1PFJA

Solution structure of the n-terminal ph/ptb domain of the tfiih p62 subunit
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
108
structure length
108
Chain Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TFIIH contains a PH domain involved in DNA nucleotide excision repair.
pubmed doi rcsb
molecule keywords TFIIH basal transcription factor complex p62 subunit
molecule tags Transcription
source organism Homo sapiens
total genus 12
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1pfjA00
4A6FB 4GZUA 1W1HA 3KZ1A 2MDXA 2GJYA 2P0DA 1U27A 4EJNA 2GCLA 4KHBB 2MFQA 3WYFB 1U5FA 3U8ZA 4HB2B 1ISNA 4A5KA 3V5WA 2ADZA 2DKQA 2COAA 2COCA 1WI1A 2HTHB 3P7ZA 4GN1A 4HAVB 3TW1A 2IFSA 2J0JA 2DX5A 4HAUB 1MK9B 2L2IA 4F7HA 1V61A 4ZRJA 5LONB 4A6HA 1RRPB 1WVHA 2DLWA 1J0WA 1UEFA 2N23A 5DI9B 3QIJA 4F7GA 2J0KA 2KGXB 5DHFB 2OQBA 1V89A 1FHWA 4DX8A 3F0WA 3PVUA 5D3VA 2I5FA 1OY2A 3P6AA 1M7RA 3CXBB 2D2QA 4KHOA 4PQ0A 4ZRKA 2D4QA 2DX1A 1DDVA 1Y5OA 3OANA 1XD4A 4K81A 2AL6A 3GYPA 2Y8GA 1ZC4B 2D9WA 2DHIA 1GC7A 1FHOA 2D9ZA 1DBHA 2W2XC 2VKIA 1X1GA 1UPQA 3A98B 4Z2NA 4NY0A 3HQCA 3UZTA 2R09A 2AEHA 3D8DA 2K00A 1QQGA 3TFMA 2G35A 2RGNB 5D27A 3LJUX 1P5TA 1OQNA 1ZSQA 1XODA 3PVLA 4CYEA 4HDQA 3NSUA 4GMVA 2KUPA 2QKMA 5C5BA 1WJMA 1X86A 1FGYA 1H4RA 3DXDA 3BJIA 2DYNA 1KZ7A 2I1JA 4K17A 2H7DA 1V5UA 3VIAA 1IRSA 4B6HA 1FGZA 5CLQB 2GS0A 5HE3A 1W1GA 4DX90 1DYNA 4DXAB 1LW3A 2VRWB 2XQNM 1NI2A 1WJ1A 4WJ7A 3FSSA 4HAYB 2EJ8A 3ULCA 3KSYA 2UZSA 3TO1A 1PFJA 3TCAA 1TXDA 3PZDA 5D3XA 2DFKA 2DHJA 2OTXA 3U7DA 1RJ2A 3TVVA 1EGXA 2ROVA 4TKNA 3ODOA 3PEGA 2D10A 2J59M 4Y94A 3WA0A 4DBBA 1DDWA 3FEHA 2I1KA 1X1FA 1BTNA 1XX0A 1WGUA 1ZVRA 1NU2A 5KQ4A 3A8PA 4GMXB 4HAXB 2EC1A 4HDOA 2D9XA 1AWEA 4H8SA 3AU4A 3MDBC 1H10A 1OMWA 2KCJA 4EMOA 5J3QA 2DYQA 2YS5A 4HB4B 1BAKA 2RVBB 4XWXA 3GYOA 4ZRIA 1X05A 1FHXA 5HE1A 5L81A 3A8QA 2COFA 4Z2MB 2LOZA 3DXCA 1FB8A 3ULBA 1WG7A 2GCJA 3MPXA 3D8EA 4A6KA 2RUKB 3QBVB 1EVHA 4MY6A 1WGQA 5JHHA 3QWMA 4KVGB 3SO6A 4IFSA 3KRXA 5FI0A 5DH9B 4K2OA 2K2JA 5LOPB 1KZGA 5HE0A 3ZDTA 1MK7B 1MIXA 2DN6A 2JP2A 2W2WA 2K2UA 1ZM0A 4K2PA 3AJ4A 2MKRA 2Z0QA 2IYBA 1U5GA 2VSZA 4HATB 1BWNA 2DKPA 4MT7A 3SYXA 4TYZA 2RLOA 5HE2A 4HHVA 4A6FA 2D9YA 4GPTB 4NSWA 5D3WA 5KQ1A 4MK0A 3RCPA 4EKUA 1EF1A 1XR0B 2YS1A 2LYDA 2DHKA 2CAYA 2LULA 3KRWA 1V5MA 1W1DA 4D0NB 2YF0A 1FAOA 1J19A 2R0DA 5C5BB 2ELBA 2BCJA 5CLLB 2Z0OA 1UNRA 1DROA 3IVFA 1V5PA 5C79A 3HK0A 3CIKA 2CY4A 3F5RA 2I5CA 1MKEA 2DTCA 4YONA 2ELAA 2L1CA 3N7CA 5GOWB 2DA0A 5DHAB 3ODWA 2RSGA 2P0HA 4HAWB 1X11A 4BBKA 1PMSA 1GG3A 1Y19B 4F7UP 2HE7A 4KAXB 4CHMA 1U5DA 2YT0A 2YRYA 2J0MA 5DIFB 5EFXA 2M38A 5JLJB 2YVCA 2FJLA 4P7IA 3M1IB 1P3RA 3SV1A 1I7AA 2LKOA 4HB0B 1MPHA 3X23A 1AQCA 2Y8FA 2X18A 3SUZA 3HW2B 1FOEA 1Q67A 1MIZB 1MAIA 1NTVA 3D8FA 5FI1A 2P0FA 1P6SA 5C16A 2UVMA 1M7EA 1I2HA 2QKLA 1N3HA 1QC6A 3SNHA 1KI1B 3PSCA 4IAPA 2YS3A 5D3YA 4KHAA 2Q13A 2LOXA 2P8VA 4C0AA 3PP2A 2MWNB 1K5DB 3BINA 4YL8A 5J3TA 4GXBA 1GC6A 3FM8C 2LG1A 3ODXA 2ROZB 4PNKA 2Y7BA 3ZVRA 1XKEA 2NZ8B 5JP4A 3O96A 2Z0PA 2M14A 1E5WA 1DDMA 2W2XD 1UPRA 1B55A 4HB3B 2ZPYA 3T06A 3PG7A 2EMSA 2YT1A 1LB1A 1U5EA 4WSFA 2N0YA 1PLSA 2EMTA 1K5GB 1SHCA 1BTKA 1SGHA 2CODA 5KCVA 1UNQA 1TQZA 1U29A 1UNPA 4WVFB 1XCGA 2NMBA 2E2XA 3DXEA 2D11A 2D9VA 1TJ6A 5J3YA 2PZ1A 2CRFA 4L6EA 4IOYX 2H7EA 1ZC3B 4HAZB 1EAZA 3VOQA 5C6RA 5JHGA 2UZRA 4CHJA 1U2BA 3AU5A 1Z87A 1V88A 2V76A 3ML4A 1NTYA 3G9WA 2CY5A 3KY9A 2YSZA 2RNRB 3PVWA
chains in the Genus database with same CATH superfamily
5I2MA 5I2SA 4A6FB 4GZUA 1W1HA 3KZ1A 2MDXA 2GJYA 2P0DA 1U27A 4EJNA 2GCLA 4KHBB 2MFQA 3WYFB 1U5FA 3U8ZA 4HB2B 2Z59A 1ISNA 4A5KA 3V5WA 2ADZA 2DKQA 2Z13A 2COAA 2COCA 1WI1A 2HTHB 3P7ZA 4GN1A 4HAVB 3TW1A 2IFSA 2J0JA 2DX5A 4QJ4B 4HAUB 1MK9B 2L2IA 4F7HA 1V61A 4ZRJA 4GNKB 5LONB 4A6HA 1RRPB 1WVHA 2DLWA 1J0WA 1UEFA 2N23A 5DI9B 3QIJA 4F7GA 2J0KA 2KGXB 5DHFB 2OQBA 1V89A 1FHWA 4DX8A 3F0WA 3PVUA 5D3VA 2I5FA 1OY2A 3P6AA 1M7RA 3CXBB 2D2QA 4KHOA 4PQ0A 4ZRKA 2D4QA 2DX1A 1DDVA 1Y5OA 3OANA 1XD4A 4K81A 2AL6A 3GYPA 2Y8GA 1ZC4B 2D9WA 3B77A 2DHIA 1GC7A 1FHOA 2D9ZA 1DBHA 3OHMB 2W2XC 2VKIA 1X1GA 1UPQA 3A98B 4Z2NA 4NY0A 3HQCA 3UZTA 2R09A 2AEHA 3D8DA 2K00A 1QQGA 2K8EA 3TFMA 2G35A 2RGNB 2FJUB 5D27A 3LJUX 1P5TA 1OQNA 1ZSQA 1XODA 3PVLA 4CYEA 4HDQA 3NSUA 4GMVA 2KUPA 2QKMA 5C5BA 1WJMA 1X86A 1FGYA 1H4RA 3DXDA 3BJIA 2DYNA 2KUQA 1KZ7A 2I1JA 4K17A 2H7DA 1V5UA 3VIAA 1IRSA 4B6HA 1FGZA 5CLQB 2KR0A 2GS0A 5HE3A 1W1GA 4DX90 1DYNA 4DXAB 1LW3A 2VRWB 2XQNM 3HIEA 1NI2A 1WJ1A 4WJ7A 3FSSA 4D6WA 4HAYB 2EJ8A 3ULCA 2R2YA 3KSYA 2UZSA 3TO1A 1PFJA 3TCAA 3NWAA 3A58A 1TXDA 3PZDA 5D3XA 2DFKA 2DHJA 2OTXA 3U7DA 5LG4B 1RJ2A 3TVVA 4OT1A 1EGXA 2ROVA 4TKNA 3FVCA 3ODOA 3PEGA 2D10A 2J59M 4Y94A 3WA0A 4DBBA 3U12A 1DDWA 3FEHA 3NWDA 2I1KA 1X1FA 1BTNA 1XX0A 1WGUA 1ZVRA 2YT2A 1NU2A 5KQ4A 3A8PA 4GMXB 4HAXB 2EC1A 2GUMA 2K49A 4HDOA 2D9XA 1AWEA 4H8SA 3AU4A 3MDBC 1H10A 1OMWA 2KCJA 4EMOA 5J3QA 2DYQA 2YS5A 4HB4B 1BAKA 2RVBB 4XWXA 3GYOA 4ZRIA 1X05A 1FHXA 5HE1A 5L81A 3A8QA 2COFA 3NWFA 4Z2MB 2LOZA 3DXCA 1FB8A 3ULBA 1WG7A 2GCJA 3MPXA 1T77A 3D8EA 4A6KA 2RUKB 3QBVB 1EVHA 4MY6A 1WGQA 5JHHA 3QWMA 4KVGB 3SO6A 4DIXA 4IFSA 3KRXA 5FI0A 5DH9B 4K2OA 2K2JA 5LOPB 1KZGA 4HSIA 5HE0A 3ZDTA 1MK7B 1MIXA 2NBVA 2DN6A 2JP2A 2W2WA 2K2UA 1ZM0A 4K2PA 3AJ4A 2MKRA 2Z0QA 2IYBA 1U5GA 2VSZA 4HATB 1ZYIA 1BWNA 2DKPA 4MT7A 3SYXA 4TYZA 2RLOA 5HE2A 4HHVA 4A6FA 2D9YA 4GPTB 4NSWA 5D3WA 4KHBA 5KQ1A 4MK0A 2ZKMX 3RCPA 4EKUA 1EF1A 1XR0B 2YS1A 2LYDA 4GOUA 2DHKA 2CAYA 2LULA 3KRWA 1V5MA 4OSNA 1W1DA 4D0NB 2YF0A 1FAOA 2RRFA 1J19A 2R0DA 5C5BB 2ELBA 2BCJA 5CLLB 2Z0OA 1UNRA 1DROA 3IVFA 1V5PA 3DCXA 5M4YB 5C79A 3HK0A 3CIKA 4CSQA 2CY4A 3F5RA 2I5CA 1MKEA 2DTCA 4YONA 2ELAA 2L1CA 3N7CA 5GOWB 2DA0A 5DHAB 3ODWA 2RSGA 2P0HA 4HAWB 1X11A 3HSAA 1PMSA 4BBKA 1GG3A 1Y19B 4F7UP 2HE7A 4KAXB 4CHMA 4QJ5B 1U5DA 2YT0A 2YRYA 2J0MA 5DIFB 5EFXA 2M38A 5JLJB 2YVCA 2FJLA 4P7IA 3M1IB 1P3RA 3SV1A 1I7AA 4L1RA 2LKOA 4HB0B 1MPHA 3X23A 1AQCA 2Y8FA 2X18A 3SUZA 3HW2B 1FOEA 1Q67A 1MIZB 1MAIA 1NTVA 3D8FA 5FI1A 2P0FA 1P6SA 5C16A 2UVMA 1M7EA 1I2HA 2QKLA 1N3HA 1QC6A 3SNHA 1KI1B 5IRSA 3PSCA 4QXAB 1MI1A 4IAPA 2YS3A 5D3YA 4KHAA 2Q13A 2LOXA 2P8VA 4C0AA 3PP2A 2MWNB 1K5DB 3BINA 4QJ3B 4YL8A 5J3TA 4GXBA 1GC6A 2Z14A 3FM8C 2LG1A 3ODXA 2ROZB 4PNKA 2Y7BA 3ZVRA 1XKEA 2NZ8B 5JP4A 3O96A 2Z0PA 2M14A 1E5WA 1DDMA 2W2XD 1UPRA 1B55A 4HB3B 2KIGA 2ZPYA 3T06A 3PG7A 2EMSA 2YT1A 1LB1A 3NW8A 1U5EA 4WSFA 2N0YA 1PLSA 2EMTA 1K5GB 1SHCA 1BTKA 1SGHA 2CODA 5KCVA 1UNQA 1TQZA 1U29A 1UNPA 4WVFB 1XCGA 2NMBA 2E2XA 3DXEA 2D11A 2D9VA 1TJ6A 5J3YA 2PZ1A 2CRFA 4L6EA 4IOYX 2H7EA 1ZC3B 2KIEA 4HAZB 1EAZA 3VOQA 5C6RA 5JHGA 2UZRA 4CHJA 1U2BA 3AU5A 1Z87A 1V88A 2V76A 3ML4A 1NTYA 3G9WA 2CY5A 3KY9A 2YSZA 2RNRB 3PVWA 2Z4DA
chains in the Genus database with same CATH topology
4A6FB 4GZUA 1W1HA 3KZ1A 2MDXA 2GJYA 2P0DA 1U27A 4EJNA 2GCLA 4KHBB 2MFQA 3WYFB 1U5FA 3U8ZA 4HB2B 1ISNA 4A5KA 3V5WA 2ADZA 2DKQA 2COAA 2COCA 1WI1A 2HTHB 3P7ZA 4GN1A 4HAVB 3TW1A 2IFSA 2J0JA 2DX5A 4HAUB 1MK9B 2L2IA 4F7HA 1V61A 4ZRJA 5LONB 4A6HA 1RRPB 1WVHA 2DLWA 1J0WA 1UEFA 2N23A 5DI9B 3QIJA 4F7GA 2J0KA 2KGXB 5DHFB 2OQBA 1V89A 1FHWA 4DX8A 3F0WA 3PVUA 5D3VA 2I5FA 1OY2A 3P6AA 1M7RA 3CXBB 2D2QA 4KHOA 4PQ0A 4ZRKA 2D4QA 2DX1A 1DDVA 1Y5OA 3OANA 1XD4A 4K81A 2AL6A 3GYPA 2Y8GA 1ZC4B 2D9WA 2DHIA 1GC7A 1FHOA 2D9ZA 1DBHA 2W2XC 2VKIA 1X1GA 1UPQA 3A98B 4Z2NA 4NY0A 3HQCA 3UZTA 2R09A 2AEHA 3D8DA 2K00A 1QQGA 3TFMA 2G35A 2RGNB 5D27A 3LJUX 1P5TA 1OQNA 1ZSQA 1XODA 3PVLA 4CYEA 4HDQA 3NSUA 4GMVA 2KUPA 2QKMA 5C5BA 1WJMA 1X86A 1FGYA 1H4RA 3DXDA 3BJIA 2DYNA 1KZ7A 2I1JA 4K17A 2H7DA 1V5UA 3VIAA 1IRSA 4B6HA 1FGZA 5CLQB 2GS0A 5HE3A 1W1GA 4DX90 1DYNA 4DXAB 1LW3A 2VRWB 2XQNM 1NI2A 1WJ1A 4WJ7A 3FSSA 4HAYB 2EJ8A 3ULCA 3KSYA 2UZSA 3TO1A 1PFJA 3TCAA 1TXDA 3PZDA 5D3XA 2DFKA 2DHJA 2OTXA 3U7DA 1RJ2A 3TVVA 1EGXA 2ROVA 4TKNA 3ODOA 3PEGA 2D10A 2J59M 4Y94A 3WA0A 4DBBA 1DDWA 3FEHA 2I1KA 1X1FA 1BTNA 1XX0A 1WGUA 1ZVRA 1NU2A 5KQ4A 3A8PA 4GMXB 4HAXB 2EC1A 4HDOA 2D9XA 1AWEA 4H8SA 3AU4A 3MDBC 1H10A 1OMWA 2KCJA 4EMOA 5J3QA 2DYQA 2YS5A 4HB4B 1BAKA 2RVBB 4XWXA 3GYOA 4ZRIA 1X05A 1FHXA 5HE1A 5L81A 3A8QA 2COFA 4Z2MB 2LOZA 3DXCA 1FB8A 3ULBA 1WG7A 2GCJA 3MPXA 3D8EA 4A6KA 2RUKB 3QBVB 1EVHA 4MY6A 1WGQA 5JHHA 3QWMA 4KVGB 3SO6A 4IFSA 3KRXA 5FI0A 5DH9B 4K2OA 2K2JA 5LOPB 1KZGA 5HE0A 3ZDTA 1MK7B 1MIXA 2DN6A 2JP2A 2W2WA 2K2UA 1ZM0A 4K2PA 3AJ4A 2MKRA 2Z0QA 2IYBA 1U5GA 2VSZA 4HATB 1BWNA 2DKPA 4MT7A 3SYXA 4TYZA 2RLOA 5HE2A 4HHVA 4A6FA 2D9YA 4GPTB 4NSWA 5D3WA 5KQ1A 4MK0A 3RCPA 4EKUA 1EF1A 1XR0B 2YS1A 2LYDA 2DHKA 2CAYA 2LULA 3KRWA 1V5MA 1W1DA 4D0NB 2YF0A 1FAOA 1J19A 2R0DA 5C5BB 2ELBA 2BCJA 5CLLB 2Z0OA 1UNRA 1DROA 3IVFA 1V5PA 5C79A 3HK0A 3CIKA 2CY4A 3F5RA 2I5CA 1MKEA 2DTCA 4YONA 2ELAA 2L1CA 3N7CA 5GOWB 2DA0A 5DHAB 3ODWA 2RSGA 2P0HA 4HAWB 1X11A 4BBKA 1PMSA 1GG3A 1Y19B 4F7UP 2HE7A 4KAXB 4CHMA 1U5DA 2YT0A 2YRYA 2J0MA 5DIFB 5EFXA 2M38A 5JLJB 2YVCA 2FJLA 4P7IA 3M1IB 1P3RA 3SV1A 1I7AA 2LKOA 4HB0B 1MPHA 3X23A 1AQCA 2Y8FA 2X18A 3SUZA 3HW2B 1FOEA 1Q67A 1MIZB 1MAIA 1NTVA 3D8FA 5FI1A 2P0FA 1P6SA 5C16A 2UVMA 1M7EA 1I2HA 2QKLA 1N3HA 1QC6A 3SNHA 1KI1B 3PSCA 4IAPA 2YS3A 5D3YA 4KHAA 2Q13A 2LOXA 2P8VA 4C0AA 3PP2A 2MWNB 1K5DB 3BINA 4YL8A 5J3TA 4GXBA 1GC6A 3FM8C 2LG1A 3ODXA 2ROZB 4PNKA 2Y7BA 3ZVRA 1XKEA 2NZ8B 5JP4A 3O96A 2Z0PA 2M14A 1E5WA 1DDMA 2W2XD 1UPRA 1B55A 4HB3B 2ZPYA 3T06A 3PG7A 2EMSA 2YT1A 1LB1A 1U5EA 4WSFA 2N0YA 1PLSA 2EMTA 1K5GB 1SHCA 1BTKA 1SGHA 2CODA 5KCVA 1UNQA 1TQZA 1U29A 1UNPA 4WVFB 1XCGA 2NMBA 2E2XA 3DXEA 2D11A 2D9VA 1TJ6A 5J3YA 2PZ1A 2CRFA 4L6EA 4IOYX 2H7EA 1ZC3B 4HAZB 1EAZA 3VOQA 5C6RA 5JHGA 2UZRA 4CHJA 1U2BA 3AU5A 1Z87A 1V88A 2V76A 3ML4A 1NTYA 3G9WA 2CY5A 3KY9A 2YSZA 2RNRB 3PVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6F B;  4GZU A;  1W1H A;  3KZ1 A;  2MDX A;  2GJY A;  2P0D A;  1U27 A;  4EJN A;  2GCL A;  4KHB B;  2MFQ A;  3WYF B;  1U5F A;  3U8Z A;  4HB2 B;  1ISN A;  4A5K A;  3V5W A;  2ADZ A;  2DKQ A;  2COA A;  2COC A;  1WI1 A;  2HTH B;  3P7Z A;  4GN1 A;  4HAV B;  3TW1 A;  2IFS A;  2J0J A;  2DX5 A;  4HAU B;  1MK9 B;  2L2I A;  4F7H A;  1V61 A;  4ZRJ A;  5LON B;  4A6H A;  1RRP B;  1WVH A;  2DLW A;  1J0W A;  1UEF A;  2N23 A;  5DI9 B;  3QIJ A;  4F7G A;  2J0K A;  2KGX B;  5DHF B;  2OQB A;  1V89 A;  1FHW A;  4DX8 A;  3F0W A;  3PVU A;  5D3V A;  2I5F A;  1OY2 A;  3P6A A;  1M7R A;  3CXB B;  2D2Q A;  4KHO A;  4PQ0 A;  4ZRK A;  2D4Q A;  2DX1 A;  1DDV A;  1Y5O A;  3OAN A;  1XD4 A;  4K81 A;  2AL6 A;  3GYP A;  2Y8G A;  1ZC4 B;  2D9W A;  2DHI A;  1GC7 A;  1FHO A;  2D9Z A;  1DBH A;  2W2X C;  2VKI A;  1X1G A;  1UPQ A;  3A98 B;  4Z2N A;  4NY0 A;  3HQC A;  3UZT A;  2R09 A;  2AEH A;  3D8D A;  2K00 A;  1QQG A;  3TFM A;  2G35 A;  2RGN B;  5D27 A;  3LJU X;  1P5T A;  1OQN A;  1ZSQ A;  1XOD A;  3PVL A;  4CYE A;  4HDQ A;  3NSU A;  4GMV A;  2KUP A;  2QKM A;  5C5B A;  1WJM A;  1X86 A;  1FGY A;  1H4R A;  3DXD A;  3BJI A;  2DYN A;  1KZ7 A;  2I1J A;  4K17 A;  2H7D A;  1V5U A;  3VIA A;  1IRS A;  4B6H A;  1FGZ A;  5CLQ B;  2GS0 A;  5HE3 A;  1W1G A;  4DX9 0;  1DYN A;  4DXA B;  1LW3 A;  2VRW B;  2XQN M;  1NI2 A;  1WJ1 A;  4WJ7 A;  3FSS A;  4HAY B;  2EJ8 A;  3ULC A;  3KSY A;  2UZS A;  3TO1 A;  1PFJ A;  3TCA A;  1TXD A;  3PZD A;  5D3X A;  2DFK A;  2DHJ A;  2OTX A;  3U7D A;  1RJ2 A;  3TVV A;  1EGX A;  2ROV A;  4TKN A;  3ODO A;  3PEG A;  2D10 A;  2J59 M;  4Y94 A;  3WA0 A;  4DBB A;  1DDW A;  3FEH A;  2I1K A;  1X1F A;  1BTN A;  1XX0 A;  1WGU A;  1ZVR A;  1NU2 A;  5KQ4 A;  3A8P A;  4GMX B;  4HAX B;  2EC1 A;  4HDO A;  2D9X A;  1AWE A;  4H8S A;  3AU4 A;  3MDB C;  1H10 A;  1OMW A;  2KCJ A;  4EMO A;  5J3Q A;  2DYQ A;  2YS5 A;  4HB4 B;  1BAK A;  2RVB B;  4XWX A;  3GYO A;  4ZRI A;  1X05 A;  1FHX A;  5HE1 A;  5L81 A;  3A8Q A;  2COF A;  4Z2M B;  2LOZ A;  3DXC A;  1FB8 A;  3ULB A;  1WG7 A;  2GCJ A;  3MPX A;  3D8E A;  4A6K A;  2RUK B;  3QBV B;  1EVH A;  4MY6 A;  1WGQ A;  5JHH A;  3QWM A;  4KVG B;  3SO6 A;  4IFS A;  3KRX A;  5FI0 A;  5DH9 B;  4K2O A;  2K2J A;  5LOP B;  1KZG A;  5HE0 A;  3ZDT A;  1MK7 B;  1MIX A;  2DN6 A;  2JP2 A;  2W2W A;  2K2U A;  1ZM0 A;  4K2P A;  3AJ4 A;  2MKR A;  2Z0Q A;  2IYB A;  1U5G A;  2VSZ A;  4HAT B;  1BWN A;  2DKP A;  4MT7 A;  3SYX A;  4TYZ A;  2RLO A;  5HE2 A;  4HHV A;  4A6F A;  2D9Y A;  4GPT B;  4NSW A;  5D3W A;  5KQ1 A;  4MK0 A;  3RCP A;  4EKU A;  1EF1 A;  1XR0 B;  2YS1 A;  2LYD A;  2DHK A;  2CAY A;  2LUL A;  3KRW A;  1V5M A;  1W1D A;  4D0N B;  2YF0 A;  1FAO A;  1J19 A;  2R0D A;  5C5B B;  2ELB A;  2BCJ A;  5CLL B;  2Z0O A;  1UNR A;  1DRO A;  3IVF A;  1V5P A;  5C79 A;  3HK0 A;  3CIK A;  2CY4 A;  3F5R A;  2I5C A;  1MKE A;  2DTC A;  4YON A;  2ELA A;  2L1C A;  3N7C A;  5GOW B;  2DA0 A;  5DHA B;  3ODW A;  2RSG A;  2P0H A;  4HAW B;  1X11 A;  4BBK A;  1PMS A;  1GG3 A;  1Y19 B;  4F7U P;  2HE7 A;  4KAX B;  4CHM A;  1U5D A;  2YT0 A;  2YRY A;  2J0M A;  5DIF B;  5EFX A;  2M38 A;  5JLJ B;  2YVC A;  2FJL A;  4P7I A;  3M1I B;  1P3R A;  3SV1 A;  1I7A A;  2LKO A;  4HB0 B;  1MPH A;  3X23 A;  1AQC A;  2Y8F A;  2X18 A;  3SUZ A;  3HW2 B;  1FOE A;  1Q67 A;  1MIZ B;  1MAI A;  1NTV A;  3D8F A;  5FI1 A;  2P0F A;  1P6S A;  5C16 A;  2UVM A;  1M7E A;  1I2H A;  2QKL A;  1N3H A;  1QC6 A;  3SNH A;  1KI1 B;  3PSC A;  4IAP A;  2YS3 A;  5D3Y A;  4KHA A;  2Q13 A;  2LOX A;  2P8V A;  4C0A A;  3PP2 A;  2MWN B;  1K5D B;  3BIN A;  4YL8 A;  5J3T A;  4GXB A;  1GC6 A;  3FM8 C;  2LG1 A;  3ODX A;  2ROZ B;  4PNK A;  2Y7B A;  3ZVR A;  1XKE A;  2NZ8 B;  5JP4 A;  3O96 A;  2Z0P A;  2M14 A;  1E5W A;  1DDM A;  2W2X D;  1UPR A;  1B55 A;  4HB3 B;  2ZPY A;  3T06 A;  3PG7 A;  2EMS A;  2YT1 A;  1LB1 A;  1U5E A;  4WSF A;  2N0Y A;  1PLS A;  2EMT A;  1K5G B;  1SHC A;  1BTK A;  1SGH A;  2COD A;  5KCV A;  1UNQ A;  1TQZ A;  1U29 A;  1UNP A;  4WVF B;  1XCG A;  2NMB A;  2E2X A;  3DXE A;  2D11 A;  2D9V A;  1TJ6 A;  5J3Y A;  2PZ1 A;  2CRF A;  4L6E A;  4IOY X;  2H7E A;  1ZC3 B;  4HAZ B;  1EAZ A;  3VOQ A;  5C6R A;  5JHG A;  2UZR A;  4CHJ A;  1U2B A;  3AU5 A;  1Z87 A;  1V88 A;  2V76 A;  3ML4 A;  1NTY A;  3G9W A;  2CY5 A;  3KY9 A;  2YSZ A;  2RNR B;  3PVW A; 
#chains in the Genus database with same CATH topology
 5I2M A;  5I2S A;  4A6F B;  4GZU A;  1W1H A;  3KZ1 A;  2MDX A;  2GJY A;  2P0D A;  1U27 A;  4EJN A;  2GCL A;  4KHB B;  2MFQ A;  3WYF B;  1U5F A;  3U8Z A;  4HB2 B;  2Z59 A;  1ISN A;  4A5K A;  3V5W A;  2ADZ A;  2DKQ A;  2Z13 A;  2COA A;  2COC A;  1WI1 A;  2HTH B;  3P7Z A;  4GN1 A;  4HAV B;  3TW1 A;  2IFS A;  2J0J A;  2DX5 A;  4QJ4 B;  4HAU B;  1MK9 B;  2L2I A;  4F7H A;  1V61 A;  4ZRJ A;  4GNK B;  5LON B;  4A6H A;  1RRP B;  1WVH A;  2DLW A;  1J0W A;  1UEF A;  2N23 A;  5DI9 B;  3QIJ A;  4F7G A;  2J0K A;  2KGX B;  5DHF B;  2OQB A;  1V89 A;  1FHW A;  4DX8 A;  3F0W A;  3PVU A;  5D3V A;  2I5F A;  1OY2 A;  3P6A A;  1M7R A;  3CXB B;  2D2Q A;  4KHO A;  4PQ0 A;  4ZRK A;  2D4Q A;  2DX1 A;  1DDV A;  1Y5O A;  3OAN A;  1XD4 A;  4K81 A;  2AL6 A;  3GYP A;  2Y8G A;  1ZC4 B;  2D9W A;  3B77 A;  2DHI A;  1GC7 A;  1FHO A;  2D9Z A;  1DBH A;  3OHM B;  2W2X C;  2VKI A;  1X1G A;  1UPQ A;  3A98 B;  4Z2N A;  4NY0 A;  3HQC A;  3UZT A;  2R09 A;  2AEH A;  3D8D A;  2K00 A;  1QQG A;  2K8E A;  3TFM A;  2G35 A;  2RGN B;  2FJU B;  5D27 A;  3LJU X;  1P5T A;  1OQN A;  1ZSQ A;  1XOD A;  3PVL A;  4CYE A;  4HDQ A;  3NSU A;  4GMV A;  2KUP A;  2QKM A;  5C5B A;  1WJM A;  1X86 A;  1FGY A;  1H4R A;  3DXD A;  3BJI A;  2DYN A;  2KUQ A;  1KZ7 A;  2I1J A;  4K17 A;  2H7D A;  1V5U A;  3VIA A;  1IRS A;  4B6H A;  1FGZ A;  5CLQ B;  2KR0 A;  2GS0 A;  5HE3 A;  1W1G A;  4DX9 0;  1DYN A;  4DXA B;  1LW3 A;  2VRW B;  2XQN M;  3HIE A;  1NI2 A;  1WJ1 A;  4WJ7 A;  3FSS A;  4D6W A;  4HAY B;  2EJ8 A;  3ULC A;  2R2Y A;  3KSY A;  2UZS A;  3TO1 A;  1PFJ A;  3TCA A;  3NWA A;  3A58 A;  1TXD A;  3PZD A;  5D3X A;  2DFK A;  2DHJ A;  2OTX A;  3U7D A;  5LG4 B;  1RJ2 A;  3TVV A;  4OT1 A;  1EGX A;  2ROV A;  4TKN A;  3FVC A;  3ODO A;  3PEG A;  2D10 A;  2J59 M;  4Y94 A;  3WA0 A;  4DBB A;  3U12 A;  1DDW A;  3FEH A;  3NWD A;  2I1K A;  1X1F A;  1BTN A;  1XX0 A;  1WGU A;  1ZVR A;  2YT2 A;  1NU2 A;  5KQ4 A;  3A8P A;  4GMX B;  4HAX B;  2EC1 A;  2GUM A;  2K49 A;  4HDO A;  2D9X A;  1AWE A;  4H8S A;  3AU4 A;  3MDB C;  1H10 A;  1OMW A;  2KCJ A;  4EMO A;  5J3Q A;  2DYQ A;  2YS5 A;  4HB4 B;  1BAK A;  2RVB B;  4XWX A;  3GYO A;  4ZRI A;  1X05 A;  1FHX A;  5HE1 A;  5L81 A;  3A8Q A;  2COF A;  3NWF A;  4Z2M B;  2LOZ A;  3DXC A;  1FB8 A;  3ULB A;  1WG7 A;  2GCJ A;  3MPX A;  1T77 A;  3D8E A;  4A6K A;  2RUK B;  3QBV B;  1EVH A;  4MY6 A;  1WGQ A;  5JHH A;  3QWM A;  4KVG B;  3SO6 A;  4DIX A;  4IFS A;  3KRX A;  5FI0 A;  5DH9 B;  4K2O A;  2K2J A;  5LOP B;  1KZG A;  4HSI A;  5HE0 A;  3ZDT A;  1MK7 B;  1MIX A;  2NBV A;  2DN6 A;  2JP2 A;  2W2W A;  2K2U A;  1ZM0 A;  4K2P A;  3AJ4 A;  2MKR A;  2Z0Q A;  2IYB A;  1U5G A;  2VSZ A;  4HAT B;  1ZYI A;  1BWN A;  2DKP A;  4MT7 A;  3SYX A;  4TYZ A;  2RLO A;  5HE2 A;  4HHV A;  4A6F A;  2D9Y A;  4GPT B;  4NSW A;  5D3W A;  4KHB A;  5KQ1 A;  4MK0 A;  2ZKM X;  3RCP A;  4EKU A;  1EF1 A;  1XR0 B;  2YS1 A;  2LYD A;  4GOU A;  2DHK A;  2CAY A;  2LUL A;  3KRW A;  1V5M A;  4OSN A;  1W1D A;  4D0N B;  2YF0 A;  1FAO A;  2RRF A;  1J19 A;  2R0D A;  5C5B B;  2ELB A;  2BCJ A;  5CLL B;  2Z0O A;  1UNR A;  1DRO A;  3IVF A;  1V5P A;  3DCX A;  5M4Y B;  5C79 A;  3HK0 A;  3CIK A;  4CSQ A;  2CY4 A;  3F5R A;  2I5C A;  1MKE A;  2DTC A;  4YON A;  2ELA A;  2L1C A;  3N7C A;  5GOW B;  2DA0 A;  5DHA B;  3ODW A;  2RSG A;  2P0H A;  4HAW B;  1X11 A;  3HSA A;  1PMS A;  4BBK A;  1GG3 A;  1Y19 B;  4F7U P;  2HE7 A;  4KAX B;  4CHM A;  4QJ5 B;  1U5D A;  2YT0 A;  2YRY A;  2J0M A;  5DIF B;  5EFX A;  2M38 A;  5JLJ B;  2YVC A;  2FJL A;  4P7I A;  3M1I B;  1P3R A;  3SV1 A;  1I7A A;  4L1R A;  2LKO A;  4HB0 B;  1MPH A;  3X23 A;  1AQC A;  2Y8F A;  2X18 A;  3SUZ A;  3HW2 B;  1FOE A;  1Q67 A;  1MIZ B;  1MAI A;  1NTV A;  3D8F A;  5FI1 A;  2P0F A;  1P6S A;  5C16 A;  2UVM A;  1M7E A;  1I2H A;  2QKL A;  1N3H A;  1QC6 A;  3SNH A;  1KI1 B;  5IRS A;  3PSC A;  4QXA B;  1MI1 A;  4IAP A;  2YS3 A;  5D3Y A;  4KHA A;  2Q13 A;  2LOX A;  2P8V A;  4C0A A;  3PP2 A;  2MWN B;  1K5D B;  3BIN A;  4QJ3 B;  4YL8 A;  5J3T A;  4GXB A;  1GC6 A;  2Z14 A;  3FM8 C;  2LG1 A;  3ODX A;  2ROZ B;  4PNK A;  2Y7B A;  3ZVR A;  1XKE A;  2NZ8 B;  5JP4 A;  3O96 A;  2Z0P A;  2M14 A;  1E5W A;  1DDM A;  2W2X D;  1UPR A;  1B55 A;  4HB3 B;  2KIG A;  2ZPY A;  3T06 A;  3PG7 A;  2EMS A;  2YT1 A;  1LB1 A;  3NW8 A;  1U5E A;  4WSF A;  2N0Y A;  1PLS A;  2EMT A;  1K5G B;  1SHC A;  1BTK A;  1SGH A;  2COD A;  5KCV A;  1UNQ A;  1TQZ A;  1U29 A;  1UNP A;  4WVF B;  1XCG A;  2NMB A;  2E2X A;  3DXE A;  2D11 A;  2D9V A;  1TJ6 A;  5J3Y A;  2PZ1 A;  2CRF A;  4L6E A;  4IOY X;  2H7E A;  1ZC3 B;  2KIE A;  4HAZ B;  1EAZ A;  3VOQ A;  5C6R A;  5JHG A;  2UZR A;  4CHJ A;  1U2B A;  3AU5 A;  1Z87 A;  1V88 A;  2V76 A;  3ML4 A;  1NTY A;  3G9W A;  2CY5 A;  3KY9 A;  2YSZ A;  2RNR B;  3PVW A;  2Z4D A; 
#chains in the Genus database with same CATH homology
 4A6F B;  4GZU A;  1W1H A;  3KZ1 A;  2MDX A;  2GJY A;  2P0D A;  1U27 A;  4EJN A;  2GCL A;  4KHB B;  2MFQ A;  3WYF B;  1U5F A;  3U8Z A;  4HB2 B;  1ISN A;  4A5K A;  3V5W A;  2ADZ A;  2DKQ A;  2COA A;  2COC A;  1WI1 A;  2HTH B;  3P7Z A;  4GN1 A;  4HAV B;  3TW1 A;  2IFS A;  2J0J A;  2DX5 A;  4HAU B;  1MK9 B;  2L2I A;  4F7H A;  1V61 A;  4ZRJ A;  5LON B;  4A6H A;  1RRP B;  1WVH A;  2DLW A;  1J0W A;  1UEF A;  2N23 A;  5DI9 B;  3QIJ A;  4F7G A;  2J0K A;  2KGX B;  5DHF B;  2OQB A;  1V89 A;  1FHW A;  4DX8 A;  3F0W A;  3PVU A;  5D3V A;  2I5F A;  1OY2 A;  3P6A A;  1M7R A;  3CXB B;  2D2Q A;  4KHO A;  4PQ0 A;  4ZRK A;  2D4Q A;  2DX1 A;  1DDV A;  1Y5O A;  3OAN A;  1XD4 A;  4K81 A;  2AL6 A;  3GYP A;  2Y8G A;  1ZC4 B;  2D9W A;  2DHI A;  1GC7 A;  1FHO A;  2D9Z A;  1DBH A;  2W2X C;  2VKI A;  1X1G A;  1UPQ A;  3A98 B;  4Z2N A;  4NY0 A;  3HQC A;  3UZT A;  2R09 A;  2AEH A;  3D8D A;  2K00 A;  1QQG A;  3TFM A;  2G35 A;  2RGN B;  5D27 A;  3LJU X;  1P5T A;  1OQN A;  1ZSQ A;  1XOD A;  3PVL A;  4CYE A;  4HDQ A;  3NSU A;  4GMV A;  2KUP A;  2QKM A;  5C5B A;  1WJM A;  1X86 A;  1FGY A;  1H4R A;  3DXD A;  3BJI A;  2DYN A;  1KZ7 A;  2I1J A;  4K17 A;  2H7D A;  1V5U A;  3VIA A;  1IRS A;  4B6H A;  1FGZ A;  5CLQ B;  2GS0 A;  5HE3 A;  1W1G A;  4DX9 0;  1DYN A;  4DXA B;  1LW3 A;  2VRW B;  2XQN M;  1NI2 A;  1WJ1 A;  4WJ7 A;  3FSS A;  4HAY B;  2EJ8 A;  3ULC A;  3KSY A;  2UZS A;  3TO1 A;  1PFJ A;  3TCA A;  1TXD A;  3PZD A;  5D3X A;  2DFK A;  2DHJ A;  2OTX A;  3U7D A;  1RJ2 A;  3TVV A;  1EGX A;  2ROV A;  4TKN A;  3ODO A;  3PEG A;  2D10 A;  2J59 M;  4Y94 A;  3WA0 A;  4DBB A;  1DDW A;  3FEH A;  2I1K A;  1X1F A;  1BTN A;  1XX0 A;  1WGU A;  1ZVR A;  1NU2 A;  5KQ4 A;  3A8P A;  4GMX B;  4HAX B;  2EC1 A;  4HDO A;  2D9X A;  1AWE A;  4H8S A;  3AU4 A;  3MDB C;  1H10 A;  1OMW A;  2KCJ A;  4EMO A;  5J3Q A;  2DYQ A;  2YS5 A;  4HB4 B;  1BAK A;  2RVB B;  4XWX A;  3GYO A;  4ZRI A;  1X05 A;  1FHX A;  5HE1 A;  5L81 A;  3A8Q A;  2COF A;  4Z2M B;  2LOZ A;  3DXC A;  1FB8 A;  3ULB A;  1WG7 A;  2GCJ A;  3MPX A;  3D8E A;  4A6K A;  2RUK B;  3QBV B;  1EVH A;  4MY6 A;  1WGQ A;  5JHH A;  3QWM A;  4KVG B;  3SO6 A;  4IFS A;  3KRX A;  5FI0 A;  5DH9 B;  4K2O A;  2K2J A;  5LOP B;  1KZG A;  5HE0 A;  3ZDT A;  1MK7 B;  1MIX A;  2DN6 A;  2JP2 A;  2W2W A;  2K2U A;  1ZM0 A;  4K2P A;  3AJ4 A;  2MKR A;  2Z0Q A;  2IYB A;  1U5G A;  2VSZ A;  4HAT B;  1BWN A;  2DKP A;  4MT7 A;  3SYX A;  4TYZ A;  2RLO A;  5HE2 A;  4HHV A;  4A6F A;  2D9Y A;  4GPT B;  4NSW A;  5D3W A;  5KQ1 A;  4MK0 A;  3RCP A;  4EKU A;  1EF1 A;  1XR0 B;  2YS1 A;  2LYD A;  2DHK A;  2CAY A;  2LUL A;  3KRW A;  1V5M A;  1W1D A;  4D0N B;  2YF0 A;  1FAO A;  1J19 A;  2R0D A;  5C5B B;  2ELB A;  2BCJ A;  5CLL B;  2Z0O A;  1UNR A;  1DRO A;  3IVF A;  1V5P A;  5C79 A;  3HK0 A;  3CIK A;  2CY4 A;  3F5R A;  2I5C A;  1MKE A;  2DTC A;  4YON A;  2ELA A;  2L1C A;  3N7C A;  5GOW B;  2DA0 A;  5DHA B;  3ODW A;  2RSG A;  2P0H A;  4HAW B;  1X11 A;  4BBK A;  1PMS A;  1GG3 A;  1Y19 B;  4F7U P;  2HE7 A;  4KAX B;  4CHM A;  1U5D A;  2YT0 A;  2YRY A;  2J0M A;  5DIF B;  5EFX A;  2M38 A;  5JLJ B;  2YVC A;  2FJL A;  4P7I A;  3M1I B;  1P3R A;  3SV1 A;  1I7A A;  2LKO A;  4HB0 B;  1MPH A;  3X23 A;  1AQC A;  2Y8F A;  2X18 A;  3SUZ A;  3HW2 B;  1FOE A;  1Q67 A;  1MIZ B;  1MAI A;  1NTV A;  3D8F A;  5FI1 A;  2P0F A;  1P6S A;  5C16 A;  2UVM A;  1M7E A;  1I2H A;  2QKL A;  1N3H A;  1QC6 A;  3SNH A;  1KI1 B;  3PSC A;  4IAP A;  2YS3 A;  5D3Y A;  4KHA A;  2Q13 A;  2LOX A;  2P8V A;  4C0A A;  3PP2 A;  2MWN B;  1K5D B;  3BIN A;  4YL8 A;  5J3T A;  4GXB A;  1GC6 A;  3FM8 C;  2LG1 A;  3ODX A;  2ROZ B;  4PNK A;  2Y7B A;  3ZVR A;  1XKE A;  2NZ8 B;  5JP4 A;  3O96 A;  2Z0P A;  2M14 A;  1E5W A;  1DDM A;  2W2X D;  1UPR A;  1B55 A;  4HB3 B;  2ZPY A;  3T06 A;  3PG7 A;  2EMS A;  2YT1 A;  1LB1 A;  1U5E A;  4WSF A;  2N0Y A;  1PLS A;  2EMT A;  1K5G B;  1SHC A;  1BTK A;  1SGH A;  2COD A;  5KCV A;  1UNQ A;  1TQZ A;  1U29 A;  1UNP A;  4WVF B;  1XCG A;  2NMB A;  2E2X A;  3DXE A;  2D11 A;  2D9V A;  1TJ6 A;  5J3Y A;  2PZ1 A;  2CRF A;  4L6E A;  4IOY X;  2H7E A;  1ZC3 B;  4HAZ B;  1EAZ A;  3VOQ A;  5C6R A;  5JHG A;  2UZR A;  4CHJ A;  1U2B A;  3AU5 A;  1Z87 A;  1V88 A;  2V76 A;  3ML4 A;  1NTY A;  3G9W A;  2CY5 A;  3KY9 A;  2YSZ A;  2RNR B;  3PVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...