1PFNA

Pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 16-27 of a 27-model set.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
MSAKELRCQCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF4-M2 CHIMERA
publication title NMR solution structure of the 32-kDa platelet factor 4 ELR-motif N-terminal chimera: a symmetric tetramer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 7
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfnA00
1PFMA 2HCCA 5T1GA 1WD1A 1HFGA 2JYOA 1DOKA 3GV3A 2B2WA 1WTRA 1RHPA 5CBAE 1C8CA 1NR2A 1ICWA 2FJ2A 2HDLA 2RSOA 3I90A 3IFDA 3LWEA 1B4OA 1Q3LA 1WTQA 1O7YA 1KNAA 5EPJA 1RTNA 1ESRA 1M8AA 2KECA 1B3AA 1QG7A 2EOTA 4X3SA 2VXWA 1XX8A 2NWGA 2MGSA 2M2LA 3I91A 4X3TA 5E4XA 1WTWA 1J8IA 1LV9A 2L1BA 1J9OA 1CA6A 1NAPA 1CM9A 1G2TA 3FDTA 4HSVA 2B2VA 2L12A 1BO0A 3D6WA 1QE6A 2HUGA 1AZPA 1HA6A 5D65A 2KVMA 2B2YA 1QNKA 2DY8A 1WTVA 1MI2A 2DY7A 2L11A 1HRJA 4IUUA 2B2TC 2Q8TA 4DN4M 5EPLA 1HUNA 1O7ZA 3KUPA 2N55A 1RTOA 4R9WA 1IKMA 5EQ0A 2KOLA 1MSGA 1MSHA 4HCSA 4X3UA 1BF4A 2B2UC 3KBXA 3ONAB 1B2TA 1VMPA 3H91A 1O80A 2KEEA 2NZ1D 2K03A 2N88A 3MTSA 2K1BA 1ILQA 4O42A 2K01A 3GV6A 2K05A 1DOLA 1EOTA 1EQTA 5T1IA 1JICA 1PFNA 1EIGA 4IUQA 1RODA 5CORA 1WTOA 3I8ZA 4IUTA 1WVLA 1CA5A 1G91A 1E0BA 3UI2A 2NYZD 2RSNA 4QUFA 5EPKA 1IL8A 1PDQA 2EPBA 2FINB 1RJTA 2RA4A 5COYA 1KNEA 3Q6SA 1AZQA 3IL8A 4CJ1B 1WD0A 1ZXTA 3I3CA 3TZDA 1A15A 2X6GA 4OIKA 1BBXC 2JP1A 2X69A 1B53A 2H1EA 1HHVA 2XIWA 3F2UA 2B2TA 1G2SA 3FPUB 4CJ0B 5JJZA 4XT3B 1F9PA 3DM1A 4MHEA 2FMMA 5D14A 1MGSA 4CJ2C 1U4PA 3QO2A 2B2UA 3P7JA 1U4MA 3G7LA 4ZK9B 4R8IA 1XYIA 1SDFA 1B50A 2EE1A 1U4RA 4IUVA 4ZAIA 2KUMA 1PLFA 2SDFA 4IUPA 4QUCA 1DONA 2CVRA 4UAIA 3DEPA 4ZKBB 2Q8RE 1ML0D 1WTXA 1EL0A 3DEOA 4IURA 1HFNA 1SSOA 5E4WC 1HUMA 2J7ZA 2B2WC 1BNZA 2K28A 2MPMA 1F9QA 3HP3A 1X3QA 5CMDA 2MJ8A 5EKIA 5CBEE 1IKLA 1NR4A 1SAPA 1X3PA 2KEDA 2FFKB 1EIHA 1F9SA 1JE4A 1DZ1A 2IL8A 2L9HA 4HAEA 4RWSC 3TN2A 1WTPA 1AP0A 1GUWA 1VMCA 2RVLA 4OIJA 1F2LA 2HDMA 1TVXA 2B2VC 2L4NA 3MWYW 4MN3A 5EJWA 2BDNA 1ILPA 2B2YC 4XDXA 3R93A 4ZLTF 1S4ZA 1U4LA 4X3KA 3SVMA 1PFBA 4RAUC 5AFWA 2HCIA 5DNFA 1DOMA 2FHTA 2R3ZA 2X6LA 4RA8A 1F9RA 4NW2A 2MP1A 4ZKCB 1NCVA 4LMQD 4XT1B 2K04A 4U68A 1G6ZA 1X32A 2D9UA 4HEDA 3N52A
chains in the Genus database with same CATH superfamily
1PFMA 3RN5A 1PZID 3KYHC 4YY3Q 2I5HA 5CC4A 1A2TA 1KTKA 3HOUB 4BY1B 3M3YH 2KCCA 1WTQA 3GTQB 3FKIG 1RKNA 3S2DB 1B3AA 1O7IA 1STEA 1N33L 1CQVA 3CW2C 4YCUA 3FDTA 2GVAA 2B2VA 4WJWA 4LFAQ 5L37A 2XN9C 2PPBC 5BN3A 1PXUA 4IPGA 1LT6D 4POFA 1JCKB 3AQQA 4NMZA 1XNQQ 3J80L 2R93H 1Q1EA 2F3VA 1DD2A 3DWQA 1TWHH 3VYSA 2UUCL 1MSHA 4HCSA 3GTMH 2BH8A 1Q90A 1VMPA 1BCPC 3H91A 1KABA 2K03A 2N88A 1A3VA 5J3BA 3GV6A 4FF2A 4JYAQ 3WOEA 2E2IB 3I8ZA 1CHQD 2NVXB 2XWBB 2A6ED 1QCBD 1YEZA 3KFUA 4J8QA 1HNZL 2B39A 5A2QL 3R3OA 4IOAA 5C3XA 2KHSA 2CW0D 5I6WA 2K32A 1BBXC 4LUOA 3J81c 4CJ0B 1EYCA 3GP7A 3URYA 5LHY1 4HR7B 2FMMA 3P75A 1F77A 3SK6A 2PMZB 5C44G 1U4MA 3C46A 4DV7Q 4LF4L 2VUMB 1KLUD 1QILA 4KI0A 2QGQA 3DEPA 5C3EB 1IBMQ 3PO3G 1EIFA 4G7OC 2VNUD 1SN8A 2M00A 2Q2UA 3Q22A 3DLLA 4OX9L 1X3PA 2ZJQA 3GTGH 3D4RA 3J81L 4B3RL 4LFBL 2EXDA 4HAEA 3TN2A 1EU3A 1I4XA 4OO1G 2VW9A 3OIPA 4MN3A 2HT1A 3KDFB 1M4VA 4K5XA 4A3GH 4I65A 3HOXG 1HQMC 3HFZB 2FHTA 3S24A 3CHBD 3BVMA 3E6ZX 4BA1I 4BS9A 3K5NA 4JVZA 4FXDA 3IRBA 4U68A 3SK8A 1S40A 1GUGA 4DR5L 2DNEA 2JA7H 3W2DA 1F2ZA 3RD4A 2AMCB 4DXFA 3DUZA 2L12A 2C35B 3M3YB 2RQXA 4N9PA 5BN5A 3S2HH 4PMCA 4JI4Q 1LTGD 1BKBA 4DR4Q 4DR6Q 1TWAH 1SE3A 3PUZA 3KUPA 1IKMA 4F87A 1NY4A 1LTRD 4RMFA 2AQ2B 4TQUS 3MEHA 1SYDA 2R93B 3NBHB 3A8JE 4QY7A 2EY5A 1TWHB 4IUQA 3ITPA 3GTMB 3CCUA 4HJAA 2E75C 4UPAA 2AUKA 4A3KB 4NXNQ 1WFQA 2I0QA 2JXMB 3OTOQ 1TKWB 1E24A 1VQAA 1SNDA 2ATWA 2JP1A 1I4QA 1TY0A 2A19A 1SJHD 1WYDA 5I2YA 3O13A 3T4AC 3QO2A 5KIXA 3H09A 4R8IA 2ICIA 2VQFL 3MXNB 1XXGA 3H0GH 5IIFA 2SDFA 1Y8OB 4NPSA 4DV4L 1OTCA 1IBKQ 1HUMA 3A8KE 1ASYA 2UXBQ 3NPPA 3I7FA 3G71A 2Y0SG 3NBIA 4S3SA 2ZT9C 5CMDA 2MJ8A 2PQAA 4XQQA 3HRZC 2BH2A 1KD1C 1V1QA 2RDHA 4JI8Q 1V8QA 4BXXH 1S72A 1FD7D 1VMCA 2ICEC 4A3FG 5LMNL 1K8GA 3SEBA 3GTGB 4XDXA 5C4XG 4X3KA 3STBD 1X9NA 4B3TL 4ZUIA 5DNFA 4NXML 5FLMG 1VF7A 2VZAA 4RHSA 4A3GB 5T1GA 4DV1Q 4DAPA 2B2WA 3H94A 2R7ZH 3HOWH 1OXVA 3I90A 4LUVA 1LTSD 1WJJA 2Q2HA 4HSPA 5CYUA 5KRUA 1EFWA 4WJ3M 2M2LA 2BA1A 4X3TA 1C9OA 1SJED 3BJUA 4A76A 2JA7B 1JOKA 1QE6A 2XVSA 4DV0Q 2UUBQ 2HUGA 2JA8H 4L5QA 1X3EA 4K5WA 5A2QE 4LF5L 1DM0B 3HOYG 4GKJQ 4LF8Q 1STYA 4BY7H 1CTMA 5AJ3L 3S2HB 1HQRD 2K5HA 3GTKH 1ILQA 4LF9L 1TWAB 4HIMA 3E9IA 4DUYQ 3S1RH 2MHVA 4JI0Q 4IPCA 4ZCKA 1CT1D 1TR5A 2CH4A 1KC8C 4P75A 1IYVA 4DV5L 4C3IH 1BBUA 1A15A 4PQXA 2XIWA 2EJMA 5KNBA 3J81E 4QL5A 1SE2A 1Q1BA 1Q81C 4UHVA 3V05A 3OW2A 2F03A 4HN7A 1XPOA 4RFBA 2KUMA 2AQ1B 4EX5A 1E2WA 4UAIA 1EYDA 5M3FG 1CI3M 3DEOA 4R4TA 1GJXA 1N8RC 5C4ZA 1VQPA 2MPMA 3H0GB 1EWCA 1J5EL 5M5XB 4DR1Q 3JAMc 4B3SQ 1HNXL 2R7ZG 1ZKOA 4C1NK 4NKLA 4XYOA 4POGA 1ILPA 1SEBD 3SVMA 2EYMA 3EA6A 4WORA 4P74A 4A3BH 1DOMA 2YTYA 3KLRA 4RA8A 4UY8C 4A3IB 4HEDA 3NUCA 3VYUA 1CKNB 5GAEC 3RN2A 3AFQA 3J7A5 3D0FA 4LF6Q 3MC0B 3GV3A 3JAML 3SR1A 3K58A 2NVYH 2F4VL 4A3DB 3UDGA 1HH2P 2JN4A 2Q2IA 2ZM6Q 4PZ8A 1JMCA 2JJQA 4LK1C 5E4XA 3I73A 4DR7Q 1J6QA 1SFOH 3TDQA 3CCMA 1HA5A 1JWUD 5A35A 2OCEA 3LWUA 4IFDI 1HA6A 5EAYA 5D65A 4IPDA 2JA5H 3R8BA 1B9NA 4GS3A 1G6PA 3S15H 5JEAH 5EQ0A 1YNJC 2PYKA 3FPPA 1K9MC 1AEXA 1IYUA 4JOIC 4C3HH 2JA8B 2TMPA 5LMUL 1I94L 4E6IA 4G7HC 1M1KC 4LF7Q 1N34Q 4QCLA 4PG3A 5ELFA 4A3LH 4TVAB 5E7NA 1V1OA 1PMRA 1PRTB 3GTKB 1EY0A 1EY9A 3PF5A 3KBGA 3HOVH 1PYBA 2R61A 1WTHA 1L0WA 1AE2A 4C1NI 3S1RB 1LTLA 4RGMA 1B53A 4ZRZA 3K8AA 4XYQA 3MXUA 4XQJA 4XT3B 1F9PA 5D14A 2PMZE 5K36H 3ULPA 4DAMA 3G7LA 5EKKA 1AW7A 4DPGA 1TWGB 4ZAIA 3BS1A 1DONA 1Q82C 2QCPX 2OQ0A 1MD2D 3AU7A 3S1MH 1AFPA 1QZGA 3TQYA 2DJFC 1G8ZD 3NHHA 2ZXOA 3OIQA 1HZAA 1Y8PB 2ALYB 3FVQA 1F9QA 2NN6H 1II3A 4BBRG 1HZCA 1RF2D 3D4WA 4N8X1 3OYYA 2E2DC 4BBSH 1SR3A 1Q86C 3A7AB 3VA5A 4OIJA 1IBLL 3ER0A 1L0XB 4N9TA 1JJCB 2K50A 1W6KA 3A8IE 1RDPD 3BZKA 1XMOL 2CFMA 1UNSA 3CCJA 1QVGA 3OMCA 3ND8A 1STBA 4DAVA 2QKIC 2ENBA 3KLWA 1EEID 4JK1C 4JV5Q 1C4QA 4IQZA 3IAYA 1D7QA 1WD1A 2EDGA 2PW5A 1VQNA 1TY2A 4A3BB 1RHPA 2MFIA 5M5WB 3M4YA 1UWVA 2KECA 4L5SA 1CA6A 2NVYB 3P20A 1K83H 1X3FA 1QUQB 2F0TA 4IFDG 1Y1VG 1QNKA 1KIXA 1T5EA 1E1TA 5I9OA 1EFID 5LMNW 1N36L 4R4IA 4HMIA 1JT8A 3KBXA 2D0PA 1B2TA 2BOSA 2KJXA 3KF6B 1O80A 2JA5B 2K1BA 3QOJA 2MO1A 1S5FD 5CV8A 1DOLA 2NUCA 3S15B 1I50H 4HIDA 4CHTB 5CORA 4JI2L 1YI2A 1U9RA 1YNJD 2F0GA 4ME5A 1D5ZC 4C3HB 1E2VA 1LTTD 2NTSA 4GN5A 1AN8A 2E2HB 1EU4A 4EQPA 1WCMG 5M3MG 1PA6A 5JPNC 1VCIA 3UE0A 4B3MQ 4DAYB 3K5OA 5JJZA 4Z9CB 3HOVB 4MHEA 2G5DA 3C2PA 4CDCC 1UE5A 3CF5A 2Z8LA 1V9PA 4IUVA 2R92G 2CW0C 4L63B 2GVBA 1SYFA 5C3WA 4A3EB 1TS2A 4FXKC 5JJLA 3VR2A 3ULJA 1WOCA 2DNCA 3H3VH 1SMYD 3J7AF 2JQOA 2JK8A 1GVPA 1K8MA 2K33A 3JAME 4DK1A 3KLSA 1GHJA 3DXJC 5C3EH 4QB4A 1R4QB 3GTOB 2BDNA 4N8FA 2YV5A 5KEEA 1S4ZA 3PQIA 4BBSB 2J0TD 5AFWA 4EGVA 1H95A 3CRKC 3ULLA 3K6OA 1UE1A 1CUKA 2MQHA 3GDEA 3HOUG 4JBWA 2A73B 4A3CG 1D6EC 1CQFA 4BY1G 3OPOA 4NP5A 5E1FA 4K0KQ 1JORA 1XNRL 1DOKA 1EY7A 4CKEA 2A1AA 4AQYL 3G6EA 4M8AA 4X65Q 1EYAA 1TS5A 3GO5A 1AE3A 4QQBX 3CCSA 4MZ9A 5D3IB 2CCZA 3PUWA 1G2TA 4RKLA 2A5HA 4XQNA 1KL9A 2B8GA 4JI6Q 1QZHA 1IL2A 4EVOA 2EXZA 1VQHA 2F0UA 3RLOA 1MIUA 1H9RA 3NE5B 4YY3L 4DF7A 5LL6X 3AFPA 4R9WA 2NBFA 2BCOA 1A2UA 4GOPC 3NQIA 1K83B 2MNAA 2OT2A 2WIIB 3WOFA 2F0FA 4IJHA 5M5YB 5C5MA 3L7ZC 3I4MG 4JI1L 3U9SA 4FVMA 4KLKA 1EIGA 5JJKA 4LFAL 4IUTA 3S17H 2F3WA 1JWSD 2HHHQ 2K52A 2N8NA 3E0EA 5EPKA 5DAUA 1BR9A 1UE7A 2RCFA 2SNMA 3PO2H 1H9JA 1I50B 3IL8A 1STNA 5C0XH 3J80i 3MFYA 1CZGA 5J1ZA 4JYAL 4L8JA 4A3KH 3T56B 2VUMG 1RD9D 4A3MH 2EY1A 2K75A 1L1OB 1EIYB 5G3LF 4IUPA 4QF4A 1B70B 1VQIA 4JCVE 3E3XA 1SE4A 4V0BA 2CHBD 2XNAC 1BNZA 3AEVA 2KEDA 1JE5A 3T13A 4QJFA 4DV7L 4Q0FA 1ENFA 2SOBA 1TVXA 2QW7A 4YWMA 4JI5Q 2BE5D 2B2YC 5IYDH 5IYBH 3K5LA 4DR3Q 2RDGA 1EWIA 2OQKA 3M4OB 4GZYC 3LX0A 1X54A 4LMQD 3NELA 3NWSA 4K2LA 1DYQA 1SLJA 4TKOB 3I4OA 4NB3A 4H02A 3STBC 1NR2A 2RSOA 2HDLA 1Z7TA 1XWEA 3J81i 1EZ8A 1ESRA 1HXYD 4X3SA 1UAPA 1NNXA 2I46A 1CKMA 4LFCL 3TSSA 2XRQD 1MBYA 2AUJD 2OEOA 4YHHQ 1OXTA 5IYCH 1W3SA 5C5LA 4RGNA 5KNDA 3K7AB 3AMUA 1SE8A 5GADC 1HRJA 2B2TC 2PNRC 1HUNA 1MSGA 2R93G 2B2UC 2RBMA 1CFMA 4DV2Q 2WP8J 4HIOA 1GUNA 1I3QB 1PH2A 1EY5A 3NP8A 2JA6H 3OMGA 4IZ8A 4G4KA 4JI4L 1LM0A 5C44B 1SNPA 4DR4L 2RSNA 4AH6A 2PI2A 1PDQA 3LGJA 1U0LA 2F0WA 1LABA 1KNEA 1LT3D 2A69C 2EIFA 1TWFB 4RHRA 4A93H 5KNCA 3S17B 4P73A 2IWHA 5IP7H 3EIVA 2X69A 5GAGC 3GTLH 4JBKA 1UEBA 5CR3A 2LY7A 5TSSA 3DM1A 1GM5A 3PO2B 3WDNA 1VF5C 4CJ2C 3I4LA 4KY5A 3EFXD 2Q2TA 4JOIA 2WFWA 1U4RA 4NXNL 4J1MA 4GLAC 1OXSC 3NSWA 1HCZA 3RMHA 2TSSA 4L6TB 3FRPB 5E4WC 4A3MB 4Y52H 4QIWB 2K28A 3PCOB 4OWXB 3GD7A 3HOXB 2ES2A 5CBEE 1SAPA 3PIO3 1V43A 1H9SB 2FFKB 3SK5A 1AP0A 5IWAQ 2D2CC 2I07B 5IGEA 3TP6A 3UE1A 2QEXA 2ZXRA 4KKUA 1U4LA 5C4JH 4RG1A 1OO9B 1PFBA 1TWCH 2F0VA 5M5XH 4A3GG 4KK7A 2L55A 3EVQA 3D31A 4R4QA 4IN3A 5M9OA 2NVTB 2K04A 1VQGA 4JI8L 1GUOA 1VQCA 3A5UA 2L5TA 2JYOA 1WTRA 1LTBD 5IP9H 2JA7G 1SYGA 2IHFA 1HTLD 2RF4A 3BYYB 1XX8A 3M9BA 5ELCA 4A3IH 4DKAC 3UDIA 4X62Q 1J9OA 2R7FA 3MA2B 1KLGD 4ZUJA 5FKAC 1KXLA 4MIUA 4WRDA 4A3DH 4DV1L 2DY7A 4XIGS 5FOBB 2UU9L 5EPLA 3KJPA 1GXDC 1SROA 1YHBA 3J80E 1G291 2IPKD 4A75A 3TZUA 5NUCA 4U673 1JICA 4UP8A 4K6LA 4DV0L 2UUBL 3UI2A 3VDYA 4GKJL 4LF8L 2JA6B 1CHPD 1PRTD 1EZ6A 1TS4A 4UP9A 4JI7Q 4CJ1B 4PNYA 2Z6BA 5DM63 1W2BA 2HD3A 3CU7A 3K59A 1I6VC 4O1NA 2Y0SB 3I72A 2VY3A 2A69D 4JI0L 4YWKA 1YJ9A 4A93B 3IKJA 4DV3Q 3T1YQ 3S1NH 4EQOA 3GTLB 2F0DA 1NBWA 2J4XA 3Q23A 3H0GG 3VA7A 1HFNA 3ERQA 2J7ZA 3H6MA 5I9PA 3KOJA 3I56A 3OSOA 4ALPA 5IGCA 1X55A 2JE6I 4KTAA 1TWGH 1C0AA 1K73C 4RWSC 1RCVD 5CV5A 3Q24A 3MXNA 4B08A 4BXXG 5EJWA 5BR8L 1JQYD 2N49A 2PCFB 4P2CB 2LKVA 3J7ZC 4DA2A 5KYLA 1R9TB 1PH9A 2MP1A 5IT9L 4DR1L 2B63H 4B3SL 3W1BA 1TS3A 3N52A 4X66Q 3TRZA 5C4JB 4KHZA 1FNUA 1TWCB 3CD6A 2EQSA 3CAMA 3BU2A 4AIMA 3BG3A 3S1QH 3HOWG 1BDOA 1RTNA 4C3JH 2UUAQ 3RNUA 4A3JH 3CP0A 2GA4B 1J8IA 1BCPB 4GLVB 4HSVA 1E22A 3HKZB 5M5WH 3A56A 4K14A 4DK6C 2K5VA 1HR0Q 1D8LA 4LF6L 2JA8G 4KHPQ 4DN4M 3TMEA 1RTOA 2F0EA 3M7GA 4CKBA 4BWGB 3CQZH 3NENA 1HZBA 1QVCA 4X3UA 2ZM6L 1L0YB 1A62A 4BY7G 1PH8A 4IOCA 2VS1A 3MTSA 2KEEA 3JAMi 3RR5A 4DR7L 5T1IA 1B1ZA 1VS0A 1PFNA 2G9HD 4AYBB 4MNOA 2DGYA 4UP7A 1XTDA 3MHBA 2RA4A 2LMCB 1VQBA 4ID6A 4IPHA 5M3FB 1HNWQ 4C3IG 1H9MA 3M7NA 1C48A 2K7VA 4YCWA 2H1EA 4OL7A 2ASBA 3F2UA 1N34L 4LJZC 4GOPA 4DR2Q 4R8NA 1OXXK 1TXYA 3KLSX 2AQ3B 1QVFA 2E2HH 3C1FA 3D3RA 2EZVA 2F0HA 4J15A 3KF8B 2IY5B 1B44D 4IURA 2OTLA 3VR4A 2E8GA 3PSIA 3S1NB 1UEAB 1ZEQX 3NEMA 2E74C 3K0YA 1TIID 4R1JA 2NN6I 4GNXB 4JI3Q 2IL8A 4KN7C 1JWMD 1PH3A 3S16H 4A3EH 1D5XC 5G3LD 2FMCA 2XRSD 3I4NH 4ZYSA 1YZ6A 1Z6HA 4FF4A 1SMYC 1XPUA 5FK9C 1KQSA 2QDLA 1M90C 4FXGC 1BQQT 3I2ZA 4RAUC 4C56C 4A3BG 3OW7A 4ZKCB 1EQVA 3PIP3 1GOZA 1CZWA 1HFGA 4ILWA 5HGQA 3GTOH 4KD3A 3PF4A 4DK0A 1PH7A 3C3LA 1DXMA 5IODA 2F0LA 1VQ5A 3UDXA 5I2XA 3FMCA 2B63B 3HZXA 5EPJA 4EQNA 1FL0A 3CMAA 3A7LA 2VB2X 4DV6L 2ZXPA 3U58A 1SXTA 1B3QA 2KCNA 1XMQL 3S1QB 4J6HA 2LXJA 2B2YA 2EJFC 1KDBA 4C3JB 3TP5A 1CKNA 1Y1WB 4A3JB 2JA5G 5ELEA 1EY8A 1CKOA 1BXTA 1KAAA 1HZ9A 5JEAG 1PYWD 5FJ8H 3L3OC 3SXHA 4IALA 3CRLC 1YITA 1SNQA 1I6HH 1D2BA 2K5QA 4PMBA 4OXPA 4Y7NH 4C3HG 3BDCA 1PVOA 3HOZB 3U50C 3CQZB 4GN4B 1FJGQ 2WB1B 3Q0AA 1WVLA 2YYZA 4X64Q 5LL6S 4A3LG 1VQKA 1IL8A 2EPBA 4JBMA 2OTJA 5IGGA 3Q6SA 1AZQA 5M5YH 3HOVG 5D3DA 1PRTF 2IX0A 1HJPA 5EBCA 2DJGC 2WAQB 3TP8A 2B2TA 2VQEQ 4G7ZC 1A3UA 4LAAA 1EYGA 2B2UA 1FNWA 1GUTA 3H15A 4ZK9B 5K36G 1ENAA 1NJIC 2RCNA 3D8GA 1PTOH 2ID0A 1Q8KA 1WTXA 1YIJA 5CGKA 4FDBA 4B3ML 2O4XA 3RZOH 4O0AA 2ZTDA 1N32Q 5E3FA 3MAQA 2LS01 1OXUA 2NN6G 1N36Q 3H3VI 4DUZQ 4OONA 1YBYA 2E5LQ 2Z0SA 2H5XA 2F1MA 4BBSG 3TS2A 3BDOA 1EY6A 3BDLA 1JB7A 1QWYA 1STHA 2G9DA 3RZDB 2YTVA 5ELNA 3T16A 1Z9FA 2R3ZA 3S16B 3WWVA 3I4NB 1GKHA 1NCVA 3EN2A 1DJRD 1X32A 2D9UA 3VYTA 2A68C 2BE5C 1X65A 3FP9A 1DGSA 5I6YA 3FKIH 5CBAE 3D6CA 1SNCA 3M4QA 3K57A 1ONLA 1QG7A 4HJ8A 3M4OH 1TT2A 4CDEC 3AB9A 1SYCA 1G51A 1LLRD 1Y69U 3DWAA 3CC7A 4FYDA 1TQOA 4RGOS 3CKIB 4K0KL 2HQLA 4DFAA 3GTJB 5CV6A 2UXCQ 1I4GA 4RCOA 1S3OA 2F0MA 2EY2A 4EQ5A 4X65L 5HGTA 1WCMB 5M3MB 1KRSA 3A55A 3NXWA 5DLQE 1LT4D 2K5NA 4P72A 2NVQH 4GKKL 2MO0A 1RODA 3K7AH 4JI6L 1GUSA 3QWNA 3KK7A 1I6HB 4LW1A 2UXDQ 2PZTA 4TRDA 4Y7NB 2PZUA 2R92B 4B9WA 1I3QH 1GD7A 4B9XA 3DWPA 3T1HQ 2X6GA 1B8AA 4KY7A 1KRTA 2JEAI 1VQ6A 2Y0SE 2F0QA 5C0XI 5C44H 2E76C 1VQEA 1HPCA 4OO1I 1U4PA 2CH4W 3P7JA 1I4PA 2Q8IB 2HHHL 2EYOA 1SDFA 1Q12A 2WV6D 4CDFC 3U4ZA 1FYCA 3A74A 1TWFH 4OELB 4ULLA 3TS0A 5FO8B 3PO3H 4DU9A 3U4VA 5EBDA 3VYRA 4ZKBB 2IJ0A 4ME3A 1XNQL 1PYSB 4DAYA 5C4HA 3S14H 2JSOA 1K0RA 1PTOB 2WKDA 1V1PA 3AYHB 5F2DA 1EUJA 1S5BD 4OO1H 3RZOB 3NQTA 4A4IA 1IW7C 3J7AV 2EYPA 5C3EG 4R4OA 2NZHA 4JI1Q 3T51B 3ZJYC 3HOXH 2D5DA 1PV4A 3I55A 4K2KA 4KJOA 1N33Q 2XSCA 3CCQA 1G6ZA 2F0SA 1PFSA 3R2IA 3HG9A 1PHJA 4NDXA 3S9WA 2K5WA 2VL6A 1BVSA 4FO2A 4JI5L 3TP7A 2UUCQ 2HIVA 5IOCA 5IGDA 3Q8DA 1ZYRC 4DNRB 2A68D 4DR3L 2NWGA 3U9OA 2NVTH 3I91A 1D5MC 4HJ7A 2L1BA 4L5TA 1IBML 3I4MB 3FKIB 3HKZE 3QB3A 4IJLA 2KENA 1AZPA 2C9OA 5IY0A 2KVMA 4PZ6A 1GHKA 2K5DA 3HKSA 1GO3E 2IT1A 4IUUA 5C6AA 1HNZQ 4H0LC 1O7ZA 3F2BA 1LTAD 3C1EA 1EOVA 2F0NA 2IX3A 4X6AH 1EQTA 4AYBE 4ODGA 2CQAA 3VR3A 3F2CA 4YHHL 2YU9B 1BBWA 1FGUA 1UE6A 1NMGA 4YWLA 4APVA 5FO7B 4LF4Q 2KHJA 4H13C 2NVQB 2B29A 2KQ3A 1IHZA 5J22A 1WD0A 3OWFA 3PO2G 1F2YA 1U5KA 2NB0A 3BZCA 2EY6A 4DV2L 4OIKA 3GTPH 4FF1A 2DUDA 3RUZA 4H44C 5C0XG 2RHQB 2PQAB 5FLXc 4OX9Q 5JOBA 1PRTC 1PTOF 1A63A 4A3KG 2L15A 1EQQA 1VQMA 4B3RQ 1QJOA 4LFBQ 3EROA 3L2PA 4A3MG 1I5FA 4JC0A 1EEFD 4QUCA 5KGUA 3QIAA 2Q8RE 1RL2A 2AKWB 2ZTCA 2WINB 4GNXC 4DR6L 1EL0A 4LFCQ 3QJYA 2H4OA 3X3MA 1D1IA 5GAHC 3W3AA 4JG2A 4XTCS 4RKBA 1UUPA 1X3QA 3RLNA 4K6DA 1JC7A 3PO3B 1VQ4A 3GQBA 4FF3A 1HTPA 1EIHA 4A3FH 5FLXL 3SK4A 1PH6A 2KA7A 1WTPA 4DR5Q 1GUWA 3S14B 1T9HA 5FO9B 1L1OA 5C4XH 3B6YA 4DNTB 3R93A 3CC2A 1E3PA 3OTOL 3MVVA 5BN4A 5FLMH 1SYBA 2HCIA 5IGBA 4KKSA 5IYBG 5IYDG 4PV1C 1ICFB 2X6LA 1D1KA 1F9RA 1Z47A 1IW7D 3VR6A 2QEJC 3T53B 4GLXA 2V4DA 5IWAL 1KHIA 1JR0D 4R4CA 2A74C 1VQ7A 1X3GA 1ICWA 2Z6KC 5EGTA 1Q3LA 2JA9A 3P1HA 1R9TH 2EOTA 2VXWA 1Y14B 1NAPA 5ISRA 1BCPD 2KCMA 1IBKL 4QMGA 1BO0A 2UXBL 2PQEA 3A5ZB 1JOOA 3HOYH 2K6AA 1WTVA 5IYCG 1YJWA 1A3TA 1ZYRD 1F2MA 4H7BA 1YHAA 1N9WA 3DM3A 4M1UB 3CMEA 3D4DA 2N78A 1MHWC 3ONAB 3W5OA 3V2TA 3PUYA 2QILA 4X62L 1EOTA 3KDFA 1STGA 2JA6G 2WB1E 3PIOA 1CA5A 1G91A 3G4SA 1E0BA 2OF1A 2VQFQ 2A6HC 1K3BC 4RH6A 3M4PA 1RJTA 2Z9HA 1O7LA 2PZWA 3NK9A 2DN8A 3JC66 3E9HA 1JOQA 2F0KA 2C5CA 4DV4Q 4MTKA 2MUYA 2WAQE 1VQ8A 1S5DD 4A93G 5IP7G 2O5JC 3K80C 3MZ5A 1R4PB 3F2DA 1TU2B 3NTHA 1K8AC 2R6GA 2EE1A 1WI5A 3EJIA 1PZKD 1E1OA 3V96A 3ICEA 5IGFA 3GTPB 5M3FH 5JPMC 2CKZB 5LMNQ 1LO5D 5KYIA 4JI7L 2CVRA 1ML0D 2QDBA 4HTHA 1E7ZA 1YVCA 4B3TQ 2QF7A 4ABNA 4HJ5A 4NXMQ 1QOHA 2UU9Q 3VR5A 2IHEA 3QOLA 3NBHA 4DV3L 3T1YL 4OGQC 2RVLA 4DUYL 1Q7YC 2HDMA 2B2VC 1B7YB 1QNUA 2Z1CA 1NUCA 4OHJA 3BVGA 4K5VA 4A3FB 2FXQA 4CBVA 3F8TA 4NW2A 5C4XB 5IT9c 4XT1B 1LACA 1H9SA 5J39A 3ND9A 1EY4A 4XXEA 2LSSA 3TREA 2CWPA 2BDOA 3PUXA 5JEAJ 4LF5Q 4I7ZC 4F8MA 1FGBD 2FJ2A 3PMFA 1B4OA 5IP9G 5AJ3Q 1KNAA 2OWOA 3HKZG 4GOPB 5CV4A 1NSNS 2RDFA 1BUVT 4LF9Q 4Q5VA 3PV0A 4A3IG 3NWTA 1VQFA 4DXGA 3BZDB 2F4IA 4IFDJ 1L2FA 3EBEA 4X66L 4JBJA 2GN5A 1MI2A 2EJGC 2EYLA 2L11A 3X3NA 1K0SA 4HMJA 1PH1A 4A3DG 2D0OA 3FHWA 4DV5Q 2PO4A 4DK3C 1BF4A 3E0JA 4AYBG 1T5XD 2UUAL 3HOYB 1K8OA 3J7YW 3CCRA 4KY6A 2K05A 5GROA 1YNXA 4LUZA 2PNHA 4WFN3 1Y1WH 1K28A 5DEHA 1SYEA 3RLFA 5H1SE 1SBBB 3R2TA 1MJEA 4QUFA 2NYZD 3SHLA 5BR8Q 1HR0L 4KHPL 1XPRA 2JEBI 4RCNA 3QG1A 1ZXTA 4LWCA 4O2DA 4HCEA 5HY6A 3TZDA 2A8VA 3HOZH 1ASZA 1YNNC 3FPUB 2A6HD 1J5EQ 1ET9A 5FLXE 2KHIA 2P5ZX 3K5MA 3K81C 5JJIA 1HNXQ 1K3RA 2NTTA 4TSSA 3J81j 2EYFA 1FVIA 4K8JA 1W6JA 4P71A 1PTOC 3HEJA 3W1GA 1HNWL 2SNSA 4YIJA 1VQ9A 4BBRH 2AHOB 3CPWA 2QA4A 2O2LD 3KJOA 2IW3A 4V190 2VB3X 2F52A 4OWWB 2XGTA 5EKIA 5JAVA 4DR2L 5ELDA 2BA0A 2KBNA 1L1OC 1F9SA 1JE4A 1DZ1A 3OWEB 4LF7L 1JB3A 2F4VQ 1LT5D 1F2LA 1CSPA 2L4NA 3MWYW 3N6RA 5CV7A 3HGBA 1STAA 1AH9A 2R7ZB 3HOWB 4KJNA 2PI2E 2CQOA 4HIKA 2F0IA 4KN4C 3DHQA 4JI3L 4F88A 4K8IA 2B3GA 4RGTA 3NTIA 2B63G 3H3VC 3PGZA 1C8CA 3MFGA 3IFDA 1P8LA 3LWEA 3RZDH 1X6OA 4BY7B 1M8AA 1H9KA 4C3JG 1WTWA 5LMUQ 1I94Q 1LV9A 1Y1WG 1JJGA 4IFDH 4A3JG 1Y1VH 2RKSA 3D6WA 5EKLA 1A0IA 2E2JH 1BCPF 3BYTB 2Q8TA 4YCVA 4WJ4A 1IXRA 1X56A 3HOZG 1QB5D 4JW0A 1IZ6A 4KKTA 4C3IB 2NZ1D 2WB1G 4O42A 2K01A 2RHSB 1B9MA 4MTNA 3MXPA 3BVZA 1SRUA 2AWNA 5IE8A 4QGUA 5JVG3 1WTOA 1S5ED 3GTJH 4JV5L 3SE0A 1ENCA 1WCMH 2WAQG 5M3MH 3PUVA 1VQLA 3G48A 2F0JA 3CXCA 3QR8A 1G2SA 1I4RA 1PH4A 4OWTB 4C2MH 2N3SA 1CK1A 5CV9A 1YJNA 3IFTA 2KCTA 1FJGL 1MGSA 1I4HA 3PIPA 2R92H 1O78A 4X64L 2I5LX 1XYIA 2IX1A 1B50A 1KAWA 1ESFA 1Y8NB 3CCEA 3TBIB 1IBLQ 4CGYB 1YHQA 1YNND 4DV6Q 3M85A 3MEFA 4IUNA 1XMOQ 1SSOA 1VQDA 2B2WC 2Z4IA 1XMQQ 2VQEL 2R7DA 3CCVA 5I4DA 2LFNA 1PH5A 2K14A 1PTOD 1A8VA 1EWHA 1CSQA 4HJ9A 2L9HA 4BBRB 1XJVA 4GN3B 1C7YA 1DCZA 4UDUC 4A3EG 1KDCA 3HS0C 3KF8A 4ZLTF 3K0XA 3I4NG 2HIXA 3ZYYX 3K7UC 1N32L 1LTID 3HOUH 4A3CH 2ZTEA 4BY1H 3DMUA 3GTQH 1IYJB 4QIWE 2SEBD 3SGIA 3CC4A 4ZQ3A 4CKCA 4DUZL 4GNXA 5IT9E 1SFOB 3S2DH 2E5LL 2HCCA 3I70A 5HURA 3UDFA 2EVBA 1NTGA 4KD4A 2M9VA 1A6XA 4IO9A 4CDDC 1O7YA 1FR3A 2YTXA 1E2ZA 4OEMB 2MGSA 1JJ2A 1CM9A 2CWAA 1XTCD 4KMUC 4JI2Q 4I7AA 2DY8A 2NZOA 1NMFA 4KHVA 1S5CD 2N55A 2E2IH 2KOLA 2D62A 2NVXH 1Y1VB 2A6EC 5C0XJ 1V1PB 1EQRA 3I4MH 1VQJA 2AWOA 5FJ8G 2E2JB 2LXKA 3TEHB 2Z6KA 2ZJPA 1P16A 1Q46A 3LNNA 3L9AX 1NE3A 2ZJRA 2UXCL 2FINB 4PMWA 1ET6A 1SNOA 5COYA 5ELBA 4FNFA 3I3CA 4DGZA 2YU9H 5GQOA 3S1MB 2F3IA 3E5SA 2VUMH 3SDZA 1HHVA 3MXGA 2I5MX 2PW7A 4FP5D 5DM73 1VQOA 3A54A 3F1ZA 2B8FA 3L0OA 2O5IC 3CCLA 2EYJA 3OHXC 1MKHA 2XTIA 4F7XA 2UXDL 1SMXA 1PLFA 1PZJD 1QUQA 4L5RC 4C2MB 4LNQA 1LYLA 4G57A 3FEWX 3A0JA 3T1HL 1FNVA 1Q8IA 4BA2I 3EQLC 1BOSA 4DNIA 3HP3A 3OOCA 1VDZA 2HQEA 2L0CA 1IKLA 1NR4A 3KF6A 1MJCA 3NTKA 1KDAA 1LUZA 3CPFA 2F0OA 2EYHA 4PZ7A 5K5PA 1HR0W 1SNMA 1XNRQ 2OXPA 2F0PA 2V1CC 5JVH3 4AQYQ 4KV6A 1RIPA 3ERSX 4GKKQ 5ELOA 2Z4HA 2WACA 2XWJB 2K4KA 4JPBW 3G6JB 3J80c 2WKCA
chains in the Genus database with same CATH topology
1PFMA 1PZID 5CC4A 1A2TA 1KTKA 3HOUB 4BY1B 2KCCA 1WTQA 3GTQB 1RKNA 3S2DB 1B3AA 1STEA 1CQVA 3FDTA 2B2VA 4WJWA 2XN9C 2PPBC 5BN3A 1PXUA 1LT6D 1JCKB 4NMZA 3J80L 1Q1EA 2F3VA 1DD2A 3DWQA 3VYSA 1MSHA 4HCSA 1Q90A 1VMPA 1BCPC 3H91A 1KABA 2K03A 2N88A 1A3VA 3GV6A 4FF2A 3WOEA 2E2IB 3I8ZA 1CHQD 2NVXB 2XWBB 2A6ED 1QCBD 4J8QA 2B39A 5A2QL 3R3OA 5C3XA 2KHSA 2CW0D 5I6WA 2K32A 1BBXC 4CJ0B 1EYCA 3GP7A 3URYA 5LHY1 4HR7B 2FMMA 3P75A 1F77A 3SK6A 2PMZB 1U4MA 3C46A 2VUMB 1KLUD 1QILA 4KI0A 3DEPA 5C3EB 4G7OC 2VNUD 2M00A 3Q22A 1X3PA 3D4RA 3J81L 4HAEA 3TN2A 1EU3A 1I4XA 4OO1G 3OIPA 4MN3A 1M4VA 4K5XA 4I65A 1HQMC 2FHTA 3CHBD 3BVMA 3E6ZX 4BA1I 4BS9A 3K5NA 4FXDA 4U68A 3SK8A 1GUGA 2DNEA 3W2DA 1F2ZA 3RD4A 4DXFA 3DUZA 2L12A 3M3YB 2RQXA 4N9PA 5BN5A 4PMCA 1LTGD 1SE3A 3PUZA 3KUPA 1IKMA 4F87A 1LTRD 2AQ2B 4TQUS 3MEHA 1SYDA 2R93B 3A8JE 2EY5A 1TWHB 4IUQA 3ITPA 3GTMB 2E75C 2AUKA 4A3KB 2JXMB 1TKWB 1SNDA 2JP1A 1I4QA 1TY0A 1SJHD 5I2YA 3O13A 3T4AC 3QO2A 5KIXA 3H09A 4R8IA 2ICIA 1XXGA 5IIFA 2SDFA 1Y8OB 1HUMA 3A8KE 3NPPA 3NBIA 4S3SA 2ZT9C 5CMDA 2MJ8A 4XQQA 3HRZC 2RDHA 1V8QA 1FD7D 1VMCA 2ICEC 3SEBA 3GTGB 4XDXA 4X3KA 4ZUIA 5DNFA 1VF7A 4RHSA 4A3GB 5T1GA 4DAPA 2B2WA 3H94A 1OXVA 3I90A 1LTSD 4HSPA 5CYUA 5KRUA 2M2LA 2BA1A 4X3TA 1SJED 2JA7B 1JOKA 1QE6A 2XVSA 2HUGA 4K5WA 5A2QE 1DM0B 1STYA 1CTMA 3S2HB 1HQRD 1ILQA 1TWAB 2MHVA 1CT1D 1TR5A 1IYVA 1A15A 4PQXA 2XIWA 2EJMA 5KNBA 3J81E 1SE2A 1Q1BA 3V05A 2F03A 4HN7A 4RFBA 2KUMA 2AQ1B 1E2WA 4UAIA 1EYDA 1CI3M 3DEOA 1GJXA 5C4ZA 2MPMA 3H0GB 1EWCA 5M5XB 1ZKOA 4C1NK 4NKLA 4XYOA 1ILPA 1SEBD 3SVMA 2EYMA 3EA6A 4WORA 1DOMA 3KLRA 4RA8A 4A3IB 4HEDA 3NUCA 3VYUA 3MC0B 3GV3A 3JAML 3SR1A 3K58A 4A3DB 4LK1C 5E4XA 3I73A 3TDQA 1HA5A 1JWUD 5A35A 3LWUA 4IFDI 1HA6A 5D65A 3R8BA 1B9NA 5JEAH 5EQ0A 1YNJC 2PYKA 3FPPA 1AEXA 1IYUA 2JA8B 2TMPA 4E6IA 4G7HC 4QCLA 5ELFA 1V1OA 1PMRA 1PRTB 3GTKB 1EY0A 1EY9A 3KBGA 2R61A 4C1NI 3S1RB 4RGMA 1B53A 4ZRZA 4XYQA 3MXUA 4XQJA 4XT3B 1F9PA 5D14A 5K36H 3G7LA 5EKKA 1AW7A 1TWGB 4ZAIA 3BS1A 1DONA 2QCPX 1MD2D 3AU7A 1AFPA 1G8ZD 3NHHA 2ZXOA 1Y8PB 3OIQA 3FVQA 1F9QA 2NN6H 1II3A 1RF2D 3D4WA 2E2DC 3A7AB 3VA5A 4OIJA 1L0XB 4N9TA 1W6KA 3A8IE 1RDPD 1UNSA 3OMCA 3ND8A 1STBA 4DAVA 2QKIC 2ENBA 1EEID 4JK1C 1C4QA 4IQZA 3IAYA 1WD1A 2EDGA 2PW5A 1TY2A 4A3BB 1RHPA 5M5WB 3M4YA 2KECA 1CA6A 2NVYB 3P20A 2F0TA 4IFDG 1QNKA 1T5EA 5I9OA 1EFID 4HMIA 3KBXA 1B2TA 2BOSA 2KJXA 1O80A 2JA5B 2K1BA 3QOJA 1S5FD 5CV8A 1DOLA 2NUCA 3S15B 4CHTB 5CORA 1U9RA 1YNJD 2F0GA 4ME5A 1D5ZC 4C3HB 1E2VA 1LTTD 2NTSA 1AN8A 2E2HB 1EU4A 4EQPA 5JPNC 1VCIA 3K5OA 5JJZA 4Z9CB 3HOVB 4MHEA 3C2PA 2Z8LA 4IUVA 2CW0C 4L63B 1SYFA 5C3WA 4A3EB 1TS2A 4FXKC 3VR2A 2DNCA 1SMYD 3J7AF 1K8MA 2K33A 3JAME 4DK1A 3KLSA 1GHJA 3DXJC 4QB4A 1R4QB 3GTOB 2BDNA 5KEEA 1S4ZA 4BBSB 2J0TD 5AFWA 4EGVA 3CRKC 3K6OA 4JBWA 2A73B 1D6EC 1CQFA 3OPOA 4NP5A 5E1FA 1JORA 1DOKA 1EY7A 4CKEA 4M8AA 1EYAA 1TS5A 3GO5A 5D3IB 3PUWA 1G2TA 4RKLA 2A5HA 4XQNA 2B8GA 4EVOA 2EXZA 2F0UA 1H9RA 3NE5B 4DF7A 5LL6X 4R9WA 2NBFA 2BCOA 1A2UA 3NQIA 1K83B 2OT2A 2WIIB 3WOFA 2F0FA 5M5YB 5C5MA 3L7ZC 3U9SA 4FVMA 1EIGA 4IUTA 2F3WA 1JWSD 5EPKA 5DAUA 1BR9A 2SNMA 1H9JA 1I50B 3IL8A 1STNA 5C0XH 3MFYA 1CZGA 5J1ZA 4L8JA 3T56B 1RD9D 2EY1A 5G3LF 4IUPA 4QF4A 1SE4A 4V0BA 2CHBD 2XNAC 1BNZA 2KEDA 3T13A 4Q0FA 1ENFA 2SOBA 1TVXA 2BE5D 2B2YC 3K5LA 2RDGA 3M4OB 4GZYC 3LX0A 4LMQD 3NWSA 4K2LA 1DYQA 4TKOB 1NR2A 2RSOA 2HDLA 1Z7TA 1XWEA 1EZ8A 1ESRA 1HXYD 4X3SA 1UAPA 2I46A 3TSSA 2XRQD 1MBYA 2AUJD 2OEOA 1OXTA 5C5LA 4RGNA 5KNDA 3K7AB 3AMUA 1HRJA 2B2TC 2PNRC 1HUNA 1MSGA 2B2UC 2RBMA 1CFMA 2WP8J 1GUNA 1I3QB 1EY5A 3NP8A 3OMGA 4IZ8A 4G4KA 5C44B 1SNPA 2RSNA 1PDQA 2F0WA 1LABA 1KNEA 1LT3D 2A69C 1TWFB 4RHRA 5KNCA 3S17B 2IWHA 2X69A 5CR3A 2LY7A 5TSSA 3DM1A 3PO2B 3WDNA 1VF5C 4CJ2C 3I4LA 4KY5A 3EFXD 1U4RA 4J1MA 1OXSC 3NSWA 1HCZA 3RMHA 2TSSA 4L6TB 3FRPB 5E4WC 4A3MB 4QIWB 2K28A 3GD7A 3HOXB 5CBEE 1SAPA 3PIO3 1V43A 1H9SB 2FFKB 3SK5A 1AP0A 2D2CC 2I07B 5IGEA 3TP6A 2ZXRA 4KKUA 1U4LA 1OO9B 1PFBA 2F0VA 4KK7A 2L55A 3EVQA 3D31A 4IN3A 5M9OA 2NVTB 2K04A 1GUOA 2L5TA 2JYOA 1WTRA 1LTBD 1SYGA 1HTLD 3BYYB 1XX8A 5ELCA 1J9OA 3MA2B 1KLGD 4ZUJA 5FKAC 4MIUA 4WRDA 2DY7A 4XIGS 5FOBB 5EPLA 1GXDC 3J80E 1G291 2IPKD 3TZUA 5NUCA 4U673 1JICA 4K6LA 3UI2A 2JA6B 1CHPD 1PRTD 1EZ6A 1TS4A 4CJ1B 4PNYA 5DM63 3CU7A 3K59A 1I6VC 4O1NA 2Y0SB 3I72A 2A69D 4A93B 3IKJA 4EQOA 3GTLB 2F0DA 2J4XA 3Q23A 3VA7A 1HFNA 3ERQA 2J7ZA 3H6MA 5I9PA 3OSOA 5IGCA 2JE6I 4KTAA 4RWSC 1RCVD 5CV5A 3Q24A 3MXNA 4B08A 5EJWA 1JQYD 2PCFB 4P2CB 2LKVA 4DA2A 5KYLA 1R9TB 2MP1A 5IT9L 1TS3A 3N52A 5C4JB 4KHZA 1FNUA 1TWCB 3BG3A 1BDOA 1RTNA 2GA4B 1J8IA 1BCPB 4HSVA 3HKZB 3A56A 4K14A 4DN4M 3TMEA 1RTOA 2F0EA 3M7GA 4CKBA 4BWGB 4X3UA 1L0YB 3MTSA 2KEEA 5T1IA 1B1ZA 2G9HD 1PFNA 4AYBB 3MHBA 2RA4A 2LMCB 4ID6A 5M3FB 4C3IG 1H9MA 3M7NA 1C48A 2K7VA 2H1EA 4OL7A 3F2UA 4LJZC 4R8NA 1OXXK 3KLSX 2AQ3B 3C1FA 3D3RA 2EZVA 2F0HA 1B44D 4IURA 3VR4A 3S1NB 1UEAB 1ZEQX 2E74C 3K0YA 1TIID 2NN6I 2IL8A 4KN7C 1JWMD 1D5XC 5G3LD 2FMCA 2XRSD 4ZYSA 1Z6HA 4FF4A 1SMYC 5FK9C 4FXGC 1BQQT 4RAUC 4C56C 3OW7A 4ZKCB 1EQVA 3PIP3 1GOZA 1CZWA 1HFGA 4ILWA 4KD3A 4DK0A 3C3LA 1DXMA 5IODA 2F0LA 5I2XA 3FMCA 2B63B 3HZXA 5EPJA 4EQNA 3A7LA 2VB2X 2ZXPA 1SXTA 2KCNA 3S1QB 4J6HA 2B2YA 2EJFC 1KDBA 4C3JB 3TP5A 1Y1WB 4A3JB 5ELEA 1EY8A 1BXTA 1KAAA 5JEAG 1PYWD 3L3OC 3SXHA 4IALA 3CRLC 1SNQA 1D2BA 2K5QA 4PMBA 4C3HG 3BDCA 3HOZB 3CQZB 2WB1B 3Q0AA 1WVLA 2YYZA 5LL6S 1IL8A 2EPBA 5IGGA 3Q6SA 1AZQA 5D3DA 1PRTF 2IX0A 5EBCA 2WAQB 3TP8A 2B2TA 4G7ZC 1A3UA 4LAAA 2B2UA 1FNWA 1GUTA 4ZK9B 5K36G 1ENAA 3D8GA 1PTOH 2ID0A 1WTXA 5CGKA 2O4XA 5E3FA 3MAQA 2LS01 1OXUA 2NN6G 2F1MA 3BDOA 1EY6A 3BDLA 1QWYA 1STHA 2G9DA 3RZDB 3T16A 2R3ZA 3S16B 3I4NB 1NCVA 1DJRD 1X32A 2D9UA 3VYTA 2A68C 2BE5C 5I6YA 5CBAE 3D6CA 1SNCA 3K57A 1ONLA 1QG7A 1TT2A 3AB9A 1SYCA 1LLRD 1Y69U 3DWAA 4FYDA 1TQOA 4RGOS 3CKIB 4DFAA 3GTJB 5CV6A 1I4GA 4RCOA 2F0MA 2EY2A 5HGTA 1WCMB 5M3MB 3A55A 3NXWA 1LT4D 1RODA 1GUSA 3QWNA 3KK7A 1I6HB 2PZTA 4TRDA 4Y7NB 2PZUA 2R92B 4B9WA 4B9XA 3DWPA 2X6GA 4KY7A 2JEAI 2F0QA 5C0XI 2E76C 1HPCA 4OO1I 1U4PA 3P7JA 1I4PA 2Q8IB 2EYOA 1SDFA 1Q12A 2WV6D 1FYCA 4ULLA 5FO8B 4DU9A 3VYRA 5EBDA 4ZKBB 2IJ0A 4DAYA 5C4HA 2JSOA 1PTOB 2WKDA 1V1PA 5F2DA 1S5BD 4OO1H 3RZOB 3NQTA 1IW7C 3J7AV 2EYPA 3T51B 2D5DA 4K2KA 4KJOA 2XSCA 1G6ZA 2F0SA 3R2IA 3HG9A 4NDXA 3S9WA 2K5WA 4FO2A 3TP7A 5IOCA 5IGDA 4DNRB 1ZYRC 2A68D 2NWGA 3U9OA 3I91A 1D5MC 2L1BA 3I4MB 3FKIB 3QB3A 1AZPA 2C9OA 1GHKA 2KVMA 2K5DA 2IT1A 4IUUA 5C6AA 4H0LC 1O7ZA 1LTAD 3C1EA 2F0NA 2IX3A 1EQTA 4ODGA 2CQAA 3VR3A 2YU9B 5FO7B 4H13C 2NVQB 2KQ3A 1IHZA 5J22A 1WD0A 3OWFA 1F2YA 2NB0A 2EY6A 4OIKA 4FF1A 3RUZA 4H44C 5C0XG 5JOBA 1PRTC 1PTOF 1QJOA 3EROA 1EEFD 4QUCA 5KGUA 3QIAA 2Q8RE 2WINB 1EL0A 3QJYA 2H4OA 3X3MA 1D1IA 3W3AA 4XTCS 4RKBA 1UUPA 1X3QA 4K6DA 1JC7A 3PO3B 3GQBA 4FF3A 1HTPA 1EIHA 5FLXL 3SK4A 2KA7A 1WTPA 1GUWA 3S14B 5FO9B 4DNTB 3R93A 3MVVA 5BN4A 1SYBA 2HCIA 5IGBA 4KKSA 4PV1C 2X6LA 1D1KA 1F9RA 1Z47A 1IW7D 3VR6A 2QEJC 3T53B 2V4DA 1JR0D 2A74C 1ICWA 5EGTA 1Q3LA 3P1HA 2EOTA 2VXWA 1NAPA 5ISRA 1BCPD 4QMGA 1BO0A 2PQEA 1JOOA 2K6AA 1WTVA 1A3TA 1ZYRD 1F2MA 4H7BA 4M1UB 3D4DA 3ONAB 3V2TA 3PUYA 2QILA 1EOTA 1STGA 1CA5A 1G91A 1E0BA 2OF1A 2A6HC 4RH6A 1RJTA 1O7LA 2PZWA 3NK9A 2DN8A 1JOQA 2F0KA 2C5CA 2MUYA 1S5DD 2O5JC 3MZ5A 1R4PB 1TU2B 3NTHA 2R6GA 2EE1A 3EJIA 1PZKD 3V96A 3GTPB 5IGFA 5JPMC 1LO5D 5KYIA 2CVRA 1ML0D 2QDBA 4HTHA 2QF7A 4ABNA 1QOHA 3VR5A 3QOLA 3NBHA 4OGQC 2RVLA 2HDMA 2B2VC 1QNUA 2Z1CA 1NUCA 4OHJA 3BVGA 4K5VA 4A3FB 4CBVA 4NW2A 5C4XB 4XT1B 1LACA 1H9SA 5J39A 3ND9A 1EY4A 4XXEA 2BDOA 3PUXA 5JEAJ 4I7ZC 4F8MA 1FGBD 2FJ2A 3PMFA 1B4OA 1KNAA 5CV4A 1NSNS 2RDFA 1BUVT 4Q5VA 3PV0A 3NWTA 4DXGA 3BZDB 2F4IA 4IFDJ 1MI2A 2EJGC 2EYLA 2L11A 3X3NA 4HMJA 2PO4A 1BF4A 3E0JA 1T5XD 3HOYB 1K8OA 3J7YW 4KY6A 2K05A 4WFN3 5DEHA 1SYEA 3RLFA 1SBBB 3R2TA 4QUFA 2NYZD 3SHLA 2JEBI 4RCNA 3QG1A 1ZXTA 4HCEA 3TZDA 1YNNC 3FPUB 2A6HD 1ET9A 5FLXE 3K5MA 2NTTA 4TSSA 2EYFA 4K8JA 1W6JA 1PTOC 3HEJA 2SNSA 4YIJA 2O2LD 2IW3A 4V190 2VB3X 5EKIA 5JAVA 5ELDA 2BA0A 1F9SA 1JE4A 1DZ1A 3OWEB 1JB3A 1LT5D 1F2LA 2L4NA 3MWYW 3N6RA 5CV7A 3HGBA 1STAA 2R7ZB 3HOWB 4KJNA 2F0IA 4KN4C 3DHQA 4F88A 4K8IA 4RGTA 3NTIA 3H3VC 1C8CA 3MFGA 3IFDA 3LWEA 4BY7B 1M8AA 1H9KA 4C3JG 1WTWA 1LV9A 4IFDH 2RKSA 3D6WA 5EKLA 1BCPF 3BYTB 2Q8TA 1QB5D 4KKTA 4C3IB 2NZ1D 4O42A 2K01A 1B9MA 3MXPA 3BVZA 2AWNA 5JVG3 1WTOA 1S5ED 3SE0A 1ENCA 3PUVA 2F0JA 1G2SA 1I4RA 5CV9A 1CK1A 3IFTA 1MGSA 1I4HA 1O78A 1XYIA 2IX1A 1B50A 1ESFA 1Y8NB 3TBIB 4CGYB 1YNND 3M85A 4IUNA 1SSOA 2B2WC 2Z4IA 5I4DA 2LFNA 1PTOD 1EWHA 2L9HA 4BBRB 1DCZA 4UDUC 1KDCA 3HS0C 3KF8A 4ZLTF 3ZYYX 1LTID 3DMUA 2SEBD 4ZQ3A 4CKCA 5IT9E 1SFOB 2HCCA 3I70A 5HURA 2EVBA 4KD4A 2M9VA 1A6XA 1O7YA 1FR3A 1E2ZA 2MGSA 1CM9A 1XTCD 4KMUC 2DY8A 4KHVA 1S5CD 2N55A 2KOLA 2D62A 1Y1VB 2A6EC 5C0XJ 1V1PB 2AWOA 2E2JB 3LNNA 3L9AX 2FINB 4PMWA 1ET6A 1SNOA 5COYA 5ELBA 4FNFA 3I3CA 4DGZA 3S1MB 3E5SA 1HHVA 3SDZA 3MXGA 2PW7A 4FP5D 5DM73 3A54A 2B8FA 2O5IC 2EYJA 3OHXC 4F7XA 1PLFA 1PZJD 4C2MB 4G57A 3FEWX 1FNVA 1Q8IA 4BA2I 3EQLC 1BOSA 3HP3A 3OOCA 1VDZA 2HQEA 2L0CA 1IKLA 1NR4A 3NTKA 1KDAA 5K5PA 2F0OA 2EYHA 1SNMA 2OXPA 2F0PA 5JVH3 4KV6A 2Z4HA 2WACA 2XWJB 3G6JB 2WKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFM A;  2HCC A;  5T1G A;  1WD1 A;  1HFG A;  2JYO A;  1DOK A;  3GV3 A;  2B2W A;  1WTR A;  1RHP A;  5CBA E;  1C8C A;  1NR2 A;  1ICW A;  2FJ2 A;  2HDL A;  2RSO A;  3I90 A;  3IFD A;  3LWE A;  1B4O A;  1Q3L A;  1WTQ A;  1O7Y A;  1KNA A;  5EPJ A;  1RTN A;  1ESR A;  1M8A A;  2KEC A;  1B3A A;  1QG7 A;  2EOT A;  4X3S A;  2VXW A;  1XX8 A;  2NWG A;  2MGS A;  2M2L A;  3I91 A;  4X3T A;  5E4X A;  1WTW A;  1J8I A;  1LV9 A;  2L1B A;  1J9O A;  1CA6 A;  1NAP A;  1CM9 A;  1G2T A;  3FDT A;  4HSV A;  2B2V A;  2L12 A;  1BO0 A;  3D6W A;  1QE6 A;  2HUG A;  1AZP A;  1HA6 A;  5D65 A;  2KVM A;  2B2Y A;  1QNK A;  2DY8 A;  1WTV A;  1MI2 A;  2DY7 A;  2L11 A;  1HRJ A;  4IUU A;  2B2T C;  2Q8T A;  4DN4 M;  5EPL A;  1HUN A;  1O7Z A;  3KUP A;  2N55 A;  1RTO A;  4R9W A;  1IKM A;  5EQ0 A;  2KOL A;  1MSG A;  1MSH A;  4HCS A;  4X3U A;  1BF4 A;  2B2U C;  3KBX A;  3ONA B;  1B2T A;  1VMP A;  3H91 A;  1O80 A;  2KEE A;  2NZ1 D;  2K03 A;  2N88 A;  3MTS A;  2K1B A;  1ILQ A;  4O42 A;  2K01 A;  3GV6 A;  2K05 A;  1DOL A;  1EOT A;  1EQT A;  5T1I A;  1JIC A;  1PFN A;  1EIG A;  4IUQ A;  1ROD A;  5COR A;  1WTO A;  3I8Z A;  4IUT A;  1WVL A;  1CA5 A;  1G91 A;  1E0B A;  3UI2 A;  2NYZ D;  2RSN A;  4QUF A;  5EPK A;  1IL8 A;  1PDQ A;  2EPB A;  2FIN B;  1RJT A;  2RA4 A;  5COY A;  1KNE A;  3Q6S A;  1AZQ A;  3IL8 A;  4CJ1 B;  1WD0 A;  1ZXT A;  3I3C A;  3TZD A;  1A15 A;  2X6G A;  4OIK A;  1BBX C;  2JP1 A;  2X69 A;  1B53 A;  2H1E A;  1HHV A;  2XIW A;  3F2U A;  2B2T A;  1G2S A;  3FPU B;  4CJ0 B;  5JJZ A;  4XT3 B;  1F9P A;  3DM1 A;  4MHE A;  2FMM A;  5D14 A;  1MGS A;  4CJ2 C;  1U4P A;  3QO2 A;  2B2U A;  3P7J A;  1U4M A;  3G7L A;  4ZK9 B;  4R8I A;  1XYI A;  1SDF A;  1B50 A;  2EE1 A;  1U4R A;  4IUV A;  4ZAI A;  2KUM A;  1PLF A;  2SDF A;  4IUP A;  4QUC A;  1DON A;  2CVR A;  4UAI A;  3DEP A;  4ZKB B;  2Q8R E;  1ML0 D;  1WTX A;  1EL0 A;  3DEO A;  4IUR A;  1HFN A;  1SSO A;  5E4W C;  1HUM A;  2J7Z A;  2B2W C;  1BNZ A;  2K28 A;  2MPM A;  1F9Q A;  3HP3 A;  1X3Q A;  5CMD A;  2MJ8 A;  5EKI A;  5CBE E;  1IKL A;  1NR4 A;  1SAP A;  1X3P A;  2KED A;  2FFK B;  1EIH A;  1F9S A;  1JE4 A;  1DZ1 A;  2IL8 A;  2L9H A;  4HAE A;  4RWS C;  3TN2 A;  1WTP A;  1AP0 A;  1GUW A;  1VMC A;  2RVL A;  4OIJ A;  1F2L A;  2HDM A;  1TVX A;  2B2V C;  2L4N A;  3MWY W;  4MN3 A;  5EJW A;  2BDN A;  1ILP A;  2B2Y C;  4XDX A;  3R93 A;  4ZLT F;  1S4Z A;  1U4L A;  4X3K A;  3SVM A;  1PFB A;  4RAU C;  5AFW A;  2HCI A;  5DNF A;  1DOM A;  2FHT A;  2R3Z A;  2X6L A;  4RA8 A;  1F9R A;  4NW2 A;  2MP1 A;  4ZKC B;  1NCV A;  4LMQ D;  4XT1 B;  2K04 A;  4U68 A;  1G6Z A;  1X32 A;  2D9U A;  4HED A;  3N52 A; 
#chains in the Genus database with same CATH topology
 1PFM A;  3RN5 A;  1PZI D;  3KYH C;  4YY3 Q;  2I5H A;  5CC4 A;  1A2T A;  1KTK A;  3HOU B;  4BY1 B;  3M3Y H;  2KCC A;  1WTQ A;  3GTQ B;  3FKI G;  1RKN A;  3S2D B;  1B3A A;  1O7I A;  1STE A;  1N33 L;  1CQV A;  3CW2 C;  4YCU A;  3FDT A;  2GVA A;  2B2V A;  4WJW A;  4LFA Q;  5L37 A;  2XN9 C;  2PPB C;  5BN3 A;  1PXU A;  4IPG A;  1LT6 D;  4POF A;  1JCK B;  3AQQ A;  4NMZ A;  1XNQ Q;  3J80 L;  2R93 H;  1Q1E A;  2F3V A;  1DD2 A;  3DWQ A;  1TWH H;  3VYS A;  2UUC L;  1MSH A;  4HCS A;  3GTM H;  2BH8 A;  1Q90 A;  1VMP A;  1BCP C;  3H91 A;  1KAB A;  2K03 A;  2N88 A;  1A3V A;  5J3B A;  3GV6 A;  4FF2 A;  4JYA Q;  3WOE A;  2E2I B;  3I8Z A;  1CHQ D;  2NVX B;  2XWB B;  2A6E D;  1QCB D;  1YEZ A;  3KFU A;  4J8Q A;  1HNZ L;  2B39 A;  5A2Q L;  3R3O A;  4IOA A;  5C3X A;  2KHS A;  2CW0 D;  5I6W A;  2K32 A;  1BBX C;  4LUO A;  3J81 c;  4CJ0 B;  1EYC A;  3GP7 A;  3URY A;  5LHY 1;  4HR7 B;  2FMM A;  3P75 A;  1F77 A;  3SK6 A;  2PMZ B;  5C44 G;  1U4M A;  3C46 A;  4DV7 Q;  4LF4 L;  2VUM B;  1KLU D;  1QIL A;  4KI0 A;  2QGQ A;  3DEP A;  5C3E B;  1IBM Q;  3PO3 G;  1EIF A;  4G7O C;  2VNU D;  1SN8 A;  2M00 A;  2Q2U A;  3Q22 A;  3DLL A;  4OX9 L;  1X3P A;  2ZJQ A;  3GTG H;  3D4R A;  3J81 L;  4B3R L;  4LFB L;  2EXD A;  4HAE A;  3TN2 A;  1EU3 A;  1I4X A;  4OO1 G;  2VW9 A;  3OIP A;  4MN3 A;  2HT1 A;  3KDF B;  1M4V A;  4K5X A;  4A3G H;  4I65 A;  3HOX G;  1HQM C;  3HFZ B;  2FHT A;  3S24 A;  3CHB D;  3BVM A;  3E6Z X;  4BA1 I;  4BS9 A;  3K5N A;  4JVZ A;  4FXD A;  3IRB A;  4U68 A;  3SK8 A;  1S40 A;  1GUG A;  4DR5 L;  2DNE A;  2JA7 H;  3W2D A;  1F2Z A;  3RD4 A;  2AMC B;  4DXF A;  3DUZ A;  2L12 A;  2C35 B;  3M3Y B;  2RQX A;  4N9P A;  5BN5 A;  3S2H H;  4PMC A;  4JI4 Q;  1LTG D;  1BKB A;  4DR4 Q;  4DR6 Q;  1TWA H;  1SE3 A;  3PUZ A;  3KUP A;  1IKM A;  4F87 A;  1NY4 A;  1LTR D;  4RMF A;  2AQ2 B;  4TQU S;  3MEH A;  1SYD A;  2R93 B;  3NBH B;  3A8J E;  4QY7 A;  2EY5 A;  1TWH B;  4IUQ A;  3ITP A;  3GTM B;  3CCU A;  4HJA A;  2E75 C;  4UPA A;  2AUK A;  4A3K B;  4NXN Q;  1WFQ A;  2I0Q A;  2JXM B;  3OTO Q;  1TKW B;  1E24 A;  1VQA A;  1SND A;  2ATW A;  2JP1 A;  1I4Q A;  1TY0 A;  2A19 A;  1SJH D;  1WYD A;  5I2Y A;  3O13 A;  3T4A C;  3QO2 A;  5KIX A;  3H09 A;  4R8I A;  2ICI A;  2VQF L;  3MXN B;  1XXG A;  3H0G H;  5IIF A;  2SDF A;  1Y8O B;  4NPS A;  4DV4 L;  1OTC A;  1IBK Q;  1HUM A;  3A8K E;  1ASY A;  2UXB Q;  3NPP A;  3I7F A;  3G71 A;  2Y0S G;  3NBI A;  4S3S A;  2ZT9 C;  5CMD A;  2MJ8 A;  2PQA A;  4XQQ A;  3HRZ C;  2BH2 A;  1KD1 C;  1V1Q A;  2RDH A;  4JI8 Q;  1V8Q A;  4BXX H;  1S72 A;  1FD7 D;  1VMC A;  2ICE C;  4A3F G;  5LMN L;  1K8G A;  3SEB A;  3GTG B;  4XDX A;  5C4X G;  4X3K A;  3STB D;  1X9N A;  4B3T L;  4ZUI A;  5DNF A;  4NXM L;  5FLM G;  1VF7 A;  2VZA A;  4RHS A;  4A3G B;  5T1G A;  4DV1 Q;  4DAP A;  2B2W A;  3H94 A;  2R7Z H;  3HOW H;  1OXV A;  3I90 A;  4LUV A;  1LTS D;  1WJJ A;  2Q2H A;  4HSP A;  5CYU A;  5KRU A;  1EFW A;  4WJ3 M;  2M2L A;  2BA1 A;  4X3T A;  1C9O A;  1SJE D;  3BJU A;  4A76 A;  2JA7 B;  1JOK A;  1QE6 A;  2XVS A;  4DV0 Q;  2UUB Q;  2HUG A;  2JA8 H;  4L5Q A;  1X3E A;  4K5W A;  5A2Q E;  4LF5 L;  1DM0 B;  3HOY G;  4GKJ Q;  4LF8 Q;  1STY A;  4BY7 H;  1CTM A;  5AJ3 L;  3S2H B;  1HQR D;  2K5H A;  3GTK H;  1ILQ A;  4LF9 L;  1TWA B;  4HIM A;  3E9I A;  4DUY Q;  3S1R H;  2MHV A;  4JI0 Q;  4IPC A;  4ZCK A;  1CT1 D;  1TR5 A;  2CH4 A;  1KC8 C;  4P75 A;  1IYV A;  4DV5 L;  4C3I H;  1BBU A;  1A15 A;  4PQX A;  2XIW A;  2EJM A;  5KNB A;  3J81 E;  4QL5 A;  1SE2 A;  1Q1B A;  1Q81 C;  4UHV A;  3V05 A;  3OW2 A;  2F03 A;  4HN7 A;  1XPO A;  4RFB A;  2KUM A;  2AQ1 B;  4EX5 A;  1E2W A;  4UAI A;  1EYD A;  5M3F G;  1CI3 M;  3DEO A;  4R4T A;  1GJX A;  1N8R C;  5C4Z A;  1VQP A;  2MPM A;  3H0G B;  1EWC A;  1J5E L;  5M5X B;  4DR1 Q;  3JAM c;  4B3S Q;  1HNX L;  2R7Z G;  1ZKO A;  4C1N K;  4NKL A;  4XYO A;  4POG A;  1ILP A;  1SEB D;  3SVM A;  2EYM A;  3EA6 A;  4WOR A;  4P74 A;  4A3B H;  1DOM A;  2YTY A;  3KLR A;  4RA8 A;  4UY8 C;  4A3I B;  4HED A;  3NUC A;  3VYU A;  1CKN B;  5GAE C;  3RN2 A;  3AFQ A;  3J7A 5;  3D0F A;  4LF6 Q;  3MC0 B;  3GV3 A;  3JAM L;  3SR1 A;  3K58 A;  2NVY H;  2F4V L;  4A3D B;  3UDG A;  1HH2 P;  2JN4 A;  2Q2I A;  2ZM6 Q;  4PZ8 A;  1JMC A;  2JJQ A;  4LK1 C;  5E4X A;  3I73 A;  4DR7 Q;  1J6Q A;  1SFO H;  3TDQ A;  3CCM A;  1HA5 A;  1JWU D;  5A35 A;  2OCE A;  3LWU A;  4IFD I;  1HA6 A;  5EAY A;  5D65 A;  4IPD A;  2JA5 H;  3R8B A;  1B9N A;  4GS3 A;  1G6P A;  3S15 H;  5JEA H;  5EQ0 A;  1YNJ C;  2PYK A;  3FPP A;  1K9M C;  1AEX A;  1IYU A;  4JOI C;  4C3H H;  2JA8 B;  2TMP A;  5LMU L;  1I94 L;  4E6I A;  4G7H C;  1M1K C;  4LF7 Q;  1N34 Q;  4QCL A;  4PG3 A;  5ELF A;  4A3L H;  4TVA B;  5E7N A;  1V1O A;  1PMR A;  1PRT B;  3GTK B;  1EY0 A;  1EY9 A;  3PF5 A;  3KBG A;  3HOV H;  1PYB A;  2R61 A;  1WTH A;  1L0W A;  1AE2 A;  4C1N I;  3S1R B;  1LTL A;  4RGM A;  1B53 A;  4ZRZ A;  3K8A A;  4XYQ A;  3MXU A;  4XQJ A;  4XT3 B;  1F9P A;  5D14 A;  2PMZ E;  5K36 H;  3ULP A;  4DAM A;  3G7L A;  5EKK A;  1AW7 A;  4DPG A;  1TWG B;  4ZAI A;  3BS1 A;  1DON A;  1Q82 C;  2QCP X;  2OQ0 A;  1MD2 D;  3AU7 A;  3S1M H;  1AFP A;  1QZG A;  3TQY A;  2DJF C;  1G8Z D;  3NHH A;  2ZXO A;  3OIQ A;  1HZA A;  1Y8P B;  2ALY B;  3FVQ A;  1F9Q A;  2NN6 H;  1II3 A;  4BBR G;  1HZC A;  1RF2 D;  3D4W A;  4N8X 1;  3OYY A;  2E2D C;  4BBS H;  1SR3 A;  1Q86 C;  3A7A B;  3VA5 A;  4OIJ A;  1IBL L;  3ER0 A;  1L0X B;  4N9T A;  1JJC B;  2K50 A;  1W6K A;  3A8I E;  1RDP D;  3BZK A;  1XMO L;  2CFM A;  1UNS A;  3CCJ A;  1QVG A;  3OMC A;  3ND8 A;  1STB A;  4DAV A;  2QKI C;  2ENB A;  3KLW A;  1EEI D;  4JK1 C;  4JV5 Q;  1C4Q A;  4IQZ A;  3IAY A;  1D7Q A;  1WD1 A;  2EDG A;  2PW5 A;  1VQN A;  1TY2 A;  4A3B B;  1RHP A;  2MFI A;  5M5W B;  3M4Y A;  1UWV A;  2KEC A;  4L5S A;  1CA6 A;  2NVY B;  3P20 A;  1K83 H;  1X3F A;  1QUQ B;  2F0T A;  4IFD G;  1Y1V G;  1QNK A;  1KIX A;  1T5E A;  1E1T A;  5I9O A;  1EFI D;  5LMN W;  1N36 L;  4R4I A;  4HMI A;  1JT8 A;  3KBX A;  2D0P A;  1B2T A;  2BOS A;  2KJX A;  3KF6 B;  1O80 A;  2JA5 B;  2K1B A;  3QOJ A;  2MO1 A;  1S5F D;  5CV8 A;  1DOL A;  2NUC A;  3S15 B;  1I50 H;  4HID A;  4CHT B;  5COR A;  4JI2 L;  1YI2 A;  1U9R A;  1YNJ D;  2F0G A;  4ME5 A;  1D5Z C;  4C3H B;  1E2V A;  1LTT D;  2NTS A;  4GN5 A;  1AN8 A;  2E2H B;  1EU4 A;  4EQP A;  1WCM G;  5M3M G;  1PA6 A;  5JPN C;  1VCI A;  3UE0 A;  4B3M Q;  4DAY B;  3K5O A;  5JJZ A;  4Z9C B;  3HOV B;  4MHE A;  2G5D A;  3C2P A;  4CDC C;  1UE5 A;  3CF5 A;  2Z8L A;  1V9P A;  4IUV A;  2R92 G;  2CW0 C;  4L63 B;  2GVB A;  1SYF A;  5C3W A;  4A3E B;  1TS2 A;  4FXK C;  5JJL A;  3VR2 A;  3ULJ A;  1WOC A;  2DNC A;  3H3V H;  1SMY D;  3J7A F;  2JQO A;  2JK8 A;  1GVP A;  1K8M A;  2K33 A;  3JAM E;  4DK1 A;  3KLS A;  1GHJ A;  3DXJ C;  5C3E H;  4QB4 A;  1R4Q B;  3GTO B;  2BDN A;  4N8F A;  2YV5 A;  5KEE A;  1S4Z A;  3PQI A;  4BBS B;  2J0T D;  5AFW A;  4EGV A;  1H95 A;  3CRK C;  3ULL A;  3K6O A;  1UE1 A;  1CUK A;  2MQH A;  3GDE A;  3HOU G;  4JBW A;  2A73 B;  4A3C G;  1D6E C;  1CQF A;  4BY1 G;  3OPO A;  4NP5 A;  5E1F A;  4K0K Q;  1JOR A;  1XNR L;  1DOK A;  1EY7 A;  4CKE A;  2A1A A;  4AQY L;  3G6E A;  4M8A A;  4X65 Q;  1EYA A;  1TS5 A;  3GO5 A;  1AE3 A;  4QQB X;  3CCS A;  4MZ9 A;  5D3I B;  2CCZ A;  3PUW A;  1G2T A;  4RKL A;  2A5H A;  4XQN A;  1KL9 A;  2B8G A;  4JI6 Q;  1QZH A;  1IL2 A;  4EVO A;  2EXZ A;  1VQH A;  2F0U A;  3RLO A;  1MIU A;  1H9R A;  3NE5 B;  4YY3 L;  4DF7 A;  5LL6 X;  3AFP A;  4R9W A;  2NBF A;  2BCO A;  1A2U A;  4GOP C;  3NQI A;  1K83 B;  2MNA A;  2OT2 A;  2WII B;  3WOF A;  2F0F A;  4IJH A;  5M5Y B;  5C5M A;  3L7Z C;  3I4M G;  4JI1 L;  3U9S A;  4FVM A;  4KLK A;  1EIG A;  5JJK A;  4LFA L;  4IUT A;  3S17 H;  2F3W A;  1JWS D;  2HHH Q;  2K52 A;  2N8N A;  3E0E A;  5EPK A;  5DAU A;  1BR9 A;  1UE7 A;  2RCF A;  2SNM A;  3PO2 H;  1H9J A;  1I50 B;  3IL8 A;  1STN A;  5C0X H;  3J80 i;  3MFY A;  1CZG A;  5J1Z A;  4JYA L;  4L8J A;  4A3K H;  3T56 B;  2VUM G;  1RD9 D;  4A3M H;  2EY1 A;  2K75 A;  1L1O B;  1EIY B;  5G3L F;  4IUP A;  4QF4 A;  1B70 B;  1VQI A;  4JCV E;  3E3X A;  1SE4 A;  4V0B A;  2CHB D;  2XNA C;  1BNZ A;  3AEV A;  2KED A;  1JE5 A;  3T13 A;  4QJF A;  4DV7 L;  4Q0F A;  1ENF A;  2SOB A;  1TVX A;  2QW7 A;  4YWM A;  4JI5 Q;  2BE5 D;  2B2Y C;  5IYD H;  5IYB H;  3K5L A;  4DR3 Q;  2RDG A;  1EWI A;  2OQK A;  3M4O B;  4GZY C;  3LX0 A;  1X54 A;  4LMQ D;  3NEL A;  3NWS A;  4K2L A;  1DYQ A;  1SLJ A;  4TKO B;  3I4O A;  4NB3 A;  4H02 A;  3STB C;  1NR2 A;  2RSO A;  2HDL A;  1Z7T A;  1XWE A;  3J81 i;  1EZ8 A;  1ESR A;  1HXY D;  4X3S A;  1UAP A;  1NNX A;  2I46 A;  1CKM A;  4LFC L;  3TSS A;  2XRQ D;  1MBY A;  2AUJ D;  2OEO A;  4YHH Q;  1OXT A;  5IYC H;  1W3S A;  5C5L A;  4RGN A;  5KND A;  3K7A B;  3AMU A;  1SE8 A;  5GAD C;  1HRJ A;  2B2T C;  2PNR C;  1HUN A;  1MSG A;  2R93 G;  2B2U C;  2RBM A;  1CFM A;  4DV2 Q;  2WP8 J;  4HIO A;  1GUN A;  1I3Q B;  1PH2 A;  1EY5 A;  3NP8 A;  2JA6 H;  3OMG A;  4IZ8 A;  4G4K A;  4JI4 L;  1LM0 A;  5C44 B;  1SNP A;  4DR4 L;  2RSN A;  4AH6 A;  2PI2 A;  1PDQ A;  3LGJ A;  1U0L A;  2F0W A;  1LAB A;  1KNE A;  1LT3 D;  2A69 C;  2EIF A;  1TWF B;  4RHR A;  4A93 H;  5KNC A;  3S17 B;  4P73 A;  2IWH A;  5IP7 H;  3EIV A;  2X69 A;  5GAG C;  3GTL H;  4JBK A;  1UEB A;  5CR3 A;  2LY7 A;  5TSS A;  3DM1 A;  1GM5 A;  3PO2 B;  3WDN A;  1VF5 C;  4CJ2 C;  3I4L A;  4KY5 A;  3EFX D;  2Q2T A;  4JOI A;  2WFW A;  1U4R A;  4NXN L;  4J1M A;  4GLA C;  1OXS C;  3NSW A;  1HCZ A;  3RMH A;  2TSS A;  4L6T B;  3FRP B;  5E4W C;  4A3M B;  4Y52 H;  4QIW B;  2K28 A;  3PCO B;  4OWX B;  3GD7 A;  3HOX B;  2ES2 A;  5CBE E;  1SAP A;  3PIO 3;  1V43 A;  1H9S B;  2FFK B;  3SK5 A;  1AP0 A;  5IWA Q;  2D2C C;  2I07 B;  5IGE A;  3TP6 A;  3UE1 A;  2QEX A;  2ZXR A;  4KKU A;  1U4L A;  5C4J H;  4RG1 A;  1OO9 B;  1PFB A;  1TWC H;  2F0V A;  5M5X H;  4A3G G;  4KK7 A;  2L55 A;  3EVQ A;  3D31 A;  4R4Q A;  4IN3 A;  5M9O A;  2NVT B;  2K04 A;  1VQG A;  4JI8 L;  1GUO A;  1VQC A;  3A5U A;  2L5T A;  2JYO A;  1WTR A;  1LTB D;  5IP9 H;  2JA7 G;  1SYG A;  2IHF A;  1HTL D;  2RF4 A;  3BYY B;  1XX8 A;  3M9B A;  5ELC A;  4A3I H;  4DKA C;  3UDI A;  4X62 Q;  1J9O A;  2R7F A;  3MA2 B;  1KLG D;  4ZUJ A;  5FKA C;  1KXL A;  4MIU A;  4WRD A;  4A3D H;  4DV1 L;  2DY7 A;  4XIG S;  5FOB B;  2UU9 L;  5EPL A;  3KJP A;  1GXD C;  1SRO A;  1YHB A;  3J80 E;  1G29 1;  2IPK D;  4A75 A;  3TZU A;  5NUC A;  4U67 3;  1JIC A;  4UP8 A;  4K6L A;  4DV0 L;  2UUB L;  3UI2 A;  3VDY A;  4GKJ L;  4LF8 L;  2JA6 B;  1CHP D;  1PRT D;  1EZ6 A;  1TS4 A;  4UP9 A;  4JI7 Q;  4CJ1 B;  4PNY A;  2Z6B A;  5DM6 3;  1W2B A;  2HD3 A;  3CU7 A;  3K59 A;  1I6V C;  4O1N A;  2Y0S B;  3I72 A;  2VY3 A;  2A69 D;  4JI0 L;  4YWK A;  1YJ9 A;  4A93 B;  3IKJ A;  4DV3 Q;  3T1Y Q;  3S1N H;  4EQO A;  3GTL B;  2F0D A;  1NBW A;  2J4X A;  3Q23 A;  3H0G G;  3VA7 A;  1HFN A;  3ERQ A;  2J7Z A;  3H6M A;  5I9P A;  3KOJ A;  3I56 A;  3OSO A;  4ALP A;  5IGC A;  1X55 A;  2JE6 I;  4KTA A;  1TWG H;  1C0A A;  1K73 C;  4RWS C;  1RCV D;  5CV5 A;  3Q24 A;  3MXN A;  4B08 A;  4BXX G;  5EJW A;  5BR8 L;  1JQY D;  2N49 A;  2PCF B;  4P2C B;  2LKV A;  3J7Z C;  4DA2 A;  5KYL A;  1R9T B;  1PH9 A;  2MP1 A;  5IT9 L;  4DR1 L;  2B63 H;  4B3S L;  3W1B A;  1TS3 A;  3N52 A;  4X66 Q;  3TRZ A;  5C4J B;  4KHZ A;  1FNU A;  1TWC B;  3CD6 A;  2EQS A;  3CAM A;  3BU2 A;  4AIM A;  3BG3 A;  3S1Q H;  3HOW G;  1BDO A;  1RTN A;  4C3J H;  2UUA Q;  3RNU A;  4A3J H;  3CP0 A;  2GA4 B;  1J8I A;  1BCP B;  4GLV B;  4HSV A;  1E22 A;  3HKZ B;  5M5W H;  3A56 A;  4K14 A;  4DK6 C;  2K5V A;  1HR0 Q;  1D8L A;  4LF6 L;  2JA8 G;  4KHP Q;  4DN4 M;  3TME A;  1RTO A;  2F0E A;  3M7G A;  4CKB A;  4BWG B;  3CQZ H;  3NEN A;  1HZB A;  1QVC A;  4X3U A;  2ZM6 L;  1L0Y B;  1A62 A;  4BY7 G;  1PH8 A;  4IOC A;  2VS1 A;  3MTS A;  2KEE A;  3JAM i;  3RR5 A;  4DR7 L;  5T1I A;  1B1Z A;  1VS0 A;  1PFN A;  2G9H D;  4AYB B;  4MNO A;  2DGY A;  4UP7 A;  1XTD A;  3MHB A;  2RA4 A;  2LMC B;  1VQB A;  4ID6 A;  4IPH A;  5M3F B;  1HNW Q;  4C3I G;  1H9M A;  3M7N A;  1C48 A;  2K7V A;  4YCW A;  2H1E A;  4OL7 A;  2ASB A;  3F2U A;  1N34 L;  4LJZ C;  4GOP A;  4DR2 Q;  4R8N A;  1OXX K;  1TXY A;  3KLS X;  2AQ3 B;  1QVF A;  2E2H H;  3C1F A;  3D3R A;  2EZV A;  2F0H A;  4J15 A;  3KF8 B;  2IY5 B;  1B44 D;  4IUR A;  2OTL A;  3VR4 A;  2E8G A;  3PSI A;  3S1N B;  1UEA B;  1ZEQ X;  3NEM A;  2E74 C;  3K0Y A;  1TII D;  4R1J A;  2NN6 I;  4GNX B;  4JI3 Q;  2IL8 A;  4KN7 C;  1JWM D;  1PH3 A;  3S16 H;  4A3E H;  1D5X C;  5G3L D;  2FMC A;  2XRS D;  3I4N H;  4ZYS A;  1YZ6 A;  1Z6H A;  4FF4 A;  1SMY C;  1XPU A;  5FK9 C;  1KQS A;  2QDL A;  1M90 C;  4FXG C;  1BQQ T;  3I2Z A;  4RAU C;  4C56 C;  4A3B G;  3OW7 A;  4ZKC B;  1EQV A;  3PIP 3;  1GOZ A;  1CZW A;  1HFG A;  4ILW A;  5HGQ A;  3GTO H;  4KD3 A;  3PF4 A;  4DK0 A;  1PH7 A;  3C3L A;  1DXM A;  5IOD A;  2F0L A;  1VQ5 A;  3UDX A;  5I2X A;  3FMC A;  2B63 B;  3HZX A;  5EPJ A;  4EQN A;  1FL0 A;  3CMA A;  3A7L A;  2VB2 X;  4DV6 L;  2ZXP A;  3U58 A;  1SXT A;  1B3Q A;  2KCN A;  1XMQ L;  3S1Q B;  4J6H A;  2LXJ A;  2B2Y A;  2EJF C;  1KDB A;  4C3J B;  3TP5 A;  1CKN A;  1Y1W B;  4A3J B;  2JA5 G;  5ELE A;  1EY8 A;  1CKO A;  1BXT A;  1KAA A;  1HZ9 A;  5JEA G;  1PYW D;  5FJ8 H;  3L3O C;  3SXH A;  4IAL A;  3CRL C;  1YIT A;  1SNQ A;  1I6H H;  1D2B A;  2K5Q A;  4PMB A;  4OXP A;  4Y7N H;  4C3H G;  3BDC A;  1PVO A;  3HOZ B;  3U50 C;  3CQZ B;  4GN4 B;  1FJG Q;  2WB1 B;  3Q0A A;  1WVL A;  2YYZ A;  4X64 Q;  5LL6 S;  4A3L G;  1VQK A;  1IL8 A;  2EPB A;  4JBM A;  2OTJ A;  5IGG A;  3Q6S A;  1AZQ A;  5M5Y H;  3HOV G;  5D3D A;  1PRT F;  2IX0 A;  1HJP A;  5EBC A;  2DJG C;  2WAQ B;  3TP8 A;  2B2T A;  2VQE Q;  4G7Z C;  1A3U A;  4LAA A;  1EYG A;  2B2U A;  1FNW A;  1GUT A;  3H15 A;  4ZK9 B;  5K36 G;  1ENA A;  1NJI C;  2RCN A;  3D8G A;  1PTO H;  2ID0 A;  1Q8K A;  1WTX A;  1YIJ A;  5CGK A;  4FDB A;  4B3M L;  2O4X A;  3RZO H;  4O0A A;  2ZTD A;  1N32 Q;  5E3F A;  3MAQ A;  2LS0 1;  1OXU A;  2NN6 G;  1N36 Q;  3H3V I;  4DUZ Q;  4OON A;  1YBY A;  2E5L Q;  2Z0S A;  2H5X A;  2F1M A;  4BBS G;  3TS2 A;  3BDO A;  1EY6 A;  3BDL A;  1JB7 A;  1QWY A;  1STH A;  2G9D A;  3RZD B;  2YTV A;  5ELN A;  3T16 A;  1Z9F A;  2R3Z A;  3S16 B;  3WWV A;  3I4N B;  1GKH A;  1NCV A;  3EN2 A;  1DJR D;  1X32 A;  2D9U A;  3VYT A;  2A68 C;  2BE5 C;  1X65 A;  3FP9 A;  1DGS A;  5I6Y A;  3FKI H;  5CBA E;  3D6C A;  1SNC A;  3M4Q A;  3K57 A;  1ONL A;  1QG7 A;  4HJ8 A;  3M4O H;  1TT2 A;  4CDE C;  3AB9 A;  1SYC A;  1G51 A;  1LLR D;  1Y69 U;  3DWA A;  3CC7 A;  4FYD A;  1TQO A;  4RGO S;  3CKI B;  4K0K L;  2HQL A;  4DFA A;  3GTJ B;  5CV6 A;  2UXC Q;  1I4G A;  4RCO A;  1S3O A;  2F0M A;  2EY2 A;  4EQ5 A;  4X65 L;  5HGT A;  1WCM B;  5M3M B;  1KRS A;  3A55 A;  3NXW A;  5DLQ E;  1LT4 D;  2K5N A;  4P72 A;  2NVQ H;  4GKK L;  2MO0 A;  1ROD A;  3K7A H;  4JI6 L;  1GUS A;  3QWN A;  3KK7 A;  1I6H B;  4LW1 A;  2UXD Q;  2PZT A;  4TRD A;  4Y7N B;  2PZU A;  2R92 B;  4B9W A;  1I3Q H;  1GD7 A;  4B9X A;  3DWP A;  3T1H Q;  2X6G A;  1B8A A;  4KY7 A;  1KRT A;  2JEA I;  1VQ6 A;  2Y0S E;  2F0Q A;  5C0X I;  5C44 H;  2E76 C;  1VQE A;  1HPC A;  4OO1 I;  1U4P A;  2CH4 W;  3P7J A;  1I4P A;  2Q8I B;  2HHH L;  2EYO A;  1SDF A;  1Q12 A;  2WV6 D;  4CDF C;  3U4Z A;  1FYC A;  3A74 A;  1TWF H;  4OEL B;  4ULL A;  3TS0 A;  5FO8 B;  3PO3 H;  4DU9 A;  3U4V A;  5EBD A;  3VYR A;  4ZKB B;  2IJ0 A;  4ME3 A;  1XNQ L;  1PYS B;  4DAY A;  5C4H A;  3S14 H;  2JSO A;  1K0R A;  1PTO B;  2WKD A;  1V1P A;  3AYH B;  5F2D A;  1EUJ A;  1S5B D;  4OO1 H;  3RZO B;  3NQT A;  4A4I A;  1IW7 C;  3J7A V;  2EYP A;  5C3E G;  4R4O A;  2NZH A;  4JI1 Q;  3T51 B;  3ZJY C;  3HOX H;  2D5D A;  1PV4 A;  3I55 A;  4K2K A;  4KJO A;  1N33 Q;  2XSC A;  3CCQ A;  1G6Z A;  2F0S A;  1PFS A;  3R2I A;  3HG9 A;  1PHJ A;  4NDX A;  3S9W A;  2K5W A;  2VL6 A;  1BVS A;  4FO2 A;  4JI5 L;  3TP7 A;  2UUC Q;  2HIV A;  5IOC A;  5IGD A;  3Q8D A;  1ZYR C;  4DNR B;  2A68 D;  4DR3 L;  2NWG A;  3U9O A;  2NVT H;  3I91 A;  1D5M C;  4HJ7 A;  2L1B A;  4L5T A;  1IBM L;  3I4M B;  3FKI B;  3HKZ E;  3QB3 A;  4IJL A;  2KEN A;  1AZP A;  2C9O A;  5IY0 A;  2KVM A;  4PZ6 A;  1GHK A;  2K5D A;  3HKS A;  1GO3 E;  2IT1 A;  4IUU A;  5C6A A;  1HNZ Q;  4H0L C;  1O7Z A;  3F2B A;  1LTA D;  3C1E A;  1EOV A;  2F0N A;  2IX3 A;  4X6A H;  1EQT A;  4AYB E;  4ODG A;  2CQA A;  3VR3 A;  3F2C A;  4YHH L;  2YU9 B;  1BBW A;  1FGU A;  1UE6 A;  1NMG A;  4YWL A;  4APV A;  5FO7 B;  4LF4 Q;  2KHJ A;  4H13 C;  2NVQ B;  2B29 A;  2KQ3 A;  1IHZ A;  5J22 A;  1WD0 A;  3OWF A;  3PO2 G;  1F2Y A;  1U5K A;  2NB0 A;  3BZC A;  2EY6 A;  4DV2 L;  4OIK A;  3GTP H;  4FF1 A;  2DUD A;  3RUZ A;  4H44 C;  5C0X G;  2RHQ B;  2PQA B;  5FLX c;  4OX9 Q;  5JOB A;  1PRT C;  1PTO F;  1A63 A;  4A3K G;  2L15 A;  1EQQ A;  1VQM A;  4B3R Q;  1QJO A;  4LFB Q;  3ERO A;  3L2P A;  4A3M G;  1I5F A;  4JC0 A;  1EEF D;  4QUC A;  5KGU A;  3QIA A;  2Q8R E;  1RL2 A;  2AKW B;  2ZTC A;  2WIN B;  4GNX C;  4DR6 L;  1EL0 A;  4LFC Q;  3QJY A;  2H4O A;  3X3M A;  1D1I A;  5GAH C;  3W3A A;  4JG2 A;  4XTC S;  4RKB A;  1UUP A;  1X3Q A;  3RLN A;  4K6D A;  1JC7 A;  3PO3 B;  1VQ4 A;  3GQB A;  4FF3 A;  1HTP A;  1EIH A;  4A3F H;  5FLX L;  3SK4 A;  1PH6 A;  2KA7 A;  1WTP A;  4DR5 Q;  1GUW A;  3S14 B;  1T9H A;  5FO9 B;  1L1O A;  5C4X H;  3B6Y A;  4DNT B;  3R93 A;  3CC2 A;  1E3P A;  3OTO L;  3MVV A;  5BN4 A;  5FLM H;  1SYB A;  2HCI A;  5IGB A;  4KKS A;  5IYB G;  5IYD G;  4PV1 C;  1ICF B;  2X6L A;  1D1K A;  1F9R A;  1Z47 A;  1IW7 D;  3VR6 A;  2QEJ C;  3T53 B;  4GLX A;  2V4D A;  5IWA L;  1KHI A;  1JR0 D;  4R4C A;  2A74 C;  1VQ7 A;  1X3G A;  1ICW A;  2Z6K C;  5EGT A;  1Q3L A;  2JA9 A;  3P1H A;  1R9T H;  2EOT A;  2VXW A;  1Y14 B;  1NAP A;  5ISR A;  1BCP D;  2KCM A;  1IBK L;  4QMG A;  1BO0 A;  2UXB L;  2PQE A;  3A5Z B;  1JOO A;  3HOY H;  2K6A A;  1WTV A;  5IYC G;  1YJW A;  1A3T A;  1ZYR D;  1F2M A;  4H7B A;  1YHA A;  1N9W A;  3DM3 A;  4M1U B;  3CME A;  3D4D A;  2N78 A;  1MHW C;  3ONA B;  3W5O A;  3V2T A;  3PUY A;  2QIL A;  4X62 L;  1EOT A;  3KDF A;  1STG A;  2JA6 G;  2WB1 E;  3PIO A;  1CA5 A;  1G91 A;  3G4S A;  1E0B A;  2OF1 A;  2VQF Q;  2A6H C;  1K3B C;  4RH6 A;  3M4P A;  1RJT A;  2Z9H A;  1O7L A;  2PZW A;  3NK9 A;  2DN8 A;  3JC6 6;  3E9H A;  1JOQ A;  2F0K A;  2C5C A;  4DV4 Q;  4MTK A;  2MUY A;  2WAQ E;  1VQ8 A;  1S5D D;  4A93 G;  5IP7 G;  2O5J C;  3K80 C;  3MZ5 A;  1R4P B;  3F2D A;  1TU2 B;  3NTH A;  1K8A C;  2R6G A;  2EE1 A;  1WI5 A;  3EJI A;  1PZK D;  1E1O A;  3V96 A;  3ICE A;  5IGF A;  3GTP B;  5M3F H;  5JPM C;  2CKZ B;  5LMN Q;  1LO5 D;  5KYI A;  4JI7 L;  2CVR A;  1ML0 D;  2QDB A;  4HTH A;  1E7Z A;  1YVC A;  4B3T Q;  2QF7 A;  4ABN A;  4HJ5 A;  4NXM Q;  1QOH A;  2UU9 Q;  3VR5 A;  2IHE A;  3QOL A;  3NBH A;  4DV3 L;  3T1Y L;  4OGQ C;  2RVL A;  4DUY L;  1Q7Y C;  2HDM A;  2B2V C;  1B7Y B;  1QNU A;  2Z1C A;  1NUC A;  4OHJ A;  3BVG A;  4K5V A;  4A3F B;  2FXQ A;  4CBV A;  3F8T A;  4NW2 A;  5C4X B;  5IT9 c;  4XT1 B;  1LAC A;  1H9S A;  5J39 A;  3ND9 A;  1EY4 A;  4XXE A;  2LSS A;  3TRE A;  2CWP A;  2BDO A;  3PUX A;  5JEA J;  4LF5 Q;  4I7Z C;  4F8M A;  1FGB D;  2FJ2 A;  3PMF A;  1B4O A;  5IP9 G;  5AJ3 Q;  1KNA A;  2OWO A;  3HKZ G;  4GOP B;  5CV4 A;  1NSN S;  2RDF A;  1BUV T;  4LF9 Q;  4Q5V A;  3PV0 A;  4A3I G;  3NWT A;  1VQF A;  4DXG A;  3BZD B;  2F4I A;  4IFD J;  1L2F A;  3EBE A;  4X66 L;  4JBJ A;  2GN5 A;  1MI2 A;  2EJG C;  2EYL A;  2L11 A;  3X3N A;  1K0S A;  4HMJ A;  1PH1 A;  4A3D G;  2D0O A;  3FHW A;  4DV5 Q;  2PO4 A;  4DK3 C;  1BF4 A;  3E0J A;  4AYB G;  1T5X D;  2UUA L;  3HOY B;  1K8O A;  3J7Y W;  3CCR A;  4KY6 A;  2K05 A;  5GRO A;  1YNX A;  4LUZ A;  2PNH A;  4WFN 3;  1Y1W H;  1K28 A;  5DEH A;  1SYE A;  3RLF A;  5H1S E;  1SBB B;  3R2T A;  1MJE A;  4QUF A;  2NYZ D;  3SHL A;  5BR8 Q;  1HR0 L;  4KHP L;  1XPR A;  2JEB I;  4RCN A;  3QG1 A;  1ZXT A;  4LWC A;  4O2D A;  4HCE A;  5HY6 A;  3TZD A;  2A8V A;  3HOZ H;  1ASZ A;  1YNN C;  3FPU B;  2A6H D;  1J5E Q;  1ET9 A;  5FLX E;  2KHI A;  2P5Z X;  3K5M A;  3K81 C;  5JJI A;  1HNX Q;  1K3R A;  2NTT A;  4TSS A;  3J81 j;  2EYF A;  1FVI A;  4K8J A;  1W6J A;  4P71 A;  1PTO C;  3HEJ A;  3W1G A;  1HNW L;  2SNS A;  4YIJ A;  1VQ9 A;  4BBR H;  2AHO B;  3CPW A;  2QA4 A;  2O2L D;  3KJO A;  2IW3 A;  4V19 0;  2VB3 X;  2F52 A;  4OWW B;  2XGT A;  5EKI A;  5JAV A;  4DR2 L;  5ELD A;  2BA0 A;  2KBN A;  1L1O C;  1F9S A;  1JE4 A;  1DZ1 A;  3OWE B;  4LF7 L;  1JB3 A;  2F4V Q;  1LT5 D;  1F2L A;  1CSP A;  2L4N A;  3MWY W;  3N6R A;  5CV7 A;  3HGB A;  1STA A;  1AH9 A;  2R7Z B;  3HOW B;  4KJN A;  2PI2 E;  2CQO A;  4HIK A;  2F0I A;  4KN4 C;  3DHQ A;  4JI3 L;  4F88 A;  4K8I A;  2B3G A;  4RGT A;  3NTI A;  2B63 G;  3H3V C;  3PGZ A;  1C8C A;  3MFG A;  3IFD A;  1P8L A;  3LWE A;  3RZD H;  1X6O A;  4BY7 B;  1M8A A;  1H9K A;  4C3J G;  1WTW A;  5LMU Q;  1I94 Q;  1LV9 A;  1Y1W G;  1JJG A;  4IFD H;  4A3J G;  1Y1V H;  2RKS A;  3D6W A;  5EKL A;  1A0I A;  2E2J H;  1BCP F;  3BYT B;  2Q8T A;  4YCV A;  4WJ4 A;  1IXR A;  1X56 A;  3HOZ G;  1QB5 D;  4JW0 A;  1IZ6 A;  4KKT A;  4C3I B;  2NZ1 D;  2WB1 G;  4O42 A;  2K01 A;  2RHS B;  1B9M A;  4MTN A;  3MXP A;  3BVZ A;  1SRU A;  2AWN A;  5IE8 A;  4QGU A;  5JVG 3;  1WTO A;  1S5E D;  3GTJ H;  4JV5 L;  3SE0 A;  1ENC A;  1WCM H;  2WAQ G;  5M3M H;  3PUV A;  1VQL A;  3G48 A;  2F0J A;  3CXC A;  3QR8 A;  1G2S A;  1I4R A;  1PH4 A;  4OWT B;  4C2M H;  2N3S A;  1CK1 A;  5CV9 A;  1YJN A;  3IFT A;  2KCT A;  1FJG L;  1MGS A;  1I4H A;  3PIP A;  2R92 H;  1O78 A;  4X64 L;  2I5L X;  1XYI A;  2IX1 A;  1B50 A;  1KAW A;  1ESF A;  1Y8N B;  3CCE A;  3TBI B;  1IBL Q;  4CGY B;  1YHQ A;  1YNN D;  4DV6 Q;  3M85 A;  3MEF A;  4IUN A;  1XMO Q;  1SSO A;  1VQD A;  2B2W C;  2Z4I A;  1XMQ Q;  2VQE L;  2R7D A;  3CCV A;  5I4D A;  2LFN A;  1PH5 A;  2K14 A;  1PTO D;  1A8V A;  1EWH A;  1CSQ A;  4HJ9 A;  2L9H A;  4BBR B;  1XJV A;  4GN3 B;  1C7Y A;  1DCZ A;  4UDU C;  4A3E G;  1KDC A;  3HS0 C;  3KF8 A;  4ZLT F;  3K0X A;  3I4N G;  2HIX A;  3ZYY X;  3K7U C;  1N32 L;  1LTI D;  3HOU H;  4A3C H;  2ZTE A;  4BY1 H;  3DMU A;  3GTQ H;  1IYJ B;  4QIW E;  2SEB D;  3SGI A;  3CC4 A;  4ZQ3 A;  4CKC A;  4DUZ L;  4GNX A;  5IT9 E;  1SFO B;  3S2D H;  2E5L L;  2HCC A;  3I70 A;  5HUR A;  3UDF A;  2EVB A;  1NTG A;  4KD4 A;  2M9V A;  1A6X A;  4IO9 A;  4CDD C;  1O7Y A;  1FR3 A;  2YTX A;  1E2Z A;  4OEM B;  2MGS A;  1JJ2 A;  1CM9 A;  2CWA A;  1XTC D;  4KMU C;  4JI2 Q;  4I7A A;  2DY8 A;  2NZO A;  1NMF A;  4KHV A;  1S5C D;  2N55 A;  2E2I H;  2KOL A;  2D62 A;  2NVX H;  1Y1V B;  2A6E C;  5C0X J;  1V1P B;  1EQR A;  3I4M H;  1VQJ A;  2AWO A;  5FJ8 G;  2E2J B;  2LXK A;  3TEH B;  2Z6K A;  2ZJP A;  1P16 A;  1Q46 A;  3LNN A;  3L9A X;  1NE3 A;  2ZJR A;  2UXC L;  2FIN B;  4PMW A;  1ET6 A;  1SNO A;  5COY A;  5ELB A;  4FNF A;  3I3C A;  4DGZ A;  2YU9 H;  5GQO A;  3S1M B;  2F3I A;  3E5S A;  2VUM H;  3SDZ A;  1HHV A;  3MXG A;  2I5M X;  2PW7 A;  4FP5 D;  5DM7 3;  1VQO A;  3A54 A;  3F1Z A;  2B8F A;  3L0O A;  2O5I C;  3CCL A;  2EYJ A;  3OHX C;  1MKH A;  2XTI A;  4F7X A;  2UXD L;  1SMX A;  1PLF A;  1PZJ D;  1QUQ A;  4L5R C;  4C2M B;  4LNQ A;  1LYL A;  4G57 A;  3FEW X;  3A0J A;  3T1H L;  1FNV A;  1Q8I A;  4BA2 I;  3EQL C;  1BOS A;  4DNI A;  3HP3 A;  3OOC A;  1VDZ A;  2HQE A;  2L0C A;  1IKL A;  1NR4 A;  3KF6 A;  1MJC A;  3NTK A;  1KDA A;  1LUZ A;  3CPF A;  2F0O A;  2EYH A;  4PZ7 A;  5K5P A;  1HR0 W;  1SNM A;  1XNR Q;  2OXP A;  2F0P A;  2V1C C;  5JVH 3;  4AQY Q;  4KV6 A;  1RIP A;  3ERS X;  4GKK Q;  5ELO A;  2Z4H A;  2WAC A;  2XWJ B;  2K4K A;  4JPB W;  3G6J B;  3J80 c;  2WKC A; 
#chains in the Genus database with same CATH homology
 1PFM A;  1PZI D;  5CC4 A;  1A2T A;  1KTK A;  3HOU B;  4BY1 B;  2KCC A;  1WTQ A;  3GTQ B;  1RKN A;  3S2D B;  1B3A A;  1STE A;  1CQV A;  3FDT A;  2B2V A;  4WJW A;  2XN9 C;  2PPB C;  5BN3 A;  1PXU A;  1LT6 D;  1JCK B;  4NMZ A;  3J80 L;  1Q1E A;  2F3V A;  1DD2 A;  3DWQ A;  3VYS A;  1MSH A;  4HCS A;  1Q90 A;  1VMP A;  1BCP C;  3H91 A;  1KAB A;  2K03 A;  2N88 A;  1A3V A;  3GV6 A;  4FF2 A;  3WOE A;  2E2I B;  3I8Z A;  1CHQ D;  2NVX B;  2XWB B;  2A6E D;  1QCB D;  4J8Q A;  2B39 A;  5A2Q L;  3R3O A;  5C3X A;  2KHS A;  2CW0 D;  5I6W A;  2K32 A;  1BBX C;  4CJ0 B;  1EYC A;  3GP7 A;  3URY A;  5LHY 1;  4HR7 B;  2FMM A;  3P75 A;  1F77 A;  3SK6 A;  2PMZ B;  1U4M A;  3C46 A;  2VUM B;  1KLU D;  1QIL A;  4KI0 A;  3DEP A;  5C3E B;  4G7O C;  2VNU D;  2M00 A;  3Q22 A;  1X3P A;  3D4R A;  3J81 L;  4HAE A;  3TN2 A;  1EU3 A;  1I4X A;  4OO1 G;  3OIP A;  4MN3 A;  1M4V A;  4K5X A;  4I65 A;  1HQM C;  2FHT A;  3CHB D;  3BVM A;  3E6Z X;  4BA1 I;  4BS9 A;  3K5N A;  4FXD A;  4U68 A;  3SK8 A;  1GUG A;  2DNE A;  3W2D A;  1F2Z A;  3RD4 A;  4DXF A;  3DUZ A;  2L12 A;  3M3Y B;  2RQX A;  4N9P A;  5BN5 A;  4PMC A;  1LTG D;  1SE3 A;  3PUZ A;  3KUP A;  1IKM A;  4F87 A;  1LTR D;  2AQ2 B;  4TQU S;  3MEH A;  1SYD A;  2R93 B;  3A8J E;  2EY5 A;  1TWH B;  4IUQ A;  3ITP A;  3GTM B;  2E75 C;  2AUK A;  4A3K B;  2JXM B;  1TKW B;  1SND A;  2JP1 A;  1I4Q A;  1TY0 A;  1SJH D;  5I2Y A;  3O13 A;  3T4A C;  3QO2 A;  5KIX A;  3H09 A;  4R8I A;  2ICI A;  1XXG A;  5IIF A;  2SDF A;  1Y8O B;  1HUM A;  3A8K E;  3NPP A;  3NBI A;  4S3S A;  2ZT9 C;  5CMD A;  2MJ8 A;  4XQQ A;  3HRZ C;  2RDH A;  1V8Q A;  1FD7 D;  1VMC A;  2ICE C;  3SEB A;  3GTG B;  4XDX A;  4X3K A;  4ZUI A;  5DNF A;  1VF7 A;  4RHS A;  4A3G B;  5T1G A;  4DAP A;  2B2W A;  3H94 A;  1OXV A;  3I90 A;  1LTS D;  4HSP A;  5CYU A;  5KRU A;  2M2L A;  2BA1 A;  4X3T A;  1SJE D;  2JA7 B;  1JOK A;  1QE6 A;  2XVS A;  2HUG A;  4K5W A;  5A2Q E;  1DM0 B;  1STY A;  1CTM A;  3S2H B;  1HQR D;  1ILQ A;  1TWA B;  2MHV A;  1CT1 D;  1TR5 A;  1IYV A;  1A15 A;  4PQX A;  2XIW A;  2EJM A;  5KNB A;  3J81 E;  1SE2 A;  1Q1B A;  3V05 A;  2F03 A;  4HN7 A;  4RFB A;  2KUM A;  2AQ1 B;  1E2W A;  4UAI A;  1EYD A;  1CI3 M;  3DEO A;  1GJX A;  5C4Z A;  2MPM A;  3H0G B;  1EWC A;  5M5X B;  1ZKO A;  4C1N K;  4NKL A;  4XYO A;  1ILP A;  1SEB D;  3SVM A;  2EYM A;  3EA6 A;  4WOR A;  1DOM A;  3KLR A;  4RA8 A;  4A3I B;  4HED A;  3NUC A;  3VYU A;  3MC0 B;  3GV3 A;  3JAM L;  3SR1 A;  3K58 A;  4A3D B;  4LK1 C;  5E4X A;  3I73 A;  3TDQ A;  1HA5 A;  1JWU D;  5A35 A;  3LWU A;  4IFD I;  1HA6 A;  5D65 A;  3R8B A;  1B9N A;  5JEA H;  5EQ0 A;  1YNJ C;  2PYK A;  3FPP A;  1AEX A;  1IYU A;  2JA8 B;  2TMP A;  4E6I A;  4G7H C;  4QCL A;  5ELF A;  1V1O A;  1PMR A;  1PRT B;  3GTK B;  1EY0 A;  1EY9 A;  3KBG A;  2R61 A;  4C1N I;  3S1R B;  4RGM A;  1B53 A;  4ZRZ A;  4XYQ A;  3MXU A;  4XQJ A;  4XT3 B;  1F9P A;  5D14 A;  5K36 H;  3G7L A;  5EKK A;  1AW7 A;  1TWG B;  4ZAI A;  3BS1 A;  1DON A;  2QCP X;  1MD2 D;  3AU7 A;  1AFP A;  1G8Z D;  3NHH A;  2ZXO A;  1Y8P B;  3OIQ A;  3FVQ A;  1F9Q A;  2NN6 H;  1II3 A;  1RF2 D;  3D4W A;  2E2D C;  3A7A B;  3VA5 A;  4OIJ A;  1L0X B;  4N9T A;  1W6K A;  3A8I E;  1RDP D;  1UNS A;  3OMC A;  3ND8 A;  1STB A;  4DAV A;  2QKI C;  2ENB A;  1EEI D;  4JK1 C;  1C4Q A;  4IQZ A;  3IAY A;  1WD1 A;  2EDG A;  2PW5 A;  1TY2 A;  4A3B B;  1RHP A;  5M5W B;  3M4Y A;  2KEC A;  1CA6 A;  2NVY B;  3P20 A;  2F0T A;  4IFD G;  1QNK A;  1T5E A;  5I9O A;  1EFI D;  4HMI A;  3KBX A;  1B2T A;  2BOS A;  2KJX A;  1O80 A;  2JA5 B;  2K1B A;  3QOJ A;  1S5F D;  5CV8 A;  1DOL A;  2NUC A;  3S15 B;  4CHT B;  5COR A;  1U9R A;  1YNJ D;  2F0G A;  4ME5 A;  1D5Z C;  4C3H B;  1E2V A;  1LTT D;  2NTS A;  1AN8 A;  2E2H B;  1EU4 A;  4EQP A;  5JPN C;  1VCI A;  3K5O A;  5JJZ A;  4Z9C B;  3HOV B;  4MHE A;  3C2P A;  2Z8L A;  4IUV A;  2CW0 C;  4L63 B;  1SYF A;  5C3W A;  4A3E B;  1TS2 A;  4FXK C;  3VR2 A;  2DNC A;  1SMY D;  3J7A F;  1K8M A;  2K33 A;  3JAM E;  4DK1 A;  3KLS A;  1GHJ A;  3DXJ C;  4QB4 A;  1R4Q B;  3GTO B;  2BDN A;  5KEE A;  1S4Z A;  4BBS B;  2J0T D;  5AFW A;  4EGV A;  3CRK C;  3K6O A;  4JBW A;  2A73 B;  1D6E C;  1CQF A;  3OPO A;  4NP5 A;  5E1F A;  1JOR A;  1DOK A;  1EY7 A;  4CKE A;  4M8A A;  1EYA A;  1TS5 A;  3GO5 A;  5D3I B;  3PUW A;  1G2T A;  4RKL A;  2A5H A;  4XQN A;  2B8G A;  4EVO A;  2EXZ A;  2F0U A;  1H9R A;  3NE5 B;  4DF7 A;  5LL6 X;  4R9W A;  2NBF A;  2BCO A;  1A2U A;  3NQI A;  1K83 B;  2OT2 A;  2WII B;  3WOF A;  2F0F A;  5M5Y B;  5C5M A;  3L7Z C;  3U9S A;  4FVM A;  1EIG A;  4IUT A;  2F3W A;  1JWS D;  5EPK A;  5DAU A;  1BR9 A;  2SNM A;  1H9J A;  1I50 B;  3IL8 A;  1STN A;  5C0X H;  3MFY A;  1CZG A;  5J1Z A;  4L8J A;  3T56 B;  1RD9 D;  2EY1 A;  5G3L F;  4IUP A;  4QF4 A;  1SE4 A;  4V0B A;  2CHB D;  2XNA C;  1BNZ A;  2KED A;  3T13 A;  4Q0F A;  1ENF A;  2SOB A;  1TVX A;  2BE5 D;  2B2Y C;  3K5L A;  2RDG A;  3M4O B;  4GZY C;  3LX0 A;  4LMQ D;  3NWS A;  4K2L A;  1DYQ A;  4TKO B;  1NR2 A;  2RSO A;  2HDL A;  1Z7T A;  1XWE A;  1EZ8 A;  1ESR A;  1HXY D;  4X3S A;  1UAP A;  2I46 A;  3TSS A;  2XRQ D;  1MBY A;  2AUJ D;  2OEO A;  1OXT A;  5C5L A;  4RGN A;  5KND A;  3K7A B;  3AMU A;  1HRJ A;  2B2T C;  2PNR C;  1HUN A;  1MSG A;  2B2U C;  2RBM A;  1CFM A;  2WP8 J;  1GUN A;  1I3Q B;  1EY5 A;  3NP8 A;  3OMG A;  4IZ8 A;  4G4K A;  5C44 B;  1SNP A;  2RSN A;  1PDQ A;  2F0W A;  1LAB A;  1KNE A;  1LT3 D;  2A69 C;  1TWF B;  4RHR A;  5KNC A;  3S17 B;  2IWH A;  2X69 A;  5CR3 A;  2LY7 A;  5TSS A;  3DM1 A;  3PO2 B;  3WDN A;  1VF5 C;  4CJ2 C;  3I4L A;  4KY5 A;  3EFX D;  1U4R A;  4J1M A;  1OXS C;  3NSW A;  1HCZ A;  3RMH A;  2TSS A;  4L6T B;  3FRP B;  5E4W C;  4A3M B;  4QIW B;  2K28 A;  3GD7 A;  3HOX B;  5CBE E;  1SAP A;  3PIO 3;  1V43 A;  1H9S B;  2FFK B;  3SK5 A;  1AP0 A;  2D2C C;  2I07 B;  5IGE A;  3TP6 A;  2ZXR A;  4KKU A;  1U4L A;  1OO9 B;  1PFB A;  2F0V A;  4KK7 A;  2L55 A;  3EVQ A;  3D31 A;  4IN3 A;  5M9O A;  2NVT B;  2K04 A;  1GUO A;  2L5T A;  2JYO A;  1WTR A;  1LTB D;  1SYG A;  1HTL D;  3BYY B;  1XX8 A;  5ELC A;  1J9O A;  3MA2 B;  1KLG D;  4ZUJ A;  5FKA C;  4MIU A;  4WRD A;  2DY7 A;  4XIG S;  5FOB B;  5EPL A;  1GXD C;  3J80 E;  1G29 1;  2IPK D;  3TZU A;  5NUC A;  4U67 3;  1JIC A;  4K6L A;  3UI2 A;  2JA6 B;  1CHP D;  1PRT D;  1EZ6 A;  1TS4 A;  4CJ1 B;  4PNY A;  5DM6 3;  3CU7 A;  3K59 A;  1I6V C;  4O1N A;  2Y0S B;  3I72 A;  2A69 D;  4A93 B;  3IKJ A;  4EQO A;  3GTL B;  2F0D A;  2J4X A;  3Q23 A;  3VA7 A;  1HFN A;  3ERQ A;  2J7Z A;  3H6M A;  5I9P A;  3OSO A;  5IGC A;  2JE6 I;  4KTA A;  4RWS C;  1RCV D;  5CV5 A;  3Q24 A;  3MXN A;  4B08 A;  5EJW A;  1JQY D;  2PCF B;  4P2C B;  2LKV A;  4DA2 A;  5KYL A;  1R9T B;  2MP1 A;  5IT9 L;  1TS3 A;  3N52 A;  5C4J B;  4KHZ A;  1FNU A;  1TWC B;  3BG3 A;  1BDO A;  1RTN A;  2GA4 B;  1J8I A;  1BCP B;  4HSV A;  3HKZ B;  3A56 A;  4K14 A;  4DN4 M;  3TME A;  1RTO A;  2F0E A;  3M7G A;  4CKB A;  4BWG B;  4X3U A;  1L0Y B;  3MTS A;  2KEE A;  5T1I A;  1B1Z A;  2G9H D;  1PFN A;  4AYB B;  3MHB A;  2RA4 A;  2LMC B;  4ID6 A;  5M3F B;  4C3I G;  1H9M A;  3M7N A;  1C48 A;  2K7V A;  2H1E A;  4OL7 A;  3F2U A;  4LJZ C;  4R8N A;  1OXX K;  3KLS X;  2AQ3 B;  3C1F A;  3D3R A;  2EZV A;  2F0H A;  1B44 D;  4IUR A;  3VR4 A;  3S1N B;  1UEA B;  1ZEQ X;  2E74 C;  3K0Y A;  1TII D;  2NN6 I;  2IL8 A;  4KN7 C;  1JWM D;  1D5X C;  5G3L D;  2FMC A;  2XRS D;  4ZYS A;  1Z6H A;  4FF4 A;  1SMY C;  5FK9 C;  4FXG C;  1BQQ T;  4RAU C;  4C56 C;  3OW7 A;  4ZKC B;  1EQV A;  3PIP 3;  1GOZ A;  1CZW A;  1HFG A;  4ILW A;  4KD3 A;  4DK0 A;  3C3L A;  1DXM A;  5IOD A;  2F0L A;  5I2X A;  3FMC A;  2B63 B;  3HZX A;  5EPJ A;  4EQN A;  3A7L A;  2VB2 X;  2ZXP A;  1SXT A;  2KCN A;  3S1Q B;  4J6H A;  2B2Y A;  2EJF C;  1KDB A;  4C3J B;  3TP5 A;  1Y1W B;  4A3J B;  5ELE A;  1EY8 A;  1BXT A;  1KAA A;  5JEA G;  1PYW D;  3L3O C;  3SXH A;  4IAL A;  3CRL C;  1SNQ A;  1D2B A;  2K5Q A;  4PMB A;  4C3H G;  3BDC A;  3HOZ B;  3CQZ B;  2WB1 B;  3Q0A A;  1WVL A;  2YYZ A;  5LL6 S;  1IL8 A;  2EPB A;  5IGG A;  3Q6S A;  1AZQ A;  5D3D A;  1PRT F;  2IX0 A;  5EBC A;  2WAQ B;  3TP8 A;  2B2T A;  4G7Z C;  1A3U A;  4LAA A;  2B2U A;  1FNW A;  1GUT A;  4ZK9 B;  5K36 G;  1ENA A;  3D8G A;  1PTO H;  2ID0 A;  1WTX A;  5CGK A;  2O4X A;  5E3F A;  3MAQ A;  2LS0 1;  1OXU A;  2NN6 G;  2F1M A;  3BDO A;  1EY6 A;  3BDL A;  1QWY A;  1STH A;  2G9D A;  3RZD B;  3T16 A;  2R3Z A;  3S16 B;  3I4N B;  1NCV A;  1DJR D;  1X32 A;  2D9U A;  3VYT A;  2A68 C;  2BE5 C;  5I6Y A;  5CBA E;  3D6C A;  1SNC A;  3K57 A;  1ONL A;  1QG7 A;  1TT2 A;  3AB9 A;  1SYC A;  1LLR D;  1Y69 U;  3DWA A;  4FYD A;  1TQO A;  4RGO S;  3CKI B;  4DFA A;  3GTJ B;  5CV6 A;  1I4G A;  4RCO A;  2F0M A;  2EY2 A;  5HGT A;  1WCM B;  5M3M B;  3A55 A;  3NXW A;  1LT4 D;  1ROD A;  1GUS A;  3QWN A;  3KK7 A;  1I6H B;  2PZT A;  4TRD A;  4Y7N B;  2PZU A;  2R92 B;  4B9W A;  4B9X A;  3DWP A;  2X6G A;  4KY7 A;  2JEA I;  2F0Q A;  5C0X I;  2E76 C;  1HPC A;  4OO1 I;  1U4P A;  3P7J A;  1I4P A;  2Q8I B;  2EYO A;  1SDF A;  1Q12 A;  2WV6 D;  1FYC A;  4ULL A;  5FO8 B;  4DU9 A;  3VYR A;  5EBD A;  4ZKB B;  2IJ0 A;  4DAY A;  5C4H A;  2JSO A;  1PTO B;  2WKD A;  1V1P A;  5F2D A;  1S5B D;  4OO1 H;  3RZO B;  3NQT A;  1IW7 C;  3J7A V;  2EYP A;  3T51 B;  2D5D A;  4K2K A;  4KJO A;  2XSC A;  1G6Z A;  2F0S A;  3R2I A;  3HG9 A;  4NDX A;  3S9W A;  2K5W A;  4FO2 A;  3TP7 A;  5IOC A;  5IGD A;  4DNR B;  1ZYR C;  2A68 D;  2NWG A;  3U9O A;  3I91 A;  1D5M C;  2L1B A;  3I4M B;  3FKI B;  3QB3 A;  1AZP A;  2C9O A;  1GHK A;  2KVM A;  2K5D A;  2IT1 A;  4IUU A;  5C6A A;  4H0L C;  1O7Z A;  1LTA D;  3C1E A;  2F0N A;  2IX3 A;  1EQT A;  4ODG A;  2CQA A;  3VR3 A;  2YU9 B;  5FO7 B;  4H13 C;  2NVQ B;  2KQ3 A;  1IHZ A;  5J22 A;  1WD0 A;  3OWF A;  1F2Y A;  2NB0 A;  2EY6 A;  4OIK A;  4FF1 A;  3RUZ A;  4H44 C;  5C0X G;  5JOB A;  1PRT C;  1PTO F;  1QJO A;  3ERO A;  1EEF D;  4QUC A;  5KGU A;  3QIA A;  2Q8R E;  2WIN B;  1EL0 A;  3QJY A;  2H4O A;  3X3M A;  1D1I A;  3W3A A;  4XTC S;  4RKB A;  1UUP A;  1X3Q A;  4K6D A;  1JC7 A;  3PO3 B;  3GQB A;  4FF3 A;  1HTP A;  1EIH A;  5FLX L;  3SK4 A;  2KA7 A;  1WTP A;  1GUW A;  3S14 B;  5FO9 B;  4DNT B;  3R93 A;  3MVV A;  5BN4 A;  1SYB A;  2HCI A;  5IGB A;  4KKS A;  4PV1 C;  2X6L A;  1D1K A;  1F9R A;  1Z47 A;  1IW7 D;  3VR6 A;  2QEJ C;  3T53 B;  2V4D A;  1JR0 D;  2A74 C;  1ICW A;  5EGT A;  1Q3L A;  3P1H A;  2EOT A;  2VXW A;  1NAP A;  5ISR A;  1BCP D;  4QMG A;  1BO0 A;  2PQE A;  1JOO A;  2K6A A;  1WTV A;  1A3T A;  1ZYR D;  1F2M A;  4H7B A;  4M1U B;  3D4D A;  3ONA B;  3V2T A;  3PUY A;  2QIL A;  1EOT A;  1STG A;  1CA5 A;  1G91 A;  1E0B A;  2OF1 A;  2A6H C;  4RH6 A;  1RJT A;  1O7L A;  2PZW A;  3NK9 A;  2DN8 A;  1JOQ A;  2F0K A;  2C5C A;  2MUY A;  1S5D D;  2O5J C;  3MZ5 A;  1R4P B;  1TU2 B;  3NTH A;  2R6G A;  2EE1 A;  3EJI A;  1PZK D;  3V96 A;  3GTP B;  5IGF A;  5JPM C;  1LO5 D;  5KYI A;  2CVR A;  1ML0 D;  2QDB A;  4HTH A;  2QF7 A;  4ABN A;  1QOH A;  3VR5 A;  3QOL A;  3NBH A;  4OGQ C;  2RVL A;  2HDM A;  2B2V C;  1QNU A;  2Z1C A;  1NUC A;  4OHJ A;  3BVG A;  4K5V A;  4A3F B;  4CBV A;  4NW2 A;  5C4X B;  4XT1 B;  1LAC A;  1H9S A;  5J39 A;  3ND9 A;  1EY4 A;  4XXE A;  2BDO A;  3PUX A;  5JEA J;  4I7Z C;  4F8M A;  1FGB D;  2FJ2 A;  3PMF A;  1B4O A;  1KNA A;  5CV4 A;  1NSN S;  2RDF A;  1BUV T;  4Q5V A;  3PV0 A;  3NWT A;  4DXG A;  3BZD B;  2F4I A;  4IFD J;  1MI2 A;  2EJG C;  2EYL A;  2L11 A;  3X3N A;  4HMJ A;  2PO4 A;  1BF4 A;  3E0J A;  1T5X D;  3HOY B;  1K8O A;  3J7Y W;  4KY6 A;  2K05 A;  4WFN 3;  5DEH A;  1SYE A;  3RLF A;  1SBB B;  3R2T A;  4QUF A;  2NYZ D;  3SHL A;  2JEB I;  4RCN A;  3QG1 A;  1ZXT A;  4HCE A;  3TZD A;  1YNN C;  3FPU B;  2A6H D;  1ET9 A;  5FLX E;  3K5M A;  2NTT A;  4TSS A;  2EYF A;  4K8J A;  1W6J A;  1PTO C;  3HEJ A;  2SNS A;  4YIJ A;  2O2L D;  2IW3 A;  4V19 0;  2VB3 X;  5EKI A;  5JAV A;  5ELD A;  2BA0 A;  1F9S A;  1JE4 A;  1DZ1 A;  3OWE B;  1JB3 A;  1LT5 D;  1F2L A;  2L4N A;  3MWY W;  3N6R A;  5CV7 A;  3HGB A;  1STA A;  2R7Z B;  3HOW B;  4KJN A;  2F0I A;  4KN4 C;  3DHQ A;  4F88 A;  4K8I A;  4RGT A;  3NTI A;  3H3V C;  1C8C A;  3MFG A;  3IFD A;  3LWE A;  4BY7 B;  1M8A A;  1H9K A;  4C3J G;  1WTW A;  1LV9 A;  4IFD H;  2RKS A;  3D6W A;  5EKL A;  1BCP F;  3BYT B;  2Q8T A;  1QB5 D;  4KKT A;  4C3I B;  2NZ1 D;  4O42 A;  2K01 A;  1B9M A;  3MXP A;  3BVZ A;  2AWN A;  5JVG 3;  1WTO A;  1S5E D;  3SE0 A;  1ENC A;  3PUV A;  2F0J A;  1G2S A;  1I4R A;  5CV9 A;  1CK1 A;  3IFT A;  1MGS A;  1I4H A;  1O78 A;  1XYI A;  2IX1 A;  1B50 A;  1ESF A;  1Y8N B;  3TBI B;  4CGY B;  1YNN D;  3M85 A;  4IUN A;  1SSO A;  2B2W C;  2Z4I A;  5I4D A;  2LFN A;  1PTO D;  1EWH A;  2L9H A;  4BBR B;  1DCZ A;  4UDU C;  1KDC A;  3HS0 C;  3KF8 A;  4ZLT F;  3ZYY X;  1LTI D;  3DMU A;  2SEB D;  4ZQ3 A;  4CKC A;  5IT9 E;  1SFO B;  2HCC A;  3I70 A;  5HUR A;  2EVB A;  4KD4 A;  2M9V A;  1A6X A;  1O7Y A;  1FR3 A;  1E2Z A;  2MGS A;  1CM9 A;  1XTC D;  4KMU C;  2DY8 A;  4KHV A;  1S5C D;  2N55 A;  2KOL A;  2D62 A;  1Y1V B;  2A6E C;  5C0X J;  1V1P B;  2AWO A;  2E2J B;  3LNN A;  3L9A X;  2FIN B;  4PMW A;  1ET6 A;  1SNO A;  5COY A;  5ELB A;  4FNF A;  3I3C A;  4DGZ A;  3S1M B;  3E5S A;  1HHV A;  3SDZ A;  3MXG A;  2PW7 A;  4FP5 D;  5DM7 3;  3A54 A;  2B8F A;  2O5I C;  2EYJ A;  3OHX C;  4F7X A;  1PLF A;  1PZJ D;  4C2M B;  4G57 A;  3FEW X;  1FNV A;  1Q8I A;  4BA2 I;  3EQL C;  1BOS A;  3HP3 A;  3OOC A;  1VDZ A;  2HQE A;  2L0C A;  1IKL A;  1NR4 A;  3NTK A;  1KDA A;  5K5P A;  2F0O A;  2EYH A;  1SNM A;  2OXP A;  2F0P A;  5JVH 3;  4KV6 A;  2Z4H A;  2WAC A;  2XWJ B;  3G6J B;  2WKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...