1PGRB

2:2 complex of g-csf with its receptor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
213
structure length
208
Chain Sequence
AGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVKLEPPMLQALDIGPDQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)
publication title Atomic structure of the GCSF-receptor complex showing a new cytokine-receptor recognition scheme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 33
structure length 208
sequence length 213
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 1999-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pgrB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pgrB02
2VXSH 2YPLE 3VGGA 3QQ3A 1LEKA 4KMTH 3W39B 1S8DB 3TYFB 3QJFA 1WFOA 4LVOB 3ZE1F 3VFPB 3DMMA 4X4XA 5IW3A 1S7XB 2EZ0D 5GQBA 5BS0B 5JW3H 4LCWA 3V5KB 1YJDH 4PJXE 1CG9A 3D48R 4OZHA 2BP3A 2HYMA 3WMSA 3SQOH 5KBNC 2QSQA 1AC6A 4HPYL 3SE4C 4X8XA 5C0IB 3L3DA 5E9DE 4IJ3B 4LPXA 4Y88A 5BOZG 4ZXBC 4HKBA 4OD1H 1ZT4B 3HS0B 3JVGA 1HHHB 2GFBA 4LNRA 2EE3A 1TJIH 4JDTL 3GSNA 5SV3A 4MYWB 1OAKH 3NA4A 2NQCA 3VXNB 2EH7L 1RZJC 3HZKA 3KXFE 4CW1B 3AGVA 1MJ8L 1OARL 5DYOA 2R4RL 1BD2E 1MFDH 4H0GA 1XAUA 3OB8A 3QHFH 1KLFA 1MLCB 4NZTL 2RR3A 1U58B 1EEQA 4LVNC 5DT1L 3WHE1 3KHOA 2NY1C 4GRWF 2E7CA 4EI6B 4ZS7L 3F7YB 5A43C 3HNTH 3VW3L 3MLVL 3NPSC 5AZEL 3ARFA 2XPGA 4LSPH 1G9EA 3NOIA 2HRPL 4OI9A 1D9KA 1P7QD 3HHRB 3BPCB 2ZG2A 3DXAA 4PLJD 5EU7C 1YEKH 1PBYA 1H8SA 1VENA 1N64H 4UTAH 3CCHB 3MC0A 3TZVC 4AENB 1BF8A 4IDJL 4XTRC 3BRGC 4FTVB 5K93A 5HGDB 1FFOB 1S9KC 5GGRB 3JV0A 3S6CA 2C3VA 3VGAB 2A6JB 3B9VA 2V5TA 3S88L 3MQIA 2CLVB 1ZHLB 3D18A 1ZSDA 5ISZA 1KOAA 2BFVH 3IDMA 4J3TA 1AI1L 1CR9H 1TJGH 3K8LA 2EDEA 3MR9A 4MJIE 2V5SA 1MUJB 4OF3A 1BFTA 3LMJH 1P7KB 4YQXH 1D7FA 1FPTH 3ES6A 3PHQB 3D85B 3TF7C 4YFDB 1KJ2B 4HBQA 1U8NA 1K4CA 1Q72L 5HVHB 3F5WB 3JWOC 4FABH 2EH8L 4DN4H 5BMFH 5D8JH 1KG0B 2FO4B 3HPJA 1OF2B 5GJTH 2Z31B 5JHDD 5J3HC 3MRCA 4WWKA 5CJ5A 4WU5B 3I50L 3FKUS 3TBSA 4X5WB 3ARED 3IKCB 1WBXB 5F88A 3N9GL 3MV7A 2J6EL 3W11D 2EXWD 2F53E 3WHXB 5J12B 4MA8L 3RIFK 5C0EB 5DMJB 1T0MB 2ADIB 1TCRA 3OQ3B 4JM4L 1E0OB 2AK4A 1Q1JH 3ARUA 4UQ3A 1UJ3B 4JRWA 2BSED 1L0QA 1U8MA 4HUUB 1GVIA 2VQ1B 4X8JA 3VA2C 2W9DL 4WO4A 4CVXB 5HGHB 1OTTD 4I3RL 5EIQA 4QRPA 3THML 1KPRA 5AUMB 4F33B 4UIKL 5DJ6A 3U36A 4HLZH 3BEVA 3Q0HA 5GHWH 3UJTL 2C1PB 3MOQA 5DDHA 1BVKB 5K9KA 5C2BL 4NO0B 4OQTH 2JIXB 5CP7B 5HGBB 1IC1A 1I1AB 2J8UB 5KANG 4Z5RB 3MACH 3LD8C 3TWCH 1F4AA 5D2NE 2JJWA 5GRWA 3QDMB 4MD0B 3C87A 3S4SA 4FQ2H 3TA3B 3A6BH 4HD9A 3RWHA 3VJ6B 3RA7H 5TE4L 5HDBF 3BFOA 5DJ8A 1H3XA 2QADC 1CFQB 3B2UC 5T3XE 3S34L 1PZUB 4L9LB 4BQ9A 4OGXH 3IJYB 4X6DB 1CDCA 3IFOB 4OF8A 4QHUB 3UTZA 5BS0D 3WO4B 1J8HA 1TFHA 1W72H 2FX7L 4X4YA 4F9PC 4PJ8B 3BD5A 1KTLA 3NA9H 2VDPL 2IADB 2VLJE 5I8EB 2OTUA 5I73C 3KLAB 1E4XL 1DVFA 5HPMB 1CL7H 5LGKA 3O6KL 2X4RB 3EJZC 4KJYB 1KEGL 4DZBA 4UT7H 3GI9L 3MOAH 3O6FB 5F9OL 1GHFL 3ZKMD 1QPPA 5KJRH 3DVFA 4PJBF 4M6ML 4PV9B 4JO4H 4A6YH 5D96B 1DSFH 4EQ3A 2JJSC 4YPGA 1F13A 1AE6L 1BIIB 1ZGLA 1T2XA 3B8SA 1U8KB 3G6DL 1RUPL 1IT9H 3HPLB 3SGDI 3GMOB 1MRFL 4JZNB 1FRGL 5F7DB 3SE3C 4P9ML 1KB5L 4F7MA 1EAPA 4JFFB 4XAWL 1INEH 1QFWM 3CVIL 4HS6B 5FYKU 1BZQK 5IQ9A 5K59F 5BO1H 1UWGL 3LKPA 5DMYA 5B22A 5CEZD 3CLFL 3GM0A 3D1MC 1NAKL 1FZKB 1WFNA 1BOGA 2XICA 4DKDC 3ULSB 4FHBD 4FNLL 1QNZL 4ZXBD 3EO0A 3LEVL 4JFOB 3F7RA 5CMAB 1A7OL 2V5MA 4QHLB 4NCC2 2AJYL 1A1OA 1B3JA 5DFVC 2PCPB 4Q7DA 3HUJF 3CSGA 1FV1A 4RCAA 2QQNL 5JLZA 2HFGL 4WFEE 1BAFH 1RK0B 5IKCA 1WK0A 5JIIA 3T2OA 2B1HL 1JTTA 4JFPA 1SVZA 3DX7B 4HLZG 4OGYL 4PLKD 4XP5H 4XVSH 4C83B 5L8KB 2GSGA 4DUWA 1U8IA 2DM7A 5HYSG 4PRNA 5IR1A 5E99H 4OLZL 5I1KL 5FCSH 4KK8C 2EDHA 1FG2B 5BRZD 1BFOA 1PX4A 4LLAA 3D85D 4APQD 4KI5E 3K4ZA 3D0VB 5D72H 3PHOB 2W92A 3QG6B 3U4BL 2P47B 3L7FA 3MRKB 1BWMA 2NW3B 2XWBA 2WZPD 3ETBF 4H88L 1ZEAL 2BX5A 3HCVA 3NZHL 3AREA 5CHNA 5FF6B 5J8OA 4OQ1A 1U9KA 1F6AA 1TZHA 3HAEB 3UZQA 3W9DA 3RKDD 2R2BA 1U8PB 3BVNA 4H25B 4NOBA 1SMAA 3LRSA 1QBLH 1HXYB 5LAXA 1ZHBA 2D0HA 2OZ4H 3CLEL 1RUML 1G0XA 5FYLE 1CE6A 3PWLB 4G6FB 3ROLB 3S37L 1QZ1A 1IAII 1J1OL 2FHCA 2EO1A 2R1YB 1MCCA 5SX5H 3FZUD 4PJHF 4N8VA 4XP9L 5DMIH 2BNRD 5IEKA 4NPYA 4JQVC 3EYQD 1MREH 1ORQB 4P46C 2ITDB 1CGWA 3U48A 2I5YH 4NO0D 3EFDL 2Q20A 5FCUL 4LFHG 5KSUB 5SV4A 4QRRB 4PRAB 4GMSL 1NMBL 1YEDB 3R0NA 4JM2F 4K7PX 5D70L 4LLUB 4PRHB 4PBVC 5GSRA 2EEBA 1C5CH 4GBXC 2ZKHH 2N4IA 2Q8AL 2EDQA 4OSUH 3ULUD 3GSVB 2IGFH 5ACMA 3MXWL 1S8DA 4RMQA 3SKOB 3TYFA 5FKPB 3VFPA 4DK3A 3FONB 3AC0A 3DSFL 1YN6B 5BS0A 1JRHL 4JLRB 5FYJH 4TVPH 2GSIB 3O2WL 5I1GH 1I1FA 4PJ8D 1SJHB 5B39A 3ULVL 2Z92B 2HT3D 1ZS8B 3K2MC 2AGJH 3EDKA 4K7FB 5C0IA 5F7NC 4NUJB 2YN3A 1ZT4A 3HS0A 1HHHA 4MCZB 2E9WA 1U8QA 1YEEL 4EDWH 5D9SB 4PJFB 2X4SA 5GZND 3VXNA 3VDBA 5KAQG 2EE9A 4TQEL 4OV6F 4BFGA 4CW1A 1B4RA 4RFNC 5ALCH 4WTZA 4M7JH 3VFTB 3QUKB 4DJMA 4LHJB 4LASL 4BM7A 1OGAD 1MLCA 1U58A 5EU4B 3U9PL 2OI9B 1QSEE 3L1OH 4PS4L 3MROB 3S5LG 4EI6A 3QZWG 3AS1A 2YPLB 1CLCA 2YPVH 5E1HB 2VXVH 3GSNL 3R1GL 4OF7A 3BPCA 1XT5A 3WKMH 3ZKSD 3DHMA 1OM3H 4PJXB 2DQIH 2ZUQC 3U7WH 1JPST 3CCHA 4AENA 1DEDA 4NNYB 4FTVA 1X6LA 1PYWB 1MHPH 1Q0XL 4PJGE 4MQSB 5E9DB 5GGRA 2A6JA 4RGOH 1D5XB 3OKEB 1FVEB 2CLVA 1ZHLA 1WEJH 5I1CH 3KPMB 4HJ0D 5E2TL 5DQDH 1LP9F 2W07A 2QSVA 1MUJA 1E6JL 3KXFB 4NNPH 3FOMB 4XT1C 4MB3A 3PHQA 1BD2B 3D85A 3WBDA 4HUKB 4YO0B 4R97B 4APQA 1KJ2A 4QTIL 2R56H 3V0WH 4Z0XA 1CFBA 3F5WA 1KG0A 1OF2A 2Z31A 4UU9B 3FRPA 2AXGB 4WU5A 5A2IH 2VB5A 5E8DL 4QXUL 4X5WA 4JO1H 2R29L 3IKCA 4YDKL 5DFVD 1AR1C 1WBXA 5C0GB 1GCFA 3C5SB 4HC1A 5C0EA 1T0MA 1OP3K 1XF5B 2ADIA 5I17B 4L5FL 1YEIH 4UBDC 4BSWA 4GOSA 4KPHL 5LJYH 1F58L 4S2SB 3DYOA 1UJ3A 4Y2DC 5KG9B 3NCFB 1A7PL 4Y4KB 1CGSL 4K2UL 5BV7H 3UPRB 2QSCH 3PP4H 3K4AA 4HUUA 2VQ1A 2YEZB 5AEAA 4KXZI 2Y07L 3D3VD 3CK0L 5IIEA 4G6AC 3RHWF 4CVXA 5I8OH 5HGHA 4F33A 5AUMA 3V6ZA 1P53A 4MJIB 2NZ9D 1CGTA 3MLYH 5INCB 2BY0A 2ZUVA 4PJEB 3CFBB 4PG9B 2C1PA 2XN9D 1BVKA 2JK5B 4NO0A 2R0ZH 5CP7A 1NQBA 5HGBA 1I75A 3LY6A 1XR8B 2J8UA 5F7WC 4Z5RA 3O4LE 4QRRD 3BI9X 1ZVHA 2HTKC 4PRHD 2QV2A 1W8OA 4YXLL 2ICEB 3QDMA 5CLTA 2BVTA 3TA3A 3VJ6A 1NCCL 1A7NL 1L7IH 3V8OA 3OG4B 1CXIA 5DHXB 1NFDE 1X4YA 1CFQA 4GAFB 2F53B 3MCLH 1WAAE 2W65B 1N6QL 3KAAA 3CFIC 4XPHL 1MFEL 2FR4B 3IJYA 4X6DA 2CDEA 3SKJH 2H2PC 3IFOA 4EIZC 4XP6H 4WI8A 4MQTB 1ODAA 4JG0H 1ITBB 4PJ8A 4OBRA 3KPSD 3SDCC 3UTPE 1B2WH 4XC3L 2IADA 2FNBA 3N06B 5I8EA 3KLAA 3O6LH 3W5NA 1IGJB 4DTGH 2D7PA 5HPMA 4MNQE 5DF0A 5GZOD 1UM5L 3DROB 2X4RA 3QBTB 1FFNB 3NFNB 5DJ2B 3O9WC 4U1IB 4D2NA 3FN0H 1SM3H 4PV9A 5TGBA 5AD0B 1BIIA 1OGAA 2OBGA 3CSYB 1NANI 3KG5A 5E4EC 2IF7A 4IMKA 5D2NB 1LD9B 1U8KA 2A9ML 3HPLA 3EYVB 1JP5A 3GMOA 5HHXH 4D8PB 4JZNA 1BQHG 3B9AA 3IS0X 2EC9U 2FATL 4JFFA 4BK5A 4HS6A 3EAKA 4LDLB 3LKRB 2DM2A 1MLBA 5FO9B 3IVKB 1FFPB 1F90L 1FZKA 1UZ8B 1XGTB 3FFDB 2J8HA 5I1HH 3ULSA 3JWDC 5IGXH 1KCVL 3JTTB 4PP2A 2V2TA 5IJKA 1ZLVH 2AEIT 2HJFB 4QHLA 3VI4F 3P0VL 2VLJB 3SQBA 3UJIL 2BNQD 3I9GL 5HI3C 1RU9H 4PRDB 4OIBA 1ACYL 2ERJB 2WWKO 3QPQC 2AEQL 5E9DD 3VFRB 3H6JA 1DN0B 1D5BB 2FHBA 4XMKH 3SY0B 4R2GC 4HUVB 4GRWH 3RNQB 1RK0A 2WQ8A 4L29B 1E4XI 4FZ8L 4C83A 3DX7A 3TBVA 2FWOB 4IRSC 1NGYA 1D5IH 2K1MA 1KJVB 3QSKB 4Z77B 5H8DA 2RB8A 3KXFD 4X9BA 4Q58C 1PZ5B 2AV7A 1FG2A 4P5TB 5FHBL 3F58H 5D4QA 3BPLC 3JV6B 4XBPB 5C0BE 3TJEH 3D0VA 3R4DA 3UYPA 1I85C 5E1AB 1I9IH 3QG6A 4M43L 4RA0C 3WXVL 4I9WD 3R0MA 2VC2L 2HN7B 2P4AB 3MRKA 2NW3A 3DUSA 3RVWD 1A0QL 1AY1L 1HCVA 3U0PB 4WW2F 1ZT7A 1HHGB 3QQ9C 1AGEB 3JV4B 3VD9A 5D1XC 3TVMB 3VXUD 5FF6A 2VRAA 1F00I 5HBBA 1CZ8L 3HAEA 3LKQB 3RY6C 2BVEA 1U8PA 1XIWB 3CSBA 3O81A 4H25A 1JE6A 1KJ3L 4XHJD 2A77H 3GKZA 3V4UL 1HXYA 3F8UB 4LPTA 3OF6D 3V4VH 4DN3L 3BZ4B 2NXYC 1YJDC 5IQ7H 3PWLA 2R9HC 3ROLA 3A6OA 3T2NL 5C0CD 4Y4KD 2ZCHL 2IJ0C 2R4SH 4NKQB 1ZAGA 4D9QD 5EU7E 2AJSH 2CRZA 1YEGL 3MLTB 2CUIA 2R1YA 4ODSH 2O5XH 4LVEA 5CD3A 3CFEB 3FQNB 4JQIH 4PP1C 4NQEE 5DZLA 1PDKA 4HGKC 1RVFL 1JF6A 1ORQA 2ITDA 4LOUD 4YBHA 4YE4L 3NACL 4OFVA 2VZ3A 4XGZB 3RWGB 3QDGE 5TH2B 2ZNXA 4P3DB 3LZFH 4JHWH 3BISA 3C08L 5KSUA 4QRRA 4PRAA 2H45A 5EOCL 3MV8E 1RZIA 2YC1B 1YEDA 1N7ML 4LLUA 2FECL 4PRHA 5F7KC 2COQA 2NY2B 3ZE2F 1JGVL 2IQ9L 1U2HA 3QUXC 2N56A 4QXTB 3IDGB 3GSVA 1NMAL 4XVUC 1FL5B 4Y2DD 2DMBA 4JN1H 4P4KB 3CIQA 3V5HA 4MA7H 5FKPA 3VG0H 3FONA 2J5LC 1YN6A 4S0SD 4NN5C 4JLRA 5EIVA 2GSIA 4YNYA 4FFZL 3KPSA 4UI2A 4F7CB 3LHPL 1RZGB 2EIEA 3ARRA 4PJ9D 2Z92A 1ZS8A 4K7FA 5JW4R 4AM0B 1SEBB 2LQRA 3FJTA 4NUJA 4JVPA 3WFCL 4NKMB 4EZMA 5JO5A 5LQBH 3LKSB 1EO7A 3VD7A 1G84A 5CIPB 5D9SA 4ALAH 4JFZH 1S7TB 4PJFA 1DBBL 3TYGL 1NGQH 4MDJB 2B4CH 3EZ8A 3CU7A 5C71A 3VFTA 3QUKA 1ERNA 5EU5B 3IAGC 5ESAB 5HHMD 3Q1SH 4G3YH 1T83C 5EDXA 5EU4A 1BP3B 3MROA 4RRPG 2H2PD 4YZFF 2YPLA 1JCKA 1LO4L 1IGML 5JHLH 1NFIB 4ZG1A 3SDAB 1R3LB 5T5FL 5HHPB 4NJ9L 5DTFB 3L95B 2FBOJ 1NGWB 3DWTA 3NIFF 1TJHH 3BZFB 2QJDA 3QXTA 1FSKB 4PJXA 3F6IA 4YHNB 1MEXH 2YRLA 3FT4B 1G6RB 2K7QA 4KKLC 4XZUB 3MMEB 4LBEB 4NNYA 3O9WD 2AV1A 5EUKB 1CTNA 3NTCH 2P43B 1H3PL 5E9DA 3BQUC 1WQVT 1D5XA 4G6KH 4NOFA 3OKEA 1FNFA 1NGPH 1FVEA 5SWSD 2Z4QB 5CEZL 3VFMB 2Y6SC 5EO0B 4OZFH 5GGTA 2DQDL 3ALWA 1BZ9A 2DIJA 3KXFA 3FOMA 5FA3B 4IMLA 3CC5B 3X12B 1WITA 5DLML 3VRLF 1BD2A 3G9AB 5HDQH 5D7KE 2CKBL 4YO0A 3SDXF 5TF1L 4F7PB 1PFCA 2CGRH 2GCYB 1NAMA 2IPTL 4F7EB 3KNBB 3B5TA 1QSEB 4MXVE 2DQJL 3I2CH 4PREB 3VI3E 5E08L 3FTGB 3CXDH 5EUOF 1NCUA 1C8PA 4FQXC 2AXGA 2X4QA 2NY0B 3VXUA 2EDWA 4Y19E 4QHNB 3VXRD 1P6FA 5C0GA 4JFHD 3TVMD 1I3VA 2XQYG 3C5SA 1XIWD 1N6UA 2CDGB 3BMVA 4C55A 1KJ2L 3OF6A 1JNNH 1XF5A 5I17A 1EPFA 1PLGL 5E03A 3NABL 5J13C 3DRQB 4KGJA 4PJGB 4RIRB 5KG9A 4Y4KA 4NZUL 4FFWC 5DD0L 3UPRA 4UZGA 1S7VB 2I25N 1XCQB 2YEZA 4KFZC 4WFED 5HYSB 3ULVF 3TO4D 3CDCA 5DJCA 4MJIA 2HVJB 4HCRH 5INCA 2DQEL 4LQFL 2BJML 4U1JA 2FH8A 1MQKL 4PJEA 3CFBA 4PG9A 4HC1L 1MH5B 2VZOA 4FQIH 4NWTL 4CADB 2JK5A 2Y25A 4KI5D 4Z7NE 2XV6B 4FQHB 4P48A 5D1XD 1XR8A 2IFFL 1V3LA 1A14L 4Y1AE 5LXGL 2O93L 1F4HA 4AEIH 2CK0H 4OZHF 4KY1H 4K3DH 2ICEA 3MLSL 2NY2D 3VWKD 2NXYD 4OM1L 1DBJL 2X4NB 5JPMB 1U91B 1HINH 3S36L 4YDLB 2F53A 3V6FB 1VERA 1QLFA 1T66D 3KWWB 1H3UA 4HDIB 3C2SA 3AVEA 4NRZB 4LSRL 4CGTA 3MLRL 2GK0B 2DQHH 2C3XA 3MGTB 5DQ9B 9CGTA 5BVJB 3KHQA 4S1SH 3MRLA 3O4OC 3VXOB 2IMNA 4OLXL 3BUYB 3VXTB 4Z7WE 3L5XL 2V7HB 5DRXB 5IHUL 3ULUL 1IGJA 2VZSA 5JQ6L 1ZANL 4OZFG 3U7YL 3DROA 1QYGH 1GPOH 1OTSC 2VQTA 1FFNA 3WUWB 5JNYB 1AP2B 1T6VN 5D7JC 4U1IA 2ZP0T 1EBAA 1S5IH 5C70A 4F15C 3WS6A 4PJ5E 3RX5A 3O4LB 5AD0A 4MB4A 4LRNH 4POZD 4XCFL 2A6DB 1LD9A 1JHLH 4M62L 4ZOBA 3KLHC 1NJ9B 2EE2A 3OHXA 4M7ZC 4GW5B 3QIBB 3O2DA 5CZVL 4S1DD 1NFDB 4K94H 1YNLH 1NC2D 3SDAD 1GZPB 2NR6D 1S3KL 2BCKB 4JY4B 2I26N 5FO9A 3RAJL 3IVKA 1FFPA 4YWGH 2LE9A 1UZ8A 1XGTA 4LLYB 4OFYD 4R7DB 1MCQA 4OFDA 2AK1L 4ODUB 1DLHB 1LE9B 1BGXL 3LDBB 5KSVA 3JTTA 5E24E 5DGRA 3O0RL 2HJFA 4ZO9A 3CMOL 1NL0L 4NC0B 3WLBB 1G7JB 5E6IC 4PRDA 4LSVH 4MHHG 2MFNA 3VFRA 5SWSA 4MNQB 5GRXG 1DN0A 3SY0A 4K3EH 1QLEH 5DMKB 3RNQA 4L29A 1J8KA 2FWOA 1ZGLP 3HC3L 5IMOB 1Y6NR 1MFBL 4LHQB 4X0KB 4Z77A 5K9QI 4P2OB 4Q97A 2Z35A 4HF5H 1XFPA 3PF2A 5HYJD 3DECA 1PZ5A 2VXUL 4P5TA 4RBPH 2ZCKL 3JV6A 4WEUD 4XBPA 4WUUE 5F7UA 2BHZA 4P0DA 4ZPTB 2YN5A 3RL1B 2UYLB 4S1QH 2APVA 2ZCLL 4H8WH 5E1AA 3RY5A 1Q94B 3ZTNH 4X7EC 4EI5C 3KJ6L 3KPRD 4JO2H 4Y5YB 4NQUA 2HN7A 5DGQA 4KKLD 3U0PA 2DI9A 3EYFB 5BW7A 1HHGA 4L1HA 2R69L 1A6TB 1AFVL 2NY0D 3F62A 3VXRA 2VLRD 3TVMA 2NX5E 3WFDH 5HYEA 1RD6A 3BP7B 6FABH 3BQUD 3LKQA 1NSNH 5DMGD 4NZJA 1XIWA 5FM8A 4X9GA 3BMWA 2JB5H 3NCMA 1T1WB 3PIQB 4NIKB 2FZ3B 1EVTC 3BZ4A 2BXYA 4KH2A 2M2DA 1K85A 3VFVA 1FYTD 3MLTA 1S7QB 4X7TB 4YH6A 1NEZG 3FFCE 3CFEA 1XCTB 2OQJB 4ZFFB 1PD6A 3BAEH 1G9NH 3LS5H 1D6EB 1MIML 3OB0K 2IANE 4IS6A 2MKWA 4MAYD 4XGZA 5C0BB 1B4JH 5TH2A 3GM8A 4P3DA 3OL2A 1PG7L 3MYZA 3T4AB 3BZEB 4K9EL 3SO3C 2APWA 3MRHA 5IV2A 2YC1A 3FOLA 3GSUB 2DM3A 2C3HA 5I19L 4RGNE 2OR7A 5GIRA 2FJHB 1S7UA 3VWKA 5CP3H 1RIHL 3MRQB 4NKOA 1FL5A 1CT8B 4P4KA 3OAZK 4HPYH 5I6XB 3MFGB 3WO3B 3NPSB 1YC8A 3SGKA 3ZE0E 1EJOL 1MNUL 4MJ4A 3P4NB 4JDTH 4XPTL 4F7CA 2EH7H 1BM3L 4XPGL 2P5WE 1X7QB 1MJ8H 1OARH 3ARYA 4AM0A 4KDVA 1SEBA 2R4RH 3CXHJ 2FB4L 4OJFL 1H15B 4DEPC 5I0ZA 3RGVB 3TJHD 1FL3B 4NQEB 4ELMF 2BDNL 4L4JA 4TULH 5DT1H 1QOKA 2B5IB 5IOPB 5CIPA 5F1NB 1J0YA 3HRZA 4ZS7H 3AY4A 3QDGB 4QNPF 4MDJA 4KKBD 4OD3L 3VW3H 3MLVH 4LFHD 5D2LE 1XH3B 3S98A 1HYSC 3E3QE 5AZEH 5EU5A 1OQOA 2HRPH 3IDNA 3MV8B 4PJDE 5ESAA 4Y4FD 3HFML 1DQJB 3O4LD 4J3OC 1YPZE 1INQB 2CXGA 3I02B 5DD6A 3B43A 1F6LL 1NFIA 3QIBD 3OBAA 1NC2A 3SDAA 3V0VB 5IMLB 3SN6N 4C57C 4Y16C 5CKGA 5DTFA 1S7WB 3L95A 4OTXL 4OFKA 3ARSA 1NGWA 5JW5A 3S88H 3BZFA 5DUML 4U3CA 4YHNA 4FA8A 4LSSL 2IAMC 1G6RA 2JCCE 3FT4A 5M94B 4Z8FL 5JOPD 4KAQH 2X70B 4XZUA 1R5IB 4WIQA 1AI1H 3RZWA 2X4UB 2Z91B 4LBEA 4PR5B 4ZO7A 5JUEL 5EUKA 3C5ZB 2IBZX 4YUEL 1INDL 4MNQD 4XNZC 1JGDB 5BV7C 2Z4QA 3OKMB 1T22B 2HTLD 3VFMA 5E4IA 1Q72H 1IQDB 5AYQA 3O3DB 5CZXD 5EO0A 1FJ1B 2EH8H 1DLFL 2HJKB 4S0TD 5BZWB 5HYJA 5FA3A 3BGMB 5I71B 1NC4B 3CC5A 4NC1C 1FBIL 3AB0C 3I50H 3GBML 2XZZA 5CGTA 5FGBA 4F7PA 2GCYA 1A6PA 4F7EA 1FFQA 3KNBA 4JGJA 3N9GH 3MRPB 2J6EH 3LN9A 1K8IB 4MA8H 4PREA 4I3GA 3FTGA 2V9QA 4PG2C 5LGJB 5I8CB 1KCRL 4S1RH 3CDYA 2BVUA 2VLRA 1OTUD 5GGTL 3NGBC 4QHNA 2Y4SA 3SGEI 2ORBL 2W9DH 4L3CB 5HTSA 1PEWA 2CDGA 4I3RH 3THMH 4G7VL 1JZ4A 5DJDA 1NAML 3WIHA 2QADB 3DRQA 1NH6A 1D6VL 1KTKE 4RIRA 3BW9B 5EU3B 3UJTH 5IK3B 3RWFB 3KJ4B 2APBA 3RVUC 4X80H 4HXAL 1YEFL 5C2BH 1S7VA 5EWIL 1XCQA 1LMKA 5HYSA 3MLXL 3VXPB 4IIQB 5ESQA 4R26L 4HG4J 2HVJA 5L2JB 1X44A 3G08B 4KI1A 5KOMC 4MAYA 1JYNA 4BELD 1QBBA 5TE4H 4O51B 1U3ZA 2GT9A 3VRIB 2YD7A 4ENEC 3MLZH 4HKZB 4FQHA 4NQDD 1IL1B 3S34H 2H26B 4FOMA 4JPIB 4RZCA 3ZYZA 5HHQB 4JVUA 3DI3B 3BUTA 4DQOL 2FX7H 4RX4D 4Y19B 4EUPB 2ENSA 4KZDL 2VDPH 1W72A 4OAWA 2X4NA 3KDMB 3ZLQC 1U91A 1E4XH 4HV8B 3V6FA 5MENE 1JYWA 1JHKL 4JPWL 3GIZL 1U8JA 4HIJB 3O6KH 4HDIA 4OUOA 1KEGH 2GK0A 3BH9B 3BPOC 1FNEA 3GI9H 5DQ9A 5F9OH 1GHFH 2MOVA 5BVJA 4CAGA 1D3CA 1X5YA 4HK3J 1AXTL 4M6MH 4OM0L 4DAGL 4GKOA 3VXOA 3VXTA 4GMTH 1FG9C 5DRXA 4A6YA 4O9HL 3G6DH 5EORL 3RGVD 1RUPH 3C60C 4KQ4H 5FHAL 5ABDE 3WUWA 3B2VL 1AP2A 2XRAL 1MRFH 2FIRT 4YHLL 3S35X 4P9MH 4HG4K 1KB5H 3RJDA 4XAWH 3UAJD 1NKOA 3CVIH 3N85L 5JMRA 2J7LA 3U1SL 2HLFD 1UWGH 1FDLL 2BSTB 4P3CL 3O4LA 1LO2L 1NAKH 3GI8L 4XCNB 2XY1A 2A6DA 1OY3B 2UUDH 4LLDB 1NJ9A 4FNLH 1QNZH 2BY2A 3TFKC 3LEVH 3ARXA 4E41E 4GW5A 1A6UL 3QIBA 1PEZA 1A7OH 2WUCL 1WSST 1LHZA 1NFDA 2AJYH 5GJSL 4UINL 3QFDB 5D1ZB 4EOWL 2QQNH 4LLYA 4R7DA 2HFGH 4U1KB 1U8OB 2B1HH 1DLHA 4ODUA 1G7MB 1KN4L 1LE9A 1N0XH 4NWUL 2E6PA 2H2SD 1HWHB 1ES0B 2HA1A 32C2B 4KROD 1F6FB 4OLZH 3WLBA 4Z7WB 1G7JA 4Y4HC 5I1KH 3ZMRA 3C5ZD 3O2DL 4MNQA 3B9DA 4MWFB 2ZUWA 5T3XL 1A2YB 4O00A 2PYEE 4GG6E 5EN2A 3U4BH 5IMOA 1CLZL 4X0KA 4P2OA 3RUGB 5A3ID 4H88H 4PJ5B 5B38G 3B83A 1ZEAH 4HK3N 2ICES 3PWVB 4U2ZA 3NZHH 2EDFA 4M6NL 3QXVA 4MA1B 1A4KB 4ZPTA 3D6GA 3RL1A 5JZ7C 2UYLA 3M17B 3KPQA 5DD3H 4ZFZB 1PKQE 5T3ZE 4JZOA 4Y5YA 4FXKB 4RWHA 5DHYA 4YDVB 2GJZB 3BYYA 5I1AB 3EYFA 3FB7B 3CLEH 1RUMH 5CD5D 1A6TA 2WBJC 4OCLC 5DEGB 1S9XA 1DE4B 4OLEA 4YHOL 3S37H 3QWOB 4P23C 3RIAK 2R1WB 3BP7A 3QEGL 4JGUA 3QA3B 1J1OH 1XR9B 2L7JA 4EVNB 5DUPL 4XP9H 1P84K 1T1WA 4NKIL 4XH2B 3PIQA 3RWEB 1NCAL 3TO2B 1G7HA 2FZ3A 2DQUL 3SBWC 2RCSL 2J8UF 2D7TL 4YXKL 4LIQH 5IBUG 5I66A 2P46B 4G8FA 2VH5L 3QIWD 3EFDH 5FCUH 1RIUL 1VA9A 1IC5L 2F15A 4CKVX 3MBEB 1S7QA 3LH2L 4GMSH 2VWEC 2P8PB 4LKXB 1NMBH 2W9LA 1Z9LA 1XCTA 2OQJA 4JKKA 5D70H 2DQTL 2GQHA 3LQAL 3SE4A 1D6EA 2Q8AH 5B4MC 2LABA 1P6AB 4WUUB 4QLRA 1MCDA 4NQDA 3ZHKA 2F5AL 3MXWH 3IETB 3KYNB 4X6DF 4Z7OE 3BZEA 2B4CC 1L7TL 1AQDB 3DSFH 1HXMB 1JRHH 3GSUA 4EDXA 4N5UA 3UCRA 2ZSWB 4RX4A 3O2WH 1G7PB 5KS9E 2FJHA 1BFVL 4GXUN 2W0FB 1HHIA 3MRQA 5DC4B 3ULVH 1CT8A 1YECL 2VXQL 3GB7B 3D9AL 3RVUD 4DVRL 3RIFF 2P8LB 4POUB 3W9EB 4UQ2B 1LO3L 4AY0A 1ZKAA 4XB8A 3BP6A 4AZ8A 5I9QC 5E2VL 2VXSL 3P4NA 1YEEH 3TIDB 1XF2B 4OGAC 3U4EB 3M1BA 3LPFA 4TQEH 4C56D 3VD3A 1H15A 5JW3L 1VFMA 1C16B 3FFCB 3RGVA 4LASH 1FL3A 4X83A 1GYAA 1UCBL 4OCMC 3U9PH 5CINH 5IOPA 2IANB 4PS4H 1VPOL 3MZGB 5F1NA 3DJ9A 2CXKA 3QDGA 1AIFB 3NPZB 4XNYL 1XH3A 3IDYB 4L8DB 4XNXL 3ALPA 3OR6B 3GSNH 3MV8A 2AJ3B 2QQQA 3QULB 3R1GH 2AJXL 1DQJA 1GC1C 4X7DC 4FQQB 2G9HB 1INQA 3I02A 4RGNB 4R4NC 3U7AA 1NLDL 1P2CB 3OKLB 4NSKB 4GXUM 5B3JE 5A2LH 4UDTB 4EJ1C 1S7WA 4Q6IA 2ZUSA 1A9EA 3MRMB 1T1YB 1UH2A 3ARGB 1B6DA 1F11B 1IM9D 3TPKA 3EO1B 3L3HB 1HH9B 4YXHL 5JW4Q 1R5IA 3MCG1 1G6VK 2X4UA 4IOFD 4LSPL 2P5WB 4PR5A 3C5ZA 4KRPB 4K71C 5I2IB 5IESL 2AJUL 2BRQA 1MI5E 3BJ91 1YEKL 4QTIH 1JGDA 3CD4A 3OKMA 1T22A 4UTAL 3KPPB 1IZKA 4F2MB 1OD7A 1FJ1A 3TFKD 5E8PB 2HJKA 5BZWA 5D2LB 3RZCB 3BGMA 2BRRL 5D6CA 5IHLB 1G6RL 4NFBA 4PJDB 4GW1B 3O6ML 4IRJB 1YPZB 5E8DH 4NN7B 4QXUH 2R29H 4QRUB 1BQHA 4YDKH 1E28B 2D9CA 3O45A 4CN1A 3MRPA 3FCTB 1TJGL 1P69B 5J11B 3S3SA 1M71B 1FPTL 4L5FH 4F8TA 2FEEL 2UV3A 4KPHH 4ELKB 5I8CA 5LGJA 4IBLT 1F58H 2E9BA 5KN5B 3BPNB 5D7SH 1A7PH 5JDSB 1U3HC 4N5ED 2CDFA 2ADFL 2ARJB 3T0EC 2JCCB 2NPLX 5DJAB 2Y07H 1AHWB 4L3CA 1G9ML 4FABL 1OAXL 2VABA 4DZ8B 2CIKA 3TT3L 4AJ0A 4M5YH 3NCEB 5CGMA 1G0YR 2PXYD 4WEBH 3UJJL 2DJUA 5IK3A 3RWFA 5ICXA 3VXSD 1HNGA 4J4PC 2FDBP 5BCAA 1A6WL 4K07A 3VXPA 4IIQA 3UPCA 1YY8B 4M5ZL 3MBED 4CU6A 2X4TB 5JPNA 2HVKB 1SYVB 3IFPB 3G08A 1VFAB 4YXLH 1A3QA 2Q1EA 3P4LA 4BQ6A 1WBZA 3AFLA 1T21B 1NCCH 1A7NH 3WIHL 1LEGB 3EYSL 4O51A 4WUUD 2WBJD 1CDHA 1RJZB 5DQJB 3IU3A 4HKZA 3RP1A 1IL1A 2H26A 3G5ZB 1EEZA 3VMOA 1N6QH 3ZDYE 4JPIA 1CK0H 1MFEH 2CLZA 4G8GD 5HHQA 2Q8BL 3VU2A 2BHUA 1FO0A 2V2XB 5FAAA 5GS2D 5IVXB 1OWRM 5J7CC 4C54A 4GO6B 4XC3H 3KDMA 1N5YL 3KPTA 1MCWW 4HV8A 3SE3A 5ETUB 1RUKL 1AQKH 1Y0LB 4FMKA 3MCKB 2C4XA 4HIJA 1H5BC 4PJFF 1UM5H 4NZDA 2EDBA 3IS1X 5F8RC 3BH9A 1YEJH 2ID5A 1O7SA 4IOIB 1T4KB 4HWZB 4OGXL 3U4AA 1NEZB 4YFLI 1N59B 1MPAL 1I8IB 3X3GL 3U82B 5GS1C 1W72L 1QFOA 2A9MH 3GHEL 1KIRB 2BHYA 2J88L 3FN3A 3GJFH 3T77B 5KVFL 3FT3A 5HD8C 5FYJE 4TVPE 2FATH 1ZLUK 4R2GB 3AUVA 4KK5C 5FYKH 4FN0A 3AMLA 4TPRL 1WWCA 4PJXF 2BSTA 3PQYB 2ZUUA 1F90H 5E8NB 1S9VB 4HS3B 4RDQG 4LLDA 1JWSB 4RGND 1RK1B 1KCVH 2NXZB 3WNPA 4H8WC 4N0RA 4JO4L 4A6YL 1OW0C 3P0VH 3UJIH 4LLMA 3FQUB 2NY5L 3I9GH 5MENB 1ACYH 4FFVC 4K7PL 4OI8A 1IM9A 5D1ZA 1EDQA 3GRWA 3ARGD 1T89C 2GAZB 1A7RL 1G7MA 4FZ8H 4AH2A 2AI0L 1ES0A 32C2A 4R0LB 4UUJB 4MD5B 5BZDB 1E27B 1GRWA 1YZZA 4AQOA 5HXMA 4Z7WA 2P5WD 1Z9MA 4GRLC 2QTEA 5FHBH 4KRPD 4FXGB 1ZLWK 4CMMB 3IU4L 1BJ8A 4MWFA 1KXVC 4Q9BA 3RDTC 2W0PA 4LGSB 1A2YA 4L8SB 4M43H 3LCYA 4E5XB 3LRGA 1VHPA 2VC2H 3MRRB 3QIUB 3RUGA 3ZO0A 4LLQA 1A0QH 1AY1H 3PDDA 4PJ5A 3RZCD 4H1LH 1G9NC 4JN2B 3PWVA 4KQ3L 3WLWC 1B0WA 4GXVH 3MUGB 4IRJD 4RRPA 3OGOE 2UWEE 1CZ8H 3M17A 4E41B 5CKAA 3I3DA 4FXKA 3WFZA 3V4UH 1J7VR 4HUMB 4V2CB 3EOTL 3GSQB 4DN3H 3FB7A 2ZUTA 1KYOK 1T03L 3U0TA 5DEGA 1DE4A 2ZCHH 3QWOA 4LCIL 5C0FA 2HMIC 4HK0B 4XVJL 5DD5H 1F3JA 3QUXB 3MNZB 1XR9A 1YEGH 4EVNA 5CBEB 1J18A 4PJEF 3JUZA 5E00B 4JZJA 3RWEA 2PXYA 4XH2A 3H3BC 1RVFH 2NY3B 3L9RB 4HH8A 1X5GA 4YE4H 5F3HB 3ZHLA 3NACH 3X13B 1FNLA 1BHGA 2EDDA 2PYEB 4GG6B 3C08H 3MBEA 5EOCH 4GKZB 3WJJC 4LKXA 4U6XB 1MCLA 4PLNC 4RISL 1JGVH 2IQ9H 4R90L 1UKQA 2JJUA 1X5HA 3RTQC 4WUUA 2A83B 2QHLA 4W81A 1NMAH 3BDXA 4ZFOA 5E2WL 3IETA 3KYNA 1I1RA 1PKQB 2EDOA 1UCTA 4U3HA 3DI2B 4G8GA 3TBYB 3G6JE 1AQDA 5D93B 1HXMA 3V9FA 3HMXA 3DGGB 2ZSWA 1G7PA 4FFZH 3LHPH 1ITCA 3WNOA 3MTRA 2P8LA 2RBLA 2ICWJ 4TRPL 3WFCH 3W9EA 3QEHB 4X4ME 4U1NB 2ATKB 3QJHB 3LPGA 4QGTA 2R8SL 5IVZB 4JM2D 4NBZB 4OSUL 1WC7B 1XF2A 3U4EA 3BD4A 4PB0H 3T1FB 1T1XB 2DYPB 2B20A 3C8DA 5I1IL 1JFQL 3GMMA 4KVCL 4LL9A 2XNAB 1U95B 1C16A 3HI1A 1RJCA 4PTUB 1N2RB 4U1SB 3R8BB 2F9BT 2IANA 3OSKA 5EIIB 4H1LG 1LDPL 3QDJD 3P4OB 1LO4H 1IGMH 1AIFA 2H1PH 1DUYB 5T5FH 3RU8L 4NJ9H 4L8DA 5DO2C 2AJ3A 3OR6A 3QULA 3PQYD 4HUXA 2VQUA 3OZ9L 3FB8B 2RIKA 3ARDC 1IBGL 2FX8L 4CDGC 5KS9B 3PG2A 1P2CA 3OKLA 4NSKA 4M7JL 1WT5A 2YMXL 5L88L 4GRMB 3QRFM 4B0MM 2XWTB 1H3PH 3CUPB 5MEND 4P4RB 4U6HB 1T1YA 3ARGA 1DBAL 4L8BA 3S97C 5K33A 1I1YB 3OJ2C 1X6NA 1YUHB 3DTXB 3ZKXC 5CEZH 1RZKH 3L3HA 5D7IE 3QISA 1HH9A 4WU7A 3C6SB 3NFPB 4JFXA 2DQDH 2VXVL 2IC2A 2HG5B 2P5WA 1R3JA 3TP4A 3BIBX 4ODBD 5AAWA 4OCRL 5DLMH 3WKML 5TF1H 3U6RB 3MA7B 3B8YA 2IPTH 5J13B 5MHSE 2R2EB 1A3LH 2G5BB 3KPPA 4UAOC 4F2MA 2DQJH 2XI9A 3JV5A 3QUMB 4YBQD 1F02I 4ODXA 5E8PA 4PV8B 4N8VG 3SKMB 5D2LA 3RZCA 1JHTB 3QIUD 2GY7B 3UTSD 4PJDA 4GW1A 3W82A 1RUQL 3EW3B 3GSRA 4QYOB 4IRJA 1YPZA 3DSNA 5DRZB 4QRUA 2EDXA 3P0YL 1E28A 4RA3A 4FFVD 4FFYL 4GAYB 4YHZL 2XA8L 4E41D 4H5SB 4YGAB 1KJ2H 2J3SA 2ZG3A 4G6JL 3C6LC 1OOAA 2BVOB 4ELKA 1DQDL 3U79A 5KN5A 4BSJA 4NZUH 5JDSA 5C07E 4F9LC 2NLJB 3L6FB 2DBLL 2P1YA 2ARJA 2V6HA 4UNTA 1AHWA 4QKXB 3BYTA 4DZ8A 1IKNC 2G5RA 4U7SA 2WAHA 4LQFH 5F6IC 5KANI 5FOJA 2KH2B 2BJMH 4KI5F 3HE7C 3UTTE 3B9KC 4JO1L 1MI5B 3QNXB 4NM4H 4OZGB 4DKEL 3HE6C 2VUYA 3WLWD 2ESVB 2IBBA 1YY8A 2IFFH 3WN5C 5L8LB 3RY4A 4XBEL 4JY5L 4POYA 2IEPA 3LPWA 1A14H 3O4OB 1PKOA 2X4TA 5TE7L 2HVKA 4NN6B 3H9HA 4NZRL 1VFAA 3MLSH 5I1DB 2HWZH 2QSCL 1T21A 4L9DA 4P99A 3OKDB 4B5EA 4TSCL 3TH2T 1LEGA 3S7GA 4D3CL 4OM1H 2OLDA 1DBJH 1RJZA 1EFXB 1NCWL 3S36H 4WTZG 5D7JB 1Z5LB 5DWUL 2CIIA 5T3ZD 3DIFB 2NY6C 4ZS6D 4PGCA 1CD9B 2C4FT 4F15B 1IE5A 3MLRH 1MCOL 1ZV5A 3HB3D 3UPAA 5MP6L 5C0RH 2YA1A 3C09B 3OKNB 2V2XA 2FH6A 4WHTB 5IVXA 4S10A 5EC1B 2FEEI 3FRUA 4OLXH 2BZDA 2QQLL 3L5XH 1QRNE 5IHUH 5I1JL 4Y5XC 4A2MA 1CXLA 5ETUA 2BY3A 5DEFA 1X9QA 1Y0LA 3BKJL 4MXWL 3MCKA 1ND0B 5KZCD 1ZANH 3U7YH 3P4MB 4JM2A 2IPKA 4R4FL 1XGPB 1CXEA 4U1GB 4ODWB 2QEJA 1FNGB 1MHCA 2GHWB 1T4KA 4ORGB 4HWZA 3OX8B 1NEZA 1N59A 3QB7C 1I8IA 3RVTC 5D6DA 3NAAL 5FDWB 1FO0L 3ORJA 2YRPA 4XCFH 3ZKQD 1KIRA 3T77A 1VFOA 3QDJA 1QR4A 1A7BA 4F3FB 5CZVH 4P2RE 1AGBB 5DUBB 3O6LL 4Y5VA 4MGXA 2H41A 4GUPB 1W0WB 3PQYA 4JKPL 2Q86B 3RAJH 5CSBA 4CDHA 1FAIL 2V9TA 1KLGB 5E8NA 3WJLA 4RGMC 2AK1H 1JWSA 3FB6B 1BGXH 1SM3L 2A6IB 4HIEB 5IF0A 1FNSL 4WV1B 3O0RH 4M7LL 2I07B 1NL0H 3CMOH 2C7UB 5HDBE 1J5OL 2PO6B 4KJPC 1I85A 3FQUA 3PL6C 3FRPG 4EI5B 2O5YL 5C0JB 5MENA 2EDKA 4RQQB 5DR5L 3CU1A 2F19L 5A40E 2GAZA 3MFFB 5F7EL 4G9DB 3VGHA 2AEPL 4R0LA 1R3IL 1UA6L 3HC3H 4MD5A 4UUJA 1E27A 1MFBH 2XT1B 4U6VL 5BQ7B 3MRBB 1EEUA 3MRNB 5FA4A 2B1AH 3ZDXE 3ZZ1A 3KYMA 2VXUH 5I1HL 4CMMA 5J6HB 2BOBB 2ZCKH 5DO2D 3BWAB 4JFQB 3TH3T 1Q9OB 4GG8B 1R5VB 2ZCLH 3L3JB 4ONOA 4KV5E 4L8SA 3AMKA 3KJ6H 2CO6B 4LEOB 2VDML 3MRRA 3GRWL 3QIUA 4Z95L 2XZCL 4QO1A 5EU6E 4JN2A 4RMVA 5DJ0B 3VWJC 5GGRY 4JKLA 3MUGA 2A73B 1OPGL 1NUFA 3ESUF 2OP4L 1CL7I 4XXCC 4E41A 2WBWB 4W4OC 2YBRB 3FQWB 4JRXD 2GK2A 1AXSB 5EBMB 1LP9A 3GSQA 3F58L 5KSAB 3PWPE 4HPOL 3V7AG 5F71A 3ILQC 1DZBA 3NVQA 5IVNA 2DIAA 4H0HB 3ULVC 3MNZA 25C8H 5CJOL 1DR9A 2LV4A 1C12A 2W38A 1AGFA 5E00A 1FLTX 3HAEH 5ID1B 1EA9C 1MIMH 3L9RA 1DP0A 5F3HA 5MI0C 4QWWC 3FHQA 3DMMC 2Q6WB 3K4DA 1QG3A 2AEWA 4G42A 1PG7H 3X13A 2QLVB 2PYEA 2C26A 5C09E 4GG6A 2ESVD 4K9EH 4JFED 3QEQE 4GKZA 2ZWLT 1W0VB 5CWSA 5FECB 1FNAA 4U6XA 5I19H 1CVRA 2VIRB 5IEHA 3C6LD 3M8OH 5JDJA 1RIHH 2A83A 4HW6A 3QG7L 5I75B 2UWEB 1C7TA 1JMXA 2D9QB 1MCEA 3JVGC 4ODSL 1PKQA 1LO5A 2P5EB 1EFXD 4AEHL 2ADJA 2YPKB 1W8NA 3V4PL 4ACPA 3VCLB 3TBYA 1QP1A 4TUJB 1YY9C 1CI5A 1EJOH 3DGGA 4M02A 1MNUH 1AD0B 1U0QA 1KV3A 4KTYA 5B8CB 4I13B 1Z0MA 1T83A 3HE7D 1BM3H 2YUWA 1J05B 3B9KD 1UM4H 4PJCE 4QRQB 4XPGH 5HYIA 5KSBE 3D87B 4LCCB 1MIEL 4MZ3A 5GXBB 5HDLA 1DQQB 4KKCD 3EDDA 2FB4H 4OJFH 3MRGB 2XTJC 3QEHA 4KRNA 2BDNH 2ATKA 4U1NA 3QJHA 4Y16B 4ZFOL 4O4YL 4LVHC 4WW1B 5IVZA 4UMGA 2ENYA 1WC7A 3T1WA 1R6VA 3ARFC 3TCLB 3AAZB 3T1FA 1D9KC 2DYPA 3KR3L 2ZJSL 5LKNA 4OD3H 3HMXL 3KPLB 3T0EE 3VH8B 2IAMB 2W0KA 5ALBL 2XNAA 4BYHA 1U95A 1KLUB 2VL5B 4R3SB 3HFMH 1T7XA 4QOKE 4HSQA 4OZ4B 3TM6A 4PTUA 5FOBB 4U1SA 1QSFE 3DGCR 1NFDF 1WIOA 5EIIA 2VTFA 1WAAF 3P4OA 4XBGB 1MVUB 15C8L 3QWRD 1B0RB 4OTXH 5C6TL 1GOFA 3FB8A 1REIA 4N0YL 4YGVA 5MERB 5DUMH 1M7DB 4JFZL 3QQNA 4Z8FH 5KS9A 2WP3T 1NGQL 3ET9F 1CGUA 4HMCA 1NEUA 3S8WA 1P1ZA 4GRMA 4K8RH 2PO6D 2XWTA 3Q1SL 4G3YL 3CUPA 4YUEH 4P4RA 3BKYL 1INDH 1I1YA 1P7HL 1PY4A 3V79C 3DTXA 3GFUA 3HAEG 1ZLVK 1HEZB 2Y5TB 2XYCA 4WWKC 3C6SA 3NFPA 2HG5A 5GGSB 2V5RA 4OKDA 3H9SD 3GBMH 1W0YT 1T5WA 4ETQB 3MA7A 1SQ2N 2YZ8A 2Z9TA 2R2EA 2G5BA 1P9MA 2Q76B 4CJ0A 1RULL 3QUMA 5BXFB 4YLQT 4PV8A 3SKMA 1QTYT 1JHTA 5FUCE 1K2DB 4G6KL 1KCRH 1CICD 4YBLB 1PJ9A 4WO4C 3W81A 3GIVB 1MHHB 5DRZA 4C4KT 1KJMA 2ORBH 3HMWL 4GAYA 5IB4B 4KMLB 4H5SA 3WHE0 3TV3L 2BVOA 3P40A 1D6VH 4V2BA 5FV2A 4ERSH 4JJ5B 3I6LE 3CMGA 3L6FA 4HXAH 1YEFH 5JIPA 5EWIH 4OLWL 1ZXQA 5GPRA 5D7IB 1FNHA 3CXDL 1HE7A 4R26H 3OTTA 4X99A 5IP4A 5BJTB 4O5LL 1XF4A 4JDVB 3N0PB 1K5NB 3T8XB 4WW2A 3UTOA 3QNXA 1ZE3C 1RHHB 4OZGA 1OSPL 4D0DB 2EZ0C 2ESVA 4JFEA 5D71L 4OCSL 3M45A 2FEDC 4LSQL 4WY7L 4FS0A 1V05A 4J2XA 3ELAT 2ICWA 2VOTA 5I1DA 4QEGA 4DQOH 3GHBH 3OKDA 3G5VB 1DVFC 3C60B 1IKFL 4KZDH 2LU3A 1EFXA 4D0CB 4L4VE 3ECBB 1Z5LA 2P5ED 3DIFA 4JPWH 3GIZH 2D03L 1E4KA 1OQXA 5A1AA 3HG1E 2MCPL 5C07B 3OKNA 2FX9H 4WHTA 1AXTH 1RMFH 4I3SL 5EC1A 4DAGH 3BP5B 5AYUL 4LDEB 5GGUB 5DD1L 4NDMB 3DMMD 4AEIL 2CK0L 1ND0A 5E94B 5D1QB 3P4MA 3BX7C 5EZLB 1DQTA 5FHAH 1XGPA 3UTTB 2Y7QB 2XRAH 1CDBA 3CH1A 2Y06L 2XFXB 3PE9A 3PGFL 3Q6FB 4ODWA 4YHLH 1FNGA 5EULV 4V1DE 1KBGL 4PRID 3X17A 4ORGA 1MRCL 3OX8A 4N8CL 4PLJC 4ZO8A 3U1SH 2D7MA 4R96A 4P3CH 1LO2H 5FDWA 2EXYD 2YR3A 4G6ML 3AM8A 3O2VL 4Y4HB 1U2CA 1ZGLM 3VDCA 3WXWL 1A6UH 1B0GB 1YY9D 2OL3B 4UB0L 4ZO6A 4F3FA 2WUCH 1DANU 1AGBA 5DUBA 1J0JA 1MJUL 2A9NL 3ME0A 5GISL 5T1MB 3P77B 4GUPA 5KOVC 1W0WA 3S3PA 3DX6A 5GJSH 2Q86A 4KRMB 4UINH 5EOTB 3H9ZA 4EOWH 1KLGA 5FB8B 4N90D 2F58L 3D5OF 5F1IB 4YHYB 3FB6A 1FIGL 1KN4H 4NWUH 2A6IA 4HIEA 4L4TE 1S5IL 4WV1A 4TNWF 2I07A 2C7UA 2PO6A 2EDNA 2YD3A 1T3FB 3IXAA 4MLSA 1AD9A 1QRNB 4EI5A 1PX3A 3O2DH 5FUZH 5C1MB 3IF1A 1IZJA 2I60L 1VGKB 4R4BA 5GS3A 5DZNA 5T3XH 3MFFA 4NJAL 3S9DB 5BOPA 4G9DA 4KJQD 2L4OA 5IFJB 4K94L 4XC1L 1YNLL 2B7DT 3OJDB 1CLZH 2AXJA 5BQ7A 3AREC 3MRNA 3H9SA 2AW2A 3G04B 1T7YA 2EXWC 4KTEL 1LK3L 4KDTA 4M6NH 4OCNC 5J6HA 2BOBA 3ARBD 3NCCB 4W6YB 3IJHB 3BWAA 4JFQA 1Q9OA 3OAYK 1R5VA 3L3JA 3P2TA 5ISZD 1KFAL 1JZ6A 2MTPA 4LEOA 4P2RB 1CD1B 1L6ZA 35C8L 1CICA 2VL4A 4F8QA 4M6AA 2DTSA 1OTTC 5DJ0A 4YHOH 2A73A 1A5FL 3QEGH 3G6AB 1FAKT 2H3NB 2FJGB 2YBRA 2NY4B 1DL7L 3FQWA 4JJHA 1FC2D 1AXSA 5EBMA 3Q2CA 4NKIH 1FVDB 4J3UA 1NCAH 5KSAA 2VLLB 4P2QE 2CH8A 3CDGB 2RCSH 4NUGL 2D7TH 4YDJB 3SDXA 3QWQB 4YXKH 1R5WB 5GGQL 2VH5H 4PGDA 2VDNH 4JO2L 1RIUH 1RZ7L 1IC5H 4AK1A 3GMQB 1OT1A 5C08E 2E7LA 3LH2H 4Z7UE 2DQTH 3EO9L 1MSPA 3LQAH 3QDAA 4PUBH 2Z8VC 5ID1A 4IM8A 1S5HA 5CUSL 1M05B 3H0TB 4JVWA 2GJJA 4MXVF 1CD0A 3MRIB 1NSNL 4LVOC 4TTDD 3VI3F 4HGWB 2Q6WA 2F5AH 4WO4D 2G2RB 2UVFA 2OM5A 3QHTC 4QRPD 3DX9B 1DUZB 1W0VA 3BGFB 5FECA 5E8OB 3Q5OA 5DZOA 5EU6B 1RI8A 1EHLL 4HJGB 2VIRA 4YHPB 4HWBA 4LGPB 1WCBB 1BFVH 4IJ3C 5IBTL 4XP4L 3OKKB 1YECH 3D9AH 3T04D 4DVRH 1QSZA 3U0WL 2P5EA 4Y89A 2YPKA 2RJMA 3ZKMC 5JOEA 1OL0A 4TUJA 1LO3H 4GS7B 5E2VH 3NIGE 3PWPB 5B8CA 1B4JL 1J05A 4QRQA 3GGWB 4LCCA 1DQQA 4EN3D 5AG8A 3MRGA 3SKNB 1UCBH 2FEDD 1B9ZA 4WW1A 1J8HD 5T3ZL 4PRPE 3N1QC 4ZD3L 4Z7NF 1VPOH 4PRIA 3AAZA 4LLWA 2QL1A 4EXKA 2XA3A 1X5AA 2EKJA 3KYKH 4XNYH 5F9WB 3KPLA 3VH8A 2IAMA 2IH1A 4I77L 5C09B 1DVFD 4XNXH 3QEQB 1KLUA 2VL5A 4R3SA 2AJXH 3KYOB 4W68A 1FGNL 4OZ4A 5FYKD 1L9NA 2AJZB 3J7HA 5F9JA 3ILPB 3WNKA 1NLDH 5C3LD 3IGAA 1MCJA 2VLMD 2X6MA 1LNUB 1BQLL 3VGAC 2WP3O 1NCDH 2VERN 5CIPH 1OAUL 1B0RA 4FRWA 4PLKC 3STZB 3IXTA 3SDDB 1JWMB 4TULL 3B6SB 4HEPG 4DFHA 1CBVL 3DBXB 5MERA 1M7DA 2GEEA 5GSVA 2ZOKA 1AJ7L 4B7IA 1ZWIB 4YXHH 4Z7WF 2OTPA 2QHRL 2CR6A 4PJCB 5KSBB 3SGJA 4APQC 2MQ3A 1ZHKB 3QFJE 4WHDA 5IESH 1QRND 2AJUH 2VZ1A 4X4MA 1EXUA 1ZA3B 3HC4L 3RUGF 2Z31C 2Y5TA 1U3HB 1RZ8B 2X4PB 2ED9A 4AEEA 4WFFE 3T0EB 5GGSA 2BRRH 5HYFA 1A9BB 4U31A 1H3VA 1G6RH 2A6KB 3RKDC 3ARBA 4QOKB 3O6MH 1KEML 3ZT5A 5J12C 3QI9B 4ETQA 1MHEB 3FHAA 5F1OB 4KAQL 1U8HB 1QSFB 4C4KO 2Q76A 5BXFA 3C9NB 1Q0YL 2ARWA 1UJ3C 4JY6B 2K3TA 2LU7A 1K2DA 3BP4B 2Y5EA 2FJFB 3H3PL 1YNTB 1MHHA 4YK4C 3FZUC 5FK9B 2W60B 2ADFH 2ADGB 1QLRB 3RPIA 4JG1L 4KWUA 3HZYB 1G9MH 4TUKH 3S35L 3EYQC 1OAXH 1RQ5A 5IB4A 3MX0A 4YC2B 5DVLA 2NY4D 3TT3H 3V2AR 3C5JB 2YHGA 2I9TB 3UJJH 3QUML 4HJJL 1Z6JT 2WK2A 1A6WH 2PW1A 2WWMD 5D7IA 4DOHE 4KMQA 4FQLH 1UH4A 4FXLA 4M5ZH 1C1EL 2VSDA 3TA3C 3ULUC 4S1RL 5BJTA 1MCIA 3DVNB 3C2AH 4JDVA 2RGSA 1K5NA 3OKOB 3T8XA 2YWZA 2XXMB 4XNMB 4X6EB 3BRFA 3WIHH 3QXAB 3EYSH 4D0DA 3BHBA 1ACZA 1OLLA 1LILA 1HHKB 2WUBL 3H7BA 1YN7B 2P44B 4K3HA 4PJ8C 2Q8BH 3ZT7A 1UJTA 2X05A 1F45A 4OZIE 2HT3C 1KCUL 3VRLE 3OAUH 4X80L 3MV9E 4ZNEA 2DDQH 4ORZC 4NQCE 3G5VA 2SEBB 5GS1B 3D39E 1E4WH 3C60A 1N5YH 4M1CD 1CDUA 1JF1A 2D0GA 3ECBA 3DUUB 3QR2A 2X09A 1RUKH 2Z8RA 3GKWL 5GZNC 4XPBL 4KRLB 1NFKA 2DF3A 5IROA 5D96C 5C07A 1R24B 1UT9A 3MLZL 3RIAF 2GKIA 2X89D 4IMKC 4EN3A 1MPAH 5GGUA 2DQFB 2E6QA 2H32B 4NDMA 3ALXA 1KPUA 3X3GH 5E94A 1T2QL 5D1QA 2KUTA 2FL5B 1UZ6F 5EZLA 3GHEH 1A6ZB 2J88H 5KVFH 1PSKL 2Y7QA 4I0PB 3Q6FA 2XFXA 3GJFA 1S78D 2FCBA 4JPVL 1EGJA 5T1KB 3RVXD 4TPRH 1MCKA 4N0FA 4BH7B 3IB4A 5JORB 3WIIH 3LB6D 5IJKC 1WZMA 4MQXD 5LVEA 3GBLA 4GRLB 2LVCA 5DRNB 4HZLA 1B0GA 1D5ZB 2OL3A 1YMHA 3B5GA 4NHUA 2KQMA 2YS4A 4GMTL 3DX8B 1S9YB 1Q9WB 1HILA 2NY5H 1KPVB 1QEWB 4L4VB 5T1MA 3P77A 4HJ0C 1UADC 4K7PH 4KQ4L 5EOTA 4MHHI 1U41A 2L0DA 5FB8A 3SDDD 5F1IA 3EUUA 1BQSA 4OZHE 4AIOA 1OP5H 4ELMA 1WLHA 1A7RH 4JQXA 3HG1B 2W59A 4UT6L 4U33A 2YUVA 3X11B 2AI0H 4WGVB 2OMBA 4LEXL 1HQ4A 1T3FA 2APFA 1H0DB 1QRNA 3VFWB 2EYTB 5DJXB 3ZYJA 2DLFL 3IU4H 4QF1B 3FQXB 4CMHC 5D2LF 3GMLA 5IFJA 1V7ML 5K9OA 4V1DB 4UILL 1UYWL 4P5MB 4PJDF 2X2YA 4FTVD 1YPZF 4OKVB 3G04A 1V3MA 4KQ3H 3K3QA 4L1DA 4H1LA 1N0XL 3IJHA 4O2FB 5A2JH 2CUMA 3QI9D 4PY8J 3REWB 5D5ME 4FMFA 1QSFD 1SYSB 3GSOB 2WWKT 4M8VA 4P2RA 2AS5M 4K9EC 5IVOA 4U49A 4G7YH 3GO1L 5FUOL 5H35A 3EOTH 3QHZL 3DPBA 2BSRB 1BX2B 1T03H 4ONFL 2JCCF 4KZEL 1CU4L 1V5JA 1G1YA 2NZ9C 4LCIH 3G6AA 3GZKA 2Y23A 3DETD 2FLBT 4XVJH 3OV6A 2FJGA 3H9YA 1EV2E 4XRCB 4Q9QL 5EBLB 2Z31D 2X1OA 4LPWA 2VLLA 1QFPA 4X7CC 3CDGA 2P49B 4DGIL 2VUOA 4YDJA 1EMTL 4I48B 5DD3L 4JANB 1R5WA 3HR5B 1A8JH 4HX1B 4XAKD 3GMQA 3LRHA 4TOYL 1JNJA 4XHQA 2EC9T 2R0KH 5AWNL 1F2XK 1EZVX 4RISH 1M05A 3H0TA 4R90H 5DVOA 3LEXB 2O5ZL 3SKUD 3MRIA 5GS0D 1MJJB 5ESVB 4HGWA 1A21A 5E2WH 2G2RA 1WICA 3K8MA 2HH0L 2P8MB 1QQDB 3DX9A 1DUZA 4LSTL 1NGXA 5EU6A 2DTML 2Q7NA 4HJGA 5IVXF 5CJXA 4YHPA 5IG7B 1OAQL 3WUWG 1WCBA 4LIQL 3MV7E 1DTUA 3A0OA 3QAZC 2JIXD 5GZOC 1A1MB 3OKKA 1I1AD 1KGCE 5IFHL 3HZVB 4NHCL 4O2CB 3FO2B 4TRPH 3UYOD 1EERB 2R8SH 1HQRB 4O2EB 3QDMD 4P2QB 3TA3D 4UT9L 1ZT1B 1NBQA 3W39A 2X89A 3DV4B 3SCMB 5I1IH 1JFQH 4D9RE 1YEHH 4ZAKB 1DQLL 1GGBL 1Y18B 3OPZH 4HWBL 4KVCH 1VKXB 2OI9C 1S7XA 1CD8A 3V5KA 4Z7UB 1FVCB 3SKNA 1HDMB 2PYFB 3HI6L 1MCFA 4KK9D 1LDPH 2DWDB 3TH4T 2UZXB 4XXDB 4ZUSB 2PTVA 3QXDB 5C09A 1F2QA 3RU8H 5C0NC 5T33L 2CSPA 5J89A 3GMPB 4YEFA 3KYOA 3OZ9H 1W2KT 3P9MB 3I84A 1IBGH 3O6FD 3ILPA 2FX8H 1EHXA 1N0LA 1QBAA 2YXMA 4N1CA 4HUNB 2YMXH 5L88H 4BSVB 4PJ7E 3STZA 2VXTL 3FB5B 3SDDA 3T3PF 3GBNL 1DBAH 3B6SA 5CINL 3DBXA 3UP1A 3PGDB 5A16B 1DBML 3F7YA 1MY5A 1ZWIA 1J86A 3FMGL 4JFFD 1BBDH 5JXEA 5KSBA 4HMEA 1HHJB 3N1FC 4R97C 4K7PY 1IGIL 1ZHKA 4OCRH 1XF3B 2EEAA 1JGEB 3OB0H 3RVWC 1ZA3A 4GAJL 4DUVA 4MJ6B 4PRPB 5F3BB 3HC0B 3JWOH 5CSGA 4MNHB 2XG4A 3D69B 1U3HA 1C08B 3EFFB 5HGDA 1LWRA 3TN0B 1FFOA 4V1DD 4I4WB 3T0EA 3QUYB 3K7UA 1A9BA 2YD4A 4HQQL 2A6KA 1WWBX 4XX1E 1JGLL 1RUQH 2E8ZA 4A2LA 4XHJC 3QI9A 1MHEA 5CCKL 3P0YH 1U8HA 4B53A 1QSFA 3QUZB 2LTQB 2F5BL 4FFYH 3OG6B 4YHZH 2XA8H 4NRYB 1K8DB 3OAZH 1WIUA 2JJVA 4RMSA 2NNAB 4JY6A 1P7KA 4Y4KC 4UOW1 4G6JH 1WF5A 5IMMB 2HT2D 5CJQL 1DQDH 3BP4A 2DLGA 5EB9A 3WN5B 3RI5K 2FJFA 1YYML 1YNTA 4FQPA 2JJTA 2R0WH 2DBLH 2VE6B 2ADGA 3BXNB 1QLRA 1QHOA 1HWGB 2EYRB 2R1XB 3HZYA 5I8KL 3UBXG 4QT5B 1MRDH 2FO4A 4LOUC 4I2XE 4HS8L 3C5JA 5GRVL 4MDIB 3UROR 3QFJB 1Q9LB 2I9TA 3A6CL 1K6QL 2NY6B 3MPCA 2JF1A 3V6OA 2VN4A 4GG6F 1K9TA 5FM5M 4DKEH 3WHXA 3FO9B 3BT2L 2MQ0A 5HGAB 4XBEH 4JY5H 4XNUL 3T3ME 2NTFB 5TE7H 4Z78B 2O61B 3DVNA 4NZRH 1KXTB 5D7SL 2BK8A 3OKOA 4G6FD 4PD4J 4XNMA 4X6EA 1Y6KR 5CEYB 4NO2B 4TSCH 3QXAA 1TQCB 4D3CH 3RX8A 3IJSB 5JHDE 4BK4A 1RFDL 1NCWH 5DJZB 3NIDE 1HHKA 2J8OA 2VISB 3IRPX 4UDUB 5DWUH 4M5YL 1YN7A 3U30C 1CLOH 4PJ9C 4WEBL 5EG6C 2CO7B 1JL8A 1MCOH 1U8LB 1FP5A 5MP6H 4NBYB 1KIQB 4WEMB 2JIXA 2SEBA 5GS1A 4LK4A 1F3DH 1I1AA 4XPFL 4JAMB 5EA0H 2QQLH 4BZ1L 1LDSA 2W91A 3GMRB 5I1JH 5L7XL 3BKJH 4MXWH 2MNUA 1BJMA 2AERT 2IQAB 1WZ1L 4P59L 4J8RB 4MD0A 2DKSA 2HKFL 4R4FH 4P2QD 1R24A 3WS6C 3UX9B 1NMCC 4YDIL 4L9LA 2HFEB 4DOHB 1CK0L 4ZAKD 2DQFA 1CXKA 2H32A 4FZEL 3FAXA 1CE1L 3NAAH 4QHUA 1FO0H 1EJ6A 2A74B 5CEXB 2FL5A 1KULA 2DKMA 1A6ZA 4LNVA 3IFNL 4I0PA 2A1WH 4N0CD 4WJ5B 4Z7OF 1SBBA 3VFSB 4WFHE 4UV7L 1AQKL 1G1CA 5T1KA 1HSBB 3MGAA 4JKPH 4BH7A 4PD4K 3SEPA 5JORA 2K7PA 2GW5A 5KS9F 4KJYA 1FAIH 2JELL 4OZIB 1IEHA 4TN9A 4NCDA 3O6FA 4JHBA 5HI4C 1YEJL 1JUFB 2VKWA 3MV9B 5DRNA 1QSVA 2C9AA 4NQCB 1D5ZA 3LIZL 1FNSH 2I27N 3D39B 4R7NB 2ERJC 4M7LH 4O02H 3SHSA 3DUHA 4QXGH 1J5OH 4S11A 3DX8A 1Q9WA 1F8TL 1KPVA 1QEWA 4L4VA 4NFCA 2O5YH 4ZODA 1FGVL 2DQCH 5DR5H 2F19H 4K8RD 4BH8B 5F7DA 5AG9A 3HG1A 3N1GC 4ISVB 5F7EH 1I9EA 2AXFB 2YPLD 2IPUK 2AEPH 3X11A 1R3IH 1UA6H 5FYKL 4P5TC 3LOWA 4KJWD 4U6VH 5IW1B 5FDYA 3VFWA 2EYTA 1S7SB 2OL3L 5DJXA 5L0QB 2F8XC 3HTLX 5C0ND 3EDEA 3FQXA 3GSXB 5I74B 4JFOA 2ICWI 3VD5A 2VDLL 4RMUA 1ZVSB 5CMAA 4MXQD 3HKFA 5BW7C 3L3KB 4V1DA 2LAAA 4DGYH 1CLYL 2VDMH 4P5MA 3GRWH 3MNWB 4ZUTB 4Z95H 2XZCH 4HULB 2XKSA 4OKVA 2PCPA 3TN0D 3TVMC 2XTLA 5EO1B 3LQAC 4Q9CA 3B3IB 1XIWC 1P4BL 3K1DA 4U0RB 1OPGH 4O2FA 1MFAL 3REWA 5B3JF 1LEKB 2OP4H 1SYSA 3QUZD 4M1DL 3GSOA 4JHAL 5MI0B 2GJ6E 3ARVA 1BF2A 4X4XB 2Y72A 1BD2D 3VGEA 1I3UA 1BX2A 3TO4C 5EOQL 3WEXB 3PHOA 4HPOH 3QEUB 4HKXB 1J1XH 4WCYL 5CJOH 1AGDB 4XRCA 1UXSB 5EBLA 4HKBB 5DFTA 1QFHA 3BDBA 4KI5C 2Y1VA 4GXVL 4MNGE 2GFBB 4OZGF 1DQML 4KGLA 5CLWA 4I48A 4JANA 3HR5A 4EUPG 4HX1A 2B2XH 3T65B 5BRZE 2NY2C 5DYOB 1GJIA 1V3JA 3VWKC 1TITA 4DGVL 3HA0A 1UM6L 3LEXA 4OV5B 1MJJA 1WWAX 1T66C 5DD5L 3QG7H 5DVKA 5ESVA 1JZ8A 5D5MB 2WQRA 4P3WA 4XMLH 1X5FA 2P8MA 3SGKC 1QQDA 4WI5A 4AEHH 5BVPL 4KVNL 3V4PH 4MJID 2XPGB 5LWYH 3K46A 4B50A 3WS3B 5L9DH 1A02N 5IG7A 2AVGA 4G8EB 4OLUL 1A1MA 1MIEH 4HIXL 1J1PL 4M93C 4QRTB 1RURL 3HZVA 2UZYB 3FO2A 3RBSA 3AY4C 4O4YH 1HQRA 4O2EA 4P2QA 2C3GA 3OMZA 1ZT1A 2NCMA 4XWGL 5E2JA 4LQ1A 4Y8DC 3KPNB 3E2HB 3DV4A 4POZC 3SCMA 3KR3H 3SKOA 2ZJSH 2BNRE 3HMXH 3QCTL 4WHCA 4ZAKA 4HXBH 2F53D 1Y18A 5HGGS 1RAMA 1VKXA 5ALBH 3ZDZE 5GS2H 2IBGA 3RJQB 4Z7UA 1NGZB 1FVCA 1HDMA 4OGZA 2PYFA 3O8XB 4S1DC 1HSAB 3SDAC 4PJAE 1PQZB 3PP3K 2NR6C 1SJHA 5E7FA 4XXDA 3ZDYF 4ZUSA 1IJ9A 1CYGA 2PTUA 15C8H 1AR2A 3QXDA 5F70A 2ILLA 1FSKC 3Q5TA 1TTUA 3GMPA 3OXRB 4P57B 1WTGT 5C6TH 4MCZA 3ULUE 4N0YH 5JMOC 3P9MA 1UC6A 1RIVH 3MUY1 4M9PA 5C86A 5F88B 4PB0L 3MV7B 3O11B 4LU5L 4UOJA 4BSVA 1TCRB 1MAML 5J06A 1ULVA 3FB5A 5T1LB 2YUZA 3BKYH 4ESKA 2DAVA 3PV6B 4EBQL 1XGRB 1I8MB 4WENB 3PGDA 4QY8B 5A16A 1WJ3A 3LV3B 2EDYA 3Q48A 4KKNA 4RWYL 5GRUH 1I9JL 2H1PL 1G9MC 1HHJA 5FGBC 2NTSP 3WD5L 5T3XD 2XY2A 5F8QC 1XF3A 5E2UL 1JGEA 5F96L 4PLOB 2WNGA 3BEWB 4XP1L 8FABB 5I1LB 3NCYS 4MJ6A 4PRPA 1JRHI 2RFXB 3HC0A 3MGOB 3VFOB 1RULH 3D69A 4I18B 5DS8B 5HI4D 3WSQL 1C08A 2NY0C 2VLJD 3MJ9A 1OGAE 1PYWA 3TN0A 2A0LC 4BZYA 1CCZA 3QUYA 5DMGC 5TQ0L 1I7ZB 4JFYB 2XQBL 1GOGA 4OF0A 3KPMA 1RZKL 3QDHA 3QUZA 2OXHA 1WUNT 2YD5A 5IFAH 1JN6B 3HMWH 4NRYA 1K8DA 1G0DA 2NNAA 3O3EB 4N9GB 3ARZA 3TV3H 3WDIA 5TFSL 1VEPA 4PJ7B 1OHQA 5I1EL 4P5TD 2B39A 4KKAD 3UZVB 3WKNA 3X3FL 1A3LL 2VE6A 3BXNA 2EYRA 2R1XA 3Q5YA 1KTLB 5K9JL 4OLYL 4OLWH 5M7QA 3HR6A 1M7XA 4QT5A 1KIUA 4UU9A 3TEUA 4MAYC 2EKSB 2KPNA 4O5LH 4MDIA 1WZLA 3QFJA 2OK0L 1Q9LA 5TE6L 4KK6D 1OSPH 3FO9A 1LE5B 5HGAA 5D71H 4OCSH 2FGWL 4PRBB 4RSVA 4LSQH 4WY7H 4H26B 1CN4A 3O3BB 1JPFB 2IALB 2RHEA 2NTFA 4FP8L 4S2SA 5SWQB 3UTQB 4UTBL 1QPXA 3EBAA 2X9XA 3VG9B 5CEYA 4F7MB 1IKFH 3IJSA 4FQ1L 5IQ9B 5DJZA 3BSZL 3NN8B 2VISA 1P7QB 1T1ZB 4UDUA 3WUZA 1EHNA 2D03H 1CS6A 3PV7A 1BOGB 3UDWC 4NM4L 2MCPH 3L5JA 1KIQA 5HI5D 5I0DA 1VB9A 5ICZB 3TJHC 4HHAB 4JAMA 1ZTXL 1VSCA 4I3SH 5AYUH 1IAIL 3GMRA 1X4XA 5ILTL 2MCG1 5GS0L 5DD1H 2NY5C 3REVB 4I2XB 3KS0H 4P5KB 4J8RA 4K3GA 1TMCB 2HWZL 4KKBC 1J12A 5IKCB 3D3VE 3UYRL 2Y06H 3PGFH 3H42L 3E0GA 4Y4FC 1KBGH 1IEBB 4P4KD 2W65A 1MRCH 4N8CH 5IR1B 3LKOB 2FR4A 3ZKND 5TQ2H 5B21A 4IRZL 2YK1L 2XN9E 1BFOB 3VRJB 3MODL 2A74A 5CEXA 4G6MH 1TPXB 3QIBC 4OI7A 5C0RL 2J1KA 3O2VH 5FYLD 3O8XD 5IBLD 4WJ5A 3WXWH 1CGVA 4UB0H 5DJYB 1J0IA 3G5XB 1OCWL 4CU8A 3VFSA 2DLEA 1MJUH 5JHDB 2A9NH 5GISH 3NFSH 1HSBA 5FXCH 4QCIB 1TNMA 1VADB 2DJSA 4OZIA 1GGYA 2F58H 3NFNA 5DJ2A 5CHNB 5C9JB 1F5WA 1JUFA 4OUUB 4I0KA 3MV9A 1FIGH 4NQCA 4PTTB 4R7NA 1N6VA 1O7VA 1CIDA 4LMQI 3LS4L 4R8WL 3CSYA 3GSWB 2HTLC 5D2NA 5CZXC 3W0WE 1UKSA 3EYVA 3KPSE 1U6AH 4U1HB 1WBYB 2I60H 5FM5O 4D8PA 4BH8A 3V52H 1CQKA 4P2OC 4NJAH 3T2PA 2AXFA 1J10A 4XC1H 4LAQL 3LKRA 1KCSL 4D9RD 1UG9A 1S7SA 4F80A 3FFDA 4KTEH 1LK3H 2OJZL 1JNLH 3GSXA 4Y5YC 2R15A 1ZVSA 2OTWB 1KFAH 4NM8L 2VLJA 3L3KA 4AT6B 1OTUC 4RDQF 4IHOB 3MNWA 4XMPL 4ZUTA 3DRTB 35C8H 5F9AC 5EO1A 1D5BA 3B3IA 4G80B 4HUVA 4Y0GA 4LHUB 1RJYB 1CDIA 1A5FH 2HKHH 1KJVA 1DL7H 5MEPB 2B1AL 4WDIB 3AS2A 1C5DB 3DVIA 1MWAB 1LQSR 3WEXA 5D7IF 3QEUA 1BEYL 3IAPA 4NUGH 1I1FB 4UV4L 1H8OA 4HKXA 1QSED 4M4RA 5B39B 5GGQH 4D0BB 2BNQE 4Y7MA 1RZ7H 3TBTB 2AQ2A 1AGDA 1UXSA 4YEEA 3EO9H 5IB1B 1AGEA 3JV4A 1EHAA 5CUSH 2A0LD 5GRJL 1U8QB 4ODHL 4Y8AA 3PWUB 2X4SB 3BIKB 1Z0NA 1Z9SA 1ZLUH 3D25B 3T65A 1JK8B 1N3NB 5EBWB 4WI3A 2VLKE 2YKLH 3TNNB 1EHLH 2XOTA 1MFNA 1U3JA 2R0LL 2R2HB 4I9WE 5I6XC 4OV5A 5CFHA 2DJ4A 5IBTH 4XP4H 4KHXL 25C8L 5D5MA 3JSSA 3ZL4L 3U0WH 2D31B 1TXKA 3FQNA 2GJ6B 1UGNA 3M07A 5HHOE 4RAUB 4MVBC 2OX5A 3VXUE 4HLJA 1J9CT 3RNKB 3WS3A 4ZXBB 1DEEB 3N1MC 4G8EA 2GUOB 3RWGA 1QR1B 8CGTA 3UBXB 4D94A 2CKBB 1UEMA 3E6HB 3T08A 3RGVC 4AMKL 2EC8A 4QRTA 2B5IC 5C0CE 1T7VA 2ZPKL 3UAJC 4MNGB 4YHKL 1ZLWH 1YMME 3M8OL 4QXTA 2HLFC 4M00A 4Z6AT 4D9QE 5T3ZH 3IDGA 3LQZB 4ZD3H 4LVNB 3KPNA 2NY1B 3AS3A 1QKZL 1F3DJ 5IHZB 4I77H 5DFWH 3ZT6A 5BRZB 3KGRA 3MOBH 5ADOL 1NGZA 4PJEE 2X1XR 1FGNH 4APQB 2QKIB 3O8XA 3N1PC 3NCYP 1HSAA 1PQZA 1I4FB 1RZGA 2PETA 3P30L 1UM4L 2CRMA 4Q6IC 3BN3B 4P9HL 4Z0XB 3C8HA 1BQLH 2D3VA 3TZVB 4ZTOL 4NKMA 4X9FA 1OAUH 3OXRA 2H2SC 4P57A 4WI4A 4KROC 3IT8D 3LKSA 4OF6A 1CBVH 4X6FB 4BQBA 1S7TA 1AJ7H 3O11A 4NT6B 3C5ZC 2QHRH 1JWUB 1B88A 1EEYB 1FIEA 4F58H 4BSWB 4ZTPH 5T1LA 3P0GB 3WE6B 5E95B 3PV6A 1TETL 1XGRA 1I8MA 5A3IC 4QY8A 3DV6B 3HC4H 3LV3A 2FECI 5I71C 5IIEB 2YD6A 4YK4B 1R3LA 4CVZB 5HHPA 4WVRA 2BNRB 3V6ZB 1BVZA 1GOHA 5IW6B 1H9VA 3CPLB 1F4YL 3JTSB 1KEMH 3GEWB 3BEWA 8FABA 3LSOB 5I1LA 4PJAB 5DURB 4L3EE 3MMEA 2RFXA 3MGOA 3UTPD 1ZVYA 3VFOA 4I18A 5CD5C 4OD2B 5DS8A 5HHME 3MLWL 1Q0YH 4K8RL 1MAJA 4WFHD 3TT1L 2VZTA 4MS8D 1TVBB 1FE8L 1IGCL 1IRAY 1I7ZA 3H3PH 4JFYA 4LHUD 1YQVH 4JG1H 3F6LA 4PJIE 2PN5A 3ESVF 3S35H 1JN6A 3DO7B 4D9LL 3O3EA 4P2OD 1IAMA 4N9GA 3X12A 3KJ4C 2A38A 2BXZA 2CDEB 4PJ7A 3GNML 3QIWC 1OWWA 2V17L 3I3BA 5H37H 3SDYH 3QUMH 4GLRH 3VMNA 4IIQC 1QSEA 4WNQB 1UEYA 3MJ9L 5IB3B 1X5JA 4HJJH 2WIMA 4HFWB 2XIDA 4BUGA 1GXEA 1EUTA 3ZDXF 5JIHA 1C1EH 4RFEB 2EKSA 4W4NA 5SWSE 1HH6B 1CF8L 4GSDL 3LD8B 1QBMH 4KV5F 5ANME 3V0AC 5J4MA 1LE5A 4PRBA 5TGBB 2E3VA 2WUBH 3MJ6A 4H26A 1OGAB 3O3BA 1JPFA 1O0VA 2IALA 4PJGA 5SWQA 3UTQA 4ERSL 3IYLW 1KCUH 1JJUA 4JREC 5IMKB 3T0BA 1VEOA 1UWXK 4GJTB 3NN8A 1P7QA 1T1ZA 2IBZY 5F6HJ 2GJ6D 5I73B 1MLBB 3GKWH 3VXRE 2FD6L 3F7QA 4ODTL 4JFHE 1MH5A 4XPBH 3P11L 4CADA 1M6OB 2YD8A 2UY7A 5LBSH 5ICZA 5C0BD 1CDJA 4PP2B 2V2TB 4HHAA 3AXLB 1FH5L 3K0WA 3REVA 4I2XA 2YA0A 1T2QH 5CZKA 4P5KA 1K3ZA 3E1F1 2V2WB 3GHBL 1PSKH 1XMWA 4X5LA 4BZ2L 3TBVB 1GGCH 5JPMA 1NGYB 1IEBA 4GW4B 5HHNB 2CJUL 1KXQE 2WANA 4JPVH 2NY1D 3CZFB 5LGHL 4M4PA 3LKOA 4N0UE 2LFGA 4MJ2A 3KWWA 3DLQR 4DKFL 2AV7B 5IWLA 3MA9L 5F7FA 4NRZA 2X9YA 3VRJA 2JKXA 3WNLA 1TQBC 1J0KA 3MGTA 2D2OA 4MVBD 5HHVH 1VESA 4JCMA 2FX9L 5L6YL 1HIML 1RMFL 3I85A 5DJYA 3G5XA 1JTPA 2OR9L 3H3KA 3BUYA 4CMHB 2V7HA 4CU7A 5JHDA 4OIIL 5D1ZC 3DUSB 5L2KE 1I1CA 4KHTH 1IC4L 3EJJX 4QCIA 3TZVD 1ZT7B 1VADA 4NQED 4XTRD 3SOBL 5HYQB 2OYPA 5JNYA 4AYFA 4IOFC 5C9JA 3SE9H 4PJCF 4OUUA 5KSBF 4XCEB 2VNCA 4UT6H 4PTTA 5H37G 3QDGD 4DWHA 1WFTA 4QRSB 3UZEA 2R23B 4LEXH 4JDZB 1VACB 1ADQA 4FQJL 3GSWA 4Y1AB 1KB9J 3MV8D 2DLFH 4IEFB 3L3GB 4U1HA 1WBYA 1S9WB 5DXWA 4U7KA 3D3VB 5DHVB 2OMNA 1V7MH 4MD4B 4UILH 1UYWH 1GZPA 1WAAA 5CD3B 2BCKA 4JY4A 2DI7A 3BKML 4MA1C 1KTRL 3CVHB 2XN9B 3RL2B 1KTDB 1UWEL 1P84J 2D7QA 2FIKB 2WINB 5J3HD 4CJ1A 4PPTA 4ZUWB 2Y9RT 2OTWA 5DURD 4AT6A 4YR6B 4IHOA 4N5EC 1RZIB 4BJLA 3DRTA 3GO1H 5FUOH 5C8JB 4CNIB 3QHZH 5FUZL 1FZMB 4G80A 4ONFH 5F1KC 5DMKA 4LHUA 2X41A 4KZEH 1CU4H 1RJYA 3ISWA 4J7RA 3U46B 1Z2KA 4JZJC 2PXYC 3B5HA 2AABL 3V5HB 5MEPA 1MF2L 4Q9QH 4WDIA 1C5DA 5DK3A 1NC4D 1MWAA 1ZK9A 3WDHA 2VN7A 1PVHA 4M1GL 2GY5A 4GKNB 4DGIH 4YNYB 3W0WB 5ECJE 5CBAB 3KPSB 2ITCB 3MBEC 1EMTH 1Q94A 4P46B 4D0BA 1KB9K 3VGBA 3TBTA 12E8L 4LCUB 4TOYH 1PY9A 3QAZB 2FBJH 4MAUL 4X4ZA 5H94B 1WV7T 3MJ8B 3TBWB 5IB1A 4KUCF 5JO5B 3ARTA 5AWNH 4LRIA 2BY1A 5GGVL 2O5ZH 1MCPL 4GBXB 3PWUA 3BIKA 2DIBA 3D25A 2HH0H 5HYJE 3IFLL