1PI6A

Yeast actin interacting protein 1 (aip1), orthorhombic crystal form
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
612
structure length
606
Chain Sequence
SSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDDGDSKVPPVVQFTGHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPISDISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVGDDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTVNPLISGSYDGRIMEWSSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKHEFGSQPKVASANNDGFTAVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQNYVAVGLEEGNTIQVFKLSDLEVSFDLKTPLRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTSRWAFRTSKINAISWKPAEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Actin interacting protein 1
total genus 161
structure length 606
sequence length 612
ec nomenclature
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pi6A02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pi6A01
5CXCB 1XHMA 5EAMA 2YNPA 4K3JB 4E5ZA 3PSCB 5HYNB 4E54A 2XU7A 4FWWA 3JROA 4J8GA 4CC9A 3B7FA 5AFU3 3A0FA 3ODTA 3CIKB 5SXMA 2PM9B 4A7JA 2PM6B 3W15A 3ULEC 4GZ8A 4AEZA 4OZUA 4FAVD 4K3ID 4A0AB 4FA5D 4JSVC 4PXWA 4JSXC 5H17A 2AH0A 4CY2A 4O9DA 3L4MD 4J0XA 3I7PA 3K27A 3EMHA 5CXCA 3IKOA 4A2MA 4PC0A 3VGZA 4FHLA 4O3TB 2G99A 2OK6A 2I0RA 3RSEC 4LG9A 4ERQA 2W18A 1XKSA 5GXHA 2H9LA 4A0BA 2XYIA 4O45A 3AL8B 4J0WA 2P9PC 5EM2B 4GM9A 1R5MA 3IJCA 4GQ1A 3C99A 4J84A 3I2NA 3L4OD 4JSPC 2HJBA 4QRJA 4A11B 3EI1A 1PI6A 2YB8B 5IGQA 2P9UC 3RN1D 2QC5A 4CY3A 1MDAH 2CN3A 3SVWD 3BG0A 3OKWA 3UR4A 3V7DB 4XYHA 5EM2A 2J55H 3UKRC 2AGLA 1PEVA 1GP2B 3SBPA 3SBRA 4CZYA 4J79A 1NR0A 3V9FA 4E54B 2H68A 2AGXA 3AL8A 2AGWA 5FXYA 3F3PA 4I79A 3I8CA 4BL0A 2P9NC 5I5IA 3AFCA 1SQJA 5I5JA 4A11A 4BUJC 3I7OA 4TZ4A 4ESGA 2AGZA 2Z2NA 3DXMC 5AJAA 2TRCB 5HE2B 5K19A 2UZXB 3SWSD 3IIWA 3K26A 5CXBB 4U7AA 4CI1A 2IUVA 5C9ZB 4ZOXA 1GG2B 4CZVA 3MKQA 2CE8A 4ERZA 2I0SA 4QT8A 3PVWB 4HDJA 1MG3A 3C9CA 2YBAA 3UVKA 4J78A 2MTAH 4GQ2P 2YNNA 4G56B 5GXIA 5FKTA 2P9SC 4AOWA 2IAAA 5C2VB 3MXXA 5H1MA 4ES0A 1K8KC 3UVNA 4Y5RD 1N6EA 2Q7QA 1P22A 5CYKA 1QNIA 4X63B 5FKQA 3EU7A 4ZOZA 3N0DA 2BCJB 4CY1A 2HYEA 2PBIB 3PXWD 2OVRB 3DXKC 4J8BA 3F3FA 3FRXA 2I3SA 4QQEA 1A0RB 4J77A 2J57G 2XL2A 4IMMA 5FQDA 3EI4A 5GMKn 4FB1D 4QL1A 3HFQA 1U4CA 3OKYB 2H14A 3AL9A 2Z2PA 3ZWLB 2OVQB 4A0BB 3PXSD 4PSXB 2B5LA 4R7AB 3RFGA 4L3HD 5IC7A 5EMMB 3DSMA 4CI8A 4BH6A 4GQBB 4PBZA 3KRXB 5TEEA 4JT5C 2QXVA 4J87A 2AH1A 2XL3A 5CYKB 5EALA 4J81A 2CO0C 1ERJA 2AGYA 3VH0A 3EI3B 2CNXA 2I0TA 2PM9A 3PE7A 4L1QD 3FGBA 4GM3A 2BBKH 1RI6A 4H5IA 4L9OA 5IJ8E 4D0KA 3PSLA 3U4YA 3I7KA 4XEIC 1L0QA 2HKRA 5THAA 2IWKA 3PXTD 3BG1A 1FWXA 4CI3A 3J80g 5TF2A 3EG6A 5AMSA 4IA9A 3FM0A 4O3UB 3KRWB 3OW8A 2CN2A 3IJ0A 4X3EA 3RLMD 1GXRA 3MZKA 3I8EA 1JJUB 3JRPA 4A09A 4J73A 3BWSA 4U1EI 4NSXA 1U2VC 4FA1D 4J86A 3DWLC 3EI1B 3MZLA 3CFVA 3JB9L 4ZN4A 1OLZA 5KDOB 5EMJB 2GNQA 2H9MA 4FAND 1TYQC 4GMBA 3SHFA 3V5WB 5IGOA 4LGNA 4MK0B 5HE3B 4FA4D 2PM7B 4L3GD 2G9AA 4UI9R 4OWRA 2CO0A 2H6KA 5FKRA 1JOFA 2AQ5A 4ZOVA 3J81g 2GC7A 4JD2C 3RRMC 2HESX 3IJ1A 3UVLA 1PBYB 4CI2A 3ORVD 4ZOYA 5HE0B 3JZGA 4X60B 5I5MA 5TDHB 1SHYB 3I89A 3OTTA 1Q47A 4JSNC 2YMUA 2H6NA 3JAMg 3SCYA 2J56H 2P9KC 4GM8A 3NVQA 3NVNA 4JT6C 4ERYA 4PSWB 1TBGA 3PVUB 5K1CC 4A2LA 2H9PA 1N6DA 2B5MA 2YNOA 2CE9A 3RFHA 3JZHA 5TEFA 5A2Qg 2HXCA 3I7HA 5HE1B 2H9NA 1SQ9A 4H5JA 1OMWB 4A08A 2O9KA 1N6FA 4FA9D 2IWFA 3JPXA 5JWZA 1B9XA 5FA5B 5FLXg 1XIPA 4Y7RA 3C5MA 3UVMA 5EMLB 5EMKB 3MMYA 3SXTD 2OJYA 2OK4A 3DM0A 5HQGA 3RMZD 2H3XA 2GC4A 3IIYA 1B9YA 4KFMB 5GSAA 2UZYB 3GFCA 3I7LA 4Z8LA 4PNKB 4A08B 3OKYA 3SFZA 3E0CA 3SN6B 3NVXA 2H13A 3F3GA 4E5ZB 4GGCA 5IT9g 3JZNA 4LG8A 2B4EA 2P9LC 3N0EA 1JMXB 4GGDA 3EI4B 4X61B 3EWEA 5H14A 3RN0D 2HJ4A 1MG2A 3SJLD 4D6VA 3UVOA 3OL2A 4PBYA 2HKMA 1VYHC 5C2WB 2H6QA 4O1QD 5B4WA 4JXMA 5FKSA 4GGAA 4YVDA 3EI2A 4XYIA 1JMZB 3SBQA 2IUQA 4CY5A 4A0AA 3OKTA 3P4FA 3EI3A 2IURA 1PGUA 4J82A 5CXBA 3I7NA 2EBSA 1NEXB 5EAPA 1GOTB 2B5NA 1YFQA 1S4UX 2H47A 2OIZA 4EWRA 3SMRA 5EARA 3C75H 3AH8B 4CZXA 3EI2B 2Z2OA 3GREA 3UKUC 3CFSB 3SLED 2P9IC 2OVPB 2IUPA 3VA6A 4A09B 3OL2B 1K32A 2I3TA 4N14A 5IJ7E 3MKSB
chains in the Genus database with same CATH superfamily
5CXCB 1A12A 1XHMA 5EAMA 2YNPA 4K3JB 4E5ZA 3PSCB 5HYNB 1O6FA 4E54A 4AX4A 2XU7A 5M5UA 1H2WA 4FWWA 3JROA 4J8GA 4CC9A 3B7FA 3IJEA 5AFU3 3A0FA 3ODTA 4UM9A 3CIKB 3DDUA 2PM9B 5SXMA 3T3PA 2PM6B 3W15A 4A7JA 3ULEC 1JV2A 4GZ8A 2VZ3A 4AEZA 4OZUA 4FAVD 4K3ID 4A0AB 4FA5D 4JSVC 4PXWA 4JSXC 5H17A 4WK4A 2AH0A 4CY2A 4O9DA 1JTDB 3L4MD 4MMXA 4J0XA 3IUJA 3I7PA 3K27A 3EMHA 5CXCA 3IKOA 4A2MA 4PC0A 3VGZA 4FHLA 4O3TB 2G99A 2JKXA 2OK6A 2I0RA 4BP8A 3RSEC 4LG9A 4AMYA 2W18A 1XKSA 4ERQA 5GXHA 4JHPC 2H9LA 4A0BA 2BKLA 2XYIA 4O45A 3AL8B 4J0WA 2P9PC 5EM2B 4GM9A 3T3MA 1R5MA 3IJCA 4GQ1A 3C99A 4J84A 3I2NA 3L4OD 4JSPC 1UTCA 2HJBA 4QRJA 5E6RA 4A11B 3EI1A 1PI6A 2YB8B 4NENA 3IVMA 5IGQA 2P9UC 3RN1D 4AN0A 2QC5A 4CY3A 1MDAH 2CN3A 4BCBA 3SVWD 3BG0A 3OKWA 1QFMA 3UR4A 3V7DB 4XYHA 5EM2A 3O4GA 2J55H 3UKRC 2AGLA 1GOHA 1PEVA 1GP2B 3SBPA 3SBRA 4CZYA 4J79A 1NR0A 3V9FA 4E54B 2H68A 3GD1I 2AGXA 3AL8A 2AGWA 5FXYA 3F3PA 4I79A 5FFOA 2VC2A 3I8CA 4BL0A 2P9NC 2VDRA 2VDQA 5I5IA 3AFCA 2WQ8A 1O6GA 1SQJA 5I5JA 4A11A 4BUJC 1YR2A 3I7OA 4TZ4A 2XZGA 4ESGA 2AGZA 2VDNA 2Z2NA 4NC4A 3DXMC 5AJAA 2TRCB 5HE2B 3NIDA 5K19A 2UZXB 3SWSD 2HU5A 3IIWA 3K26A 5CXBB 1E8NA 4U7AA 4CI1A 2IUVA 5C9ZB 3ZDZA 5E6UA 4ZOXA 1GG2B 3ZE0A 4CZVA 3ZE1A 2QR5A 3MKQA 5M5VA 2CE8A 4ERZA 4AMZA 2I0SA 4QT8A 3PVWB 4HDJA 1MG3A 3C9CA 2YBAA 1K3IA 3UVKA 3O4IA 2XDWA 4J78A 2MTAH 4GQ2P 2YNNA 4G56B 4O2WA 5GXIA 5FKTA 2P9SC 4AOWA 2IAAA 5C2VB 3MXXA 1L5GA 5H1MA 4ES0A 1K8KC 3UVNA 5M5RA 4Y5RD 1N6EA 2Q7QA 1P22A 5CYKA 1QNIA 4X63B 5FKQA 2VDKA 4QAMA 3EU7A 4ZOZA 3N0DA 2BCJB 3FCSA 4CY1A 2HYEA 2PBIB 3KCIA 3PXWD 2OVRB 4AN1A 3DXKC 4IRZA 4J8BA 3F3FA 3FRXA 1VZ3A 2I3SA 1A0RB 4QQEA 4J77A 2J57G 4RE6A 2XL2A 4IMMA 5FQDA 3EI4A 5GMKn 4FB1D 4QL1A 3HFQA 1U4CA 3OKYB 2H14A 1T2XA 3AL9A 2Z2PA 3ZWLB 2OVQB 4NBMA 3NIFA 4A0BB 3PXSD 4PSXB 1UOPA 4Z7OA 2B5LA 4R7AB 3RFGA 1VE6A 3ZDXA 4L3HD 5IC7A 5EMMB 3DSMA 4CI8A 4BH6A 4GQBB 4PBZA 3KRXB 5TEEA 4JT5C 5M5TA 2QXVA 4BCCA 1E8MA 2EIEA 4J87A 2AH1A 2XL3A 3OF7A 5CYKB 4Z7QA 5EALA 1C9IA 4J81A 2CO0C 1ERJA 4RE5A 2AGYA 3VH0A 3EI3B 2CNXA 2I0TA 2PM9A 3PE7A 4L1QD 4O02A 3K6SA 3FGBA 4Z7NA 3ZDYA 4GM3A 2BBKH 1RI6A 4H5IA 4L9OA 5IJ8E 4D0KA 3PSLA 3U4YA 1H2YA 3I7KA 3QI0A 5C92A 4XEIC 1L0QA 2HKRA 5THAA 1VE7A 2IWKA 3PXTD 3BG1A 1FWXA 4CI3A 3J80g 5TF2A 3EG6A 5AMSA 4IA9A 3FM0A 3O4JA 3EQ7A 1U8CA 4O3UB 3KRWB 3O4HA 3OW8A 3K72A 2CN2A 3IJ0A 4X3EA 3NIGA 2VDOA 3V4VA 4DNUA 2HU8A 3RLMD 1GXRA 3MZKA 1UOQA 3I8EA 3IULA 4DNWA 5HDBA 1JJUB 4L1MA 3GC3B 3JRPA 3ZE2A 4A09A 4J73A 3BWSA 4U1EI 3VI3A 4NSXA 1U2VC 4FA1D 4J86A 3DWLC 3EI1B 3MZLA 3CFVA 3JB9L 4ZN4A 4WK2A 1OLZA 3EQ8A 5KDOB 5EMJB 2GNQA 3IUNA 2H9MA 2EIDA 4FAND 1TYQC 4GMBA 3SHFA 3V5WB 5IGOA 4LGNA 4MK0B 5HE3B 4FA4D 2PM7B 3EQ9A 4L3GD 2G9AA 4UI9R 4OWRA 2CO0A 2H6KA 5FKRA 1JOFA 2AQ5A 4ZOVA 3J81g 2GC7A 4JD2C 3RRMC 2HESX 3IJ1A 3UVLA 1PBYB 2EICA 4CI2A 3ORVD 4ZOYA 5HE0B 3JZGA 4X60B 5I5MA 1QFSA 5TDHB 1SHYB 3I89A 3MUNA 3OTTA 1Q47A 4JSNC 4WJKA 2YMUA 2H6NA 3JAMg 1BPOA 3SCYA 2J56H 2XE4A 2P9KC 5M5SA 4GM8A 2QZPA 3NVQA 3NVNA 4JT6C 4ERYA 4PSWB 1TBGA 3PVUB 5K1CC 4A2LA 1GOGA 1N6DA 2B5MA 2H9PA 2YNOA 2CE9A 3RFHA 3JZHA 5TEFA 5A2Qg 2HXCA 1C9LA 3I7HA 5HE1B 2H9NA 1SQ9A 1H2XA 4H5JA 1OMWB 3FCUA 1GOFA 2VDLA 4A08A 1UOOA 2O9KA 1N6FA 4FA9D 2IWFA 3JPXA 5JWZA 1B9XA 2VDMA 4G1MA 2HU7A 5FA5B 5FLXg 1XIPA 4Y7RA 4MMYA 3C5MA 3UVMA 5EMLB 5EMKB 3MMYA 3SXTD 2OJYA 2OK4A 3DM0A 5HQGA 3RMZD 2H3XA 2GC4A 3IIYA 1B9YA 4KFMB 5GSAA 2UZYB 5FFGA 5C86A 3GFCA 3I7LA 4Z8LA 4PNKB 4A08B 3OKYA 3SFZA 3E0CA 3MVDK 3SN6B 3NVXA 2H13A 3F3GA 4E5ZB 4GGCA 5IT9g 3JZNA 4LG8A 2B4EA 2P9LC 2EIBA 3N0EA 3QHYB 1JMXB 4GGDA 3IUMA 3EI4B 4X61B 3IUQA 3EWEA 5H14A 4G1EA 3RN0D 1I2MB 3IURA 2HJ4A 1MG2A 3SJLD 4D6VA 3V4PA 3UVOA 3OL2A 4PBYA 3K71A 2HKMA 1VYHC 4DNVA 5C2WB 2H6QA 4O1QD 5B4WA 3MUOA 4JXMA 5FKSA 4JHNA 4GGAA 4YVDA 3EI2A 4XYIA 1JMZB 4BCDA 3SBQA 2IUQA 4CY5A 1TYEA 4BP9A 4A0AA 5E6SA 3OKTA 3P4FA 3EI3A 2IURA 1PGUA 4G55A 4J82A 5CXBA 3I7NA 2EBSA 1NEXB 5EAPA 1M1XA 1GOTB 2B5NA 1YFQA 1S4UX 2H47A 2OIZA 4MMZA 4NAAA 4UM8A 4EWRA 3SMRA 5EARA 3C75H 1VZ2A 3AH8B 4CZXA 3EI2B 2Z2OA 3GREA 3UKUC 2VZ1A 3CFSB 3SLED 2P9IC 3VI4A 2OVPB 2IUPA 4WK0A 3VA6A 4A09B 4D9SA 1H2ZA 3OL2B 5M61A 1K32A 2VDPA 1E5TA 2I3TA 4N14A 5IJ7E 3MKSB
chains in the Genus database with same CATH topology
5CXCB 1XHMA 5EAMA 2YNPA 4K3JB 4E5ZA 3PSCB 5HYNB 4E54A 2XU7A 4FWWA 3JROA 4J8GA 4CC9A 3B7FA 5AFU3 3A0FA 3ODTA 3CIKB 5SXMA 2PM9B 4A7JA 2PM6B 3W15A 3ULEC 4GZ8A 4AEZA 4OZUA 4FAVD 4K3ID 4A0AB 4FA5D 4JSVC 4PXWA 4JSXC 5H17A 2AH0A 4CY2A 4O9DA 3L4MD 4J0XA 3I7PA 3K27A 3EMHA 5CXCA 3IKOA 4A2MA 4PC0A 3VGZA 4FHLA 4O3TB 2G99A 2OK6A 2I0RA 3RSEC 4LG9A 4ERQA 2W18A 1XKSA 5GXHA 2H9LA 4A0BA 2XYIA 4O45A 3AL8B 4J0WA 2P9PC 5EM2B 4GM9A 1R5MA 3IJCA 4GQ1A 3C99A 4J84A 3I2NA 3L4OD 4JSPC 2HJBA 4QRJA 4A11B 3EI1A 1PI6A 2YB8B 5IGQA 2P9UC 3RN1D 2QC5A 4CY3A 1MDAH 2CN3A 3SVWD 3BG0A 3OKWA 3UR4A 3V7DB 4XYHA 5EM2A 2J55H 3UKRC 2AGLA 1PEVA 1GP2B 3SBPA 3SBRA 4CZYA 4J79A 1NR0A 3V9FA 4E54B 2H68A 2AGXA 3AL8A 2AGWA 5FXYA 3F3PA 4I79A 3I8CA 4BL0A 2P9NC 5I5IA 3AFCA 1SQJA 5I5JA 4A11A 4BUJC 3I7OA 4TZ4A 4ESGA 2AGZA 2Z2NA 3DXMC 5AJAA 2TRCB 5HE2B 5K19A 2UZXB 3SWSD 3IIWA 3K26A 5CXBB 4U7AA 4CI1A 2IUVA 5C9ZB 4ZOXA 1GG2B 4CZVA 3MKQA 2CE8A 4ERZA 2I0SA 4QT8A 3PVWB 4HDJA 1MG3A 3C9CA 2YBAA 3UVKA 4J78A 2MTAH 4GQ2P 2YNNA 4G56B 5GXIA 5FKTA 2P9SC 4AOWA 2IAAA 5C2VB 3MXXA 5H1MA 4ES0A 1K8KC 3UVNA 4Y5RD 1N6EA 2Q7QA 1P22A 5CYKA 1QNIA 4X63B 5FKQA 3EU7A 4ZOZA 3N0DA 2BCJB 4CY1A 2HYEA 2PBIB 3PXWD 2OVRB 3DXKC 4J8BA 3F3FA 3FRXA 2I3SA 4QQEA 1A0RB 4J77A 2J57G 2XL2A 4IMMA 5FQDA 3EI4A 5GMKn 4FB1D 4QL1A 3HFQA 1U4CA 3OKYB 2H14A 3AL9A 2Z2PA 3ZWLB 2OVQB 4A0BB 3PXSD 4PSXB 2B5LA 4R7AB 3RFGA 4L3HD 5IC7A 5EMMB 3DSMA 4CI8A 4BH6A 4GQBB 4PBZA 3KRXB 5TEEA 4JT5C 2QXVA 4J87A 2AH1A 2XL3A 5CYKB 5EALA 4J81A 2CO0C 1ERJA 2AGYA 3VH0A 3EI3B 2CNXA 2I0TA 2PM9A 3PE7A 4L1QD 3FGBA 4GM3A 2BBKH 1RI6A 4H5IA 4L9OA 5IJ8E 4D0KA 3PSLA 3U4YA 3I7KA 4XEIC 1L0QA 2HKRA 5THAA 2IWKA 3PXTD 3BG1A 1FWXA 4CI3A 3J80g 5TF2A 3EG6A 5AMSA 4IA9A 3FM0A 4O3UB 3KRWB 3OW8A 2CN2A 3IJ0A 4X3EA 3RLMD 1GXRA 3MZKA 3I8EA 1JJUB 3JRPA 4A09A 4J73A 3BWSA 4U1EI 4NSXA 1U2VC 4FA1D 4J86A 3DWLC 3EI1B 3MZLA 3CFVA 3JB9L 4ZN4A 1OLZA 5KDOB 5EMJB 2GNQA 2H9MA 4FAND 1TYQC 4GMBA 3SHFA 3V5WB 5IGOA 4LGNA 4MK0B 5HE3B 4FA4D 2PM7B 4L3GD 2G9AA 4UI9R 4OWRA 2CO0A 2H6KA 5FKRA 1JOFA 2AQ5A 4ZOVA 3J81g 2GC7A 4JD2C 3RRMC 2HESX 3IJ1A 3UVLA 1PBYB 4CI2A 3ORVD 4ZOYA 5HE0B 3JZGA 4X60B 5I5MA 5TDHB 1SHYB 3I89A 3OTTA 1Q47A 4JSNC 2YMUA 2H6NA 3JAMg 3SCYA 2J56H 2P9KC 4GM8A 3NVQA 3NVNA 4JT6C 4ERYA 4PSWB 1TBGA 3PVUB 5K1CC 4A2LA 2H9PA 1N6DA 2B5MA 2YNOA 2CE9A 3RFHA 3JZHA 5TEFA 5A2Qg 2HXCA 3I7HA 5HE1B 2H9NA 1SQ9A 4H5JA 1OMWB 4A08A 2O9KA 1N6FA 4FA9D 2IWFA 3JPXA 5JWZA 1B9XA 5FA5B 5FLXg 1XIPA 4Y7RA 3C5MA 3UVMA 5EMLB 5EMKB 3MMYA 3SXTD 2OJYA 2OK4A 3DM0A 5HQGA 3RMZD 2H3XA 2GC4A 3IIYA 1B9YA 4KFMB 5GSAA 2UZYB 3GFCA 3I7LA 4Z8LA 4PNKB 4A08B 3OKYA 3SFZA 3E0CA 3SN6B 3NVXA 2H13A 3F3GA 4E5ZB 4GGCA 5IT9g 3JZNA 4LG8A 2B4EA 2P9LC 3N0EA 1JMXB 4GGDA 3EI4B 4X61B 3EWEA 5H14A 3RN0D 2HJ4A 1MG2A 3SJLD 4D6VA 3UVOA 3OL2A 4PBYA 2HKMA 1VYHC 5C2WB 2H6QA 4O1QD 5B4WA 4JXMA 5FKSA 4GGAA 4YVDA 3EI2A 4XYIA 1JMZB 3SBQA 2IUQA 4CY5A 4A0AA 3OKTA 3P4FA 3EI3A 2IURA 1PGUA 4J82A 5CXBA 3I7NA 2EBSA 1NEXB 5EAPA 1GOTB 2B5NA 1YFQA 1S4UX 2H47A 2OIZA 4EWRA 3SMRA 5EARA 3C75H 3AH8B 4CZXA 3EI2B 2Z2OA 3GREA 3UKUC 3CFSB 3SLED 2P9IC 2OVPB 2IUPA 3VA6A 4A09B 3OL2B 1K32A 2I3TA 4N14A 5IJ7E 3MKSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXC B;  1XHM A;  5EAM A;  2YNP A;  4K3J B;  4E5Z A;  3PSC B;  5HYN B;  4E54 A;  2XU7 A;  4FWW A;  3JRO A;  4J8G A;  4CC9 A;  3B7F A;  5AFU 3;  3A0F A;  3ODT A;  3CIK B;  5SXM A;  2PM9 B;  4A7J A;  2PM6 B;  3W15 A;  3ULE C;  4GZ8 A;  4AEZ A;  4OZU A;  4FAV D;  4K3I D;  4A0A B;  4FA5 D;  4JSV C;  4PXW A;  4JSX C;  5H17 A;  2AH0 A;  4CY2 A;  4O9D A;  3L4M D;  4J0X A;  3I7P A;  3K27 A;  3EMH A;  5CXC A;  3IKO A;  4A2M A;  4PC0 A;  3VGZ A;  4FHL A;  4O3T B;  2G99 A;  2OK6 A;  2I0R A;  3RSE C;  4LG9 A;  4ERQ A;  2W18 A;  1XKS A;  5GXH A;  2H9L A;  4A0B A;  2XYI A;  4O45 A;  3AL8 B;  4J0W A;  2P9P C;  5EM2 B;  4GM9 A;  1R5M A;  3IJC A;  4GQ1 A;  3C99 A;  4J84 A;  3I2N A;  3L4O D;  4JSP C;  2HJB A;  4QRJ A;  4A11 B;  3EI1 A;  1PI6 A;  2YB8 B;  5IGQ A;  2P9U C;  3RN1 D;  2QC5 A;  4CY3 A;  1MDA H;  2CN3 A;  3SVW D;  3BG0 A;  3OKW A;  3UR4 A;  3V7D B;  4XYH A;  5EM2 A;  2J55 H;  3UKR C;  2AGL A;  1PEV A;  1GP2 B;  3SBP A;  3SBR A;  4CZY A;  4J79 A;  1NR0 A;  3V9F A;  4E54 B;  2H68 A;  2AGX A;  3AL8 A;  2AGW A;  5FXY A;  3F3P A;  4I79 A;  3I8C A;  4BL0 A;  2P9N C;  5I5I A;  3AFC A;  1SQJ A;  5I5J A;  4A11 A;  4BUJ C;  3I7O A;  4TZ4 A;  4ESG A;  2AGZ A;  2Z2N A;  3DXM C;  5AJA A;  2TRC B;  5HE2 B;  5K19 A;  2UZX B;  3SWS D;  3IIW A;  3K26 A;  5CXB B;  4U7A A;  4CI1 A;  2IUV A;  5C9Z B;  4ZOX A;  1GG2 B;  4CZV A;  3MKQ A;  2CE8 A;  4ERZ A;  2I0S A;  4QT8 A;  3PVW B;  4HDJ A;  1MG3 A;  3C9C A;  2YBA A;  3UVK A;  4J78 A;  2MTA H;  4GQ2 P;  2YNN A;  4G56 B;  5GXI A;  5FKT A;  2P9S C;  4AOW A;  2IAA A;  5C2V B;  3MXX A;  5H1M A;  4ES0 A;  1K8K C;  3UVN A;  4Y5R D;  1N6E A;  2Q7Q A;  1P22 A;  5CYK A;  1QNI A;  4X63 B;  5FKQ A;  3EU7 A;  4ZOZ A;  3N0D A;  2BCJ B;  4CY1 A;  2HYE A;  2PBI B;  3PXW D;  2OVR B;  3DXK C;  4J8B A;  3F3F A;  3FRX A;  2I3S A;  4QQE A;  1A0R B;  4J77 A;  2J57 G;  2XL2 A;  4IMM A;  5FQD A;  3EI4 A;  5GMK n;  4FB1 D;  4QL1 A;  3HFQ A;  1U4C A;  3OKY B;  2H14 A;  3AL9 A;  2Z2P A;  3ZWL B;  2OVQ B;  4A0B B;  3PXS D;  4PSX B;  2B5L A;  4R7A B;  3RFG A;  4L3H D;  5IC7 A;  5EMM B;  3DSM A;  4CI8 A;  4BH6 A;  4GQB B;  4PBZ A;  3KRX B;  5TEE A;  4JT5 C;  2QXV A;  4J87 A;  2AH1 A;  2XL3 A;  5CYK B;  5EAL A;  4J81 A;  2CO0 C;  1ERJ A;  2AGY A;  3VH0 A;  3EI3 B;  2CNX A;  2I0T A;  2PM9 A;  3PE7 A;  4L1Q D;  3FGB A;  4GM3 A;  2BBK H;  1RI6 A;  4H5I A;  4L9O A;  5IJ8 E;  4D0K A;  3PSL A;  3U4Y A;  3I7K A;  4XEI C;  1L0Q A;  2HKR A;  5THA A;  2IWK A;  3PXT D;  3BG1 A;  1FWX A;  4CI3 A;  3J80 g;  5TF2 A;  3EG6 A;  5AMS A;  4IA9 A;  3FM0 A;  4O3U B;  3KRW B;  3OW8 A;  2CN2 A;  3IJ0 A;  4X3E A;  3RLM D;  1GXR A;  3MZK A;  3I8E A;  1JJU B;  3JRP A;  4A09 A;  4J73 A;  3BWS A;  4U1E I;  4NSX A;  1U2V C;  4FA1 D;  4J86 A;  3DWL C;  3EI1 B;  3MZL A;  3CFV A;  3JB9 L;  4ZN4 A;  1OLZ A;  5KDO B;  5EMJ B;  2GNQ A;  2H9M A;  4FAN D;  1TYQ C;  4GMB A;  3SHF A;  3V5W B;  5IGO A;  4LGN A;  4MK0 B;  5HE3 B;  4FA4 D;  2PM7 B;  4L3G D;  2G9A A;  4UI9 R;  4OWR A;  2CO0 A;  2H6K A;  5FKR A;  1JOF A;  2AQ5 A;  4ZOV A;  3J81 g;  2GC7 A;  4JD2 C;  3RRM C;  2HES X;  3IJ1 A;  3UVL A;  1PBY B;  4CI2 A;  3ORV D;  4ZOY A;  5HE0 B;  3JZG A;  4X60 B;  5I5M A;  5TDH B;  1SHY B;  3I89 A;  3OTT A;  1Q47 A;  4JSN C;  2YMU A;  2H6N A;  3JAM g;  3SCY A;  2J56 H;  2P9K C;  4GM8 A;  3NVQ A;  3NVN A;  4JT6 C;  4ERY A;  4PSW B;  1TBG A;  3PVU B;  5K1C C;  4A2L A;  2H9P A;  1N6D A;  2B5M A;  2YNO A;  2CE9 A;  3RFH A;  3JZH A;  5TEF A;  5A2Q g;  2HXC A;  3I7H A;  5HE1 B;  2H9N A;  1SQ9 A;  4H5J A;  1OMW B;  4A08 A;  2O9K A;  1N6F A;  4FA9 D;  2IWF A;  3JPX A;  5JWZ A;  1B9X A;  5FA5 B;  5FLX g;  1XIP A;  4Y7R A;  3C5M A;  3UVM A;  5EML B;  5EMK B;  3MMY A;  3SXT D;  2OJY A;  2OK4 A;  3DM0 A;  5HQG A;  3RMZ D;  2H3X A;  2GC4 A;  3IIY A;  1B9Y A;  4KFM B;  5GSA A;  2UZY B;  3GFC A;  3I7L A;  4Z8L A;  4PNK B;  4A08 B;  3OKY A;  3SFZ A;  3E0C A;  3SN6 B;  3NVX A;  2H13 A;  3F3G A;  4E5Z B;  4GGC A;  5IT9 g;  3JZN A;  4LG8 A;  2B4E A;  2P9L C;  3N0E A;  1JMX B;  4GGD A;  3EI4 B;  4X61 B;  3EWE A;  5H14 A;  3RN0 D;  2HJ4 A;  1MG2 A;  3SJL D;  4D6V A;  3UVO A;  3OL2 A;  4PBY A;  2HKM A;  1VYH C;  5C2W B;  2H6Q A;  4O1Q D;  5B4W A;  4JXM A;  5FKS A;  4GGA A;  4YVD A;  3EI2 A;  4XYI A;  1JMZ B;  3SBQ A;  2IUQ A;  4CY5 A;  4A0A A;  3OKT A;  3P4F A;  3EI3 A;  2IUR A;  1PGU A;  4J82 A;  5CXB A;  3I7N A;  2EBS A;  1NEX B;  5EAP A;  1GOT B;  2B5N A;  1YFQ A;  1S4U X;  2H47 A;  2OIZ A;  4EWR A;  3SMR A;  5EAR A;  3C75 H;  3AH8 B;  4CZX A;  3EI2 B;  2Z2O A;  3GRE A;  3UKU C;  3CFS B;  3SLE D;  2P9I C;  2OVP B;  2IUP A;  3VA6 A;  4A09 B;  3OL2 B;  1K32 A;  2I3T A;  4N14 A;  5IJ7 E;  3MKS B; 
#chains in the Genus database with same CATH topology
 5CXC B;  1A12 A;  1XHM A;  5EAM A;  2YNP A;  4K3J B;  4E5Z A;  3PSC B;  5HYN B;  1O6F A;  4E54 A;  4AX4 A;  2XU7 A;  5M5U A;  1H2W A;  4FWW A;  3JRO A;  4J8G A;  4CC9 A;  3B7F A;  3IJE A;  5AFU 3;  3A0F A;  3ODT A;  4UM9 A;  3CIK B;  3DDU A;  2PM9 B;  5SXM A;  3T3P A;  2PM6 B;  3W15 A;  4A7J A;  3ULE C;  1JV2 A;  4GZ8 A;  2VZ3 A;  4AEZ A;  4OZU A;  4FAV D;  4K3I D;  4A0A B;  4FA5 D;  4JSV C;  4PXW A;  4JSX C;  5H17 A;  4WK4 A;  2AH0 A;  4CY2 A;  4O9D A;  1JTD B;  3L4M D;  4MMX A;  4J0X A;  3IUJ A;  3I7P A;  3K27 A;  3EMH A;  5CXC A;  3IKO A;  4A2M A;  4PC0 A;  3VGZ A;  4FHL A;  4O3T B;  2G99 A;  2JKX A;  2OK6 A;  2I0R A;  4BP8 A;  3RSE C;  4LG9 A;  4AMY A;  2W18 A;  1XKS A;  4ERQ A;  5GXH A;  4JHP C;  2H9L A;  4A0B A;  2BKL A;  2XYI A;  4O45 A;  3AL8 B;  4J0W A;  2P9P C;  5EM2 B;  4GM9 A;  3T3M A;  1R5M A;  3IJC A;  4GQ1 A;  3C99 A;  4J84 A;  3I2N A;  3L4O D;  4JSP C;  1UTC A;  2HJB A;  4QRJ A;  5E6R A;  4A11 B;  3EI1 A;  1PI6 A;  2YB8 B;  4NEN A;  3IVM A;  5IGQ A;  2P9U C;  3RN1 D;  4AN0 A;  2QC5 A;  4CY3 A;  1MDA H;  2CN3 A;  4BCB A;  3SVW D;  3BG0 A;  3OKW A;  1QFM A;  3UR4 A;  3V7D B;  4XYH A;  5EM2 A;  3O4G A;  2J55 H;  3UKR C;  2AGL A;  1GOH A;  1PEV A;  1GP2 B;  3SBP A;  3SBR A;  4CZY A;  4J79 A;  1NR0 A;  3V9F A;  4E54 B;  2H68 A;  3GD1 I;  2AGX A;  3AL8 A;  2AGW A;  5FXY A;  3F3P A;  4I79 A;  5FFO A;  2VC2 A;  3I8C A;  4BL0 A;  2P9N C;  2VDR A;  2VDQ A;  5I5I A;  3AFC A;  2WQ8 A;  1O6G A;  1SQJ A;  5I5J A;  4A11 A;  4BUJ C;  1YR2 A;  3I7O A;  4TZ4 A;  2XZG A;  4ESG A;  2AGZ A;  2VDN A;  2Z2N A;  4NC4 A;  3DXM C;  5AJA A;  2TRC B;  5HE2 B;  3NID A;  5K19 A;  2UZX B;  3SWS D;  2HU5 A;  3IIW A;  3K26 A;  5CXB B;  1E8N A;  4U7A A;  4CI1 A;  2IUV A;  5C9Z B;  3ZDZ A;  5E6U A;  4ZOX A;  1GG2 B;  3ZE0 A;  4CZV A;  3ZE1 A;  2QR5 A;  3MKQ A;  5M5V A;  2CE8 A;  4ERZ A;  4AMZ A;  2I0S A;  4QT8 A;  3PVW B;  4HDJ A;  1MG3 A;  3C9C A;  2YBA A;  1K3I A;  3UVK A;  3O4I A;  2XDW A;  4J78 A;  2MTA H;  4GQ2 P;  2YNN A;  4G56 B;  4O2W A;  5GXI A;  5FKT A;  2P9S C;  4AOW A;  2IAA A;  5C2V B;  3MXX A;  1L5G A;  5H1M A;  4ES0 A;  1K8K C;  3UVN A;  5M5R A;  4Y5R D;  1N6E A;  2Q7Q A;  1P22 A;  5CYK A;  1QNI A;  4X63 B;  5FKQ A;  2VDK A;  4QAM A;  3EU7 A;  4ZOZ A;  3N0D A;  2BCJ B;  3FCS A;  4CY1 A;  2HYE A;  2PBI B;  3KCI A;  3PXW D;  2OVR B;  4AN1 A;  3DXK C;  4IRZ A;  4J8B A;  3F3F A;  3FRX A;  1VZ3 A;  2I3S A;  1A0R B;  4QQE A;  4J77 A;  2J57 G;  4RE6 A;  2XL2 A;  4IMM A;  5FQD A;  3EI4 A;  5GMK n;  4FB1 D;  4QL1 A;  3HFQ A;  1U4C A;  3OKY B;  2H14 A;  1T2X A;  3AL9 A;  2Z2P A;  3ZWL B;  2OVQ B;  4NBM A;  3NIF A;  4A0B B;  3PXS D;  4PSX B;  1UOP A;  4Z7O A;  2B5L A;  4R7A B;  3RFG A;  1VE6 A;  3ZDX A;  4L3H D;  5IC7 A;  5EMM B;  3DSM A;  4CI8 A;  4BH6 A;  4GQB B;  4PBZ A;  3KRX B;  5TEE A;  4JT5 C;  5M5T A;  2QXV A;  4BCC A;  1E8M A;  2EIE A;  4J87 A;  2AH1 A;  2XL3 A;  3OF7 A;  5CYK B;  4Z7Q A;  5EAL A;  1C9I A;  4J81 A;  2CO0 C;  1ERJ A;  4RE5 A;  2AGY A;  3VH0 A;  3EI3 B;  2CNX A;  2I0T A;  2PM9 A;  3PE7 A;  4L1Q D;  4O02 A;  3K6S A;  3FGB A;  4Z7N A;  3ZDY A;  4GM3 A;  2BBK H;  1RI6 A;  4H5I A;  4L9O A;  5IJ8 E;  4D0K A;  3PSL A;  3U4Y A;  1H2Y A;  3I7K A;  3QI0 A;  5C92 A;  4XEI C;  1L0Q A;  2HKR A;  5THA A;  1VE7 A;  2IWK A;  3PXT D;  3BG1 A;  1FWX A;  4CI3 A;  3J80 g;  5TF2 A;  3EG6 A;  5AMS A;  4IA9 A;  3FM0 A;  3O4J A;  3EQ7 A;  1U8C A;  4O3U B;  3KRW B;  3O4H A;  3OW8 A;  3K72 A;  2CN2 A;  3IJ0 A;  4X3E A;  3NIG A;  2VDO A;  3V4V A;  4DNU A;  2HU8 A;  3RLM D;  1GXR A;  3MZK A;  1UOQ A;  3I8E A;  3IUL A;  4DNW A;  5HDB A;  1JJU B;  4L1M A;  3GC3 B;  3JRP A;  3ZE2 A;  4A09 A;  4J73 A;  3BWS A;  4U1E I;  3VI3 A;  4NSX A;  1U2V C;  4FA1 D;  4J86 A;  3DWL C;  3EI1 B;  3MZL A;  3CFV A;  3JB9 L;  4ZN4 A;  4WK2 A;  1OLZ A;  3EQ8 A;  5KDO B;  5EMJ B;  2GNQ A;  3IUN A;  2H9M A;  2EID A;  4FAN D;  1TYQ C;  4GMB A;  3SHF A;  3V5W B;  5IGO A;  4LGN A;  4MK0 B;  5HE3 B;  4FA4 D;  2PM7 B;  3EQ9 A;  4L3G D;  2G9A A;  4UI9 R;  4OWR A;  2CO0 A;  2H6K A;  5FKR A;  1JOF A;  2AQ5 A;  4ZOV A;  3J81 g;  2GC7 A;  4JD2 C;  3RRM C;  2HES X;  3IJ1 A;  3UVL A;  1PBY B;  2EIC A;  4CI2 A;  3ORV D;  4ZOY A;  5HE0 B;  3JZG A;  4X60 B;  5I5M A;  1QFS A;  5TDH B;  1SHY B;  3I89 A;  3MUN A;  3OTT A;  1Q47 A;  4JSN C;  4WJK A;  2YMU A;  2H6N A;  3JAM g;  1BPO A;  3SCY A;  2J56 H;  2XE4 A;  2P9K C;  5M5S A;  4GM8 A;  2QZP A;  3NVQ A;  3NVN A;  4JT6 C;  4ERY A;  4PSW B;  1TBG A;  3PVU B;  5K1C C;  4A2L A;  1GOG A;  1N6D A;  2B5M A;  2H9P A;  2YNO A;  2CE9 A;  3RFH A;  3JZH A;  5TEF A;  5A2Q g;  2HXC A;  1C9L A;  3I7H A;  5HE1 B;  2H9N A;  1SQ9 A;  1H2X A;  4H5J A;  1OMW B;  3FCU A;  1GOF A;  2VDL A;  4A08 A;  1UOO A;  2O9K A;  1N6F A;  4FA9 D;  2IWF A;  3JPX A;  5JWZ A;  1B9X A;  2VDM A;  4G1M A;  2HU7 A;  5FA5 B;  5FLX g;  1XIP A;  4Y7R A;  4MMY A;  3C5M A;  3UVM A;  5EML B;  5EMK B;  3MMY A;  3SXT D;  2OJY A;  2OK4 A;  3DM0 A;  5HQG A;  3RMZ D;  2H3X A;  2GC4 A;  3IIY A;  1B9Y A;  4KFM B;  5GSA A;  2UZY B;  5FFG A;  5C86 A;  3GFC A;  3I7L A;  4Z8L A;  4PNK B;  4A08 B;  3OKY A;  3SFZ A;  3E0C A;  3MVD K;  3SN6 B;  3NVX A;  2H13 A;  3F3G A;  4E5Z B;  4GGC A;  5IT9 g;  3JZN A;  4LG8 A;  2B4E A;  2P9L C;  2EIB A;  3N0E A;  3QHY B;  1JMX B;  4GGD A;  3IUM A;  3EI4 B;  4X61 B;  3IUQ A;  3EWE A;  5H14 A;  4G1E A;  3RN0 D;  1I2M B;  3IUR A;  2HJ4 A;  1MG2 A;  3SJL D;  4D6V A;  3V4P A;  3UVO A;  3OL2 A;  4PBY A;  3K71 A;  2HKM A;  1VYH C;  4DNV A;  5C2W B;  2H6Q A;  4O1Q D;  5B4W A;  3MUO A;  4JXM A;  5FKS A;  4JHN A;  4GGA A;  4YVD A;  3EI2 A;  4XYI A;  1JMZ B;  4BCD A;  3SBQ A;  2IUQ A;  4CY5 A;  1TYE A;  4BP9 A;  4A0A A;  5E6S A;  3OKT A;  3P4F A;  3EI3 A;  2IUR A;  1PGU A;  4G55 A;  4J82 A;  5CXB A;  3I7N A;  2EBS A;  1NEX B;  5EAP A;  1M1X A;  1GOT B;  2B5N A;  1YFQ A;  1S4U X;  2H47 A;  2OIZ A;  4MMZ A;  4NAA A;  4UM8 A;  4EWR A;  3SMR A;  5EAR A;  3C75 H;  1VZ2 A;  3AH8 B;  4CZX A;  3EI2 B;  2Z2O A;  3GRE A;  3UKU C;  2VZ1 A;  3CFS B;  3SLE D;  2P9I C;  3VI4 A;  2OVP B;  2IUP A;  4WK0 A;  3VA6 A;  4A09 B;  4D9S A;  1H2Z A;  3OL2 B;  5M61 A;  1K32 A;  2VDP A;  1E5T A;  2I3T A;  4N14 A;  5IJ7 E;  3MKS B; 
#chains in the Genus database with same CATH homology
 5CXC B;  1XHM A;  5EAM A;  2YNP A;  4K3J B;  4E5Z A;  3PSC B;  5HYN B;  4E54 A;  2XU7 A;  4FWW A;  3JRO A;  4J8G A;  4CC9 A;  3B7F A;  5AFU 3;  3A0F A;  3ODT A;  3CIK B;  5SXM A;  2PM9 B;  4A7J A;  2PM6 B;  3W15 A;  3ULE C;  4GZ8 A;  4AEZ A;  4OZU A;  4FAV D;  4K3I D;  4A0A B;  4FA5 D;  4JSV C;  4PXW A;  4JSX C;  5H17 A;  2AH0 A;  4CY2 A;  4O9D A;  3L4M D;  4J0X A;  3I7P A;  3K27 A;  3EMH A;  5CXC A;  3IKO A;  4A2M A;  4PC0 A;  3VGZ A;  4FHL A;  4O3T B;  2G99 A;  2OK6 A;  2I0R A;  3RSE C;  4LG9 A;  4ERQ A;  2W18 A;  1XKS A;  5GXH A;  2H9L A;  4A0B A;  2XYI A;  4O45 A;  3AL8 B;  4J0W A;  2P9P C;  5EM2 B;  4GM9 A;  1R5M A;  3IJC A;  4GQ1 A;  3C99 A;  4J84 A;  3I2N A;  3L4O D;  4JSP C;  2HJB A;  4QRJ A;  4A11 B;  3EI1 A;  1PI6 A;  2YB8 B;  5IGQ A;  2P9U C;  3RN1 D;  2QC5 A;  4CY3 A;  1MDA H;  2CN3 A;  3SVW D;  3BG0 A;  3OKW A;  3UR4 A;  3V7D B;  4XYH A;  5EM2 A;  2J55 H;  3UKR C;  2AGL A;  1PEV A;  1GP2 B;  3SBP A;  3SBR A;  4CZY A;  4J79 A;  1NR0 A;  3V9F A;  4E54 B;  2H68 A;  2AGX A;  3AL8 A;  2AGW A;  5FXY A;  3F3P A;  4I79 A;  3I8C A;  4BL0 A;  2P9N C;  5I5I A;  3AFC A;  1SQJ A;  5I5J A;  4A11 A;  4BUJ C;  3I7O A;  4TZ4 A;  4ESG A;  2AGZ A;  2Z2N A;  3DXM C;  5AJA A;  2TRC B;  5HE2 B;  5K19 A;  2UZX B;  3SWS D;  3IIW A;  3K26 A;  5CXB B;  4U7A A;  4CI1 A;  2IUV A;  5C9Z B;  4ZOX A;  1GG2 B;  4CZV A;  3MKQ A;  2CE8 A;  4ERZ A;  2I0S A;  4QT8 A;  3PVW B;  4HDJ A;  1MG3 A;  3C9C A;  2YBA A;  3UVK A;  4J78 A;  2MTA H;  4GQ2 P;  2YNN A;  4G56 B;  5GXI A;  5FKT A;  2P9S C;  4AOW A;  2IAA A;  5C2V B;  3MXX A;  5H1M A;  4ES0 A;  1K8K C;  3UVN A;  4Y5R D;  1N6E A;  2Q7Q A;  1P22 A;  5CYK A;  1QNI A;  4X63 B;  5FKQ A;  3EU7 A;  4ZOZ A;  3N0D A;  2BCJ B;  4CY1 A;  2HYE A;  2PBI B;  3PXW D;  2OVR B;  3DXK C;  4J8B A;  3F3F A;  3FRX A;  2I3S A;  4QQE A;  1A0R B;  4J77 A;  2J57 G;  2XL2 A;  4IMM A;  5FQD A;  3EI4 A;  5GMK n;  4FB1 D;  4QL1 A;  3HFQ A;  1U4C A;  3OKY B;  2H14 A;  3AL9 A;  2Z2P A;  3ZWL B;  2OVQ B;  4A0B B;  3PXS D;  4PSX B;  2B5L A;  4R7A B;  3RFG A;  4L3H D;  5IC7 A;  5EMM B;  3DSM A;  4CI8 A;  4BH6 A;  4GQB B;  4PBZ A;  3KRX B;  5TEE A;  4JT5 C;  2QXV A;  4J87 A;  2AH1 A;  2XL3 A;  5CYK B;  5EAL A;  4J81 A;  2CO0 C;  1ERJ A;  2AGY A;  3VH0 A;  3EI3 B;  2CNX A;  2I0T A;  2PM9 A;  3PE7 A;  4L1Q D;  3FGB A;  4GM3 A;  2BBK H;  1RI6 A;  4H5I A;  4L9O A;  5IJ8 E;  4D0K A;  3PSL A;  3U4Y A;  3I7K A;  4XEI C;  1L0Q A;  2HKR A;  5THA A;  2IWK A;  3PXT D;  3BG1 A;  1FWX A;  4CI3 A;  3J80 g;  5TF2 A;  3EG6 A;  5AMS A;  4IA9 A;  3FM0 A;  4O3U B;  3KRW B;  3OW8 A;  2CN2 A;  3IJ0 A;  4X3E A;  3RLM D;  1GXR A;  3MZK A;  3I8E A;  1JJU B;  3JRP A;  4A09 A;  4J73 A;  3BWS A;  4U1E I;  4NSX A;  1U2V C;  4FA1 D;  4J86 A;  3DWL C;  3EI1 B;  3MZL A;  3CFV A;  3JB9 L;  4ZN4 A;  1OLZ A;  5KDO B;  5EMJ B;  2GNQ A;  2H9M A;  4FAN D;  1TYQ C;  4GMB A;  3SHF A;  3V5W B;  5IGO A;  4LGN A;  4MK0 B;  5HE3 B;  4FA4 D;  2PM7 B;  4L3G D;  2G9A A;  4UI9 R;  4OWR A;  2CO0 A;  2H6K A;  5FKR A;  1JOF A;  2AQ5 A;  4ZOV A;  3J81 g;  2GC7 A;  4JD2 C;  3RRM C;  2HES X;  3IJ1 A;  3UVL A;  1PBY B;  4CI2 A;  3ORV D;  4ZOY A;  5HE0 B;  3JZG A;  4X60 B;  5I5M A;  5TDH B;  1SHY B;  3I89 A;  3OTT A;  1Q47 A;  4JSN C;  2YMU A;  2H6N A;  3JAM g;  3SCY A;  2J56 H;  2P9K C;  4GM8 A;  3NVQ A;  3NVN A;  4JT6 C;  4ERY A;  4PSW B;  1TBG A;  3PVU B;  5K1C C;  4A2L A;  2H9P A;  1N6D A;  2B5M A;  2YNO A;  2CE9 A;  3RFH A;  3JZH A;  5TEF A;  5A2Q g;  2HXC A;  3I7H A;  5HE1 B;  2H9N A;  1SQ9 A;  4H5J A;  1OMW B;  4A08 A;  2O9K A;  1N6F A;  4FA9 D;  2IWF A;  3JPX A;  5JWZ A;  1B9X A;  5FA5 B;  5FLX g;  1XIP A;  4Y7R A;  3C5M A;  3UVM A;  5EML B;  5EMK B;  3MMY A;  3SXT D;  2OJY A;  2OK4 A;  3DM0 A;  5HQG A;  3RMZ D;  2H3X A;  2GC4 A;  3IIY A;  1B9Y A;  4KFM B;  5GSA A;  2UZY B;  3GFC A;  3I7L A;  4Z8L A;  4PNK B;  4A08 B;  3OKY A;  3SFZ A;  3E0C A;  3SN6 B;  3NVX A;  2H13 A;  3F3G A;  4E5Z B;  4GGC A;  5IT9 g;  3JZN A;  4LG8 A;  2B4E A;  2P9L C;  3N0E A;  1JMX B;  4GGD A;  3EI4 B;  4X61 B;  3EWE A;  5H14 A;  3RN0 D;  2HJ4 A;  1MG2 A;  3SJL D;  4D6V A;  3UVO A;  3OL2 A;  4PBY A;  2HKM A;  1VYH C;  5C2W B;  2H6Q A;  4O1Q D;  5B4W A;  4JXM A;  5FKS A;  4GGA A;  4YVD A;  3EI2 A;  4XYI A;  1JMZ B;  3SBQ A;  2IUQ A;  4CY5 A;  4A0A A;  3OKT A;  3P4F A;  3EI3 A;  2IUR A;  1PGU A;  4J82 A;  5CXB A;  3I7N A;  2EBS A;  1NEX B;  5EAP A;  1GOT B;  2B5N A;  1YFQ A;  1S4U X;  2H47 A;  2OIZ A;  4EWR A;  3SMR A;  5EAR A;  3C75 H;  3AH8 B;  4CZX A;  3EI2 B;  2Z2O A;  3GRE A;  3UKU C;  3CFS B;  3SLE D;  2P9I C;  2OVP B;  2IUP A;  3VA6 A;  4A09 B;  3OL2 B;  1K32 A;  2I3T A;  4N14 A;  5IJ7 E;  3MKS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...