA 2P0DA 4HDOA 1ZC3B 2MDXA 4KHOA 4K81A 1RJ2A 3WA0A 4GPTB 5GOWB 1ZC4B 1V61A 5JLJB 1DBHA 2D4QA 1E5WA 1T77A 2J0KA 2GCLA 1Y19B 1WJ1A 2Y8FA 2Y8GA 4ZRJA 2NMBA 2ZKMX 1WI1A 5EFXA 2EMSA 4HB2B 2DHKA 5HE0A 3D8EA 1GC7A 1UNPA 2COCA 2Z0QA 2Z0OA 3NW8A 4DIXA 4PNKA 3ULBA 4D6WA 1EAZA 3N7CA 1H4RA 3BJIA 1U27A 2ELAA 3PEGA 4GN1A 2D2QA 3AU4A 1XD4A 4YL8A 2LULA 3PSCA 2IFSA 4A6FB 5C16A 5J3TA 1UPRA 1FGZA 4K2OA 3SNHA 4IFSA 3F5RA 1UPQA 4QJ3B 2YRYA 4F7UP 1DYNA 1OMWA 1MKEA 2MFQA 2Z4DA 4Z2NA 2YS5A 3MPXA 2MWNB 3DCXA 1P6SA 5DHFB 3CXBB 3SO6A 1V5MA 2VRWB 3FVCA 2DYNA 3B77A 2HTHB 5FI1A 3NWAA 5DIFB 2W2XD 2YVCA 4GMXB 2DKQA 1EGXA 1MAIA 2ADZA 2D9YA 5DI9B 3DXEA 2W2XC 4F7GA 3BINA 2Z0PA 3ODXA 1P5TA 1SGHA 3KSYA 2D9XA 2AEHA 1TXDA 1V88A 2J0JA 2NZ8B 2G35A 4XWXA 1AWEA 5LOPB 4Z2MB 2YT2A 2RNRB 2DX5A 1XCGA 1WGQA 3ULCA 3O96A 5CLQB 1XODA 3TW1A 2VKIA 2DHJA 3KRXA 2GCJA 4HAXB 3D8DA 4DX90 2J0MA 2CY5A 4P7IA 3PZDA 1NU2A 4IAPA 4K2PA 1TJ6A 2GUMA 5KCVA 3PP2A 3A8QA 2EC1A 4HDQA 4C0AA 2LG1A 4QJ4B 1K5GB 3PVLA 5IRSA 1GC6A 1FGYA 1SHCA 2YF0A 2COAA 3OANA 1PLSA 2ZPYA 1MIXA 3IVFA 1W1HA 2UVMA 1W1DA 4HAWB 3VIAA 1ISNA 4PQ0A 4KVGB 5HE3A 2E2XA 1U29A 1U5FA 4Y94A 4GOUA 5LONB 2I1KA 1LB1A 2R09A 4HATB 3HQCA 1XR0B 3KRWA 3ZVRA 4TKNA 1Y5OA 4KAXB 3U8ZA 4EMOA 2VSZA 2EMTA 2L1CA 4OT1A 2R0DA 5D3VA 5HE2A 2D9ZA 4KHBB 5C79A 3HK0A 2DYQA 4GZUA 4YONA 4A6FA 2KIEA 5JHHA 4K17A 3ODWA 1PMSA 1FOEA 1RRPB 2YT1A 1X86A 2AL6A 2M14A 1I2HA 1V5PA 2Z14A 2K8EA 1EVHA 5I2SA 2K2UA 2RUKB 5DH9B 1EF1A 3CIKA 2I5FA 1FHXA 4MK0A 1XKEA 2D9VA 1QQGA 3OHMB 2YSZA 1FB8A 4CSQA 3FM8C 3TCAA 2M38A 3A8PA 1UEFA 1X11A 2DFKA 2CAYA 2DLWA 2FJLA 1NTYA 5JP4A 2IYBA 1GG3A 1K5DB 1U5GA 4GMVA 1MK9B 4HSIA 1W1GA 2KCJA 2PZ1A 1NTVA 2RRFA 3NSUA 1MK7B 5C5BB 2N23A 3PVUA 1V5UA 4KHAA 5CLLB 1N3HA 5HE1A 4HB0B 1U5DA 1BTKA 2QKMA 3U12A 3A58A 2H7EA 4L1RA 2V76A 5D3XA 3SUZA 4DXAB 1KI1B 2LOXA 1MIZB 3DXDA 1J0WA 3M1IB 4HB3B 1NI2A 2OQBA 3T06A 4CHJA 3TO1A 2GJYA 5I2MA 2P0FA 1UNRA 1FAOA 4HAVB 3PG7A 5D27A 3ZDTA 5C6RA 5J3QA 4ZRKA 3LJUX 2MKRA 2CY4A 1M7EA 3TVVA 1MI1A 4QJ5B 1XX0A 4WSFA 2DTCA 4A6HA 4WVFB 2I1JA 4GNKB 4MY6A 5D3WA 3UZTA 2KGXB 1KZGA 3X23A 2R2YA 2LKOA 3A98B 3NWDA 4IOYX 3P6AA 1FHOA 2RVBB 1WGUA 3NWFA 4A6KA 5KQ1A 2X18A 2ELBA 2JP2A 5JHGA 2CRFA 3SYXA 2LYDA 2P8VA 1OY2A 3PVWA 4CYEA 4KHBA 1MPHA 3RCPA 4NY0A 5LG4B 2Z59A 3HSAA 2DN6A 2EJ8A 1KZ7A 1AQCA 3FEHA 1Z87A 2I5CA 2RSGA 2J59M 4TYZA 3WYFB 3SV1A 1V89A 3F0WA 4EKUA 2QKLA 2KUQA 2XQNM 4CHMA 2DA0A 3QWMA 5DHAB 2COFA 3GYOA 2D11A 2ROZB 2K00A 4WJ7A 4HB4B 1I7AA 2UZSA 3P7ZA 4HAYB 5L81A 1BWNA 1TQZA 3MDBC 3GYPA 2OTXA 4MT7A 2CODA 2H7DA 1J19A 2RLOA 1WJMA 4HAZB 4NSWA 1WG7A 5J3YA 2GS0A 1U2BA 1DDWA 1Q67A 1X1GA 5M4YB 2HE7A 3U7DA 2YS1A 1X05A 1PFJA 4H8SA 1P3RA 1WVHA 3ODOA 3QIJA 4DBBA 2ROVA 2Q13A 2KIGA 2KUPA 5C5BA 2Y7BA 4OSNA 1DDVA 2P0HA 2YT0A 1DDMA 2YS3A 3FSSA 3KY9A 2Z13A 4ZRIA 4HAUB 2D10A 1FHWA 2BCJA 3V5WA 3QBVB 1ZM0A 2KR0A 3AJ4A 5D3YA 4EJNA 1M7RA 2N0YA 3DXCA 1ZSQA 4B6HA 2L2IA 4GXBA 3HIEA 2UZRA 3VOQA 4A5KA 3KZ1A 2D9WA 2K49A 4F7HA 1U5EA 3AU5A 2LOZA 1B55A 1H10A 1X1FA 3ML4A 5FI0A 2DHIA 4D0NB 4QXAB 1QC6A 4L6EA 4BBKA 4HHVA 4DX8A 2K2JA 1UNQA 1LW3A 5KQ4A 3TFMA 3HW2B 2FJUB 2W2WA
chains in the Genus database with same CATH topology
3G9WA 1ZVRA 3D8FA 1BTNA 2RGNB 1DROA 1BAKA 2DKPA 2DX1A 1IRSA 1OQNA 2P0DA 4HDOA 1ZC3B 2MDXA 4KHOA 4K81A 1RJ2A 3WA0A 4GPTB 5GOWB 1ZC4B 1V61A 5JLJB 1DBHA 2D4QA 1E5WA 2J0KA 2GCLA 1Y19B 1WJ1A 2Y8FA 2Y8GA 4ZRJA 2NMBA 1WI1A 5EFXA 2EMSA 4HB2B 2DHKA 5HE0A 3D8EA 1GC7A 1UNPA 2COCA 2Z0QA 2Z0OA 4PNKA 3ULBA 1EAZA 3N7CA 1H4RA 3BJIA 1U27A 2ELAA 3PEGA 4GN1A 2D2QA 3AU4A 1XD4A 4YL8A 2LULA 3PSCA 2IFSA 4A6FB 5C16A 5J3TA 1UPRA 1FGZA 4K2OA 3SNHA 4IFSA 3F5RA 1UPQA 2YRYA 4F7UP 1DYNA 1OMWA 1MKEA 2MFQA 4Z2NA 2YS5A 3MPXA 2MWNB 1P6SA 5DHFB 3CXBB 3SO6A 1V5MA 2VRWB 2DYNA 5FI1A 2HTHB 5DIFB 2W2XD 2YVCA 4GMXB 2DKQA 1EGXA 1MAIA 2ADZA 2D9YA 5DI9B 3DXEA 2W2XC 4F7GA 3BINA 2Z0PA 3ODXA 1P5TA 1SGHA 3KSYA 2D9XA 2AEHA 1TXDA 1V88A 2J0JA 2NZ8B 2G35A 4XWXA 1AWEA 5LOPB 4Z2MB 2RNRB 2DX5A 1XCGA 1WGQA 3ULCA 3O96A 5CLQB 1XODA 3TW1A 2VKIA 2DHJA 3KRXA 2GCJA 4HAXB 3D8DA 4DX90 2J0MA 2CY5A 4P7IA 3PZDA 1NU2A 4IAPA 4K2PA 1TJ6A 5KCVA 3PP2A 3A8QA 2EC1A 4HDQA 4C0AA 2LG1A 1K5GB 3PVLA 1GC6A 1FGYA 1SHCA 2YF0A 2COAA 3OANA 1PLSA 2ZPYA 1MIXA 3IVFA 1W1HA 2UVMA 1W1DA 4HAWB 3VIAA 1ISNA 4PQ0A 4KVGB 5HE3A 2E2XA 1U29A 1U5FA 4Y94A 5LONB 2I1KA 1LB1A 2R09A 4HATB 3HQCA 1XR0B 3KRWA 3ZVRA 4TKNA 1Y5OA 4KAXB 3U8ZA 4EMOA 2VSZA 2EMTA 2L1CA 2R0DA 5D3VA 5HE2A 2D9ZA 4KHBB 5C79A 3HK0A 2DYQA 4GZUA 4YONA 4A6FA 5JHHA 4K17A 3ODWA 1PMSA 1FOEA 1RRPB 2YT1A 1X86A 2AL6A 2M14A 1I2HA 1V5PA 1EVHA 2K2UA 2RUKB 5DH9B 1EF1A 3CIKA 2I5FA 1FHXA 4MK0A 1XKEA 2D9VA 1QQGA 2YSZA 1FB8A 3FM8C 3TCAA 2M38A 3A8PA 1UEFA 1X11A 2DFKA 2CAYA 2DLWA 2FJLA 1NTYA 5JP4A 2IYBA 1GG3A 1K5DB 1U5GA 4GMVA 1MK9B 1W1GA 2KCJA 2PZ1A 1NTVA 3NSUA 1MK7B 5C5BB 2N23A 3PVUA 1V5UA 4KHAA 5CLLB 1N3HA 5HE1A 4HB0B 1U5DA 1BTKA 2QKMA 2H7EA 2V76A 5D3XA 3SUZA 4DXAB 1KI1B 2LOXA 1MIZB 3DXDA 1J0WA 3M1IB 4HB3B 1NI2A 2OQBA 3T06A 4CHJA 3TO1A 2GJYA 2P0FA 1UNRA 1FAOA 4HAVB 3PG7A 5D27A 3ZDTA 5C6RA 5J3QA 4ZRKA 3LJUX 2MKRA 2CY4A 1M7EA 3TVVA 1XX0A 4WSFA 2DTCA 4A6HA 4WVFB 2I1JA 3UZTA 4MY6A 5D3WA 2KGXB 1KZGA 3X23A 2LKOA 3A98B 4IOYX 3P6AA 1FHOA 2RVBB 1WGUA 4A6KA 5KQ1A 2X18A 2ELBA 2JP2A 5JHGA 2CRFA 3SYXA 2LYDA 2P8VA 1OY2A 3PVWA 4CYEA 3RCPA 1MPHA 4NY0A 2DN6A 2EJ8A 1KZ7A 1AQCA 3FEHA 1Z87A 2I5CA 2RSGA 2J59M 4TYZA 3WYFB 3SV1A 1V89A 3F0WA 4EKUA 2QKLA 2XQNM 4CHMA 2DA0A 3QWMA 5DHAB 2COFA 3GYOA 2D11A 2ROZB 2K00A 4WJ7A 4HB4B 1I7AA 2UZSA 3P7ZA 4HAYB 5L81A 1BWNA 1TQZA 3MDBC 3GYPA 2OTXA 4MT7A 2CODA 2H7DA 1J19A 2RLOA 1WJMA 4HAZB 4NSWA 1WG7A 5J3YA 2GS0A 1U2BA 1DDWA 1Q67A 1X1GA 2HE7A 3U7DA 2YS1A 1X05A 1PFJA 4H8SA 1P3RA 1WVHA 3ODOA 3QIJA 4DBBA 2ROVA 2Q13A 2KUPA 5C5BA 2Y7BA 1DDVA 2P0HA 2YT0A 1DDMA 2YS3A 3FSSA 3KY9A 4ZRIA 4HAUB 2D10A 1FHWA 2BCJA 3V5WA 3QBVB 1ZM0A 3AJ4A 5D3YA 4EJNA 1M7RA 2N0YA 3DXCA 1ZSQA 4B6HA 2L2IA 4GXBA 2UZRA 3VOQA 4A5KA 3KZ1A 2D9WA 4F7HA 1U5EA 3AU5A 2LOZA 1B55A 1H10A 1X1FA 3ML4A 5FI0A 2DHIA 4D0NB 1QC6A 4L6EA 4BBKA 4HHVA 4DX8A 2K2JA 1UNQA 1LW3A 5KQ4A 3TFMA 3HW2B 2W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G9W A;  1ZVR A;  3D8F A;  1BTN A;  2RGN B;  1DRO A;  1BAK A;  2DKP A;  2DX1 A;  1IRS A;  1OQN A;  2P0D A;  4HDO A;  1ZC3 B;  2MDX A;  4KHO A;  4K81 A;  1RJ2 A;  3WA0 A;  4GPT B;  5GOW B;  1ZC4 B;  1V61 A;  5JLJ B;  1DBH A;  2D4Q A;  1E5W A;  2J0K A;  2GCL A;  1Y19 B;  1WJ1 A;  2Y8F A;  2Y8G A;  4ZRJ A;  2NMB A;  1WI1 A;  5EFX A;  2EMS A;  4HB2 B;  2DHK A;  5HE0 A;  3D8E A;  1GC7 A;  1UNP A;  2COC A;  2Z0Q A;  2Z0O A;  4PNK A;  3ULB A;  1EAZ A;  3N7C A;  1H4R A;  3BJI A;  1U27 A;  2ELA A;  3PEG A;  4GN1 A;  2D2Q A;  3AU4 A;  1XD4 A;  4YL8 A;  2LUL A;  3PSC A;  2IFS A;  4A6F B;  5C16 A;  5J3T A;  1UPR A;  1FGZ A;  4K2O A;  3SNH A;  4IFS A;  3F5R A;  1UPQ A;  2YRY A;  4F7U P;  1DYN A;  1OMW A;  1MKE A;  2MFQ A;  4Z2N A;  2YS5 A;  3MPX A;  2MWN B;  1P6S A;  5DHF B;  3CXB B;  3SO6 A;  1V5M A;  2VRW B;  2DYN A;  5FI1 A;  2HTH B;  5DIF B;  2W2X D;  2YVC A;  4GMX B;  2DKQ A;  1EGX A;  1MAI A;  2ADZ A;  2D9Y A;  5DI9 B;  3DXE A;  2W2X C;  4F7G A;  3BIN A;  2Z0P A;  3ODX A;  1P5T A;  1SGH A;  3KSY A;  2D9X A;  2AEH A;  1TXD A;  1V88 A;  2J0J A;  2NZ8 B;  2G35 A;  4XWX A;  1AWE A;  5LOP B;  4Z2M B;  2RNR B;  2DX5 A;  1XCG A;  1WGQ A;  3ULC A;  3O96 A;  5CLQ B;  1XOD A;  3TW1 A;  2VKI A;  2DHJ A;  3KRX A;  2GCJ A;  4HAX B;  3D8D A;  4DX9 0;  2J0M A;  2CY5 A;  4P7I A;  3PZD A;  1NU2 A;  4IAP A;  4K2P A;  1TJ6 A;  5KCV A;  3PP2 A;  3A8Q A;  2EC1 A;  4HDQ A;  4C0A A;  2LG1 A;  1K5G B;  3PVL A;  1GC6 A;  1FGY A;  1SHC A;  2YF0 A;  2COA A;  3OAN A;  1PLS A;  2ZPY A;  1MIX A;  3IVF A;  1W1H A;  2UVM A;  1W1D A;  4HAW B;  3VIA A;  1ISN A;  4PQ0 A;  4KVG B;  5HE3 A;  2E2X A;  1U29 A;  1U5F A;  4Y94 A;  5LON B;  2I1K A;  1LB1 A;  2R09 A;  4HAT B;  3HQC A;  1XR0 B;  3KRW A;  3ZVR A;  4TKN A;  1Y5O A;  4KAX B;  3U8Z A;  4EMO A;  2VSZ A;  2EMT A;  2L1C A;  2R0D A;  5D3V A;  5HE2 A;  2D9Z A;  4KHB B;  5C79 A;  3HK0 A;  2DYQ A;  4GZU A;  4YON A;  4A6F A;  5JHH A;  4K17 A;  3ODW A;  1PMS A;  1FOE A;  1RRP B;  2YT1 A;  1X86 A;  2AL6 A;  2M14 A;  1I2H A;  1V5P A;  1EVH A;  2K2U A;  2RUK B;  5DH9 B;  1EF1 A;  3CIK A;  2I5F A;  1FHX A;  4MK0 A;  1XKE A;  2D9V A;  1QQG A;  2YSZ A;  1FB8 A;  3FM8 C;  3TCA A;  2M38 A;  3A8P A;  1UEF A;  1X11 A;  2DFK A;  2CAY A;  2DLW A;  2FJL A;  1NTY A;  5JP4 A;  2IYB A;  1GG3 A;  1K5D B;  1U5G A;  4GMV A;  1MK9 B;  1W1G A;  2KCJ A;  2PZ1 A;  1NTV A;  3NSU A;  1MK7 B;  5C5B B;  2N23 A;  3PVU A;  1V5U A;  4KHA A;  5CLL B;  1N3H A;  5HE1 A;  4HB0 B;  1U5D A;  1BTK A;  2QKM A;  2H7E A;  2V76 A;  5D3X A;  3SUZ A;  4DXA B;  1KI1 B;  2LOX A;  1MIZ B;  3DXD A;  1J0W A;  3M1I B;  4HB3 B;  1NI2 A;  2OQB A;  3T06 A;  4CHJ A;  3TO1 A;  2GJY A;  2P0F A;  1UNR A;  1FAO A;  4HAV B;  3PG7 A;  5D27 A;  3ZDT A;  5C6R A;  5J3Q A;  4ZRK A;  3LJU X;  2MKR A;  2CY4 A;  1M7E A;  3TVV A;  1XX0 A;  4WSF A;  2DTC A;  4A6H A;  4WVF B;  2I1J A;  3UZT A;  4MY6 A;  5D3W A;  2KGX B;  1KZG A;  3X23 A;  2LKO A;  3A98 B;  4IOY X;  3P6A A;  1FHO A;  2RVB B;  1WGU A;  4A6K A;  5KQ1 A;  2X18 A;  2ELB A;  2JP2 A;  5JHG A;  2CRF A;  3SYX A;  2LYD A;  2P8V A;  1OY2 A;  3PVW A;  4CYE A;  3RCP A;  1MPH A;  4NY0 A;  2DN6 A;  2EJ8 A;  1KZ7 A;  1AQC A;  3FEH A;  1Z87 A;  2I5C A;  2RSG A;  2J59 M;  4TYZ A;  3WYF B;  3SV1 A;  1V89 A;  3F0W A;  4EKU A;  2QKL A;  2XQN M;  4CHM A;  2DA0 A;  3QWM A;  5DHA B;  2COF A;  3GYO A;  2D11 A;  2ROZ B;  2K00 A;  4WJ7 A;  4HB4 B;  1I7A A;  2UZS A;  3P7Z A;  4HAY B;  5L81 A;  1BWN A;  1TQZ A;  3MDB C;  3GYP A;  2OTX A;  4MT7 A;  2COD A;  2H7D A;  1J19 A;  2RLO A;  1WJM A;  4HAZ B;  4NSW A;  1WG7 A;  5J3Y A;  2GS0 A;  1U2B A;  1DDW A;  1Q67 A;  1X1G A;  2HE7 A;  3U7D A;  2YS1 A;  1X05 A;  1PFJ A;  4H8S A;  1P3R A;  1WVH A;  3ODO A;  3QIJ A;  4DBB A;  2ROV A;  2Q13 A;  2KUP A;  5C5B A;  2Y7B A;  1DDV A;  2P0H A;  2YT0 A;  1DDM A;  2YS3 A;  3FSS A;  3KY9 A;  4ZRI A;  4HAU B;  2D10 A;  1FHW A;  2BCJ A;  3V5W A;  3QBV B;  1ZM0 A;  3AJ4 A;  5D3Y A;  4EJN A;  1M7R A;  2N0Y A;  3DXC A;  1ZSQ A;  4B6H A;  2L2I A;  4GXB A;  2UZR A;  3VOQ A;  4A5K A;  3KZ1 A;  2D9W A;  4F7H A;  1U5E A;  3AU5 A;  2LOZ A;  1B55 A;  1H10 A;  1X1F A;  3ML4 A;  5FI0 A;  2DHI A;  4D0N B;  1QC6 A;  4L6E A;  4BBK A;  4HHV A;  4DX8 A;  2K2J A;  1UNQ A;  1LW3 A;  5KQ4 A;  3TFM A;  3HW2 B;  2W2W A; 
#chains in the Genus database with same CATH topology
 2NBV A;  3G9W A;  1ZVR A;  3D8F A;  1BTN A;  2RGN B;  1DRO A;  1BAK A;  2DKP A;  2DX1 A;  1ZYI A;  1IRS A;  1OQN A;  2P0D A;  4HDO A;  1ZC3 B;  2MDX A;  4KHO A;  4K81 A;  1RJ2 A;  3WA0 A;  4GPT B;  5GOW B;  1ZC4 B;  1V61 A;  5JLJ B;  1DBH A;  2D4Q A;  1E5W A;  1T77 A;  2J0K A;  2GCL A;  1Y19 B;  1WJ1 A;  2Y8F A;  2Y8G A;  4ZRJ A;  2NMB A;  2ZKM X;  1WI1 A;  5EFX A;  2EMS A;  4HB2 B;  2DHK A;  5HE0 A;  3D8E A;  1GC7 A;  1UNP A;  2COC A;  2Z0Q A;  2Z0O A;  3NW8 A;  4DIX A;  4PNK A;  3ULB A;  4D6W A;  1EAZ A;  3N7C A;  1H4R A;  3BJI A;  1U27 A;  2ELA A;  3PEG A;  4GN1 A;  2D2Q A;  3AU4 A;  1XD4 A;  4YL8 A;  2LUL A;  3PSC A;  2IFS A;  4A6F B;  5C16 A;  5J3T A;  1UPR A;  1FGZ A;  4K2O A;  3SNH A;  4IFS A;  3F5R A;  1UPQ A;  4QJ3 B;  2YRY A;  4F7U P;  1DYN A;  1OMW A;  1MKE A;  2MFQ A;  2Z4D A;  4Z2N A;  2YS5 A;  3MPX A;  2MWN B;  3DCX A;  1P6S A;  5DHF B;  3CXB B;  3SO6 A;  1V5M A;  2VRW B;  3FVC A;  2DYN A;  3B77 A;  2HTH B;  5FI1 A;  3NWA A;  5DIF B;  2W2X D;  2YVC A;  4GMX B;  2DKQ A;  1EGX A;  1MAI A;  2ADZ A;  2D9Y A;  5DI9 B;  3DXE A;  2W2X C;  4F7G A;  3BIN A;  2Z0P A;  3ODX A;  1P5T A;  1SGH A;  3KSY A;  2D9X A;  2AEH A;  1TXD A;  1V88 A;  2J0J A;  2NZ8 B;  2G35 A;  4XWX A;  1AWE A;  5LOP B;  4Z2M B;  2YT2 A;  2RNR B;  2DX5 A;  1XCG A;  1WGQ A;  3ULC A;  3O96 A;  5CLQ B;  1XOD A;  3TW1 A;  2VKI A;  2DHJ A;  3KRX A;  2GCJ A;  4HAX B;  3D8D A;  4DX9 0;  2J0M A;  2CY5 A;  4P7I A;  3PZD A;  1NU2 A;  4IAP A;  4K2P A;  1TJ6 A;  2GUM A;  5KCV A;  3PP2 A;  3A8Q A;  2EC1 A;  4HDQ A;  4C0A A;  2LG1 A;  4QJ4 B;  1K5G B;  3PVL A;  5IRS A;  1GC6 A;  1FGY A;  1SHC A;  2YF0 A;  2COA A;  3OAN A;  1PLS A;  2ZPY A;  1MIX A;  3IVF A;  1W1H A;  2UVM A;  1W1D A;  4HAW B;  3VIA A;  1ISN A;  4PQ0 A;  4KVG B;  5HE3 A;  2E2X A;  1U29 A;  1U5F A;  4Y94 A;  4GOU A;  5LON B;  2I1K A;  1LB1 A;  2R09 A;  4HAT B;  3HQC A;  1XR0 B;  3KRW A;  3ZVR A;  4TKN A;  1Y5O A;  4KAX B;  3U8Z A;  4EMO A;  2VSZ A;  2EMT A;  2L1C A;  4OT1 A;  2R0D A;  5D3V A;  5HE2 A;  2D9Z A;  4KHB B;  5C79 A;  3HK0 A;  2DYQ A;  4GZU A;  4YON A;  4A6F A;  2KIE A;  5JHH A;  4K17 A;  3ODW A;  1PMS A;  1FOE A;  1RRP B;  2YT1 A;  1X86 A;  2AL6 A;  2M14 A;  1I2H A;  1V5P A;  2Z14 A;  2K8E A;  1EVH A;  5I2S A;  2K2U A;  2RUK B;  5DH9 B;  1EF1 A;  3CIK A;  2I5F A;  1FHX A;  4MK0 A;  1XKE A;  2D9V A;  1QQG A;  3OHM B;  2YSZ A;  1FB8 A;  4CSQ A;  3FM8 C;  3TCA A;  2M38 A;  3A8P A;  1UEF A;  1X11 A;  2DFK A;  2CAY A;  2DLW A;  2FJL A;  1NTY A;  5JP4 A;  2IYB A;  1GG3 A;  1K5D B;  1U5G A;  4GMV A;  1MK9 B;  4HSI A;  1W1G A;  2KCJ A;  2PZ1 A;  1NTV A;  2RRF A;  3NSU A;  1MK7 B;  5C5B B;  2N23 A;  3PVU A;  1V5U A;  4KHA A;  5CLL B;  1N3H A;  5HE1 A;  4HB0 B;  1U5D A;  1BTK A;  2QKM A;  3U12 A;  3A58 A;  2H7E A;  4L1R A;  2V76 A;  5D3X A;  3SUZ A;  4DXA B;  1KI1 B;  2LOX A;  1MIZ B;  3DXD A;  1J0W A;  3M1I B;  4HB3 B;  1NI2 A;  2OQB A;  3T06 A;  4CHJ A;  3TO1 A;  2GJY A;  5I2M A;  2P0F A;  1UNR A;  1FAO A;  4HAV B;  3PG7 A;  5D27 A;  3ZDT A;  5C6R A;  5J3Q A;  4ZRK A;  3LJU X;  2MKR A;  2CY4 A;  1M7E A;  3TVV A;  1MI1 A;  4QJ5 B;  1XX0 A;  4WSF A;  2DTC A;  4A6H A;  4WVF B;  2I1J A;  4GNK B;  4MY6 A;  5D3W A;  3UZT A;  2KGX B;  1KZG A;  3X23 A;  2R2Y A;  2LKO A;  3A98 B;  3NWD A;  4IOY X;  3P6A A;  1FHO A;  2RVB B;  1WGU A;  3NWF A;  4A6K A;  5KQ1 A;  2X18 A;  2ELB A;  2JP2 A;  5JHG A;  2CRF A;  3SYX A;  2LYD A;  2P8V A;  1OY2 A;  3PVW A;  4CYE A;  4KHB A;  1MPH A;  3RCP A;  4NY0 A;  5LG4 B;  2Z59 A;  3HSA A;  2DN6 A;  2EJ8 A;  1KZ7 A;  1AQC A;  3FEH A;  1Z87 A;  2I5C A;  2RSG A;  2J59 M;  4TYZ A;  3WYF B;  3SV1 A;  1V89 A;  3F0W A;  4EKU A;  2QKL A;  2KUQ A;  2XQN M;  4CHM A;  2DA0 A;  3QWM A;  5DHA B;  2COF A;  3GYO A;  2D11 A;  2ROZ B;  2K00 A;  4WJ7 A;  4HB4 B;  1I7A A;  2UZS A;  3P7Z A;  4HAY B;  5L81 A;  1BWN A;  1TQZ A;  3MDB C;  3GYP A;  2OTX A;  4MT7 A;  2COD A;  2H7D A;  1J19 A;  2RLO A;  1WJM A;  4HAZ B;  4NSW A;  1WG7 A;  5J3Y A;  2GS0 A;  1U2B A;  1DDW A;  1Q67 A;  1X1G A;  5M4Y B;  2HE7 A;  3U7D A;  2YS1 A;  1X05 A;  1PFJ A;  4H8S A;  1P3R A;  1WVH A;  3ODO A;  3QIJ A;  4DBB A;  2ROV A;  2Q13 A;  2KIG A;  2KUP A;  5C5B A;  2Y7B A;  4OSN A;  1DDV A;  2P0H A;  2YT0 A;  1DDM A;  2YS3 A;  3FSS A;  3KY9 A;  2Z13 A;  4ZRI A;  4HAU B;  2D10 A;  1FHW A;  2BCJ A;  3V5W A;  3QBV B;  1ZM0 A;  2KR0 A;  3AJ4 A;  5D3Y A;  4EJN A;  1M7R A;  2N0Y A;  3DXC A;  1ZSQ A;  4B6H A;  2L2I A;  4GXB A;  3HIE A;  2UZR A;  3VOQ A;  4A5K A;  3KZ1 A;  2D9W A;  2K49 A;  4F7H A;  1U5E A;  3AU5 A;  2LOZ A;  1B55 A;  1H10 A;  1X1F A;  3ML4 A;  5FI0 A;  2DHI A;  4D0N B;  4QXA B;  1QC6 A;  4L6E A;  4BBK A;  4HHV A;  4DX8 A;  2K2J A;  1UNQ A;  1LW3 A;  5KQ4 A;  3TFM A;  3HW2 B;  2FJU B;  2W2W A; 
#chains in the Genus database with same CATH homology
 3G9W A;  1ZVR A;  3D8F A;  1BTN A;  2RGN B;  1DRO A;  1BAK A;  2DKP A;  2DX1 A;  1IRS A;  1OQN A;  2P0D A;  4HDO A;  1ZC3 B;  2MDX A;  4KHO A;  4K81 A;  1RJ2 A;  3WA0 A;  4GPT B;  5GOW B;  1ZC4 B;  1V61 A;  5JLJ B;  1DBH A;  2D4Q A;  1E5W A;  2J0K A;  2GCL A;  1Y19 B;  1WJ1 A;  2Y8F A;  2Y8G A;  4ZRJ A;  2NMB A;  1WI1 A;  5EFX A;  2EMS A;  4HB2 B;  2DHK A;  5HE0 A;  3D8E A;  1GC7 A;  1UNP A;  2COC A;  2Z0Q A;  2Z0O A;  4PNK A;  3ULB A;  1EAZ A;  3N7C A;  1H4R A;  3BJI A;  1U27 A;  2ELA A;  3PEG A;  4GN1 A;  2D2Q A;  3AU4 A;  1XD4 A;  4YL8 A;  2LUL A;  3PSC A;  2IFS A;  4A6F B;  5C16 A;  5J3T A;  1UPR A;  1FGZ A;  4K2O A;  3SNH A;  4IFS A;  3F5R A;  1UPQ A;  2YRY A;  4F7U P;  1DYN A;  1OMW A;  1MKE A;  2MFQ A;  4Z2N A;  2YS5 A;  3MPX A;  2MWN B;  1P6S A;  5DHF B;  3CXB B;  3SO6 A;  1V5M A;  2VRW B;  2DYN A;  5FI1 A;  2HTH B;  5DIF B;  2W2X D;  2YVC A;  4GMX B;  2DKQ A;  1EGX A;  1MAI A;  2ADZ A;  2D9Y A;  5DI9 B;  3DXE A;  2W2X C;  4F7G A;  3BIN A;  2Z0P A;  3ODX A;  1P5T A;  1SGH A;  3KSY A;  2D9X A;  2AEH A;  1TXD A;  1V88 A;  2J0J A;  2NZ8 B;  2G35 A;  4XWX A;  1AWE A;  5LOP B;  4Z2M B;  2RNR B;  2DX5 A;  1XCG A;  1WGQ A;  3ULC A;  3O96 A;  5CLQ B;  1XOD A;  3TW1 A;  2VKI A;  2DHJ A;  3KRX A;  2GCJ A;  4HAX B;  3D8D A;  4DX9 0;  2J0M A;  2CY5 A;  4P7I A;  3PZD A;  1NU2 A;  4IAP A;  4K2P A;  1TJ6 A;  5KCV A;  3PP2 A;  3A8Q A;  2EC1 A;  4HDQ A;  4C0A A;  2LG1 A;  1K5G B;  3PVL A;  1GC6 A;  1FGY A;  1SHC A;  2YF0 A;  2COA A;  3OAN A;  1PLS A;  2ZPY A;  1MIX A;  3IVF A;  1W1H A;  2UVM A;  1W1D A;  4HAW B;  3VIA A;  1ISN A;  4PQ0 A;  4KVG B;  5HE3 A;  2E2X A;  1U29 A;  1U5F A;  4Y94 A;  5LON B;  2I1K A;  1LB1 A;  2R09 A;  4HAT B;  3HQC A;  1XR0 B;  3KRW A;  3ZVR A;  4TKN A;  1Y5O A;  4KAX B;  3U8Z A;  4EMO A;  2VSZ A;  2EMT A;  2L1C A;  2R0D A;  5D3V A;  5HE2 A;  2D9Z A;  4KHB B;  5C79 A;  3HK0 A;  2DYQ A;  4GZU A;  4YON A;  4A6F A;  5JHH A;  4K17 A;  3ODW A;  1PMS A;  1FOE A;  1RRP B;  2YT1 A;  1X86 A;  2AL6 A;  2M14 A;  1I2H A;  1V5P A;  1EVH A;  2K2U A;  2RUK B;  5DH9 B;  1EF1 A;  3CIK A;  2I5F A;  1FHX A;  4MK0 A;  1XKE A;  2D9V A;  1QQG A;  2YSZ A;  1FB8 A;  3FM8 C;  3TCA A;  2M38 A;  3A8P A;  1UEF A;  1X11 A;  2DFK A;  2CAY A;  2DLW A;  2FJL A;  1NTY A;  5JP4 A;  2IYB A;  1GG3 A;  1K5D B;  1U5G A;  4GMV A;  1MK9 B;  1W1G A;  2KCJ A;  2PZ1 A;  1NTV A;  3NSU A;  1MK7 B;  5C5B B;  2N23 A;  3PVU A;  1V5U A;  4KHA A;  5CLL B;  1N3H A;  5HE1 A;  4HB0 B;  1U5D A;  1BTK A;  2QKM A;  2H7E A;  2V76 A;  5D3X A;  3SUZ A;  4DXA B;  1KI1 B;  2LOX A;  1MIZ B;  3DXD A;  1J0W A;  3M1I B;  4HB3 B;  1NI2 A;  2OQB A;  3T06 A;  4CHJ A;  3TO1 A;  2GJY A;  2P0F A;  1UNR A;  1FAO A;  4HAV B;  3PG7 A;  5D27 A;  3ZDT A;  5C6R A;  5J3Q A;  4ZRK A;  3LJU X;  2MKR A;  2CY4 A;  1M7E A;  3TVV A;  1XX0 A;  4WSF A;  2DTC A;  4A6H A;  4WVF B;  2I1J A;  3UZT A;  4MY6 A;  5D3W A;  2KGX B;  1KZG A;  3X23 A;  2LKO A;  3A98 B;  4IOY X;  3P6A A;  1FHO A;  2RVB B;  1WGU A;  4A6K A;  5KQ1 A;  2X18 A;  2ELB A;  2JP2 A;  5JHG A;  2CRF A;  3SYX A;  2LYD A;  2P8V A;  1OY2 A;  3PVW A;  4CYE A;  3RCP A;  1MPH A;  4NY0 A;  2DN6 A;  2EJ8 A;  1KZ7 A;  1AQC A;  3FEH A;  1Z87 A;  2I5C A;  2RSG A;  2J59 M;  4TYZ A;  3WYF B;  3SV1 A;  1V89 A;  3F0W A;  4EKU A;  2QKL A;  2XQN M;  4CHM A;  2DA0 A;  3QWM A;  5DHA B;  2COF A;  3GYO A;  2D11 A;  2ROZ B;  2K00 A;  4WJ7 A;  4HB4 B;  1I7A A;  2UZS A;  3P7Z A;  4HAY B;  5L81 A;  1BWN A;  1TQZ A;  3MDB C;  3GYP A;  2OTX A;  4MT7 A;  2COD A;  2H7D A;  1J19 A;  2RLO A;  1WJM A;  4HAZ B;  4NSW A;  1WG7 A;  5J3Y A;  2GS0 A;  1U2B A;  1DDW A;  1Q67 A;  1X1G A;  2HE7 A;  3U7D A;  2YS1 A;  1X05 A;  1PFJ A;  4H8S A;  1P3R A;  1WVH A;  3ODO A;  3QIJ A;  4DBB A;  2ROV A;  2Q13 A;  2KUP A;  5C5B A;  2Y7B A;  1DDV A;  2P0H A;  2YT0 A;  1DDM A;  2YS3 A;  3FSS A;  3KY9 A;  4ZRI A;  4HAU B;  2D10 A;  1FHW A;  2BCJ A;  3V5W A;  3QBV B;  1ZM0 A;  3AJ4 A;  5D3Y A;  4EJN A;  1M7R A;  2N0Y A;  3DXC A;  1ZSQ A;  4B6H A;  2L2I A;  4GXB A;  2UZR A;  3VOQ A;  4A5K A;  3KZ1 A;  2D9W A;  4F7H A;  1U5E A;  3AU5 A;  2LOZ A;  1B55 A;  1H10 A;  1X1F A;  3ML4 A;  5FI0 A;  2DHI A;  4D0N B;  1QC6 A;  4L6E A;  4BBK A;  4HHV A;  4DX8 A;  2K2J A;  1UNQ A;  1LW3 A;  5KQ4 A;  3TFM A;  3HW2 B;  2W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...