1PI6A

Yeast actin interacting protein 1 (aip1), orthorhombic crystal form
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
612
structure length
606
Chain Sequence
SSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDDGDSKVPPVVQFTGHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPISDISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVGDDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTVNPLISGSYDGRIMEWSSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKHEFGSQPKVASANNDGFTAVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQNYVAVGLEEGNTIQVFKLSDLEVSFDLKTPLRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTSRWAFRTSKINAISWKPAEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Actin interacting protein 1
publication title The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 161
structure length 606
sequence length 612
ec nomenclature
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pi6A02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pi6A01
2CE8A 3RN1D 4E54B 3HFQA 5EAMA 4A2MA 2XL3A 4O45A 2G9AA 2H9PA 2H9NA 2BCJB 4X60B 1MG3A 3UVKA 4XEIC 2EBSA 5I5IA 2QXVA 4OZUA 1PEVA 5A2Qg 3JZNA 3EWEA 2PM7B 4ZN4A 2IWFA 3I7OA 5I5JA 3EI4B 2OK4A 3A0FA 3SBQA 1Q47A 2IUVA 4JSVC 4A2LA 4J79A 4QT8A 4NSXA 3V9FA 4A7JA 1SQ9A 3MKQA 3E0CA 3NVQA 4N14A 5H17A 2OVPB 3SVWD 2J55H 4A11A 1OMWB 4J8GA 3SBRA 1K32A 2P9LC 3DM0A 4GGAA 4J87A 5EARA 4O3UB 2BBKH 1SHYB 4PC0A 3IJ0A 2B4EA 4FA9D 3DXKC 3SWSD 4X61B 2J57G 2OVQB 4E5ZB 3SMRA 1JMXB 3CFVA 3JAMg 3UKUC 2Z2OA 5IGQA 2AGXA 2H68A 3U4YA 3KRXB 5EMMB 3I7NA 2IWKA 4GMBA 5TEFA 3SFZA 4ESGA 4CY2A 3EI4A 2CO0C 3ODTA 2AGLA 3C5MA 4JT5C 1MG2A 3EI3B 3JRPA 3ZWLB 4O1QD 2I0TA 2YNOA 5B4WA 4ERZA 1SQJA 2AQ5A 2CE9A 1A0RB 3GFCA 3ORVD 2W18A 3OL2B 5HE2B 3OKWA 2OK6A 5IC7A 4AOWA 4CY1A 4GM9A 4J73A 4XYIA 3I7HA 5EMKB 5H14A 3EU7A 1QNIA 3BWSA 3I8CA 1L0QA 1PI6A 5K19A 4JXMA 5CXBB 4E5ZA 2H13A 2YBAA 3L4MD 4BL0A 3KRWB 4GQ1A 2H14A 2IUQA 3PSLA 5IT9g 3IKOA 3SHFA 4CZYA 3N0EA 3V7DB 3EI2B 2H6NA 3AL8B 4CI3A 1VYHC 2UZXB 2P9UC 5TEEA 3EI3A 4D0KA 1NEXB 4ZOZA 3RRMC 1P22A 3PXSD 1TBGA 3RSEC 1U4CA 2CN2A 2XL2A 4J77A 4HDJA 3UKRC 4LG9A 4CC9A 5AFU3 5EMJB 4L9OA 3J81g 2HESX 3OL2A 2OIZA 4Y5RD 3MZLA 4FAVD 5EAPA 2GC4A 5I5MA 1MDAH 3C99A 5AJAA 4X63B 4EWRA 5HQGA 3CIKB 2HJBA 4BH6A 4L3HD 2HKMA 3N0DA 3IIWA 3PVUB 4Y7RA 1JOFA 4XYHA 5CXBA 5K1CC 4J81A 3V5WB 2I0SA 1GP2B 4FB1D 3UVOA 4CY3A 5IGOA 2HYEA 2XU7A 1N6DA 4E54A 4MK0B 4ZOXA 4H5IA 3EI2A 4GGDA 3AL8A 3PXWD 2I3TA 3RLMD 4O3TB 5IJ8E 2B5LA 4CY5A 2H6KA 2O9KA 3JPXA 3PE7A 1FWXA 4R7AB 5FKSA 1N6FA 3EI1B 4GZ8A 3VH0A 5HE1B 3RN0D 4I79A 2PBIB 2J56H 2CNXA 3MKSB 3RFHA 5C2VB 2B5NA 3JZHA 3IIYA 4H5JA 4L1QD 3DXMC 3SBPA 2H47A 4FA4D 4Z8LA 5EMLB 4GGCA 4ERQA 2AH1A 2I3SA 2CO0A 3F3FA 3PXTD 5FLXg 3EG6A 3SCYA 4UI9R 5SXMA 1YFQA 3UVNA 5FA5B 1XKSA 4A0AB 3RFGA 3NVXA 3I7KA 4K3JB 4BUJC 3JB9L 1K8KC 4X3EA 2H9LA 1JJUB 1R5MA 4JD2C 3BG1A 4A08B 1GG2B 4LGNA 3P4FA 3UVLA 2B5MA 2P9KC 2YB8B 3FGBA 4GM3A 3EI1A 4ES0A 3SXTD 4ERYA 2H6QA 5HYNB 3BG0A 1GOTB 2P9SC 1S4UX 2Z2NA 2MTAH 4QRJA 4K3ID 2HJ4A 5C9ZB 4FHLA 1U2VC 2AGYA 3IJ1A 3SLED 3C9CA 3IJCA 3L4OD 3F3GA 3NVNA 2QC5A 4L3GD 4YVDA 3I2NA 3MMYA 4JT6C 5GXIA 3FM0A 3MZKA 4A09B 3OTTA 4PBZA 2CN3A 5CYKB 2XYIA 3W15A 5EM2B 2GNQA 3OW8A 5THAA 4CI8A 4GM8A 4CI2A 4A0BB 4J8BA 1OLZA 4U1EI 4A0AA 4CZXA 3VA6A 5GXHA 4FA1D 2UZYB 4CI1A 3OKTA 5H1MA 4CZVA 4J86A 5KDOB 4O9DA 5FKTA 4AEZA 4A08A 3DWLC 4PSWB 4D6VA 3C75H 5FKRA 5FXYA 5JWZA 2P9NC 2P9PC 4LG8A 5FKQA 2H3XA 5HE3B 3FRXA 4U7AA 5AMSA 3JZGA 3SJLD 4J0XA 1RI6A 5GMKn 5IJ7E 5EALA 5C2WB 4JSPC 3MXXA 2H9MA 3OKYB 3I7PA 1B9XA 4ZOYA 4A09A 3AH8B 3K27A 2YNNA 3VGZA 2IAAA 4FWWA 1N6EA 2AGWA 5HE0B 5CYKA 2YMUA 2I0RA 5EM2A 3I8EA 2Z2PA 1B9YA 2P9IC 4A0BA 2HKRA 4J78A 5TF2A 4J84A 3I7LA 3GREA 3ULEC 5FQDA 4PNKB 5CXCB 2G99A 2IUPA 3AFCA 4FA5D 3DSMA 3PSCB 4PSXB 3J80g 3AL9A 4IMMA 4ZOVA 3B7FA 2OJYA 2YNPA 2PM9B 4IA9A 4JSXC 3UR4A 3UVMA 2GC7A 4J82A 4GQBB 1ERJA 2TRCB 1JMZB 4JSNC 2HXCA 5GSAA 4G56B 1PGUA 2PM6B 3OKYA 1PBYB 1NR0A 4QL1A 2IURA 4GQ2P 4KFMB 4PXWA 3CFSB 3RMZD 4OWRA 5TDHB 4PBYA 3I89A 5CXCA 3JROA 3F3PA 4J0WA 4TZ4A 4FAND 1GXRA 3PVWB 1XHMA 4QQEA 2OVRB 3EMHA 1TYQC 3K26A 4A11B 2Q7QA 3SN6B 2AGZA 2AH0A 2PM9A 1XIPA
chains in the Genus database with same CATH superfamily
3IUQA 2CE8A 3RN1D 4E54B 3HFQA 5EAMA 4A2MA 2XL3A 4O45A 2G9AA 2H9PA 2EICA 2H9NA 2BCJB 4X60B 4RE5A 1MG3A 3UVKA 4XEIC 2EBSA 5I5IA 2QXVA 4OZUA 1PEVA 5A2Qg 3JZNA 1K3IA 3IUJA 3QHYB 1UOOA 3EWEA 2PM7B 4ZN4A 2IWFA 3I7OA 5I5JA 3EI4B 2OK4A 3A0FA 3EQ8A 3SBQA 1Q47A 2IUVA 4JSVC 5M61A 4A2LA 4J79A 4QT8A 4NSXA 4WK4A 3V9FA 4A7JA 5M5SA 1SQ9A 3MKQA 3E0CA 3NVQA 4N14A 4NBMA 3ZE0A 5H17A 3K71A 2OVPB 3SVWD 1A12A 2J55H 4A11A 1OMWB 2VDRA 3V4VA 4J8GA 3SBRA 1K32A 2P9LC 3DM0A 4GGAA 3K6SA 5C92A 4J87A 5EARA 4DNUA 4O3UB 4BCBA 2BBKH 1SHYB 4PC0A 3IJ0A 2B4EA 4FA9D 3DXKC 3SWSD 4O2WA 4X61B 2J57G 2VDNA 2OVQB 4E5ZB 3SMRA 1JMXB 2XZGA 3CFVA 3JAMg 3UKUC 2Z2OA 5IGQA 2AGXA 2H68A 3U4YA 3IJEA 3KRXB 5EMMB 3I7NA 2IWKA 4GMBA 5TEFA 3SFZA 4NENA 4ESGA 4CY2A 1H2WA 3EI4A 2CO0C 3ODTA 4D9SA 2AGLA 3C5MA 4JT5C 4BP8A 4WK0A 1MG2A 3EI3B 3JRPA 3ZWLB 1YR2A 4O1QD 2I0TA 4BP9A 2YNOA 5B4WA 4ERZA 3IURA 1SQJA 1U8CA 2AQ5A 2CE9A 3FCUA 1A0RB 1H2YA 3GFCA 3ORVD 2W18A 3IVMA 3OL2B 1H2ZA 5HE2B 3OKWA 2OK6A 5IC7A 3O4HA 4AOWA 4CY1A 4GM9A 4J73A 4XYIA 3T3MA 3I7HA 5EMKB 5H14A 3EU7A 1QNIA 3BWSA 3VI3A 3I8CA 1L0QA 1PI6A 1T2XA 5K19A 4JXMA 5CXBB 4WJKA 4E5ZA 2H13A 2YBAA 3L4MD 4BL0A 3KRWB 4GQ1A 2H14A 2IUQA 3PSLA 3T3PA 5IT9g 3NIGA 1UOQA 3IKOA 3QI0A 3SHFA 4CZYA 3N0EA 1O6GA 2HU8A 1E8MA 3V7DB 3MUNA 2H6NA 3EI2B 3AL8B 4CI3A 1VYHC 4Z7NA 2UZXB 1BPOA 2P9UC 5TEEA 1E5TA 3EI3A 4D0KA 1NEXB 4ZOZA 3RRMC 1P22A 3PXSD 1TBGA 3RSEC 1U4CA 2CN2A 2XL2A 4J77A 4HDJA 3UKRC 4LG9A 4CC9A 1H2XA 5AFU3 5EMJB 4L9OA 3J81g 2HESX 3OL2A 2OIZA 4Y5RD 3MZLA 4FAVD 5EAPA 2GC4A 5I5MA 3IULA 1MDAH 3C99A 5AJAA 4X63B 4EWRA 4MMXA 5HQGA 3CIKB 2HJBA 3EQ9A 4BH6A 2VDOA 4L3HD 2HKMA 3N0DA 3IIWA 3PVUB 4Y7RA 1JOFA 1QFSA 4XYHA 5CXBA 5K1CC 4J81A 4QAMA 3V5WB 2I0SA 1JV2A 1GP2B 4FB1D 3UVOA 1C9LA 4CY3A 5IGOA 5E6SA 2HYEA 2XU7A 4O02A 1C9IA 1N6DA 4E54A 4MK0B 4ZOXA 4AN0A 4H5IA 3KCIA 4GGDA 3AL8A 3EI2A 3PXWD 2I3TA 2WQ8A 1TYEA 3RLMD 4O3TB 5IJ8E 2B5LA 4CY5A 1UTCA 2H6KA 2O9KA 3JPXA 1GOGA 3PE7A 1FWXA 4G55A 1GOFA 4IRZA 4R7AB 5FKSA 3ZE2A 1N6FA 4DNVA 2VDLA 3EI1B 2EIEA 3OF7A 4GZ8A 3VH0A 5HE1B 3RN0D 4I79A 2PBIB 2J56H 2CNXA 3MKSB 3RFHA 3NIFA 5C2VB 3O4JA 2B5NA 3JZHA 3IIYA 3K72A 4H5JA 3DXMC 4L1QD 2H47A 3SBPA 4FA4D 4G1MA 4Z8LA 5EMLB 4GGCA 4ERQA 2AH1A 2I3SA 2CO0A 5HDBA 4DNWA 1I2MB 3F3FA 5M5UA 3EQ7A 3PXTD 4AX4A 5FLXg 4JHPC 1GOHA 3EG6A 3SCYA 4UI9R 5M5TA 5SXMA 2VZ1A 3MUOA 1YFQA 3UVNA 5FA5B 1XKSA 4A0AB 3RFGA 3NVXA 3I7KA 4K3JB 1E8NA 4BUJC 3JB9L 1K8KC 4X3EA 4NAAA 2EIBA 2H9LA 1JJUB 1R5MA 4JD2C 3BG1A 4A08B 1GG2B 4LGNA 4NC4A 3P4FA 3UVLA 2B5MA 2P9KC 2YB8B 3FGBA 4BCCA 4GM3A 3EI1A 4ES0A 3SXTD 4ERYA 4MMZA 2H6QA 5HYNB 4L1MA 3BG0A 1GOTB 2P9SC 1S4UX 2Z2NA 3GD1I 2MTAH 4QRJA 3MVDK 4K3ID 2HJ4A 5C9ZB 4FHLA 1U2VC 2AGYA 3IJ1A 3SLED 3C9CA 3IJCA 3IUMA 3L4OD 3F3GA 3NVNA 1JTDB 2QC5A 4L3GD 4AN1A 4YVDA 3I2NA 3MMYA 4JT6C 5GXIA 3FM0A 3MZKA 4A09B 3OTTA 4PBZA 2CN3A 4WK2A 2XE4A 5CYKB 2XYIA 3W15A 1VE6A 5EM2B 2GNQA 3OW8A 5THAA 4CI8A 4GM8A 2XDWA 4CI2A 4A0BB 4J8BA 5E6UA 1OLZA 4AMYA 4U1EI 4A0AA 3ZE1A 4CZXA 3VA6A 5C86A 3ZDYA 4FA1D 5GXHA 2UZYB 4CI1A 3OKTA 5H1MA 2BKLA 4CZVA 2QR5A 4J86A 5KDOB 4O9DA 5FKTA 4AEZA 4A08A 2VDQA 3DWLC 4PSWB 4D6VA 3C75H 5FKRA 5FXYA 5JWZA 2P9NC 3GC3B 2P9PC 2HU5A 4LG8A 5FKQA 2H3XA 5HE3B 2EIDA 3FRXA 4U7AA 5AMSA 3JZGA 3SJLD 4J0XA 4BCDA 1RI6A 5GMKn 5IJ7E 5EALA 5C2WB 2VDKA 1M1XA 4JSPC 3MXXA 2H9MA 1O6FA 3NIDA 3OKYB 3I7PA 1B9XA 3FCSA 4ZOYA 4A09A 3AH8B 3K27A 4UM9A 2YNNA 3VGZA 3VI4A 2IAAA 4FWWA 1N6EA 2AGWA 5HE0B 2HU7A 5CYKA 2YMUA 5M5RA 2I0RA 5EM2A 1VZ2A 3I8EA 2Z2PA 4G1EA 1B9YA 1UOPA 2P9IC 1L5GA 4A0BA 2HKRA 4J78A 5TF2A 4J84A 3I7LA 3GREA 3ULEC 2JKXA 5FQDA 4PNKB 5CXCB 2G99A 2IUPA 3ZDZA 3O4GA 3AFCA 4FA5D 3DSMA 3PSCB 5FFOA 4PSXB 3J80g 3AL9A 4IMMA 4ZOVA 3B7FA 1QFMA 2OJYA 2YNPA 2PM9B 4IA9A 1VE7A 4UM8A 2QZPA 4JSXC 4Z7OA 3UR4A 3UVMA 2GC7A 4J82A 5M5VA 4GQBB 1ERJA 3IUNA 5E6RA 2VC2A 2TRCB 1JMZB 2VDPA 4Z7QA 4JSNC 2HXCA 5GSAA 4G56B 1PGUA 2PM6B 4RE6A 3OKYA 1PBYB 1NR0A 3DDUA 4QL1A 5FFGA 2IURA 3O4IA 4GQ2P 3ZDXA 4KFMB 1VZ3A 4PXWA 3CFSB 3RMZD 4OWRA 5TDHB 4PBYA 3I89A 5CXCA 2VDMA 4JHNA 3JROA 3F3PA 4J0WA 2VZ3A 4TZ4A 3V4PA 4FAND 1GXRA 3PVWB 4AMZA 1XHMA 4MMYA 4QQEA 2OVRB 3EMHA 1TYQC 3K26A 4A11B 2Q7QA 3SN6B 2AGZA 2AH0A 2PM9A 1XIPA
chains in the Genus database with same CATH topology
2CE8A 3RN1D 4E54B 3HFQA 5EAMA 4A2MA 2XL3A 4O45A 2G9AA 2H9PA 2H9NA 2BCJB 4X60B 1MG3A 3UVKA 4XEIC 2EBSA 5I5IA 2QXVA 4OZUA 1PEVA 5A2Qg 3JZNA 3EWEA 2PM7B 4ZN4A 2IWFA 3I7OA 5I5JA 3EI4B 2OK4A 3A0FA 3SBQA 1Q47A 2IUVA 4JSVC 4A2LA 4J79A 4QT8A 4NSXA 3V9FA 4A7JA 1SQ9A 3MKQA 3E0CA 3NVQA 4N14A 5H17A 2OVPB 3SVWD 2J55H 4A11A 1OMWB 4J8GA 3SBRA 1K32A 2P9LC 3DM0A 4GGAA 4J87A 5EARA 4O3UB 2BBKH 1SHYB 4PC0A 3IJ0A 2B4EA 4FA9D 3DXKC 3SWSD 4X61B 2J57G 2OVQB 4E5ZB 3SMRA 1JMXB 3CFVA 3JAMg 3UKUC 2Z2OA 5IGQA 2AGXA 2H68A 3U4YA 3KRXB 5EMMB 3I7NA 2IWKA 4GMBA 5TEFA 3SFZA 4ESGA 4CY2A 3EI4A 2CO0C 3ODTA 2AGLA 3C5MA 4JT5C 1MG2A 3EI3B 3JRPA 3ZWLB 4O1QD 2I0TA 2YNOA 5B4WA 4ERZA 1SQJA 2AQ5A 2CE9A 1A0RB 3GFCA 3ORVD 2W18A 3OL2B 5HE2B 3OKWA 2OK6A 5IC7A 4AOWA 4CY1A 4GM9A 4J73A 4XYIA 3I7HA 5EMKB 5H14A 3EU7A 1QNIA 3BWSA 3I8CA 1L0QA 1PI6A 5K19A 4JXMA 5CXBB 4E5ZA 2H13A 2YBAA 3L4MD 4BL0A 3KRWB 4GQ1A 2H14A 2IUQA 3PSLA 5IT9g 3IKOA 3SHFA 4CZYA 3N0EA 3V7DB 3EI2B 2H6NA 3AL8B 4CI3A 1VYHC 2UZXB 2P9UC 5TEEA 3EI3A 4D0KA 1NEXB 4ZOZA 3RRMC 1P22A 3PXSD 1TBGA 3RSEC 1U4CA 2CN2A 2XL2A 4J77A 4HDJA 3UKRC 4LG9A 4CC9A 5AFU3 5EMJB 4L9OA 3J81g 2HESX 3OL2A 2OIZA 4Y5RD 3MZLA 4FAVD 5EAPA 2GC4A 5I5MA 1MDAH 3C99A 5AJAA 4X63B 4EWRA 5HQGA 3CIKB 2HJBA 4BH6A 4L3HD 2HKMA 3N0DA 3IIWA 3PVUB 4Y7RA 1JOFA 4XYHA 5CXBA 5K1CC 4J81A 3V5WB 2I0SA 1GP2B 4FB1D 3UVOA 4CY3A 5IGOA 2HYEA 2XU7A 1N6DA 4E54A 4MK0B 4ZOXA 4H5IA 3EI2A 4GGDA 3AL8A 3PXWD 2I3TA 3RLMD 4O3TB 5IJ8E 2B5LA 4CY5A 2H6KA 2O9KA 3JPXA 3PE7A 1FWXA 4R7AB 5FKSA 1N6FA 3EI1B 4GZ8A 3VH0A 5HE1B 3RN0D 4I79A 2PBIB 2J56H 2CNXA 3MKSB 3RFHA 5C2VB 2B5NA 3JZHA 3IIYA 4H5JA 4L1QD 3DXMC 3SBPA 2H47A 4FA4D 4Z8LA 5EMLB 4GGCA 4ERQA 2AH1A 2I3SA 2CO0A 3F3FA 3PXTD 5FLXg 3EG6A 3SCYA 4UI9R 5SXMA 1YFQA 3UVNA 5FA5B 1XKSA 4A0AB 3RFGA 3NVXA 3I7KA 4K3JB 4BUJC 3JB9L 1K8KC 4X3EA 2H9LA 1JJUB 1R5MA 4JD2C 3BG1A 4A08B 1GG2B 4LGNA 3P4FA 3UVLA 2B5MA 2P9KC 2YB8B 3FGBA 4GM3A 3EI1A 4ES0A 3SXTD 4ERYA 2H6QA 5HYNB 3BG0A 1GOTB 2P9SC 1S4UX 2Z2NA 2MTAH 4QRJA 4K3ID 2HJ4A 5C9ZB 4FHLA 1U2VC 2AGYA 3IJ1A 3SLED 3C9CA 3IJCA 3L4OD 3F3GA 3NVNA 2QC5A 4L3GD 4YVDA 3I2NA 3MMYA 4JT6C 5GXIA 3FM0A 3MZKA 4A09B 3OTTA 4PBZA 2CN3A 5CYKB 2XYIA 3W15A 5EM2B 2GNQA 3OW8A 5THAA 4CI8A 4GM8A 4CI2A 4A0BB 4J8BA 1OLZA 4U1EI 4A0AA 4CZXA 3VA6A 5GXHA 4FA1D 2UZYB 4CI1A 3OKTA 5H1MA 4CZVA 4J86A 5KDOB 4O9DA 5FKTA 4AEZA 4A08A 3DWLC 4PSWB 4D6VA 3C75H 5FKRA 5FXYA 5JWZA 2P9NC 2P9PC 4LG8A 5FKQA 2H3XA 5HE3B 3FRXA 4U7AA 5AMSA 3JZGA 3SJLD 4J0XA 1RI6A 5GMKn 5IJ7E 5EALA 5C2WB 4JSPC 3MXXA 2H9MA 3OKYB 3I7PA 1B9XA 4ZOYA 4A09A 3AH8B 3K27A 2YNNA 3VGZA 2IAAA 4FWWA 1N6EA 2AGWA 5HE0B 5CYKA 2YMUA 2I0RA 5EM2A 3I8EA 2Z2PA 1B9YA 2P9IC 4A0BA 2HKRA 4J78A 5TF2A 4J84A 3I7LA 3GREA 3ULEC 5FQDA 4PNKB 5CXCB 2G99A 2IUPA 3AFCA 4FA5D 3DSMA 3PSCB 4PSXB 3J80g 3AL9A 4IMMA 4ZOVA 3B7FA 2OJYA 2YNPA 2PM9B 4IA9A 4JSXC 3UR4A 3UVMA 2GC7A 4J82A 4GQBB 1ERJA 2TRCB 1JMZB 4JSNC 2HXCA 5GSAA 4G56B 1PGUA 2PM6B 3OKYA 1PBYB 1NR0A 4QL1A 2IURA 4GQ2P 4KFMB 4PXWA 3CFSB 3RMZD 4OWRA 5TDHB 4PBYA 3I89A 5CXCA 3JROA 3F3PA 4J0WA 4TZ4A 4FAND 1GXRA 3PVWB 1XHMA 4QQEA 2OVRB 3EMHA 1TYQC 3K26A 4A11B 2Q7QA 3SN6B 2AGZA 2AH0A 2PM9A 1XIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CE8 A;  3RN1 D;  4E54 B;  3HFQ A;  5EAM A;  4A2M A;  2XL3 A;  4O45 A;  2G9A A;  2H9P A;  2H9N A;  2BCJ B;  4X60 B;  1MG3 A;  3UVK A;  4XEI C;  2EBS A;  5I5I A;  2QXV A;  4OZU A;  1PEV A;  5A2Q g;  3JZN A;  3EWE A;  2PM7 B;  4ZN4 A;  2IWF A;  3I7O A;  5I5J A;  3EI4 B;  2OK4 A;  3A0F A;  3SBQ A;  1Q47 A;  2IUV A;  4JSV C;  4A2L A;  4J79 A;  4QT8 A;  4NSX A;  3V9F A;  4A7J A;  1SQ9 A;  3MKQ A;  3E0C A;  3NVQ A;  4N14 A;  5H17 A;  2OVP B;  3SVW D;  2J55 H;  4A11 A;  1OMW B;  4J8G A;  3SBR A;  1K32 A;  2P9L C;  3DM0 A;  4GGA A;  4J87 A;  5EAR A;  4O3U B;  2BBK H;  1SHY B;  4PC0 A;  3IJ0 A;  2B4E A;  4FA9 D;  3DXK C;  3SWS D;  4X61 B;  2J57 G;  2OVQ B;  4E5Z B;  3SMR A;  1JMX B;  3CFV A;  3JAM g;  3UKU C;  2Z2O A;  5IGQ A;  2AGX A;  2H68 A;  3U4Y A;  3KRX B;  5EMM B;  3I7N A;  2IWK A;  4GMB A;  5TEF A;  3SFZ A;  4ESG A;  4CY2 A;  3EI4 A;  2CO0 C;  3ODT A;  2AGL A;  3C5M A;  4JT5 C;  1MG2 A;  3EI3 B;  3JRP A;  3ZWL B;  4O1Q D;  2I0T A;  2YNO A;  5B4W A;  4ERZ A;  1SQJ A;  2AQ5 A;  2CE9 A;  1A0R B;  3GFC A;  3ORV D;  2W18 A;  3OL2 B;  5HE2 B;  3OKW A;  2OK6 A;  5IC7 A;  4AOW A;  4CY1 A;  4GM9 A;  4J73 A;  4XYI A;  3I7H A;  5EMK B;  5H14 A;  3EU7 A;  1QNI A;  3BWS A;  3I8C A;  1L0Q A;  1PI6 A;  5K19 A;  4JXM A;  5CXB B;  4E5Z A;  2H13 A;  2YBA A;  3L4M D;  4BL0 A;  3KRW B;  4GQ1 A;  2H14 A;  2IUQ A;  3PSL A;  5IT9 g;  3IKO A;  3SHF A;  4CZY A;  3N0E A;  3V7D B;  3EI2 B;  2H6N A;  3AL8 B;  4CI3 A;  1VYH C;  2UZX B;  2P9U C;  5TEE A;  3EI3 A;  4D0K A;  1NEX B;  4ZOZ A;  3RRM C;  1P22 A;  3PXS D;  1TBG A;  3RSE C;  1U4C A;  2CN2 A;  2XL2 A;  4J77 A;  4HDJ A;  3UKR C;  4LG9 A;  4CC9 A;  5AFU 3;  5EMJ B;  4L9O A;  3J81 g;  2HES X;  3OL2 A;  2OIZ A;  4Y5R D;  3MZL A;  4FAV D;  5EAP A;  2GC4 A;  5I5M A;  1MDA H;  3C99 A;  5AJA A;  4X63 B;  4EWR A;  5HQG A;  3CIK B;  2HJB A;  4BH6 A;  4L3H D;  2HKM A;  3N0D A;  3IIW A;  3PVU B;  4Y7R A;  1JOF A;  4XYH A;  5CXB A;  5K1C C;  4J81 A;  3V5W B;  2I0S A;  1GP2 B;  4FB1 D;  3UVO A;  4CY3 A;  5IGO A;  2HYE A;  2XU7 A;  1N6D A;  4E54 A;  4MK0 B;  4ZOX A;  4H5I A;  3EI2 A;  4GGD A;  3AL8 A;  3PXW D;  2I3T A;  3RLM D;  4O3T B;  5IJ8 E;  2B5L A;  4CY5 A;  2H6K A;  2O9K A;  3JPX A;  3PE7 A;  1FWX A;  4R7A B;  5FKS A;  1N6F A;  3EI1 B;  4GZ8 A;  3VH0 A;  5HE1 B;  3RN0 D;  4I79 A;  2PBI B;  2J56 H;  2CNX A;  3MKS B;  3RFH A;  5C2V B;  2B5N A;  3JZH A;  3IIY A;  4H5J A;  4L1Q D;  3DXM C;  3SBP A;  2H47 A;  4FA4 D;  4Z8L A;  5EML B;  4GGC A;  4ERQ A;  2AH1 A;  2I3S A;  2CO0 A;  3F3F A;  3PXT D;  5FLX g;  3EG6 A;  3SCY A;  4UI9 R;  5SXM A;  1YFQ A;  3UVN A;  5FA5 B;  1XKS A;  4A0A B;  3RFG A;  3NVX A;  3I7K A;  4K3J B;  4BUJ C;  3JB9 L;  1K8K C;  4X3E A;  2H9L A;  1JJU B;  1R5M A;  4JD2 C;  3BG1 A;  4A08 B;  1GG2 B;  4LGN A;  3P4F A;  3UVL A;  2B5M A;  2P9K C;  2YB8 B;  3FGB A;  4GM3 A;  3EI1 A;  4ES0 A;  3SXT D;  4ERY A;  2H6Q A;  5HYN B;  3BG0 A;  1GOT B;  2P9S C;  1S4U X;  2Z2N A;  2MTA H;  4QRJ A;  4K3I D;  2HJ4 A;  5C9Z B;  4FHL A;  1U2V C;  2AGY A;  3IJ1 A;  3SLE D;  3C9C A;  3IJC A;  3L4O D;  3F3G A;  3NVN A;  2QC5 A;  4L3G D;  4YVD A;  3I2N A;  3MMY A;  4JT6 C;  5GXI A;  3FM0 A;  3MZK A;  4A09 B;  3OTT A;  4PBZ A;  2CN3 A;  5CYK B;  2XYI A;  3W15 A;  5EM2 B;  2GNQ A;  3OW8 A;  5THA A;  4CI8 A;  4GM8 A;  4CI2 A;  4A0B B;  4J8B A;  1OLZ A;  4U1E I;  4A0A A;  4CZX A;  3VA6 A;  5GXH A;  4FA1 D;  2UZY B;  4CI1 A;  3OKT A;  5H1M A;  4CZV A;  4J86 A;  5KDO B;  4O9D A;  5FKT A;  4AEZ A;  4A08 A;  3DWL C;  4PSW B;  4D6V A;  3C75 H;  5FKR A;  5FXY A;  5JWZ A;  2P9N C;  2P9P C;  4LG8 A;  5FKQ A;  2H3X A;  5HE3 B;  3FRX A;  4U7A A;  5AMS A;  3JZG A;  3SJL D;  4J0X A;  1RI6 A;  5GMK n;  5IJ7 E;  5EAL A;  5C2W B;  4JSP C;  3MXX A;  2H9M A;  3OKY B;  3I7P A;  1B9X A;  4ZOY A;  4A09 A;  3AH8 B;  3K27 A;  2YNN A;  3VGZ A;  2IAA A;  4FWW A;  1N6E A;  2AGW A;  5HE0 B;  5CYK A;  2YMU A;  2I0R A;  5EM2 A;  3I8E A;  2Z2P A;  1B9Y A;  2P9I C;  4A0B A;  2HKR A;  4J78 A;  5TF2 A;  4J84 A;  3I7L A;  3GRE A;  3ULE C;  5FQD A;  4PNK B;  5CXC B;  2G99 A;  2IUP A;  3AFC A;  4FA5 D;  3DSM A;  3PSC B;  4PSX B;  3J80 g;  3AL9 A;  4IMM A;  4ZOV A;  3B7F A;  2OJY A;  2YNP A;  2PM9 B;  4IA9 A;  4JSX C;  3UR4 A;  3UVM A;  2GC7 A;  4J82 A;  4GQB B;  1ERJ A;  2TRC B;  1JMZ B;  4JSN C;  2HXC A;  5GSA A;  4G56 B;  1PGU A;  2PM6 B;  3OKY A;  1PBY B;  1NR0 A;  4QL1 A;  2IUR A;  4GQ2 P;  4KFM B;  4PXW A;  3CFS B;  3RMZ D;  4OWR A;  5TDH B;  4PBY A;  3I89 A;  5CXC A;  3JRO A;  3F3P A;  4J0W A;  4TZ4 A;  4FAN D;  1GXR A;  3PVW B;  1XHM A;  4QQE A;  2OVR B;  3EMH A;  1TYQ C;  3K26 A;  4A11 B;  2Q7Q A;  3SN6 B;  2AGZ A;  2AH0 A;  2PM9 A;  1XIP A; 
#chains in the Genus database with same CATH topology
 3IUQ A;  2CE8 A;  3RN1 D;  4E54 B;  3HFQ A;  5EAM A;  4A2M A;  2XL3 A;  4O45 A;  2G9A A;  2H9P A;  2EIC A;  2H9N A;  2BCJ B;  4X60 B;  4RE5 A;  1MG3 A;  3UVK A;  4XEI C;  2EBS A;  5I5I A;  2QXV A;  4OZU A;  1PEV A;  5A2Q g;  3JZN A;  1K3I A;  3IUJ A;  3QHY B;  1UOO A;  3EWE A;  2PM7 B;  4ZN4 A;  2IWF A;  3I7O A;  5I5J A;  3EI4 B;  2OK4 A;  3A0F A;  3EQ8 A;  3SBQ A;  1Q47 A;  2IUV A;  4JSV C;  5M61 A;  4A2L A;  4J79 A;  4QT8 A;  4NSX A;  4WK4 A;  3V9F A;  4A7J A;  5M5S A;  1SQ9 A;  3MKQ A;  3E0C A;  3NVQ A;  4N14 A;  4NBM A;  3ZE0 A;  5H17 A;  3K71 A;  2OVP B;  3SVW D;  1A12 A;  2J55 H;  4A11 A;  1OMW B;  2VDR A;  3V4V A;  4J8G A;  3SBR A;  1K32 A;  2P9L C;  3DM0 A;  4GGA A;  3K6S A;  5C92 A;  4J87 A;  5EAR A;  4DNU A;  4O3U B;  4BCB A;  2BBK H;  1SHY B;  4PC0 A;  3IJ0 A;  2B4E A;  4FA9 D;  3DXK C;  3SWS D;  4O2W A;  4X61 B;  2J57 G;  2VDN A;  2OVQ B;  4E5Z B;  3SMR A;  1JMX B;  2XZG A;  3CFV A;  3JAM g;  3UKU C;  2Z2O A;  5IGQ A;  2AGX A;  2H68 A;  3U4Y A;  3IJE A;  3KRX B;  5EMM B;  3I7N A;  2IWK A;  4GMB A;  5TEF A;  3SFZ A;  4NEN A;  4ESG A;  4CY2 A;  1H2W A;  3EI4 A;  2CO0 C;  3ODT A;  4D9S A;  2AGL A;  3C5M A;  4JT5 C;  4BP8 A;  4WK0 A;  1MG2 A;  3EI3 B;  3JRP A;  3ZWL B;  1YR2 A;  4O1Q D;  2I0T A;  4BP9 A;  2YNO A;  5B4W A;  4ERZ A;  3IUR A;  1SQJ A;  1U8C A;  2AQ5 A;  2CE9 A;  3FCU A;  1A0R B;  1H2Y A;  3GFC A;  3ORV D;  2W18 A;  3IVM A;  3OL2 B;  1H2Z A;  5HE2 B;  3OKW A;  2OK6 A;  5IC7 A;  3O4H A;  4AOW A;  4CY1 A;  4GM9 A;  4J73 A;  4XYI A;  3T3M A;  3I7H A;  5EMK B;  5H14 A;  3EU7 A;  1QNI A;  3BWS A;  3VI3 A;  3I8C A;  1L0Q A;  1PI6 A;  1T2X A;  5K19 A;  4JXM A;  5CXB B;  4WJK A;  4E5Z A;  2H13 A;  2YBA A;  3L4M D;  4BL0 A;  3KRW B;  4GQ1 A;  2H14 A;  2IUQ A;  3PSL A;  3T3P A;  5IT9 g;  3NIG A;  1UOQ A;  3IKO A;  3QI0 A;  3SHF A;  4CZY A;  3N0E A;  1O6G A;  2HU8 A;  1E8M A;  3V7D B;  3MUN A;  2H6N A;  3EI2 B;  3AL8 B;  4CI3 A;  1VYH C;  4Z7N A;  2UZX B;  1BPO A;  2P9U C;  5TEE A;  1E5T A;  3EI3 A;  4D0K A;  1NEX B;  4ZOZ A;  3RRM C;  1P22 A;  3PXS D;  1TBG A;  3RSE C;  1U4C A;  2CN2 A;  2XL2 A;  4J77 A;  4HDJ A;  3UKR C;  4LG9 A;  4CC9 A;  1H2X A;  5AFU 3;  5EMJ B;  4L9O A;  3J81 g;  2HES X;  3OL2 A;  2OIZ A;  4Y5R D;  3MZL A;  4FAV D;  5EAP A;  2GC4 A;  5I5M A;  3IUL A;  1MDA H;  3C99 A;  5AJA A;  4X63 B;  4EWR A;  4MMX A;  5HQG A;  3CIK B;  2HJB A;  3EQ9 A;  4BH6 A;  2VDO A;  4L3H D;  2HKM A;  3N0D A;  3IIW A;  3PVU B;  4Y7R A;  1JOF A;  1QFS A;  4XYH A;  5CXB A;  5K1C C;  4J81 A;  4QAM A;  3V5W B;  2I0S A;  1JV2 A;  1GP2 B;  4FB1 D;  3UVO A;  1C9L A;  4CY3 A;  5IGO A;  5E6S A;  2HYE A;  2XU7 A;  4O02 A;  1C9I A;  1N6D A;  4E54 A;  4MK0 B;  4ZOX A;  4AN0 A;  4H5I A;  3KCI A;  4GGD A;  3AL8 A;  3EI2 A;  3PXW D;  2I3T A;  2WQ8 A;  1TYE A;  3RLM D;  4O3T B;  5IJ8 E;  2B5L A;  4CY5 A;  1UTC A;  2H6K A;  2O9K A;  3JPX A;  1GOG A;  3PE7 A;  1FWX A;  4G55 A;  1GOF A;  4IRZ A;  4R7A B;  5FKS A;  3ZE2 A;  1N6F A;  4DNV A;  2VDL A;  3EI1 B;  2EIE A;  3OF7 A;  4GZ8 A;  3VH0 A;  5HE1 B;  3RN0 D;  4I79 A;  2PBI B;  2J56 H;  2CNX A;  3MKS B;  3RFH A;  3NIF A;  5C2V B;  3O4J A;  2B5N A;  3JZH A;  3IIY A;  3K72 A;  4H5J A;  3DXM C;  4L1Q D;  2H47 A;  3SBP A;  4FA4 D;  4G1M A;  4Z8L A;  5EML B;  4GGC A;  4ERQ A;  2AH1 A;  2I3S A;  2CO0 A;  5HDB A;  4DNW A;  1I2M B;  3F3F A;  5M5U A;  3EQ7 A;  3PXT D;  4AX4 A;  5FLX g;  4JHP C;  1GOH A;  3EG6 A;  3SCY A;  4UI9 R;  5M5T A;  5SXM A;  2VZ1 A;  3MUO A;  1YFQ A;  3UVN A;  5FA5 B;  1XKS A;  4A0A B;  3RFG A;  3NVX A;  3I7K A;  4K3J B;  1E8N A;  4BUJ C;  3JB9 L;  1K8K C;  4X3E A;  4NAA A;  2EIB A;  2H9L A;  1JJU B;  1R5M A;  4JD2 C;  3BG1 A;  4A08 B;  1GG2 B;  4LGN A;  4NC4 A;  3P4F A;  3UVL A;  2B5M A;  2P9K C;  2YB8 B;  3FGB A;  4BCC A;  4GM3 A;  3EI1 A;  4ES0 A;  3SXT D;  4ERY A;  4MMZ A;  2H6Q A;  5HYN B;  4L1M A;  3BG0 A;  1GOT B;  2P9S C;  1S4U X;  2Z2N A;  3GD1 I;  2MTA H;  4QRJ A;  3MVD K;  4K3I D;  2HJ4 A;  5C9Z B;  4FHL A;  1U2V C;  2AGY A;  3IJ1 A;  3SLE D;  3C9C A;  3IJC A;  3IUM A;  3L4O D;  3F3G A;  3NVN A;  1JTD B;  2QC5 A;  4L3G D;  4AN1 A;  4YVD A;  3I2N A;  3MMY A;  4JT6 C;  5GXI A;  3FM0 A;  3MZK A;  4A09 B;  3OTT A;  4PBZ A;  2CN3 A;  4WK2 A;  2XE4 A;  5CYK B;  2XYI A;  3W15 A;  1VE6 A;  5EM2 B;  2GNQ A;  3OW8 A;  5THA A;  4CI8 A;  4GM8 A;  2XDW A;  4CI2 A;  4A0B B;  4J8B A;  5E6U A;  1OLZ A;  4AMY A;  4U1E I;  4A0A A;  3ZE1 A;  4CZX A;  3VA6 A;  5C86 A;  3ZDY A;  4FA1 D;  5GXH A;  2UZY B;  4CI1 A;  3OKT A;  5H1M A;  2BKL A;  4CZV A;  2QR5 A;  4J86 A;  5KDO B;  4O9D A;  5FKT A;  4AEZ A;  4A08 A;  2VDQ A;  3DWL C;  4PSW B;  4D6V A;  3C75 H;  5FKR A;  5FXY A;  5JWZ A;  2P9N C;  3GC3 B;  2P9P C;  2HU5 A;  4LG8 A;  5FKQ A;  2H3X A;  5HE3 B;  2EID A;  3FRX A;  4U7A A;  5AMS A;  3JZG A;  3SJL D;  4J0X A;  4BCD A;  1RI6 A;  5GMK n;  5IJ7 E;  5EAL A;  5C2W B;  2VDK A;  1M1X A;  4JSP C;  3MXX A;  2H9M A;  1O6F A;  3NID A;  3OKY B;  3I7P A;  1B9X A;  3FCS A;  4ZOY A;  4A09 A;  3AH8 B;  3K27 A;  4UM9 A;  2YNN A;  3VGZ A;  3VI4 A;  2IAA A;  4FWW A;  1N6E A;  2AGW A;  5HE0 B;  2HU7 A;  5CYK A;  2YMU A;  5M5R A;  2I0R A;  5EM2 A;  1VZ2 A;  3I8E A;  2Z2P A;  4G1E A;  1B9Y A;  1UOP A;  2P9I C;  1L5G A;  4A0B A;  2HKR A;  4J78 A;  5TF2 A;  4J84 A;  3I7L A;  3GRE A;  3ULE C;  2JKX A;  5FQD A;  4PNK B;  5CXC B;  2G99 A;  2IUP A;  3ZDZ A;  3O4G A;  3AFC A;  4FA5 D;  3DSM A;  3PSC B;  5FFO A;  4PSX B;  3J80 g;  3AL9 A;  4IMM A;  4ZOV A;  3B7F A;  1QFM A;  2OJY A;  2YNP A;  2PM9 B;  4IA9 A;  1VE7 A;  4UM8 A;  2QZP A;  4JSX C;  4Z7O A;  3UR4 A;  3UVM A;  2GC7 A;  4J82 A;  5M5V A;  4GQB B;  1ERJ A;  3IUN A;  5E6R A;  2VC2 A;  2TRC B;  1JMZ B;  2VDP A;  4Z7Q A;  4JSN C;  2HXC A;  5GSA A;  4G56 B;  1PGU A;  2PM6 B;  4RE6 A;  3OKY A;  1PBY B;  1NR0 A;  3DDU A;  4QL1 A;  5FFG A;  2IUR A;  3O4I A;  4GQ2 P;  3ZDX A;  4KFM B;  1VZ3 A;  4PXW A;  3CFS B;  3RMZ D;  4OWR A;  5TDH B;  4PBY A;  3I89 A;  5CXC A;  2VDM A;  4JHN A;  3JRO A;  3F3P A;  4J0W A;  2VZ3 A;  4TZ4 A;  3V4P A;  4FAN D;  1GXR A;  3PVW B;  4AMZ A;  1XHM A;  4MMY A;  4QQE A;  2OVR B;  3EMH A;  1TYQ C;  3K26 A;  4A11 B;  2Q7Q A;  3SN6 B;  2AGZ A;  2AH0 A;  2PM9 A;  1XIP A; 
#chains in the Genus database with same CATH homology
 2CE8 A;  3RN1 D;  4E54 B;  3HFQ A;  5EAM A;  4A2M A;  2XL3 A;  4O45 A;  2G9A A;  2H9P A;  2H9N A;  2BCJ B;  4X60 B;  1MG3 A;  3UVK A;  4XEI C;  2EBS A;  5I5I A;  2QXV A;  4OZU A;  1PEV A;  5A2Q g;  3JZN A;  3EWE A;  2PM7 B;  4ZN4 A;  2IWF A;  3I7O A;  5I5J A;  3EI4 B;  2OK4 A;  3A0F A;  3SBQ A;  1Q47 A;  2IUV A;  4JSV C;  4A2L A;  4J79 A;  4QT8 A;  4NSX A;  3V9F A;  4A7J A;  1SQ9 A;  3MKQ A;  3E0C A;  3NVQ A;  4N14 A;  5H17 A;  2OVP B;  3SVW D;  2J55 H;  4A11 A;  1OMW B;  4J8G A;  3SBR A;  1K32 A;  2P9L C;  3DM0 A;  4GGA A;  4J87 A;  5EAR A;  4O3U B;  2BBK H;  1SHY B;  4PC0 A;  3IJ0 A;  2B4E A;  4FA9 D;  3DXK C;  3SWS D;  4X61 B;  2J57 G;  2OVQ B;  4E5Z B;  3SMR A;  1JMX B;  3CFV A;  3JAM g;  3UKU C;  2Z2O A;  5IGQ A;  2AGX A;  2H68 A;  3U4Y A;  3KRX B;  5EMM B;  3I7N A;  2IWK A;  4GMB A;  5TEF A;  3SFZ A;  4ESG A;  4CY2 A;  3EI4 A;  2CO0 C;  3ODT A;  2AGL A;  3C5M A;  4JT5 C;  1MG2 A;  3EI3 B;  3JRP A;  3ZWL B;  4O1Q D;  2I0T A;  2YNO A;  5B4W A;  4ERZ A;  1SQJ A;  2AQ5 A;  2CE9 A;  1A0R B;  3GFC A;  3ORV D;  2W18 A;  3OL2 B;  5HE2 B;  3OKW A;  2OK6 A;  5IC7 A;  4AOW A;  4CY1 A;  4GM9 A;  4J73 A;  4XYI A;  3I7H A;  5EMK B;  5H14 A;  3EU7 A;  1QNI A;  3BWS A;  3I8C A;  1L0Q A;  1PI6 A;  5K19 A;  4JXM A;  5CXB B;  4E5Z A;  2H13 A;  2YBA A;  3L4M D;  4BL0 A;  3KRW B;  4GQ1 A;  2H14 A;  2IUQ A;  3PSL A;  5IT9 g;  3IKO A;  3SHF A;  4CZY A;  3N0E A;  3V7D B;  3EI2 B;  2H6N A;  3AL8 B;  4CI3 A;  1VYH C;  2UZX B;  2P9U C;  5TEE A;  3EI3 A;  4D0K A;  1NEX B;  4ZOZ A;  3RRM C;  1P22 A;  3PXS D;  1TBG A;  3RSE C;  1U4C A;  2CN2 A;  2XL2 A;  4J77 A;  4HDJ A;  3UKR C;  4LG9 A;  4CC9 A;  5AFU 3;  5EMJ B;  4L9O A;  3J81 g;  2HES X;  3OL2 A;  2OIZ A;  4Y5R D;  3MZL A;  4FAV D;  5EAP A;  2GC4 A;  5I5M A;  1MDA H;  3C99 A;  5AJA A;  4X63 B;  4EWR A;  5HQG A;  3CIK B;  2HJB A;  4BH6 A;  4L3H D;  2HKM A;  3N0D A;  3IIW A;  3PVU B;  4Y7R A;  1JOF A;  4XYH A;  5CXB A;  5K1C C;  4J81 A;  3V5W B;  2I0S A;  1GP2 B;  4FB1 D;  3UVO A;  4CY3 A;  5IGO A;  2HYE A;  2XU7 A;  1N6D A;  4E54 A;  4MK0 B;  4ZOX A;  4H5I A;  3EI2 A;  4GGD A;  3AL8 A;  3PXW D;  2I3T A;  3RLM D;  4O3T B;  5IJ8 E;  2B5L A;  4CY5 A;  2H6K A;  2O9K A;  3JPX A;  3PE7 A;  1FWX A;  4R7A B;  5FKS A;  1N6F A;  3EI1 B;  4GZ8 A;  3VH0 A;  5HE1 B;  3RN0 D;  4I79 A;  2PBI B;  2J56 H;  2CNX A;  3MKS B;  3RFH A;  5C2V B;  2B5N A;  3JZH A;  3IIY A;  4H5J A;  4L1Q D;  3DXM C;  3SBP A;  2H47 A;  4FA4 D;  4Z8L A;  5EML B;  4GGC A;  4ERQ A;  2AH1 A;  2I3S A;  2CO0 A;  3F3F A;  3PXT D;  5FLX g;  3EG6 A;  3SCY A;  4UI9 R;  5SXM A;  1YFQ A;  3UVN A;  5FA5 B;  1XKS A;  4A0A B;  3RFG A;  3NVX A;  3I7K A;  4K3J B;  4BUJ C;  3JB9 L;  1K8K C;  4X3E A;  2H9L A;  1JJU B;  1R5M A;  4JD2 C;  3BG1 A;  4A08 B;  1GG2 B;  4LGN A;  3P4F A;  3UVL A;  2B5M A;  2P9K C;  2YB8 B;  3FGB A;  4GM3 A;  3EI1 A;  4ES0 A;  3SXT D;  4ERY A;  2H6Q A;  5HYN B;  3BG0 A;  1GOT B;  2P9S C;  1S4U X;  2Z2N A;  2MTA H;  4QRJ A;  4K3I D;  2HJ4 A;  5C9Z B;  4FHL A;  1U2V C;  2AGY A;  3IJ1 A;  3SLE D;  3C9C A;  3IJC A;  3L4O D;  3F3G A;  3NVN A;  2QC5 A;  4L3G D;  4YVD A;  3I2N A;  3MMY A;  4JT6 C;  5GXI A;  3FM0 A;  3MZK A;  4A09 B;  3OTT A;  4PBZ A;  2CN3 A;  5CYK B;  2XYI A;  3W15 A;  5EM2 B;  2GNQ A;  3OW8 A;  5THA A;  4CI8 A;  4GM8 A;  4CI2 A;  4A0B B;  4J8B A;  1OLZ A;  4U1E I;  4A0A A;  4CZX A;  3VA6 A;  5GXH A;  4FA1 D;  2UZY B;  4CI1 A;  3OKT A;  5H1M A;  4CZV A;  4J86 A;  5KDO B;  4O9D A;  5FKT A;  4AEZ A;  4A08 A;  3DWL C;  4PSW B;  4D6V A;  3C75 H;  5FKR A;  5FXY A;  5JWZ A;  2P9N C;  2P9P C;  4LG8 A;  5FKQ A;  2H3X A;  5HE3 B;  3FRX A;  4U7A A;  5AMS A;  3JZG A;  3SJL D;  4J0X A;  1RI6 A;  5GMK n;  5IJ7 E;  5EAL A;  5C2W B;  4JSP C;  3MXX A;  2H9M A;  3OKY B;  3I7P A;  1B9X A;  4ZOY A;  4A09 A;  3AH8 B;  3K27 A;  2YNN A;  3VGZ A;  2IAA A;  4FWW A;  1N6E A;  2AGW A;  5HE0 B;  5CYK A;  2YMU A;  2I0R A;  5EM2 A;  3I8E A;  2Z2P A;  1B9Y A;  2P9I C;  4A0B A;  2HKR A;  4J78 A;  5TF2 A;  4J84 A;  3I7L A;  3GRE A;  3ULE C;  5FQD A;  4PNK B;  5CXC B;  2G99 A;  2IUP A;  3AFC A;  4FA5 D;  3DSM A;  3PSC B;  4PSX B;  3J80 g;  3AL9 A;  4IMM A;  4ZOV A;  3B7F A;  2OJY A;  2YNP A;  2PM9 B;  4IA9 A;  4JSX C;  3UR4 A;  3UVM A;  2GC7 A;  4J82 A;  4GQB B;  1ERJ A;  2TRC B;  1JMZ B;  4JSN C;  2HXC A;  5GSA A;  4G56 B;  1PGU A;  2PM6 B;  3OKY A;  1PBY B;  1NR0 A;  4QL1 A;  2IUR A;  4GQ2 P;  4KFM B;  4PXW A;  3CFS B;  3RMZ D;  4OWR A;  5TDH B;  4PBY A;  3I89 A;  5CXC A;  3JRO A;  3F3P A;  4J0W A;  4TZ4 A;  4FAN D;  1GXR A;  3PVW B;  1XHM A;  4QQE A;  2OVR B;  3EMH A;  1TYQ C;  3K26 A;  4A11 B;  2Q7Q A;  3SN6 B;  2AGZ A;  2AH0 A;  2PM9 A;  1XIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...