1PI1A

Crystal structure of a human mob1 protein; toward understanding mob-regulated cell cycle pathways.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
185
structure length
185
Chain Sequence
MEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mob1A
publication title Crystal structure of a human mob1 protein. Toward understanding mob-regulated cell cycle pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 60
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 1pi1A00
1R3BA 5B5VA 5BRMA 2HJNA 4LQSB 5B5WA 5BRKA 4LQQB 4J1VA 1PI1A 5B6BA 4JIZA
chains in the Genus database with same CATH superfamily
1OAHA 1PK0A 2CX9A 3OWAA 4L3YA 2Q8IA 3X0XA 3TZ2A 1SK6A 2BTZA 1Y0VA 4F0XA 2C12A 4AKGA 4KSAA 1RJ4A 1FS9A 1LVCA 3BNHA 3MMOA 4G5EA 3S7WA 3Q0AA 3MPIA 2PG0A 2REHA 1T9GA 2FP2A 3EOMA 2PO4A 3B96A 2VR0A 2Q8HA 1R3BA 2Q8GA 3D1IA 2CJ4A 3TZ0A 3CE2A 5M4MA 2YYLA 2YYIA 3P4TA 2Q8FA 5K3HA 4L3ZA 2CJ5A 1FS8A 4Q5CA 4Q0TA 3AFFA 2Z1QA 3D9FA 4Q4UA 1XFZA 4FF4A 1SC5A 2PNRA 4AI6A 2WBIA 4HR3A 2E81A 1WS9A 2IX6A 2RFQA 5GJVE 1XFXA 2AO2A 1X90A 3Q22A 1JQIA 1XFYA 4QICA 1RJ1A 3SXQA 4J1VA 1Y8OA 2YYKA 1K8TA 4JIOA 3OWMA 1IS2A 3UBRA 3Q23A 3X29A 3GNCA 4V25A 1QDBA 2EC5A 4FZ4A 1FS7A 1X91A 2YYJA 1GU6A 3MPJA 4M9AA 4WJYA 2VF1A 3NF4A 4W9UA 3OIBA 4AKHA 3VKHA 1GKZA 4LQSB 3TORA 4E00A 2LFWA 4DZYA 2DDHA 2VIGA 5B5VA 4IRNA 1K90A 3UU9A 3Q24A 3N0RA 3FCJA 3R7KA 2J7AA 4KTOA 4FF2A 4KS9A 1JM6A 2CJ7A 2ZDXA 2YYMA 3C2PA 1IVHA 2R0NA 2EBAA 4H85A 3TZ4A 2R0MA 2E80A 4ZXVA 2BU8A 4OO2A 1SIQA 4L3XA 5B5WA 4FF3A 3L1TA 3MXLA 1EGEA 2FP1A 2OEXA 4AKIA 2BU2A 2BU7A 2ZO5A 4N5FA 5M4KA 3C3LA 3D9EA 3VKGA 3II9A 3PFDA 1RP3A 4MP7A 4Q5BA 1W07A 4U83A 5J71A 3X0YA 4X28A 2D29A 3D2RA 2AZEA 2YGWA 4H7QA 3SF6A 4DOYA 4HKSA 2CJ8A 2IX5A 2C0UA 1Y8PA 2XS8A 1BUCA 4JIZA 5BRKA 4Q1OA 1Y8NA 3BNJA 3SWOA 4KSFA 4H81A 4X28C 1XFVA 4HKRA 2JBSA 1S26A 2R03A 2OJQA 2R05A 3BNFA 3BNGA 3CRKA 2OR0A 5M4NA 2DVLA 4MP2A 3AFEA 4MPNA 3RKHA 3M9VA 3LGQA 2JIFA 3MDDA 1XFUA 2XS1A 4MPEA 4ZYJA 4FF1A 1XG2B 2ZAFA 1EGDA 1R2JA 4JEKA 2BU6A 4P79A 4Q17A 5K3JA 1UDYA 5J6AA 1K93A 3MDEA 1PI1A 3HWCA 1GKXA 2XQRB 2GBBA 2JBTA 2EBFX 2OEVA 3CRLA 2UXWA 2BU5A 2CJ6A 2RDZA 3EONA 1X8ZA 4L1FA 5GJWE 3GM6A 2HJNA 3D6BA 2EBHX 3LG1A 3MKHA 5BRMA 4LQQB 1XFWA 2R02A 4V26A 2RF7A 3KMLA 5M4PA 3FO3A 3VADA 1SIRA 5K3GA 2E0AA 2F6LA 4O5MA 3F29A 1RX0A 1GJVA 3TZ5A 3TTBA 1UKWA 1EGCA 2YYGA 2JBRA 4IV6A 2OT4A 3SCEA 4XVXA 3GQTA 4E02A 5B6BA 3C46A 4RM7A 4E01A 2FONA 3D9DA 4L38A 4NXLA 2ZDYA 4MPCA 2QR4A 3D9GA 4G97A 4P13A 4KCFA 5K3IA 1U8VA 2ZKJA 2A1TA
chains in the Genus database with same CATH topology
1R3BA 5B5VA 5BRMA 2HJNA 4LQSB 5B5WA 5BRKA 4LQQB 4J1VA 1PI1A 5B6BA 4JIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3B A;  5B5V A;  5BRM A;  2HJN A;  4LQS B;  5B5W A;  5BRK A;  4LQQ B;  4J1V A;  1PI1 A;  5B6B A;  4JIZ A; 
#chains in the Genus database with same CATH topology
 1OAH A;  1PK0 A;  2CX9 A;  3OWA A;  4L3Y A;  2Q8I A;  3X0X A;  3TZ2 A;  1SK6 A;  2BTZ A;  1Y0V A;  4F0X A;  2C12 A;  4AKG A;  4KSA A;  1RJ4 A;  1FS9 A;  1LVC A;  3BNH A;  3MMO A;  4G5E A;  3S7W A;  3Q0A A;  3MPI A;  2PG0 A;  2REH A;  1T9G A;  2FP2 A;  3EOM A;  2PO4 A;  3B96 A;  2VR0 A;  2Q8H A;  1R3B A;  2Q8G A;  3D1I A;  2CJ4 A;  3TZ0 A;  3CE2 A;  5M4M A;  2YYL A;  2YYI A;  3P4T A;  2Q8F A;  5K3H A;  4L3Z A;  2CJ5 A;  1FS8 A;  4Q5C A;  4Q0T A;  3AFF A;  2Z1Q A;  3D9F A;  4Q4U A;  1XFZ A;  4FF4 A;  1SC5 A;  2PNR A;  4AI6 A;  2WBI A;  4HR3 A;  2E81 A;  1WS9 A;  2IX6 A;  2RFQ A;  5GJV E;  1XFX A;  2AO2 A;  1X90 A;  3Q22 A;  1JQI A;  1XFY A;  4QIC A;  1RJ1 A;  3SXQ A;  4J1V A;  1Y8O A;  2YYK A;  1K8T A;  4JIO A;  3OWM A;  1IS2 A;  3UBR A;  3Q23 A;  3X29 A;  3GNC A;  4V25 A;  1QDB A;  2EC5 A;  4FZ4 A;  1FS7 A;  1X91 A;  2YYJ A;  1GU6 A;  3MPJ A;  4M9A A;  4WJY A;  2VF1 A;  3NF4 A;  4W9U A;  3OIB A;  4AKH A;  3VKH A;  1GKZ A;  4LQS B;  3TOR A;  4E00 A;  2LFW A;  4DZY A;  2DDH A;  2VIG A;  5B5V A;  4IRN A;  1K90 A;  3UU9 A;  3Q24 A;  3N0R A;  3FCJ A;  3R7K A;  2J7A A;  4KTO A;  4FF2 A;  4KS9 A;  1JM6 A;  2CJ7 A;  2ZDX A;  2YYM A;  3C2P A;  1IVH A;  2R0N A;  2EBA A;  4H85 A;  3TZ4 A;  2R0M A;  2E80 A;  4ZXV A;  2BU8 A;  4OO2 A;  1SIQ A;  4L3X A;  5B5W A;  4FF3 A;  3L1T A;  3MXL A;  1EGE A;  2FP1 A;  2OEX A;  4AKI A;  2BU2 A;  2BU7 A;  2ZO5 A;  4N5F A;  5M4K A;  3C3L A;  3D9E A;  3VKG A;  3II9 A;  3PFD A;  1RP3 A;  4MP7 A;  4Q5B A;  1W07 A;  4U83 A;  5J71 A;  3X0Y A;  4X28 A;  2D29 A;  3D2R A;  2AZE A;  2YGW A;  4H7Q A;  3SF6 A;  4DOY A;  4HKS A;  2CJ8 A;  2IX5 A;  2C0U A;  1Y8P A;  2XS8 A;  1BUC A;  4JIZ A;  5BRK A;  4Q1O A;  1Y8N A;  3BNJ A;  3SWO A;  4KSF A;  4H81 A;  4X28 C;  1XFV A;  4HKR A;  2JBS A;  1S26 A;  2R03 A;  2OJQ A;  2R05 A;  3BNF A;  3BNG A;  3CRK A;  2OR0 A;  5M4N A;  2DVL A;  4MP2 A;  3AFE A;  4MPN A;  3RKH A;  3M9V A;  3LGQ A;  2JIF A;  3MDD A;  1XFU A;  2XS1 A;  4MPE A;  4ZYJ A;  4FF1 A;  1XG2 B;  2ZAF A;  1EGD A;  1R2J A;  4JEK A;  2BU6 A;  4P79 A;  4Q17 A;  5K3J A;  1UDY A;  5J6A A;  1K93 A;  3MDE A;  1PI1 A;  3HWC A;  1GKX A;  2XQR B;  2GBB A;  2JBT A;  2EBF X;  2OEV A;  3CRL A;  2UXW A;  2BU5 A;  2CJ6 A;  2RDZ A;  3EON A;  1X8Z A;  4L1F A;  5GJW E;  3GM6 A;  2HJN A;  3D6B A;  2EBH X;  3LG1 A;  3MKH A;  5BRM A;  4LQQ B;  1XFW A;  2R02 A;  4V26 A;  2RF7 A;  3KML A;  5M4P A;  3FO3 A;  3VAD A;  1SIR A;  5K3G A;  2E0A A;  2F6L A;  4O5M A;  3F29 A;  1RX0 A;  1GJV A;  3TZ5 A;  3TTB A;  1UKW A;  1EGC A;  2YYG A;  2JBR A;  4IV6 A;  2OT4 A;  3SCE A;  4XVX A;  3GQT A;  4E02 A;  5B6B A;  3C46 A;  4RM7 A;  4E01 A;  2FON A;  3D9D A;  4L38 A;  4NXL A;  2ZDY A;  4MPC A;  2QR4 A;  3D9G A;  4G97 A;  4P13 A;  4KCF A;  5K3I A;  1U8V A;  2ZKJ A;  2A1T A; 
#chains in the Genus database with same CATH homology
 1R3B A;  5B5V A;  5BRM A;  2HJN A;  4LQS B;  5B5W A;  5BRK A;  4LQQ B;  4J1V A;  1PI1 A;  5B6B A;  4JIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...