1PGYA

Solution structure of the uba domain in saccharomyces cerevisiae protein, swa2p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
ALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ubiquitin-binding domain in Swa2p from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Swa2p
total genus 13
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09145 Ubiq-assoc Ubiquitin-associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1pgyA00
3LCUA 1HQYE 2DENA 1YLAA 2DAEA 2WZJA 3FE3A 1DO0A 2KHHA 3E46A 1NV9A 2DNAA 1TTEA 2OO9A 1VEKA 4F1IA 2K9DA 4UN2B 2LVOC 2LVNC 2DAKA 3H4JA 1G4AE 1OQYA 1XB2B 2QSFX 2QHOB 2CP8A 2EJSA 3GLFE 1OAIA 2DI0A 2JNHA 2QNJA 4G3OA 2JZ0A 1VEJA 1VEGA 2L4FA 1G3IA 4F2LA 1HJPA 1BVSA 2LTUA 3GLIE 1OKSA 1Q02A 2LVPC 1AIPC 1ZMWA 2O25A 1SG9A 5DFLA 2ZTDA 2HWJA 5JI2E 1C7YA 2OOBA 1E94E 1WGNA 1V92A 2BWEA 3IHPA 3FRIA 1MN3A 1HT1E 2MGWA 1OTRA 1ZV1A 2JZ1A 1IM2A 3GLHE 2LVQD 2JY6B 1T43A 1CUKA 2KNVA 3B89A 2EKKA 3MMPA 1Y8GA 2MJ5B 4Q7JA 1ZMUA 2JY7A 2K0BX 3E21A 1GO5A 1DV0A 2KNZA 1WR1B 2MROB 1DO2A 2HAKA 3F92A 2ZTCA 3K9OA 1QZEA 1PGYA 1KYIA 2EKFA 1T6OA 2DKLA 1G41A 1VDLA 3T6PA 4WP2A 3FRHA 1F4IA 2LVAA 2DAMA 2LBCA 3IECA 4R71A 3GLGE 1WGLA 1WJ7A 1HT2E 1TR8A 1UFZA 2DAIA 2KNAA 2R0IA 1EFUB 2RRUA 2JY5A 2OOAA 2G3QA 1IFYA 1IXSA 2JUJA 2DHYA 2JY8A 1VQ1A 2BWBA 2DZLA 2JP7A 2MR9A 2B3TA 2L2DA 3K9PA 2CWBA 1ZMVA 1R4GA 1WIVA 2DAGA 1VG5A 1JR3E 4HEOA 1A5TA 1NV8A 3BBZA 2H5XA 4DBGB 1XXHE 1P3QQ 4GEWA 3LCVB 1WHCA 2L4EA
chains in the Genus database with same CATH superfamily
2R65A 1HQYE 1JB0F 2DENA 3AV0A 4IJEA 1TF0B 2KZSA 5DYGA 3VLFB 3NBIA 1DO0A 4B3SM 2L09A 3FKEA 1R2YA 1DGHA 3E46A 2EO2A 3UJNA 2DNAA 5EXXA 3I01M 2OO9A 5FTNA 1QANA 1TH2A 3T38A 4F1IA 5BR8M 1AUAA 5ITXE 2Z3XA 2J7NA 4K0KM 2LVOC 2KRKA 3K8ZA 2BJWA 3TWKA 2I7PA 8CATA 2VQEM 3VK7A 1K3XA 1XB2B 3KXEC 4Z6YA 4DV1M 3QYBA 2QSFX 2FFJA 4LF7M 2EJSA 3GLFE 2DI0A 2JNHA 2QNJA 1SXJB 2E5LM 2JZ0A 1FNNA 1E32A 1V34A 2KZUA 1IXSB 3GQ3A 4LJ9A 1HJPA 3UZUA 2K47A 3HHWA 2ZBKB 3U60B 3HJSA 4I4LA 2DZNB 1Q02A 1K3WA 4GC5A 4I8OA 2HWJA 3E4RA 1C7YA 4JI2M 3GRRA 4IJFA 4KO8A 1KFVA 2DWNA 2O01F 1XWIA 4AI6A 1HT1E 3FUWA 3SYKA 4GITA 5KPRA 4LRTA 1PJJA 2JWSA 5GKNA 2V1UA 2ZANA 5KO3A 1K82A 4LF8M 1E9SA 2R4JA 3C58A 1SXJA 3U6OA 2F5PA 3FTFA 1EIJA 4JI8M 3JR4A 5EP1A 2JY6B 4TUWA 4X65M 4L8RC 2AHMA 4BBAA 4XK8F 3W67A 4YY3M 2LWXA 3GLGA 2EKKA 3MMPA 1Y8GA 4LJ8A 1NJFA 2R46A 1GO5A 1Z59A 1DV0A 2QENA 4XGIA 1IBMM 4LG2A 4MH0E 1DO2A 3JAMS 2X49A 3EIHA 3K9OA 4LFAM 2XLJA 4AQYM 2CV2A 2F5NA 1KYIA 3TPZA 1G59A 4D81A 3FTCA 1G41A 4IBKA 4GH9A 2V1CA 4WP2A 3U6MA 2XFTA 4QHTA 3WHLA 3U60A 2APLA 5DNYA 1QAMA 2LVAA 2Z8YM 3GRUA 3ZC7B 2G5GX 5FTJA 1NJGA 4PDIA 5H37D 3RGPA 1FJGM 5KPTA 3PNVA 3RFWA 5IWAM 1GJTA 3KVWA 3FUXA 4FWHA 4I5SA 4XBOA 4QNMA 3RGSA 3GLGB 2C5RA 4NRWA 3A98B 4DV6M 2QQ8A 4MGKE 4B7HA 2D7HA 3FUVA 1JQJC 3IG8A 3LQQA 4WW0A 1SXJE 4M9XA 4NL4H 2DAIA 1N75A 2UU9M 1JR3A 3HJ8A 1TGUA 3U6SA 3Q8XA 2JY5A 1L2BA 2G3QA 3L27A 4WURA 7CATA 2ERCA 1VDDA 5EP3A 3LMMA 3KFUG 2JUJA 4IBDA 5IREB 1ZAEA 3VDUA 4B7GA 3K9PA 2DZLA 2CFOA 2JP7A 2Y0TA 4RF0A 2N35A 2CWBA 2VQFM 4B7FA 2QCUA 4ANRA 3GQ5A 1VG5A 1OFHA 1JR3E 1ZQ9A 3FYCA 2HKJA 4IBCA 4DBGB 4JI5M 4LFBM 3M6AA 2CV1A 3SC3A 4GEWA 1LV7A 3DOAA 2M5ZA 3L28A 4JXJA 1WHCA 3SAWA 3LCUA 3J7AS 1YLAA 1GL7A 2DAEA 2WZJA 4DR4M 4IBJA 4RKUF 2DVWB 3C3EA 1HNWM 1NV9A 3HHZA 2Y21A 2A5YB 4ZPXA 5ITXA 3HU1A 1PM5A 4GRIA 3AOGA 2R18A 3I4YA 4M0WA 3PXGA 2DAKA 2C99A 1IN4A 3J81S 2F5OA 1GJSA 1G4AE 1OQYA 1QQWA 4LY6A 1IY2A 2O5RA 3OTOM 4OVZB 1L1TA 4X66M 3TL4X 1L1ZA 4G3OA 3GPXA 3U6CA 1VEJA 2L4FA 1G3IA 3C3DA 3HY5A 3SBJA 2DWMA 3KS8A 4AKIA 4GMQA 2KA6B 1OKSA 1N32M 1D0KA 3MK6A 2LVPC 1SG9A 2ZTDA 2OQ4A 2R45A 4JI0M 4DR5M 4JI4M 1N34M 2OOBA 3UMMA 3FYDA 1IN6A 1NO1A 4LF6M 1IY0A 3IHPA 1Z6TA 1GLNA 5FLXS 4OU7A 5ITUA 2CRUA 2YQZA 4MM3B 1R2ZA 4AKHA 2FOIC 2CUZA 1OTRA 1QUSA 3GLIA 2FE8A 2LHCA 4R3DA 1D0MA 1IM2A 2GQFA 3A46A 1PJSA 3CF2A 1IY1A 3HWSA 3HHYA 4OW0A 1HR0M 1QYRA 3CTWB 4QNRA 1L2DA 4LJ4A 3VFDA 2YR0A 3D8LA 5KQDA 4MGYE 3U6EA 1WR1B 2MROB 2KRUA 2YNMD 3F92A 4AW4A 2ZTCA 2KXEA 2F4VM 1QZEA 4M9SA 1PGYA 4KT0F 2XZFA 2DKLA 4KLNA 3KP0E 1E9RA 2J7OA 3T6PA 3TWLA 1R5LA 4Z8XA 5F3WA 4B3TM 1N36M 3E9SA 4DV4M 1GVNA 2Z4RA 3SAVA 1NVMA 3J80S 3SFZA 4CISA 5FTLA 3FTEA 3K2LA 1MJGM 3B9PA 3U61B 3PNYA 4M0DA 1XMQM 3GPUA 3L26A 1WGLA 2FH0A 4LFCM 1XNRM 3L29A 1SXJC 4BB9A 3M0EA 1L8QA 2UUBM 1J7KA 4GKJM 1HNXM 3VKHA 3KS4A 3Q8GA 4LF9M 2UXBM 1WXQA 3GPYA 4OX9M 1R6BX 1EFUB 3V76A 3SARA 1R7RA 3HX3A 1QDTA 4I81A 4FWGA 1OIPA 1IQPA 1OAOC 4W5WA 1D2NA 4DR1M 3BOSA 3A45A 3U5ZB 2JY8A 3K1JA 5EXPA 2B3TA 2I7NA 2LH0A 3PVSA 1WIVA 1GKIA 3D8BA 3QAUA 3GLIB 2EUCA 4HEOA 1NV8A 5E26A 2H5XA 4DV5M 3I4VA 4GC9A 1G8PA 3CF6E 3SHGB 1P3QQ 1QDRA 1IBLM 4II7A 3UK6A 1IBKM 2L4EA 4LF4M 3FUUA 3FE3A 4B08A 3GQ4A 3T1HM 5EP4A 4D80A 2OPFA 2J5YA 5LMNM 2KW0A 3U61A 4GHLA 1UM8A 4L6V6 3MHVC 2X4AA 1IN5A 4LGMA 1MU5A 5C1BA 2C98A 3R8FA 4PT5A 5ITYA 2LVNC 3DA1A 3DFZA 3QWLA 1SXJD 1NHGC 1QVRA 1QAQA 3TQSA 4CJ6A 2QHOB 5IT9S 4IBBA 1XNQM 2CHGA 3R9XB 1LTMA 1OAIA 1I94M 1QZMA 3KW6A 3AL0C 4JI7M 2CHVA 4F2LA 3U6LA 5KQ8A 1NNJA 1BVSA 1XXHA 3GLIE 4X62M 1I4WA 4IBEA 1AIPC 1ZMWA 3B7NA 5L8RF 3J2PB 5JI2E 3KOWE 4MGZE 2DHRA 3CGWA 5E6JA 2ZM6M 4ITQA 1WGNA 3UGJA 1Z5AA 3SHFA 4JV5M 1N77A 2BWEA 2L7HA 2X8AA 4KHPM 4M9ZA 2UXCM 2H1RA 3ZQJA 4L16A 2MGWA 1ZV1A 3RE8A 1Q3CA 1PJQA 1RU3A 5LMUM 3ZH9B 1ORYB 4GHAA 1NSFA 3JR5A 1T43A 5EP2A 3U6QA 1CUKA 4HL4A 4S12A 4Y28F 3B89A 3HJQA 2P5TA 4EIWA 2MJ5B 4P17A 2QZ4A 4Q7JA 2JY7A 1KSFX 2KNZA 2Y20A 2GNOA 4MGIE 5EXTA 3TWMA 2XGNA 2QBYB 2F5QA 5FTMA 2HAKA 5DYIA 5BPVA 3QYEA 1T6OA 1TDHA 4DR7M 1G71A 2NQ8C 3W0FA 5ITQA 5ITTA 1VDLA 4HLQA 2XEPA 2ZAOA 4CIZA 4LRSA 3FRHA 1OJLA 2R44A 4IIWA 4L4UA 1YUBA 3LVWA 2HL7A 3U6PA 1W5TA 3GRYA 3IECA 2KDLA 5EQTA 4R71A 4DV3M 2L6OA 2C9OA 2UUCM 4KODA 1WJ7A 1HT2E 2DXIA 4FCVA 1UFZA 4IBGA 3I04M 1N33M 3SYLA 1L2CA 1MX0A 5FSWA 2QBYA 1Z5BA 3KOXE 2VF7A 1DGGA 4RF1A 2R0IA 3VKGA 2D7GA 2DZOB 3HKPA 2RRUA 3LW5F 3T15A 3U6DA 4AKGA 4NSOB 1YSYA 2RKOA 1IN8A 2YFQA 1OIZA 2Y0QA 3KDSE 3GLFB 2G8LA 1Z5CA 4LZJA 3M7GA 2VF8A 3ZCBB 1TDZA 2RGHA 4R7GA 2MR9A 4IBIA 2L2DA 2LXEA 1YE9A 3AOEC 1ZMVA 3PFIA 1R4GA 4G4OA 3FD9A 3SMPA 1A5TA 3BBZA 2R6FA 3HU3A 4G6ZA 1QUTA 2C9CA 2BNKA 3NWLA 1XXHE 3HGIA 4D82A 4DV7M 3SATA 4LF5M 4DUYM 1N78A 3VK8A 5IZ7D 4JI1M 3LCVB 1XHBA 3B74A 4LJAA 3LVVA 4FD2A 2Q2EB 3WHKA 4JYAM 4X64M 2KHHA 1IN7A 4NC6A 3NBXX 2QPAA 4FW9A 3W0LB 2FS1A 3EIEA 2UUAM 4DR6M 3LQRA 2HHHM 3I51A 1TTEA 3GO8A 3HZJA 3SMSA 1OFIA 1VEKA 2CEAA 2JXNA 3GLFA 2K9DA 4G4RA 4LCBA 2L7IA 4UN2B 2CV0A 4JN6A 2MH8A 1PRBA 3H4JA 3THGA 4DV2M 2JA2A 4LGYA 3KSXA 5EJCA 5KPZA 4DR3M 1IXRC 1HNZM 3H4MA 2CP8A 2CHQA 3B7QA 4LJ5A 4PD2A 2K6BA 3ILKA 1VEGA 4AG5A 4QOSA 4FVMA 4P16A 2VDBB 1NNUC 3B7ZA 4REZA 3GP1A 2LTUA 4IBFA 1NY6A 4NOOB 2DWLA 5ITRA 3IG5A 3SAUA 1XMOM 4NRVA 3HHXA 4L78A 3DZDA 1D0LA 1TH3A 5DFLA 1S3SA 2O25A 1EE8A 4FCTA 4DR2M 2UXDM 3KOZE 4DUZM 2R4EA 1Q39A 1IXZA 2XZUA 1E94E 2FNAA 4LZZA 2XF3A 4JI3M 4RNAA 1V92A 2KEBA 2XH9A 1QAOA 2V6ZM 3FRIA 1MN3A 2Z4SA 1X37A 1XXHB 3T1YM 2W82A 2JZ1A 1HQCA 2D7EA 1J5EM 2C96A 3GLHE 3TE6A 4DV0M 3KSJA 4CHTB 3KP1E 2LVQD 3C9PA 4GIPA 4MGHA 5C18A 1DGBA 5A2QS 2KNVA 2WSEF 1H6UA 3FUTA 3U5ZA 1ZMUA 1JR3D 4G4NA 1TH4A 2K0BX 2Z7JA 3E21A 2HCBA 1PJTA 1V33A 3KOYE 4BLCA 3FTDA 3BXWA 2EA0A 3GPPA 2VIIA 5FTKA 2EKFA 2WSFF 2CE7A 1T3TA 3GLHB 4FCWA 2WSCF 3K92A 3VDPA 3MJ5A 4G4QA 1NHWC 1F4IA 1GL6A 1C1KA 2DAMA 2LBCA 4B3RM 1W5SA 3CF0A 3J7BA 4GKKM 2XSZA 4QOZC 4FWDA 1DGFA 2LHGA 4LJ7A 4OVZA 4NXNM 3GLGE 2BJVA 3AFHA 1J09A 3SASA 3L25A 3A42A 4CGYB 2XSZD 5EXSA 1TR8A 4AZFA 1PJIA 3W68A 4B3MM 1XC8A 4L15A 2KNAA 2M60A 2DWZB 3GRVA 4MB7A 1DGHB 2OOAA 1GABA 1IFYA 3GLHA 3L2AA 4QHSA 1IXSA 2F5SA 2DHYA 4JI6M 3HU2A 1VQ1A 2BWBA 1NY5A 2QP9X 4AG6A 4NXMM 4YHHM 2RGOA 2ZAMA 2DAGA 4PDGA 4NSRA 3J27B 4LJ6A 2LNHC 4A3VB 2R62A 3AJIB 2XFSA 4PCZA 5JI3E 3AKZA 3AOEA 1Q3BA
chains in the Genus database with same CATH topology
3LCUA 1HQYE 2DENA 1YLAA 2DAEA 2WZJA 3FE3A 1DO0A 2KHHA 3E46A 1NV9A 2DNAA 1TTEA 2OO9A 1VEKA 4F1IA 2K9DA 4UN2B 2LVOC 2LVNC 2DAKA 3H4JA 1G4AE 1OQYA 1XB2B 2QSFX 2QHOB 2CP8A 2EJSA 3GLFE 1OAIA 2DI0A 2JNHA 2QNJA 4G3OA 2JZ0A 1VEJA 1VEGA 2L4FA 1G3IA 4F2LA 1HJPA 1BVSA 2LTUA 3GLIE 1OKSA 1Q02A 2LVPC 1AIPC 1ZMWA 2O25A 1SG9A 5DFLA 2ZTDA 2HWJA 5JI2E 1C7YA 2OOBA 1E94E 1WGNA 1V92A 2BWEA 3IHPA 3FRIA 1MN3A 1HT1E 2MGWA 1OTRA 1ZV1A 2JZ1A 1IM2A 3GLHE 2LVQD 2JY6B 1T43A 1CUKA 2KNVA 3B89A 2EKKA 3MMPA 1Y8GA 2MJ5B 4Q7JA 1ZMUA 2JY7A 2K0BX 3E21A 1GO5A 1DV0A 2KNZA 1WR1B 2MROB 1DO2A 2HAKA 3F92A 2ZTCA 3K9OA 1QZEA 1PGYA 1KYIA 2EKFA 1T6OA 2DKLA 1G41A 1VDLA 3T6PA 4WP2A 3FRHA 1F4IA 2LVAA 2DAMA 2LBCA 3IECA 4R71A 3GLGE 1WGLA 1WJ7A 1HT2E 1TR8A 1UFZA 2DAIA 2KNAA 2R0IA 1EFUB 2RRUA 2JY5A 2OOAA 2G3QA 1IFYA 1IXSA 2JUJA 2DHYA 2JY8A 1VQ1A 2BWBA 2DZLA 2JP7A 2MR9A 2B3TA 2L2DA 3K9PA 2CWBA 1ZMVA 1R4GA 1WIVA 2DAGA 1VG5A 1JR3E 4HEOA 1A5TA 1NV8A 3BBZA 2H5XA 4DBGB 1XXHE 1P3QQ 4GEWA 3LCVB 1WHCA 2L4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCU A;  1HQY E;  2DEN A;  1YLA A;  2DAE A;  2WZJ A;  3FE3 A;  1DO0 A;  2KHH A;  3E46 A;  1NV9 A;  2DNA A;  1TTE A;  2OO9 A;  1VEK A;  4F1I A;  2K9D A;  4UN2 B;  2LVO C;  2LVN C;  2DAK A;  3H4J A;  1G4A E;  1OQY A;  1XB2 B;  2QSF X;  2QHO B;  2CP8 A;  2EJS A;  3GLF E;  1OAI A;  2DI0 A;  2JNH A;  2QNJ A;  4G3O A;  2JZ0 A;  1VEJ A;  1VEG A;  2L4F A;  1G3I A;  4F2L A;  1HJP A;  1BVS A;  2LTU A;  3GLI E;  1OKS A;  1Q02 A;  2LVP C;  1AIP C;  1ZMW A;  2O25 A;  1SG9 A;  5DFL A;  2ZTD A;  2HWJ A;  5JI2 E;  1C7Y A;  2OOB A;  1E94 E;  1WGN A;  1V92 A;  2BWE A;  3IHP A;  3FRI A;  1MN3 A;  1HT1 E;  2MGW A;  1OTR A;  1ZV1 A;  2JZ1 A;  1IM2 A;  3GLH E;  2LVQ D;  2JY6 B;  1T43 A;  1CUK A;  2KNV A;  3B89 A;  2EKK A;  3MMP A;  1Y8G A;  2MJ5 B;  4Q7J A;  1ZMU A;  2JY7 A;  2K0B X;  3E21 A;  1GO5 A;  1DV0 A;  2KNZ A;  1WR1 B;  2MRO B;  1DO2 A;  2HAK A;  3F92 A;  2ZTC A;  3K9O A;  1QZE A;  1PGY A;  1KYI A;  2EKF A;  1T6O A;  2DKL A;  1G41 A;  1VDL A;  3T6P A;  4WP2 A;  3FRH A;  1F4I A;  2LVA A;  2DAM A;  2LBC A;  3IEC A;  4R71 A;  3GLG E;  1WGL A;  1WJ7 A;  1HT2 E;  1TR8 A;  1UFZ A;  2DAI A;  2KNA A;  2R0I A;  1EFU B;  2RRU A;  2JY5 A;  2OOA A;  2G3Q A;  1IFY A;  1IXS A;  2JUJ A;  2DHY A;  2JY8 A;  1VQ1 A;  2BWB A;  2DZL A;  2JP7 A;  2MR9 A;  2B3T A;  2L2D A;  3K9P A;  2CWB A;  1ZMV A;  1R4G A;  1WIV A;  2DAG A;  1VG5 A;  1JR3 E;  4HEO A;  1A5T A;  1NV8 A;  3BBZ A;  2H5X A;  4DBG B;  1XXH E;  1P3Q Q;  4GEW A;  3LCV B;  1WHC A;  2L4E A; 
#chains in the Genus database with same CATH topology
 2R65 A;  1HQY E;  1JB0 F;  2DEN A;  3AV0 A;  4IJE A;  1TF0 B;  2KZS A;  5DYG A;  3VLF B;  3NBI A;  1DO0 A;  4B3S M;  2L09 A;  3FKE A;  1R2Y A;  1DGH A;  3E46 A;  2EO2 A;  3UJN A;  2DNA A;  5EXX A;  3I01 M;  2OO9 A;  5FTN A;  1QAN A;  1TH2 A;  3T38 A;  4F1I A;  5BR8 M;  1AUA A;  5ITX E;  2Z3X A;  2J7N A;  4K0K M;  2LVO C;  2KRK A;  3K8Z A;  2BJW A;  3TWK A;  2I7P A;  8CAT A;  2VQE M;  3VK7 A;  1K3X A;  1XB2 B;  3KXE C;  4Z6Y A;  4DV1 M;  3QYB A;  2QSF X;  2FFJ A;  4LF7 M;  2EJS A;  3GLF E;  2DI0 A;  2JNH A;  2QNJ A;  1SXJ B;  2E5L M;  2JZ0 A;  1FNN A;  1E32 A;  1V34 A;  2KZU A;  1IXS B;  3GQ3 A;  4LJ9 A;  1HJP A;  3UZU A;  2K47 A;  3HHW A;  2ZBK B;  3U60 B;  3HJS A;  4I4L A;  2DZN B;  1Q02 A;  1K3W A;  4GC5 A;  4I8O A;  2HWJ A;  3E4R A;  1C7Y A;  4JI2 M;  3GRR A;  4IJF A;  4KO8 A;  1KFV A;  2DWN A;  2O01 F;  1XWI A;  4AI6 A;  1HT1 E;  3FUW A;  3SYK A;  4GIT A;  5KPR A;  4LRT A;  1PJJ A;  2JWS A;  5GKN A;  2V1U A;  2ZAN A;  5KO3 A;  1K82 A;  4LF8 M;  1E9S A;  2R4J A;  3C58 A;  1SXJ A;  3U6O A;  2F5P A;  3FTF A;  1EIJ A;  4JI8 M;  3JR4 A;  5EP1 A;  2JY6 B;  4TUW A;  4X65 M;  4L8R C;  2AHM A;  4BBA A;  4XK8 F;  3W67 A;  4YY3 M;  2LWX A;  3GLG A;  2EKK A;  3MMP A;  1Y8G A;  4LJ8 A;  1NJF A;  2R46 A;  1GO5 A;  1Z59 A;  1DV0 A;  2QEN A;  4XGI A;  1IBM M;  4LG2 A;  4MH0 E;  1DO2 A;  3JAM S;  2X49 A;  3EIH A;  3K9O A;  4LFA M;  2XLJ A;  4AQY M;  2CV2 A;  2F5N A;  1KYI A;  3TPZ A;  1G59 A;  4D81 A;  3FTC A;  1G41 A;  4IBK A;  4GH9 A;  2V1C A;  4WP2 A;  3U6M A;  2XFT A;  4QHT A;  3WHL A;  3U60 A;  2APL A;  5DNY A;  1QAM A;  2LVA A;  2Z8Y M;  3GRU A;  3ZC7 B;  2G5G X;  5FTJ A;  1NJG A;  4PDI A;  5H37 D;  3RGP A;  1FJG M;  5KPT A;  3PNV A;  3RFW A;  5IWA M;  1GJT A;  3KVW A;  3FUX A;  4FWH A;  4I5S A;  4XBO A;  4QNM A;  3RGS A;  3GLG B;  2C5R A;  4NRW A;  3A98 B;  4DV6 M;  2QQ8 A;  4MGK E;  4B7H A;  2D7H A;  3FUV A;  1JQJ C;  3IG8 A;  3LQQ A;  4WW0 A;  1SXJ E;  4M9X A;  4NL4 H;  2DAI A;  1N75 A;  2UU9 M;  1JR3 A;  3HJ8 A;  1TGU A;  3U6S A;  3Q8X A;  2JY5 A;  1L2B A;  2G3Q A;  3L27 A;  4WUR A;  7CAT A;  2ERC A;  1VDD A;  5EP3 A;  3LMM A;  3KFU G;  2JUJ A;  4IBD A;  5IRE B;  1ZAE A;  3VDU A;  4B7G A;  3K9P A;  2DZL A;  2CFO A;  2JP7 A;  2Y0T A;  4RF0 A;  2N35 A;  2CWB A;  2VQF M;  4B7F A;  2QCU A;  4ANR A;  3GQ5 A;  1VG5 A;  1OFH A;  1JR3 E;  1ZQ9 A;  3FYC A;  2HKJ A;  4IBC A;  4DBG B;  4JI5 M;  4LFB M;  3M6A A;  2CV1 A;  3SC3 A;  4GEW A;  1LV7 A;  3DOA A;  2M5Z A;  3L28 A;  4JXJ A;  1WHC A;  3SAW A;  3LCU A;  3J7A S;  1YLA A;  1GL7 A;  2DAE A;  2WZJ A;  4DR4 M;  4IBJ A;  4RKU F;  2DVW B;  3C3E A;  1HNW M;  1NV9 A;  3HHZ A;  2Y21 A;  2A5Y B;  4ZPX A;  5ITX A;  3HU1 A;  1PM5 A;  4GRI A;  3AOG A;  2R18 A;  3I4Y A;  4M0W A;  3PXG A;  2DAK A;  2C99 A;  1IN4 A;  3J81 S;  2F5O A;  1GJS A;  1G4A E;  1OQY A;  1QQW A;  4LY6 A;  1IY2 A;  2O5R A;  3OTO M;  4OVZ B;  1L1T A;  4X66 M;  3TL4 X;  1L1Z A;  4G3O A;  3GPX A;  3U6C A;  1VEJ A;  2L4F A;  1G3I A;  3C3D A;  3HY5 A;  3SBJ A;  2DWM A;  3KS8 A;  4AKI A;  4GMQ A;  2KA6 B;  1OKS A;  1N32 M;  1D0K A;  3MK6 A;  2LVP C;  1SG9 A;  2ZTD A;  2OQ4 A;  2R45 A;  4JI0 M;  4DR5 M;  4JI4 M;  1N34 M;  2OOB A;  3UMM A;  3FYD A;  1IN6 A;  1NO1 A;  4LF6 M;  1IY0 A;  3IHP A;  1Z6T A;  1GLN A;  5FLX S;  4OU7 A;  5ITU A;  2CRU A;  2YQZ A;  4MM3 B;  1R2Z A;  4AKH A;  2FOI C;  2CUZ A;  1OTR A;  1QUS A;  3GLI A;  2FE8 A;  2LHC A;  4R3D A;  1D0M A;  1IM2 A;  2GQF A;  3A46 A;  1PJS A;  3CF2 A;  1IY1 A;  3HWS A;  3HHY A;  4OW0 A;  1HR0 M;  1QYR A;  3CTW B;  4QNR A;  1L2D A;  4LJ4 A;  3VFD A;  2YR0 A;  3D8L A;  5KQD A;  4MGY E;  3U6E A;  1WR1 B;  2MRO B;  2KRU A;  2YNM D;  3F92 A;  4AW4 A;  2ZTC A;  2KXE A;  2F4V M;  1QZE A;  4M9S A;  1PGY A;  4KT0 F;  2XZF A;  2DKL A;  4KLN A;  3KP0 E;  1E9R A;  2J7O A;  3T6P A;  3TWL A;  1R5L A;  4Z8X A;  5F3W A;  4B3T M;  1N36 M;  3E9S A;  4DV4 M;  1GVN A;  2Z4R A;  3SAV A;  1NVM A;  3J80 S;  3SFZ A;  4CIS A;  5FTL A;  3FTE A;  3K2L A;  1MJG M;  3B9P A;  3U61 B;  3PNY A;  4M0D A;  1XMQ M;  3GPU A;  3L26 A;  1WGL A;  2FH0 A;  4LFC M;  1XNR M;  3L29 A;  1SXJ C;  4BB9 A;  3M0E A;  1L8Q A;  2UUB M;  1J7K A;  4GKJ M;  1HNX M;  3VKH A;  3KS4 A;  3Q8G A;  4LF9 M;  2UXB M;  1WXQ A;  3GPY A;  4OX9 M;  1R6B X;  1EFU B;  3V76 A;  3SAR A;  1R7R A;  3HX3 A;  1QDT A;  4I81 A;  4FWG A;  1OIP A;  1IQP A;  1OAO C;  4W5W A;  1D2N A;  4DR1 M;  3BOS A;  3A45 A;  3U5Z B;  2JY8 A;  3K1J A;  5EXP A;  2B3T A;  2I7N A;  2LH0 A;  3PVS A;  1WIV A;  1GKI A;  3D8B A;  3QAU A;  3GLI B;  2EUC A;  4HEO A;  1NV8 A;  5E26 A;  2H5X A;  4DV5 M;  3I4V A;  4GC9 A;  1G8P A;  3CF6 E;  3SHG B;  1P3Q Q;  1QDR A;  1IBL M;  4II7 A;  3UK6 A;  1IBK M;  2L4E A;  4LF4 M;  3FUU A;  3FE3 A;  4B08 A;  3GQ4 A;  3T1H M;  5EP4 A;  4D80 A;  2OPF A;  2J5Y A;  5LMN M;  2KW0 A;  3U61 A;  4GHL A;  1UM8 A;  4L6V 6;  3MHV C;  2X4A A;  1IN5 A;  4LGM A;  1MU5 A;  5C1B A;  2C98 A;  3R8F A;  4PT5 A;  5ITY A;  2LVN C;  3DA1 A;  3DFZ A;  3QWL A;  1SXJ D;  1NHG C;  1QVR A;  1QAQ A;  3TQS A;  4CJ6 A;  2QHO B;  5IT9 S;  4IBB A;  1XNQ M;  2CHG A;  3R9X B;  1LTM A;  1OAI A;  1I94 M;  1QZM A;  3KW6 A;  3AL0 C;  4JI7 M;  2CHV A;  4F2L A;  3U6L A;  5KQ8 A;  1NNJ A;  1BVS A;  1XXH A;  3GLI E;  4X62 M;  1I4W A;  4IBE A;  1AIP C;  1ZMW A;  3B7N A;  5L8R F;  3J2P B;  5JI2 E;  3KOW E;  4MGZ E;  2DHR A;  3CGW A;  5E6J A;  2ZM6 M;  4ITQ A;  1WGN A;  3UGJ A;  1Z5A A;  3SHF A;  4JV5 M;  1N77 A;  2BWE A;  2L7H A;  2X8A A;  4KHP M;  4M9Z A;  2UXC M;  2H1R A;  3ZQJ A;  4L16 A;  2MGW A;  1ZV1 A;  3RE8 A;  1Q3C A;  1PJQ A;  1RU3 A;  5LMU M;  3ZH9 B;  1ORY B;  4GHA A;  1NSF A;  3JR5 A;  1T43 A;  5EP2 A;  3U6Q A;  1CUK A;  4HL4 A;  4S12 A;  4Y28 F;  3B89 A;  3HJQ A;  2P5T A;  4EIW A;  2MJ5 B;  4P17 A;  2QZ4 A;  4Q7J A;  2JY7 A;  1KSF X;  2KNZ A;  2Y20 A;  2GNO A;  4MGI E;  5EXT A;  3TWM A;  2XGN A;  2QBY B;  2F5Q A;  5FTM A;  2HAK A;  5DYI A;  5BPV A;  3QYE A;  1T6O A;  1TDH A;  4DR7 M;  1G71 A;  2NQ8 C;  3W0F A;  5ITQ A;  5ITT A;  1VDL A;  4HLQ A;  2XEP A;  2ZAO A;  4CIZ A;  4LRS A;  3FRH A;  1OJL A;  2R44 A;  4IIW A;  4L4U A;  1YUB A;  3LVW A;  2HL7 A;  3U6P A;  1W5T A;  3GRY A;  3IEC A;  2KDL A;  5EQT A;  4R71 A;  4DV3 M;  2L6O A;  2C9O A;  2UUC M;  4KOD A;  1WJ7 A;  1HT2 E;  2DXI A;  4FCV A;  1UFZ A;  4IBG A;  3I04 M;  1N33 M;  3SYL A;  1L2C A;  1MX0 A;  5FSW A;  2QBY A;  1Z5B A;  3KOX E;  2VF7 A;  1DGG A;  4RF1 A;  2R0I A;  3VKG A;  2D7G A;  2DZO B;  3HKP A;  2RRU A;  3LW5 F;  3T15 A;  3U6D A;  4AKG A;  4NSO B;  1YSY A;  2RKO A;  1IN8 A;  2YFQ A;  1OIZ A;  2Y0Q A;  3KDS E;  3GLF B;  2G8L A;  1Z5C A;  4LZJ A;  3M7G A;  2VF8 A;  3ZCB B;  1TDZ A;  2RGH A;  4R7G A;  2MR9 A;  4IBI A;  2L2D A;  2LXE A;  1YE9 A;  3AOE C;  1ZMV A;  3PFI A;  1R4G A;  4G4O A;  3FD9 A;  3SMP A;  1A5T A;  3BBZ A;  2R6F A;  3HU3 A;  4G6Z A;  1QUT A;  2C9C A;  2BNK A;  3NWL A;  1XXH E;  3HGI A;  4D82 A;  4DV7 M;  3SAT A;  4LF5 M;  4DUY M;  1N78 A;  3VK8 A;  5IZ7 D;  4JI1 M;  3LCV B;  1XHB A;  3B74 A;  4LJA A;  3LVV A;  4FD2 A;  2Q2E B;  3WHK A;  4JYA M;  4X64 M;  2KHH A;  1IN7 A;  4NC6 A;  3NBX X;  2QPA A;  4FW9 A;  3W0L B;  2FS1 A;  3EIE A;  2UUA M;  4DR6 M;  3LQR A;  2HHH M;  3I51 A;  1TTE A;  3GO8 A;  3HZJ A;  3SMS A;  1OFI A;  1VEK A;  2CEA A;  2JXN A;  3GLF A;  2K9D A;  4G4R A;  4LCB A;  2L7I A;  4UN2 B;  2CV0 A;  4JN6 A;  2MH8 A;  1PRB A;  3H4J A;  3THG A;  4DV2 M;  2JA2 A;  4LGY A;  3KSX A;  5EJC A;  5KPZ A;  4DR3 M;  1IXR C;  1HNZ M;  3H4M A;  2CP8 A;  2CHQ A;  3B7Q A;  4LJ5 A;  4PD2 A;  2K6B A;  3ILK A;  1VEG A;  4AG5 A;  4QOS A;  4FVM A;  4P16 A;  2VDB B;  1NNU C;  3B7Z A;  4REZ A;  3GP1 A;  2LTU A;  4IBF A;  1NY6 A;  4NOO B;  2DWL A;  5ITR A;  3IG5 A;  3SAU A;  1XMO M;  4NRV A;  3HHX A;  4L78 A;  3DZD A;  1D0L A;  1TH3 A;  5DFL A;  1S3S A;  2O25 A;  1EE8 A;  4FCT A;  4DR2 M;  2UXD M;  3KOZ E;  4DUZ M;  2R4E A;  1Q39 A;  1IXZ A;  2XZU A;  1E94 E;  2FNA A;  4LZZ A;  2XF3 A;  4JI3 M;  4RNA A;  1V92 A;  2KEB A;  2XH9 A;  1QAO A;  2V6Z M;  3FRI A;  1MN3 A;  2Z4S A;  1X37 A;  1XXH B;  3T1Y M;  2W82 A;  2JZ1 A;  1HQC A;  2D7E A;  1J5E M;  2C96 A;  3GLH E;  3TE6 A;  4DV0 M;  3KSJ A;  4CHT B;  3KP1 E;  2LVQ D;  3C9P A;  4GIP A;  4MGH A;  5C18 A;  1DGB A;  5A2Q S;  2KNV A;  2WSE F;  1H6U A;  3FUT A;  3U5Z A;  1ZMU A;  1JR3 D;  4G4N A;  1TH4 A;  2K0B X;  2Z7J A;  3E21 A;  2HCB A;  1PJT A;  1V33 A;  3KOY E;  4BLC A;  3FTD A;  3BXW A;  2EA0 A;  3GPP A;  2VII A;  5FTK A;  2EKF A;  2WSF F;  2CE7 A;  1T3T A;  3GLH B;  4FCW A;  2WSC F;  3K92 A;  3VDP A;  3MJ5 A;  4G4Q A;  1NHW C;  1F4I A;  1GL6 A;  1C1K A;  2DAM A;  2LBC A;  4B3R M;  1W5S A;  3CF0 A;  3J7B A;  4GKK M;  2XSZ A;  4QOZ C;  4FWD A;  1DGF A;  2LHG A;  4LJ7 A;  4OVZ A;  4NXN M;  3GLG E;  2BJV A;  3AFH A;  1J09 A;  3SAS A;  3L25 A;  3A42 A;  4CGY B;  2XSZ D;  5EXS A;  1TR8 A;  4AZF A;  1PJI A;  3W68 A;  4B3M M;  1XC8 A;  4L15 A;  2KNA A;  2M60 A;  2DWZ B;  3GRV A;  4MB7 A;  1DGH B;  2OOA A;  1GAB A;  1IFY A;  3GLH A;  3L2A A;  4QHS A;  1IXS A;  2F5S A;  2DHY A;  4JI6 M;  3HU2 A;  1VQ1 A;  2BWB A;  1NY5 A;  2QP9 X;  4AG6 A;  4NXM M;  4YHH M;  2RGO A;  2ZAM A;  2DAG A;  4PDG A;  4NSR A;  3J27 B;  4LJ6 A;  2LNH C;  4A3V B;  2R62 A;  3AJI B;  2XFS A;  4PCZ A;  5JI3 E;  3AKZ A;  3AOE A;  1Q3B A; 
#chains in the Genus database with same CATH homology
 3LCU A;  1HQY E;  2DEN A;  1YLA A;  2DAE A;  2WZJ A;  3FE3 A;  1DO0 A;  2KHH A;  3E46 A;  1NV9 A;  2DNA A;  1TTE A;  2OO9 A;  1VEK A;  4F1I A;  2K9D A;  4UN2 B;  2LVO C;  2LVN C;  2DAK A;  3H4J A;  1G4A E;  1OQY A;  1XB2 B;  2QSF X;  2QHO B;  2CP8 A;  2EJS A;  3GLF E;  1OAI A;  2DI0 A;  2JNH A;  2QNJ A;  4G3O A;  2JZ0 A;  1VEJ A;  1VEG A;  2L4F A;  1G3I A;  4F2L A;  1HJP A;  1BVS A;  2LTU A;  3GLI E;  1OKS A;  1Q02 A;  2LVP C;  1AIP C;  1ZMW A;  2O25 A;  1SG9 A;  5DFL A;  2ZTD A;  2HWJ A;  5JI2 E;  1C7Y A;  2OOB A;  1E94 E;  1WGN A;  1V92 A;  2BWE A;  3IHP A;  3FRI A;  1MN3 A;  1HT1 E;  2MGW A;  1OTR A;  1ZV1 A;  2JZ1 A;  1IM2 A;  3GLH E;  2LVQ D;  2JY6 B;  1T43 A;  1CUK A;  2KNV A;  3B89 A;  2EKK A;  3MMP A;  1Y8G A;  2MJ5 B;  4Q7J A;  1ZMU A;  2JY7 A;  2K0B X;  3E21 A;  1GO5 A;  1DV0 A;  2KNZ A;  1WR1 B;  2MRO B;  1DO2 A;  2HAK A;  3F92 A;  2ZTC A;  3K9O A;  1QZE A;  1PGY A;  1KYI A;  2EKF A;  1T6O A;  2DKL A;  1G41 A;  1VDL A;  3T6P A;  4WP2 A;  3FRH A;  1F4I A;  2LVA A;  2DAM A;  2LBC A;  3IEC A;  4R71 A;  3GLG E;  1WGL A;  1WJ7 A;  1HT2 E;  1TR8 A;  1UFZ A;  2DAI A;  2KNA A;  2R0I A;  1EFU B;  2RRU A;  2JY5 A;  2OOA A;  2G3Q A;  1IFY A;  1IXS A;  2JUJ A;  2DHY A;  2JY8 A;  1VQ1 A;  2BWB A;  2DZL A;  2JP7 A;  2MR9 A;  2B3T A;  2L2D A;  3K9P A;  2CWB A;  1ZMV A;  1R4G A;  1WIV A;  2DAG A;  1VG5 A;  1JR3 E;  4HEO A;  1A5T A;  1NV8 A;  3BBZ A;  2H5X A;  4DBG B;  1XXH E;  1P3Q Q;  4GEW A;  3LCV B;  1WHC A;  2L4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...