1PGYA

Solution structure of the uba domain in saccharomyces cerevisiae protein, swa2p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
b'ALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Swa2p
publication title Solution structure of the ubiquitin-binding domain in Swa2p from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 13
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09145 Ubiq-assoc Ubiquitin-associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1pgyA00
1IM2A 2DAGA 2KHHA 4F1IA 2MGWA 1G3IA 1WR1B 1ZV1A 2L4FA 2QHOB 1OAIA 2JUJA 3T6PA 2DI0A 1TTEA 2R0IA 3H4JA 1IFYA 1C7YA 1CUKA 1IXSA 3K9OA 2LVOC 3K9PA 2JZ1A 4F2LA 2OO9A 1WHCA 2JY8A 3BBZA 4UN2B 1QZEA 1ZMVA 2B3TA 1VEJA 1WIVA 1BVSA 3GLIE 2JZ0A 1XXHE 1HQYE 1ZMWA 1G4AE 2L4EA 2LVNC 3E46A 2G3QA 1HT1E 1TR8A 2DKLA 2BWEA 2LBCA 1T43A 2DAKA 1VEKA 2KNZA 2DAMA 1WJ7A 3GLGE 2DENA 2EKKA 2QSFX 4DBGB 2K9DA 1G41A 2DAEA 2L2DA 2KNVA 2LTUA 2O25A 3LCVB 1OTRA 1F4IA 1HT2E 1DV0A 1PGYA 1P3QQ 1GO5A 1V92A 1OQYA 2HAKA 1UFZA 1SG9A 2ZTDA 3E21A 2EKFA 2JY7A 1A5TA 2MJ5B 3B89A 5DFLA 3LCUA 3FRIA 2RRUA 4WP2A 1VDLA 2DAIA 2DNAA 2MROB 3MMPA 5JI2E 2MR9A 2DHYA 3GLHE 2LVAA 4Q7JA 1WGLA 2QNJA 2JP7A 2ZTCA 2DZLA 2CWBA 2JY6B 2EJSA 1MN3A 3GLFE 1E94E 1AIPC 2OOAA 1NV8A 4GEWA 1Q02A 1NV9A 1R4GA 1JR3E 1Y8GA 3IHPA 2LVPC 2JY5A 2JNHA 2LVQD 3FE3A 1ZMUA 2KNAA 1XB2B 1EFUB 3F92A 1VG5A 4R71A 1DO0A 1T6OA 1HJPA 2BWBA 2CP8A 1KYIA 4G3OA 2OOBA 1VEGA 2HWJA 2WZJA 4HEOA 1OKSA 2K0BX 1DO2A 2H5XA 1VQ1A 3FRHA 3IECA 1WGNA 1YLAA
chains in the Genus database with same CATH superfamily
4FWHA 1D2NA 1QAMA 2K6BA 2KHHA 3AL0C 3AJIB 1IN6A 2D7HA 1WR1B 1ZV1A 4B7FA 3PNYA 3GO8A 2ZM6M 4G4OA 4GKKM 4RKUF 2LHCA 5EP1A 3T6PA 2VQEM 2XFSA 1Z5CA 1GKIA 4OW0A 3GPYA 3H4JA 3JR4A 2CV0A 2F4VM 3K8ZA 1CUKA 4GITA 4EIWA 3KOWE 1D0LA 1IXSA 3K9OA 3GRRA 2J5YA 4B7HA 4XGIA 4B3RM 1XC8A 2JZ1A 1NSFA 5JI3E 1J7KA 2OO9A 3B74A 3PVSA 2JY8A 3TWLA 3GLIB 2DWNA 1Q39A 1PJSA 1IN8A 5LMUM 3KS8A 3J7AS 2B3TA 1VEJA 3GQ5A 2KZSA 3AV0A 3U6DA 5F3WA 2CUZA 3W0FA 1NJGA 1NJFA 2QENA 5BR8M 5FTJA 2LVNC 1SXJA 2YR0A 3FKEA 1TR8A 1UM8A 1YE9A 2DKLA 2Z4RA 3E4RA 4GRIA 4LF9M 3CF0A 2Y0TA 1Z6TA 1MU5A 2R65A 1QZMA 3AOGA 2CE7A 4L4UA 2AHMA 3KP0E 3U5ZB 4LF8M 1ZAEA 3L28A 3TWMA 2DAMA 3R8FA 1NHWC 2LNHC 4LFCM 3LVWA 1MJGM 2RGHA 3UZUA 2DWMA 2Q2EB 4IBFA 4R3DA 2QPAA 3U6OA 4IBKA 4MGZE 5FTNA 3HHZA 4LJ7A 1G41A 1ORYB 2L2DA 5EQTA 2R62A 2LTUA 2D7GA 1QVRA 1IXRC 2R4JA 1X37A 4XK8F 4NXMM 3GLGA 3LCVB 1OTRA 2XH9A 1JQJC 3CGWA 2CEAA 4NRVA 2R46A 2F5PA 3VKGA 1G71A 1IQPA 2A5YB 4KODA 1UFZA 2KA6B 3C3EA 2EKFA 4LJAA 7CATA 2JY7A 4Y28F 3KFUG 4CIZA 2FS1A 5DFLA 3HGIA 2OPFA 2R45A 3FRIA 3U6EA 2RRUA 3GLHB 3J7BA 2C98A 4M0WA 4LGYA 3B7QA 4JI3M 2XSZD 3B9PA 2XZFA 3HX3A 1PJTA 2MR9A 2DHYA 4FWDA 5IZ7D 1N34M 2QNJA 2XFTA 1EE8A 2ZTCA 3LVVA 5FTLA 4REZA 3GP1A 2I7NA 1H6UA 1N77A 3NBIA 1DGHA 3C58A 4DV3M 2LHGA 3VK7A 2F5NA 3HWSA 3AFHA 1PJIA 3U6SA 2V1CA 4MB7A 4S12A 4PD2A 2R6FA 1NY5A 3LMMA 4DV6M 3T1YM 2HHHM 4M9ZA 4JI4M 1NV9A 1Z5AA 4JN6A 4LZJA 4L16A 4M9SA 4RF1A 1TDZA 5EXTA 2UXCM 1K82A 1L2DA 3VFDA 2JY5A 2VIIA 3EIEA 3K2LA 4JI1M 3FUXA 3KVWA 5KPZA 2R18A 3FE3A 3GLFA 4L15A 4LF6M 1TH2A 2MH8A 2LXEA 1VG5A 2VF7A 2Y20A 1HJPA 2N35A 2OQ4A 2BWBA 1KYIA 3RFWA 4QNRA 1R5LA 2HWJA 4II7A 4ZPXA 5BPVA 2FNAA 2V1UA 1XNQM 4LY6A 3SC3A 3U6CA 1DO2A 1VQ1A 3FRHA 4GH9A 2ZBKB 3U60B 2C5RA 1YLAA 1IM2A 2DZOB 1HQCA 3HU2A 2FOIC 3SAWA 4DR6M 1G3IA 3MJ5A 3W68A 2DI0A 4OVZB 1N75A 3K1JA 2RGOA 4B3MM 4A3VB 3QYBA 1NHGC 4LF7M 3I51A 3B7NA 3FTDA 4IBIA 4DR1M 1YUBA 4KHPM 3KS4A 4LJ8A 3HHWA 3NBXX 3UJNA 3PFIA 4IBDA 3U6PA 1R7RA 3FTCA 4UN2B 1R6BX 4RF0A 3UMMA 2Y21A 1BVSA 3GLIE 4JI6M 3FUTA 1XXHE 3U5ZA 1KFVA 1HQYE 4BB9A 1G4AE 2KW0A 3E46A 4JV5M 3T15A 4MM3B 1HT1E 3KOXE 3GRUA 1RU3A 4B3TM 2DVWB 4NRWA 2LBCA 2DAKA 3KSXA 3E9SA 3A45A 4LCBA 4FCTA 2F5QA 2WSCF 4IIWA 1WJ7A 4GMQA 2DWZB 1QAOA 2EKKA 4CGYB 2DZNB 1T3TA 2CFOA 5EXXA 2JXNA 5KQDA 4DR7M 5DYGA 3SARA 2XLJA 4JI0M 4L6V6 2Z4SA 4TUWA 1NNUC 4LJ4A 1XXHB 2YNMD 4M0DA 2EO2A 1K3WA 5ITRA 3HJQA 1HT2E 1HNWM 1IY1A 1NVMA 3THGA 1I94M 3C9PA 1PGYA 1DV0A 1GO5A 1GLNA 2NQ8C 2ZAOA 4FCVA 5FTKA 3ZC7B 2HAKA 4QHSA 2VF8A 2ZTDA 3E21A 3HY5A 3SFZA 1L1ZA 1N78A 2YFQA 3VDUA 3NWLA 4DV1M 2G5GX 4JI5M 2M60A 1VDLA 2DNAA 4QOZC 4NL4H 3ZH9B 5ITTA 3VLFB 3GPPA 2XGNA 3MK6A 2E5LM 2Z3XA 3SBJA 3GLHE 4Q7JA 4AG5A 1WGLA 2XF3A 5EP4A 3SMSA 4B7GA 2CV2A 2CWBA 2JA2A 2EJSA 4AI6A 2QQ8A 1IN7A 3SHFA 4GIPA 3A46A 3Q8GA 4AZFA 4OU7A 1MX0A 3GPUA 1R2YA 1IBMM 4GC5A 4WURA 3QYEA 4LFAM 3FTFA 3U61B 5IT9S 1L2BA 2KZUA 1N32M 1IBLM 1JR3E 3FUWA 4MH0E 1TGUA 4MGKE 1ZQ9A 2CHVA 3HU3A 2JNHA 4L8RC 3GPXA 2KNAA 4LJ9A 3UGJA 3AOEA 2C99A 4W5WA 3F92A 1QUTA 1DO0A 1T6OA 2Z7JA 1C1KA 1GL6A 4YHHM 2QP9X 1GL7A 1PJJA 2QBYB 1FJGM 2QZ4A 1IY0A 4HEOA 3WHKA 4D81A 1Q3BA 2K0BX 4K0KM 5A2QS 3TE6A 2H5XA 3BOSA 2MGWA 1I4WA 1QANA 3B7ZA 1D0KA 4AKGA 3RGPA 3C3DA 1IN4A 2ZANA 1DGFA 1S3SA 1SXJB 4G4RA 4DR3M 1N33M 1TTEA 2R0IA 5FTMA 3L25A 1C7YA 4QNMA 3OTOM 4I5SA 3HU1A 3ZQJA 1IXZA 5DNYA 4AKIA 4IJFA 2VDBB 4CHTB 1QZEA 3CTWB 3AKZA 2BNKA 4LRTA 3EIHA 3HJ8A 1WIVA 3BXWA 2HKJA 1HR0M 4CISA 3FUVA 4QHTA 3I4VA 2L4EA 2G3QA 4X66M 2FFJA 2Y0QA 2C96A 3GLGB 2DHRA 4NXNM 4X65M 1VEKA 2KNZA 2L09A 4HL4A 3T38A 3JR5A 4XBOA 1PJQA 2DENA 3GLIA 1XXHA 2XSZA 2EA0A 2C9CA 4DBGB 3VKHA 2APLA 2K9DA 1L1TA 2F5OA 3SAUA 5E26A 4AQYM 5ITQA 1K3XA 3RGSA 2VQFM 5FSWA 3KXEC 4LF5M 1FNNA 2O25A 5DYIA 1IBKM 5KQ8A 4LGMA 2I7PA 4DUZM 4AG6A 3GRYA 2L7HA 2XEPA 2UXDM 1F4IA 1SXJD 2X4AA 3RE8A 5ITXA 3KW6A 4DR4M 1XNRM 1P3QQ 4GKJM 2DXIA 1DGHB 1SG9A 4BLCA 3QWLA 5KPRA 4X62M 1N36M 4GHAA 1Z59A 2MJ5B 4PT5A 4IBGA 4NC6A 1QAQA 3GQ4A 2KRKA 2ERCA 1JB0F 3LCUA 3H4MA 4FVMA 5EP3A 2XZUA 4MGYE 3J81S 1NO1A 3MMPA 5JI2E 5ITXE 3ILKA 2UXBM 5L8RF 2LVAA 4D82A 4CJ6A 1IY2A 3K92A 3KDSE 2DZLA 4HLQA 3SYKA 4IJEA 3VDPA 1MN3A 2L7IA 1E94E 2F5SA 1OIPA 4GHLA 1OJLA 3HHYA 4DV4M 2OOAA 3TPZA 4IBEA 1SXJC 3DOAA 4JI7M 4LJ6A 4GEWA 4ANRA 1Q02A 1DGBA 3GLHA 1Y8GA 2UUAM 3IHPA 3SYLA 3KOYE 4LZZA 1G59A 2M5ZA 2QBYA 3V76A 3PNVA 5EP2A 1L2CA 3TWKA 1XB2B 1EFUB 1OAOC 4G6ZA 3TL4X 4LFBM 1GABA 4R71A 2LWXA 3UK6A 2R44A 3HKPA 5FLXS 2OOBA 4JI2M 1VEGA 2WZJA 3FD9A 2UUBM 3SHGB 1JR3A 2LH0A 3J27B 4PDGA 1OKSA 4NSOB 4YY3M 5IREB 5GKNA 2RKOA 1OFIA 4DUYM 2QCUA 1WGNA 4IBBA 2EUCA 4FW9A 5IWAM 2DAGA 2H1RA 4M9XA 4DR5M 4QOSA 3HHXA 3PXGA 2BJVA 4F1IA 2JWSA 1QQWA 2L4FA 2QHOB 1OAIA 1XHBA 2JUJA 2ZAMA 3AOEC 3DA1A 4LRSA 4KT0F 2YQZA 1W5TA 1QDTA 3M0EA 3W0LB 2KDLA 2L6OA 3D8BA 5ITYA 1XMOM 1IFYA 3WHLA 1GJTA 1DGGA 3FYDA 3KP1E 4BBAA 1SXJE 1OFHA 2LVOC 2BJWA 3I01M 3K9PA 4IBCA 2UUCM 2J7NA 1GJSA 4LG2A 1LTMA 2Z8YM 1WHCA 4F2LA 3VK8A 3BBZA 4FCWA 3L2AA 3U60A 3SASA 1ZMVA 3KOZE 4OX9M 1IXSB 1WXQA 3DZDA 4JXJA 5EXSA 2JZ0A 3D8LA 4X64M 1ZMWA 3J80S 2O5RA 4OVZA 2BWEA 2CHQA 2UU9M 4LF4M 1T43A 2O01F 3SAVA 5E6JA 3QAUA 2GQFA 1R2ZA 3JAMS 4WW0A 4DV0M 3GLGE 4DR2M 4MGIE 2QSFX 2J7OA 3ZCBB 2V6ZM 2CRUA 1QUSA 3I4YA 2DAEA 2R4EA 4B3SM 2KNVA 1IN5A 4Z6YA 1HNXM 1E9RA 3IG8A 4I8OA 4JYAM 3LQRA 4FD2A 5KPTA 1W5SA 4DV7M 2G8LA 3L29A 3TQSA 1TH3A 2X8AA 2HCBA 5ITUA 3HJSA 3W67A 4AKHA 4P16A 2CHGA 1G8PA 3KSJA 2KRUA 1V92A 1OQYA 4LJ5A 1A5TA 3L26A 1Q3CA 1YSYA 4PDIA 3B89A 8CATA 1HNZM 3L27A 3SMPA 1E9SA 2C9OA 1PRBA 5C18A 5KO3A 4JI8M 5LMNM 3J2PB 2MROB 2DAIA 3A42A 1E32A 1OIZA 1NY6A 4KO8A 4WP2A 1GVNA 4FWGA 1V33A 1LV7A 1J5EM 1TDHA 1TH4A 1L8QA 1Z5BA 2DWLA 4KLNA 2JP7A 3FUUA 2JY6B 3CF6E 4NOOB 3T1HM 2P5TA 3M7GA 3GLFE 1AIPC 4RNAA 3U6LA 1NV8A 1VDDA 4IBJA 1TF0B 4I81A 4L78A 4G4QA 3A98B 1XWIA 1R4GA 4R7GA 1EIJA 1D0MA 2LVPC 2KEBA 3FYCA 4PCZA 2WSFF 1QDRA 3DFZA 2LVQD 3M6AA 1ZMUA 4P17A 1J09A 4D80A 3FTEA 1KSFX 3I04M 2GNOA 4DV5M 2WSEF 3U6QA 4AW4A 2FE8A 4I4LA 3HZJA 2FH0A 2K47A 3GQ3A 4Z8XA 2CP8A 3GRVA 4G3OA 1JR3D 5EJCA 3MHVC 3U6MA 4DV2M 3GLFB 1V34A 1XMQM 5H37D 4NSRA 1QYRA 5C1BA 2HL7A 5EXPA 1NNJA 3IG5A 2X49A 2W82A 4B08A 3U61A 3R9XB 3CF2A 3LW5F 4GC9A 2CV1A 3LQQA 1PM5A 3SATA 4G4NA 2KXEA 2D7EA 3IECA 4MGHA 1AUAA 3Q8XA 4ITQA
chains in the Genus database with same CATH topology
1IM2A 2DAGA 2KHHA 4F1IA 2MGWA 1G3IA 1WR1B 1ZV1A 2L4FA 2QHOB 1OAIA 2JUJA 3T6PA 2DI0A 1TTEA 2R0IA 3H4JA 1IFYA 1C7YA 1CUKA 1IXSA 3K9OA 2LVOC 3K9PA 2JZ1A 4F2LA 2OO9A 1WHCA 2JY8A 3BBZA 4UN2B 1QZEA 1ZMVA 2B3TA 1VEJA 1WIVA 1BVSA 3GLIE 2JZ0A 1XXHE 1HQYE 1ZMWA 1G4AE 2L4EA 2LVNC 3E46A 2G3QA 1HT1E 1TR8A 2DKLA 2BWEA 2LBCA 1T43A 2DAKA 1VEKA 2KNZA 2DAMA 1WJ7A 3GLGE 2DENA 2EKKA 2QSFX 4DBGB 2K9DA 1G41A 2DAEA 2L2DA 2KNVA 2LTUA 2O25A 3LCVB 1OTRA 1F4IA 1HT2E 1DV0A 1PGYA 1P3QQ 1GO5A 1V92A 1OQYA 2HAKA 1UFZA 1SG9A 2ZTDA 3E21A 2EKFA 2JY7A 1A5TA 2MJ5B 3B89A 5DFLA 3LCUA 3FRIA 2RRUA 4WP2A 1VDLA 2DAIA 2DNAA 2MROB 3MMPA 5JI2E 2MR9A 2DHYA 3GLHE 2LVAA 4Q7JA 1WGLA 2QNJA 2JP7A 2ZTCA 2DZLA 2CWBA 2JY6B 2EJSA 1MN3A 3GLFE 1E94E 1AIPC 2OOAA 1NV8A 4GEWA 1Q02A 1NV9A 1R4GA 1JR3E 1Y8GA 3IHPA 2LVPC 2JY5A 2JNHA 2LVQD 3FE3A 1ZMUA 2KNAA 1XB2B 1EFUB 3F92A 1VG5A 4R71A 1DO0A 1T6OA 1HJPA 2BWBA 2CP8A 1KYIA 4G3OA 2OOBA 1VEGA 2HWJA 2WZJA 4HEOA 1OKSA 2K0BX 1DO2A 2H5XA 1VQ1A 3FRHA 3IECA 1WGNA 1YLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IM2 A;  2DAG A;  2KHH A;  4F1I A;  2MGW A;  1G3I A;  1WR1 B;  1ZV1 A;  2L4F A;  2QHO B;  1OAI A;  2JUJ A;  3T6P A;  2DI0 A;  1TTE A;  2R0I A;  3H4J A;  1IFY A;  1C7Y A;  1CUK A;  1IXS A;  3K9O A;  2LVO C;  3K9P A;  2JZ1 A;  4F2L A;  2OO9 A;  1WHC A;  2JY8 A;  3BBZ A;  4UN2 B;  1QZE A;  1ZMV A;  2B3T A;  1VEJ A;  1WIV A;  1BVS A;  3GLI E;  2JZ0 A;  1XXH E;  1HQY E;  1ZMW A;  1G4A E;  2L4E A;  2LVN C;  3E46 A;  2G3Q A;  1HT1 E;  1TR8 A;  2DKL A;  2BWE A;  2LBC A;  1T43 A;  2DAK A;  1VEK A;  2KNZ A;  2DAM A;  1WJ7 A;  3GLG E;  2DEN A;  2EKK A;  2QSF X;  4DBG B;  2K9D A;  1G41 A;  2DAE A;  2L2D A;  2KNV A;  2LTU A;  2O25 A;  3LCV B;  1OTR A;  1F4I A;  1HT2 E;  1DV0 A;  1PGY A;  1P3Q Q;  1GO5 A;  1V92 A;  1OQY A;  2HAK A;  1UFZ A;  1SG9 A;  2ZTD A;  3E21 A;  2EKF A;  2JY7 A;  1A5T A;  2MJ5 B;  3B89 A;  5DFL A;  3LCU A;  3FRI A;  2RRU A;  4WP2 A;  1VDL A;  2DAI A;  2DNA A;  2MRO B;  3MMP A;  5JI2 E;  2MR9 A;  2DHY A;  3GLH E;  2LVA A;  4Q7J A;  1WGL A;  2QNJ A;  2JP7 A;  2ZTC A;  2DZL A;  2CWB A;  2JY6 B;  2EJS A;  1MN3 A;  3GLF E;  1E94 E;  1AIP C;  2OOA A;  1NV8 A;  4GEW A;  1Q02 A;  1NV9 A;  1R4G A;  1JR3 E;  1Y8G A;  3IHP A;  2LVP C;  2JY5 A;  2JNH A;  2LVQ D;  3FE3 A;  1ZMU A;  2KNA A;  1XB2 B;  1EFU B;  3F92 A;  1VG5 A;  4R71 A;  1DO0 A;  1T6O A;  1HJP A;  2BWB A;  2CP8 A;  1KYI A;  4G3O A;  2OOB A;  1VEG A;  2HWJ A;  2WZJ A;  4HEO A;  1OKS A;  2K0B X;  1DO2 A;  2H5X A;  1VQ1 A;  3FRH A;  3IEC A;  1WGN A;  1YLA A; 
#chains in the Genus database with same CATH topology
 4FWH A;  1D2N A;  1QAM A;  2K6B A;  2KHH A;  3AL0 C;  3AJI B;  1IN6 A;  2D7H A;  1WR1 B;  1ZV1 A;  4B7F A;  3PNY A;  3GO8 A;  2ZM6 M;  4G4O A;  4GKK M;  4RKU F;  2LHC A;  5EP1 A;  3T6P A;  2VQE M;  2XFS A;  1Z5C A;  1GKI A;  4OW0 A;  3GPY A;  3H4J A;  3JR4 A;  2CV0 A;  2F4V M;  3K8Z A;  1CUK A;  4GIT A;  4EIW A;  3KOW E;  1D0L A;  1IXS A;  3K9O A;  3GRR A;  2J5Y A;  4B7H A;  4XGI A;  4B3R M;  1XC8 A;  2JZ1 A;  1NSF A;  5JI3 E;  1J7K A;  2OO9 A;  3B74 A;  3PVS A;  2JY8 A;  3TWL A;  3GLI B;  2DWN A;  1Q39 A;  1PJS A;  1IN8 A;  5LMU M;  3KS8 A;  3J7A S;  2B3T A;  1VEJ A;  3GQ5 A;  2KZS A;  3AV0 A;  3U6D A;  5F3W A;  2CUZ A;  3W0F A;  1NJG A;  1NJF A;  2QEN A;  5BR8 M;  5FTJ A;  2LVN C;  1SXJ A;  2YR0 A;  3FKE A;  1TR8 A;  1UM8 A;  1YE9 A;  2DKL A;  2Z4R A;  3E4R A;  4GRI A;  4LF9 M;  3CF0 A;  2Y0T A;  1Z6T A;  1MU5 A;  2R65 A;  1QZM A;  3AOG A;  2CE7 A;  4L4U A;  2AHM A;  3KP0 E;  3U5Z B;  4LF8 M;  1ZAE A;  3L28 A;  3TWM A;  2DAM A;  3R8F A;  1NHW C;  2LNH C;  4LFC M;  3LVW A;  1MJG M;  2RGH A;  3UZU A;  2DWM A;  2Q2E B;  4IBF A;  4R3D A;  2QPA A;  3U6O A;  4IBK A;  4MGZ E;  5FTN A;  3HHZ A;  4LJ7 A;  1G41 A;  1ORY B;  2L2D A;  5EQT A;  2R62 A;  2LTU A;  2D7G A;  1QVR A;  1IXR C;  2R4J A;  1X37 A;  4XK8 F;  4NXM M;  3GLG A;  3LCV B;  1OTR A;  2XH9 A;  1JQJ C;  3CGW A;  2CEA A;  4NRV A;  2R46 A;  2F5P A;  3VKG A;  1G71 A;  1IQP A;  2A5Y B;  4KOD A;  1UFZ A;  2KA6 B;  3C3E A;  2EKF A;  4LJA A;  7CAT A;  2JY7 A;  4Y28 F;  3KFU G;  4CIZ A;  2FS1 A;  5DFL A;  3HGI A;  2OPF A;  2R45 A;  3FRI A;  3U6E A;  2RRU A;  3GLH B;  3J7B A;  2C98 A;  4M0W A;  4LGY A;  3B7Q A;  4JI3 M;  2XSZ D;  3B9P A;  2XZF A;  3HX3 A;  1PJT A;  2MR9 A;  2DHY A;  4FWD A;  5IZ7 D;  1N34 M;  2QNJ A;  2XFT A;  1EE8 A;  2ZTC A;  3LVV A;  5FTL A;  4REZ A;  3GP1 A;  2I7N A;  1H6U A;  1N77 A;  3NBI A;  1DGH A;  3C58 A;  4DV3 M;  2LHG A;  3VK7 A;  2F5N A;  3HWS A;  3AFH A;  1PJI A;  3U6S A;  2V1C A;  4MB7 A;  4S12 A;  4PD2 A;  2R6F A;  1NY5 A;  3LMM A;  4DV6 M;  3T1Y M;  2HHH M;  4M9Z A;  4JI4 M;  1NV9 A;  1Z5A A;  4JN6 A;  4LZJ A;  4L16 A;  4M9S A;  4RF1 A;  1TDZ A;  5EXT A;  2UXC M;  1K82 A;  1L2D A;  3VFD A;  2JY5 A;  2VII A;  3EIE A;  3K2L A;  4JI1 M;  3FUX A;  3KVW A;  5KPZ A;  2R18 A;  3FE3 A;  3GLF A;  4L15 A;  4LF6 M;  1TH2 A;  2MH8 A;  2LXE A;  1VG5 A;  2VF7 A;  2Y20 A;  1HJP A;  2N35 A;  2OQ4 A;  2BWB A;  1KYI A;  3RFW A;  4QNR A;  1R5L A;  2HWJ A;  4II7 A;  4ZPX A;  5BPV A;  2FNA A;  2V1U A;  1XNQ M;  4LY6 A;  3SC3 A;  3U6C A;  1DO2 A;  1VQ1 A;  3FRH A;  4GH9 A;  2ZBK B;  3U60 B;  2C5R A;  1YLA A;  1IM2 A;  2DZO B;  1HQC A;  3HU2 A;  2FOI C;  3SAW A;  4DR6 M;  1G3I A;  3MJ5 A;  3W68 A;  2DI0 A;  4OVZ B;  1N75 A;  3K1J A;  2RGO A;  4B3M M;  4A3V B;  3QYB A;  1NHG C;  4LF7 M;  3I51 A;  3B7N A;  3FTD A;  4IBI A;  4DR1 M;  1YUB A;  4KHP M;  3KS4 A;  4LJ8 A;  3HHW A;  3NBX X;  3UJN A;  3PFI A;  4IBD A;  3U6P A;  1R7R A;  3FTC A;  4UN2 B;  1R6B X;  4RF0 A;  3UMM A;  2Y21 A;  1BVS A;  3GLI E;  4JI6 M;  3FUT A;  1XXH E;  3U5Z A;  1KFV A;  1HQY E;  4BB9 A;  1G4A E;  2KW0 A;  3E46 A;  4JV5 M;  3T15 A;  4MM3 B;  1HT1 E;  3KOX E;  3GRU A;  1RU3 A;  4B3T M;  2DVW B;  4NRW A;  2LBC A;  2DAK A;  3KSX A;  3E9S A;  3A45 A;  4LCB A;  4FCT A;  2F5Q A;  2WSC F;  4IIW A;  1WJ7 A;  4GMQ A;  2DWZ B;  1QAO A;  2EKK A;  4CGY B;  2DZN B;  1T3T A;  2CFO A;  5EXX A;  2JXN A;  5KQD A;  4DR7 M;  5DYG A;  3SAR A;  2XLJ A;  4JI0 M;  4L6V 6;  2Z4S A;  4TUW A;  1NNU C;  4LJ4 A;  1XXH B;  2YNM D;  4M0D A;  2EO2 A;  1K3W A;  5ITR A;  3HJQ A;  1HT2 E;  1HNW M;  1IY1 A;  1NVM A;  3THG A;  1I94 M;  3C9P A;  1PGY A;  1DV0 A;  1GO5 A;  1GLN A;  2NQ8 C;  2ZAO A;  4FCV A;  5FTK A;  3ZC7 B;  2HAK A;  4QHS A;  2VF8 A;  2ZTD A;  3E21 A;  3HY5 A;  3SFZ A;  1L1Z A;  1N78 A;  2YFQ A;  3VDU A;  3NWL A;  4DV1 M;  2G5G X;  4JI5 M;  2M60 A;  1VDL A;  2DNA A;  4QOZ C;  4NL4 H;  3ZH9 B;  5ITT A;  3VLF B;  3GPP A;  2XGN A;  3MK6 A;  2E5L M;  2Z3X A;  3SBJ A;  3GLH E;  4Q7J A;  4AG5 A;  1WGL A;  2XF3 A;  5EP4 A;  3SMS A;  4B7G A;  2CV2 A;  2CWB A;  2JA2 A;  2EJS A;  4AI6 A;  2QQ8 A;  1IN7 A;  3SHF A;  4GIP A;  3A46 A;  3Q8G A;  4AZF A;  4OU7 A;  1MX0 A;  3GPU A;  1R2Y A;  1IBM M;  4GC5 A;  4WUR A;  3QYE A;  4LFA M;  3FTF A;  3U61 B;  5IT9 S;  1L2B A;  2KZU A;  1N32 M;  1IBL M;  1JR3 E;  3FUW A;  4MH0 E;  1TGU A;  4MGK E;  1ZQ9 A;  2CHV A;  3HU3 A;  2JNH A;  4L8R C;  3GPX A;  2KNA A;  4LJ9 A;  3UGJ A;  3AOE A;  2C99 A;  4W5W A;  3F92 A;  1QUT A;  1DO0 A;  1T6O A;  2Z7J A;  1C1K A;  1GL6 A;  4YHH M;  2QP9 X;  1GL7 A;  1PJJ A;  2QBY B;  1FJG M;  2QZ4 A;  1IY0 A;  4HEO A;  3WHK A;  4D81 A;  1Q3B A;  2K0B X;  4K0K M;  5A2Q S;  3TE6 A;  2H5X A;  3BOS A;  2MGW A;  1I4W A;  1QAN A;  3B7Z A;  1D0K A;  4AKG A;  3RGP A;  3C3D A;  1IN4 A;  2ZAN A;  1DGF A;  1S3S A;  1SXJ B;  4G4R A;  4DR3 M;  1N33 M;  1TTE A;  2R0I A;  5FTM A;  3L25 A;  1C7Y A;  4QNM A;  3OTO M;  4I5S A;  3HU1 A;  3ZQJ A;  1IXZ A;  5DNY A;  4AKI A;  4IJF A;  2VDB B;  4CHT B;  1QZE A;  3CTW B;  3AKZ A;  2BNK A;  4LRT A;  3EIH A;  3HJ8 A;  1WIV A;  3BXW A;  2HKJ A;  1HR0 M;  4CIS A;  3FUV A;  4QHT A;  3I4V A;  2L4E A;  2G3Q A;  4X66 M;  2FFJ A;  2Y0Q A;  2C96 A;  3GLG B;  2DHR A;  4NXN M;  4X65 M;  1VEK A;  2KNZ A;  2L09 A;  4HL4 A;  3T38 A;  3JR5 A;  4XBO A;  1PJQ A;  2DEN A;  3GLI A;  1XXH A;  2XSZ A;  2EA0 A;  2C9C A;  4DBG B;  3VKH A;  2APL A;  2K9D A;  1L1T A;  2F5O A;  3SAU A;  5E26 A;  4AQY M;  5ITQ A;  1K3X A;  3RGS A;  2VQF M;  5FSW A;  3KXE C;  4LF5 M;  1FNN A;  2O25 A;  5DYI A;  1IBK M;  5KQ8 A;  4LGM A;  2I7P A;  4DUZ M;  4AG6 A;  3GRY A;  2L7H A;  2XEP A;  2UXD M;  1F4I A;  1SXJ D;  2X4A A;  3RE8 A;  5ITX A;  3KW6 A;  4DR4 M;  1XNR M;  1P3Q Q;  4GKJ M;  2DXI A;  1DGH B;  1SG9 A;  4BLC A;  3QWL A;  5KPR A;  4X62 M;  1N36 M;  4GHA A;  1Z59 A;  2MJ5 B;  4PT5 A;  4IBG A;  4NC6 A;  1QAQ A;  3GQ4 A;  2KRK A;  2ERC A;  1JB0 F;  3LCU A;  3H4M A;  4FVM A;  5EP3 A;  2XZU A;  4MGY E;  3J81 S;  1NO1 A;  3MMP A;  5JI2 E;  5ITX E;  3ILK A;  2UXB M;  5L8R F;  2LVA A;  4D82 A;  4CJ6 A;  1IY2 A;  3K92 A;  3KDS E;  2DZL A;  4HLQ A;  3SYK A;  4IJE A;  3VDP A;  1MN3 A;  2L7I A;  1E94 E;  2F5S A;  1OIP A;  4GHL A;  1OJL A;  3HHY A;  4DV4 M;  2OOA A;  3TPZ A;  4IBE A;  1SXJ C;  3DOA A;  4JI7 M;  4LJ6 A;  4GEW A;  4ANR A;  1Q02 A;  1DGB A;  3GLH A;  1Y8G A;  2UUA M;  3IHP A;  3SYL A;  3KOY E;  4LZZ A;  1G59 A;  2M5Z A;  2QBY A;  3V76 A;  3PNV A;  5EP2 A;  1L2C A;  3TWK A;  1XB2 B;  1EFU B;  1OAO C;  4G6Z A;  3TL4 X;  4LFB M;  1GAB A;  4R71 A;  2LWX A;  3UK6 A;  2R44 A;  3HKP A;  5FLX S;  2OOB A;  4JI2 M;  1VEG A;  2WZJ A;  3FD9 A;  2UUB M;  3SHG B;  1JR3 A;  2LH0 A;  3J27 B;  4PDG A;  1OKS A;  4NSO B;  4YY3 M;  5IRE B;  5GKN A;  2RKO A;  1OFI A;  4DUY M;  2QCU A;  1WGN A;  4IBB A;  2EUC A;  4FW9 A;  5IWA M;  2DAG A;  2H1R A;  4M9X A;  4DR5 M;  4QOS A;  3HHX A;  3PXG A;  2BJV A;  4F1I A;  2JWS A;  1QQW A;  2L4F A;  2QHO B;  1OAI A;  1XHB A;  2JUJ A;  2ZAM A;  3AOE C;  3DA1 A;  4LRS A;  4KT0 F;  2YQZ A;  1W5T A;  1QDT A;  3M0E A;  3W0L B;  2KDL A;  2L6O A;  3D8B A;  5ITY A;  1XMO M;  1IFY A;  3WHL A;  1GJT A;  1DGG A;  3FYD A;  3KP1 E;  4BBA A;  1SXJ E;  1OFH A;  2LVO C;  2BJW A;  3I01 M;  3K9P A;  4IBC A;  2UUC M;  2J7N A;  1GJS A;  4LG2 A;  1LTM A;  2Z8Y M;  1WHC A;  4F2L A;  3VK8 A;  3BBZ A;  4FCW A;  3L2A A;  3U60 A;  3SAS A;  1ZMV A;  3KOZ E;  4OX9 M;  1IXS B;  1WXQ A;  3DZD A;  4JXJ A;  5EXS A;  2JZ0 A;  3D8L A;  4X64 M;  1ZMW A;  3J80 S;  2O5R A;  4OVZ A;  2BWE A;  2CHQ A;  2UU9 M;  4LF4 M;  1T43 A;  2O01 F;  3SAV A;  5E6J A;  3QAU A;  2GQF A;  1R2Z A;  3JAM S;  4WW0 A;  4DV0 M;  3GLG E;  4DR2 M;  4MGI E;  2QSF X;  2J7O A;  3ZCB B;  2V6Z M;  2CRU A;  1QUS A;  3I4Y A;  2DAE A;  2R4E A;  4B3S M;  2KNV A;  1IN5 A;  4Z6Y A;  1HNX M;  1E9R A;  3IG8 A;  4I8O A;  4JYA M;  3LQR A;  4FD2 A;  5KPT A;  1W5S A;  4DV7 M;  2G8L A;  3L29 A;  3TQS A;  1TH3 A;  2X8A A;  2HCB A;  5ITU A;  3HJS A;  3W67 A;  4AKH A;  4P16 A;  2CHG A;  1G8P A;  3KSJ A;  2KRU A;  1V92 A;  1OQY A;  4LJ5 A;  1A5T A;  3L26 A;  1Q3C A;  1YSY A;  4PDI A;  3B89 A;  8CAT A;  1HNZ M;  3L27 A;  3SMP A;  1E9S A;  2C9O A;  1PRB A;  5C18 A;  5KO3 A;  4JI8 M;  5LMN M;  3J2P B;  2MRO B;  2DAI A;  3A42 A;  1E32 A;  1OIZ A;  1NY6 A;  4KO8 A;  4WP2 A;  1GVN A;  4FWG A;  1V33 A;  1LV7 A;  1J5E M;  1TDH A;  1TH4 A;  1L8Q A;  1Z5B A;  2DWL A;  4KLN A;  2JP7 A;  3FUU A;  2JY6 B;  3CF6 E;  4NOO B;  3T1H M;  2P5T A;  3M7G A;  3GLF E;  1AIP C;  4RNA A;  3U6L A;  1NV8 A;  1VDD A;  4IBJ A;  1TF0 B;  4I81 A;  4L78 A;  4G4Q A;  3A98 B;  1XWI A;  1R4G A;  4R7G A;  1EIJ A;  1D0M A;  2LVP C;  2KEB A;  3FYC A;  4PCZ A;  2WSF F;  1QDR A;  3DFZ A;  2LVQ D;  3M6A A;  1ZMU A;  4P17 A;  1J09 A;  4D80 A;  3FTE A;  1KSF X;  3I04 M;  2GNO A;  4DV5 M;  2WSE F;  3U6Q A;  4AW4 A;  2FE8 A;  4I4L A;  3HZJ A;  2FH0 A;  2K47 A;  3GQ3 A;  4Z8X A;  2CP8 A;  3GRV A;  4G3O A;  1JR3 D;  5EJC A;  3MHV C;  3U6M A;  4DV2 M;  3GLF B;  1V34 A;  1XMQ M;  5H37 D;  4NSR A;  1QYR A;  5C1B A;  2HL7 A;  5EXP A;  1NNJ A;  3IG5 A;  2X49 A;  2W82 A;  4B08 A;  3U61 A;  3R9X B;  3CF2 A;  3LW5 F;  4GC9 A;  2CV1 A;  3LQQ A;  1PM5 A;  3SAT A;  4G4N A;  2KXE A;  2D7E A;  3IEC A;  4MGH A;  1AUA A;  3Q8X A;  4ITQ A; 
#chains in the Genus database with same CATH homology
 1IM2 A;  2DAG A;  2KHH A;  4F1I A;  2MGW A;  1G3I A;  1WR1 B;  1ZV1 A;  2L4F A;  2QHO B;  1OAI A;  2JUJ A;  3T6P A;  2DI0 A;  1TTE A;  2R0I A;  3H4J A;  1IFY A;  1C7Y A;  1CUK A;  1IXS A;  3K9O A;  2LVO C;  3K9P A;  2JZ1 A;  4F2L A;  2OO9 A;  1WHC A;  2JY8 A;  3BBZ A;  4UN2 B;  1QZE A;  1ZMV A;  2B3T A;  1VEJ A;  1WIV A;  1BVS A;  3GLI E;  2JZ0 A;  1XXH E;  1HQY E;  1ZMW A;  1G4A E;  2L4E A;  2LVN C;  3E46 A;  2G3Q A;  1HT1 E;  1TR8 A;  2DKL A;  2BWE A;  2LBC A;  1T43 A;  2DAK A;  1VEK A;  2KNZ A;  2DAM A;  1WJ7 A;  3GLG E;  2DEN A;  2EKK A;  2QSF X;  4DBG B;  2K9D A;  1G41 A;  2DAE A;  2L2D A;  2KNV A;  2LTU A;  2O25 A;  3LCV B;  1OTR A;  1F4I A;  1HT2 E;  1DV0 A;  1PGY A;  1P3Q Q;  1GO5 A;  1V92 A;  1OQY A;  2HAK A;  1UFZ A;  1SG9 A;  2ZTD A;  3E21 A;  2EKF A;  2JY7 A;  1A5T A;  2MJ5 B;  3B89 A;  5DFL A;  3LCU A;  3FRI A;  2RRU A;  4WP2 A;  1VDL A;  2DAI A;  2DNA A;  2MRO B;  3MMP A;  5JI2 E;  2MR9 A;  2DHY A;  3GLH E;  2LVA A;  4Q7J A;  1WGL A;  2QNJ A;  2JP7 A;  2ZTC A;  2DZL A;  2CWB A;  2JY6 B;  2EJS A;  1MN3 A;  3GLF E;  1E94 E;  1AIP C;  2OOA A;  1NV8 A;  4GEW A;  1Q02 A;  1NV9 A;  1R4G A;  1JR3 E;  1Y8G A;  3IHP A;  2LVP C;  2JY5 A;  2JNH A;  2LVQ D;  3FE3 A;  1ZMU A;  2KNA A;  1XB2 B;  1EFU B;  3F92 A;  1VG5 A;  4R71 A;  1DO0 A;  1T6O A;  1HJP A;  2BWB A;  2CP8 A;  1KYI A;  4G3O A;  2OOB A;  1VEG A;  2HWJ A;  2WZJ A;  4HEO A;  1OKS A;  2K0B X;  1DO2 A;  2H5X A;  1VQ1 A;  3FRH A;  3IEC A;  1WGN A;  1YLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...