1PI6A

Yeast actin interacting protein 1 (aip1), orthorhombic crystal form
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
612
structure length
606
Chain Sequence
SSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDDGDSKVPPVVQFTGHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPISDISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVGDDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTVNPLISGSYDGRIMEWSSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKHEFGSQPKVASANNDGFTAVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQNYVAVGLEEGNTIQVFKLSDLEVSFDLKTPLRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTSRWAFRTSKINAISWKPAEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Actin interacting protein 1
publication title The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 161
structure length 606
sequence length 612
ec nomenclature
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pi6A02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pi6A01
4K3ID 4FAND 1SHYB 4PSWB 3IJ1A 1GXRA 3ULEC 5CXCA 4XEIC 3SLED 3UR4A 5IJ7E 4H5JA 4UI9R 1PBYB 5EMLB 3UVKA 5I5JA 2Z2NA 1XKSA 4G56B 5TF2A 2AGWA 2PM7B 2P9NC 4J87A 2Z2PA 2TRCB 3ODTA 3AL8A 3OKTA 4K3JB 2AGYA 4JSVC 4EWRA 3IJCA 5FKSA 1PEVA 3FGBA 2H3XA 4CC9A 3I7LA 4J78A 5EM2A 3OL2B 4L9OA 5C2VB 4GMBA 3PSLA 5IGQA 2Z2OA 3EI3B 5C2WB 2XU7A 4I79A 4NSXA 4O45A 2HXCA 2OJYA 3RRMC 3L4MD 2OVRB 2QXVA 3AL9A 3EI2B 3NVNA 1PI6A 1B9YA 4D6VA 4O9DA 1FWXA 4YVDA 3DXKC 4J8BA 3OKYB 2AGXA 4N14A 4PXWA 3VH0A 5HYNB 4A09B 2P9LC 3SBPA 2XL3A 1YFQA 3MKQA 4PNKB 4J81A 2HYEA 1B9XA 3PE7A 4A08B 3FM0A 3JZHA 4PBYA 3DXMC 3MKSB 4ES0A 4JSNC 4GQ1A 5FXYA 3JZNA 3A0FA 2PM9B 1MDAH 3ZWLB 3IKOA 2HKRA 3J80g 2YNOA 2HJ4A 1XIPA 1OMWB 4A0BA 5IC7A 3DM0A 4ZOYA 4A7JA 1U4CA 5AJAA 1MG2A 2J56H 4Y5RD 2B5NA 2CE9A 3F3FA 3EI4B 3I8CA 5HE1B 4XYIA 5FQDA 4A11A 1MG3A 4L3GD 3AFCA 4ERYA 3DSMA 3PVUB 4ERZA 4X61B 2AH0A 3RN1D 4GQBB 3RFGA 2GC7A 3ORVD 2CO0C 4U1EI 2GC4A 3RFHA 5CXCB 2PBIB 2OVPB 3N0DA 1NR0A 4LG9A 1GP2B 2H6KA 5AMSA 5TEEA 2AQ5A 2H6QA 3JAMg 5IT9g 2OK4A 2IAAA 4JSPC 2I0SA 5JWZA 1Q47A 2CN3A 1GOTB 3GFCA 5TEFA 5FKQA 4J84A 4ZOVA 5IGOA 3UVLA 2B5MA 2IURA 3JPXA 5CXBB 2H47A 3AL8B 4MK0B 4HDJA 3PXSD 4J77A 3SN6B 1N6EA 2H13A 4U7AA 4J8GA 3CFSB 5EM2B 2H9MA 3MZKA 5EAMA 4OWRA 2P9IC 2H68A 3IIWA 4AOWA 4BH6A 3BG0A 3C75H 3L4OD 3SMRA 2YNPA 4JT6C 2G9AA 4O1QD 2YNNA 4JD2C 4D0KA 1K32A 5HE3B 4FA1D 3I2NA 3PVWB 1A0RB 5AFU3 4J0XA 1SQJA 3HFQA 4CZYA 2QC5A 4LGNA 4O3TB 2P9UC 3JRPA 2OIZA 5EAPA 4QRJA 2EBSA 5HE2B 5FKRA 4O3UB 2UZYB 3EI3A 4PC0A 4GGCA 2I3SA 4FWWA 3NVXA 4X60B 4CY1A 2H9NA 3SXTD 4Y7RA 4X63B 3V7DB 2P9PC 4E54B 4A0AA 1L0QA 1TYQC 1VYHC 5I5IA 3MXXA 3NVQA 4GQ2P 2H6NA 4J82A 3SBRA 3OTTA 5IJ8E 1TBGA 2IUVA 3C99A 4GGAA 3N0EA 3I89A 4A0BB 2I3TA 4CY3A 5I5MA 4CZVA 3MMYA 1QNIA 3MZLA 1JOFA 3C9CA 3EMHA 5THAA 3FRXA 4GM3A 4ZN4A 2O9KA 3UKRC 5GSAA 4FA4D 2CN2A 3CFVA 3IJ0A 3E0CA 4IA9A 2IUQA 2I0TA 3EG6A 4A11B 4KFMB 3UVMA 2GNQA 2H9LA 5HQGA 4J0WA 4Z8LA 2H9PA 5CYKA 2PM9A 4L3HD 3OKWA 3CIKB 3EI1A 1JMZB 2HESX 5C9ZB 2XYIA 4X3EA 4E5ZA 4PSXB 1ERJA 3DWLC 5EMMB 2OVQB 2CNXA 4A2LA 3F3PA 3SFZA 3K26A 3EI4A 3PXWD 4CY2A 5EMKB 5SXMA 3F3GA 3B7FA 4J79A 2BBKH 5B4WA 3V9FA 2IWKA 1P22A 3W15A 4JSXC 3I7KA 3GREA 3OW8A 4A2MA 3RSEC 4QT8A 2H14A 4BL0A 4TZ4A 1NEXB 2YB8B 1JMXB 5TDHB 4ZOXA 3SCYA 4J86A 3UVNA 2AGLA 5KDOB 4J73A 5GXHA 5CXBA 3I8EA 4CI1A 2B4EA 4ESGA 1RI6A 4PBZA 4XYHA 5EARA 3SBQA 4FHLA 4JXMA 2J55H 2PM6B 4JT5C 2P9SC 5K19A 4R7AB 4CI3A 3U4YA 3JZGA 2CO0A 2Q7QA 2J57G 2P9KC 3OL2A 3SWSD 5H17A 3AH8B 1PGUA 4CZXA 3RLMD 4QL1A 1R5MA 5H14A 5EMJB 1OLZA 1U2VC 4A0AB 4GGDA 5EALA 2YBAA 3I7OA 3IIYA 3EI2A 2B5LA 1SQ9A 3I7HA 3C5MA 2MTAH 4FB1D 3OKYA 4FA9D 3JB9L 3UVOA 2OK6A 4ERQA 5GMKn 4A09A 4GM9A 2IUPA 2UZXB 3SHFA 4IMMA 3SJLD 2HKMA 2W18A 1N6DA 5GXIA 3I7NA 3KRXB 2HJBA 5FLXg 2YMUA 1JJUB 4OZUA 5H1MA 4E54A 4FA5D 3K27A 5FA5B 4L1QD 4A08A 2G99A 3V5WB 3VGZA 4BUJC 3I7PA 5CYKB 5A2Qg 1XHMA 3EI1B 2I0RA 4LG8A 3EWEA 3SVWD 4FAVD 4ZOZA 3J81g 4E5ZB 2CE8A 3P4FA 3PXTD 5HE0B 4CY5A 1N6FA 3VA6A 4CI2A 2BCJB 4QQEA 4CI8A 2AH1A 2AGZA 4GM8A 3RN0D 3KRWB 5FKTA 3UKUC 3PSCB 1GG2B 3JROA 3BWSA 4GZ8A 5K1CC 2XL2A 3EU7A 2IWFA 3RMZD 4AEZA 3BG1A 1S4UX 1K8KC 4H5IA
chains in the Genus database with same CATH superfamily
4NBMA 4K3ID 4FAND 1H2WA 1I2MB 1E5TA 1SHYB 4PSWB 3IJ1A 1GOFA 1GXRA 3ULEC 5CXCA 4XEIC 3SLED 4DNVA 3UR4A 5IJ7E 4H5JA 4UI9R 5M61A 1PBYB 5EMLB 3UVKA 5I5JA 2Z2NA 3QI0A 1XKSA 4G56B 3IUJA 1E8NA 3VI4A 5TF2A 2AGWA 4G1EA 2PM7B 3O4HA 2P9NC 4J87A 2Z2PA 5M5TA 1YR2A 2TRCB 3ODTA 3AL8A 3OKTA 4K3JB 3K71A 2AGYA 4JSVC 3K72A 1O6GA 4EWRA 3IJCA 5FKSA 3ZDYA 1PEVA 3FGBA 2H3XA 4CC9A 3I7LA 4J78A 5EM2A 3OL2B 3NIDA 4L9OA 4NENA 4D9SA 2VDKA 5C2VB 5M5UA 4GMBA 3PSLA 3MUNA 5IGQA 2Z2OA 4AN1A 3EI3B 5C2WB 2XU7A 5E6SA 4I79A 4NSXA 4O45A 2HXCA 2OJYA 3RRMC 3L4MD 2OVRB 2QXVA 3AL9A 3EI2B 3NVNA 1PI6A 1B9YA 4D6VA 2VZ1A 4O9DA 1FWXA 4YVDA 3DXKC 4J8BA 2VDPA 3OKYB 2AGXA 4N14A 4PXWA 1H2YA 3VH0A 5HYNB 4MMXA 4A09B 2P9LC 3SBPA 2XL3A 1YFQA 3MKQA 4PNKB 4J81A 1GOHA 4BCDA 3ZDZA 2HYEA 4BCCA 4WK4A 1B9XA 3PE7A 4MMZA 4A08B 3V4VA 3FM0A 3JZHA 4PBYA 3DXMC 3MKSB 4ES0A 4JSNC 4GQ1A 2HU8A 2VDRA 3JZNA 5FXYA 2VZ3A 3A0FA 2PM9B 1MDAH 3ZWLB 3IKOA 2HKRA 4AN0A 3J80g 2YNOA 2HJ4A 1XIPA 4BP8A 1OMWB 4A0BA 5IC7A 3DM0A 4ZOYA 4A7JA 1JTDB 2BKLA 1U4CA 5AJAA 1MG2A 2J56H 4Y5RD 2B5NA 2CE9A 3F3FA 3EI4B 2QR5A 3I8CA 5HE1B 4XYIA 5FQDA 4A11A 5FFGA 1MG3A 4L3GD 4Z7OA 3AFCA 4ERYA 3DSMA 3PVUB 4BCBA 4ERZA 4X61B 2AH0A 3RN1D 1QFMA 4GQBB 1VZ3A 3KCIA 1H2XA 3RFGA 2GC7A 1VE6A 3ORVD 2CO0C 4AMYA 4G1MA 5HDBA 4U1EI 2GC4A 3RFHA 5CXCB 3IUNA 2PBIB 2OVPB 3N0DA 1NR0A 4LG9A 1GP2B 2H6KA 5AMSA 1C9LA 1VE7A 2AQ5A 2H6QA 5TEEA 1UOQA 1VZ2A 3JAMg 5IT9g 2OK4A 2IAAA 4JSPC 2I0SA 5JWZA 1Q47A 2CN3A 1GOTB 3ZDXA 3GFCA 5TEFA 5FKQA 4J84A 4ZOVA 5IGOA 3UVLA 2B5MA 2IURA 3JPXA 5CXBB 2H47A 3ZE2A 3AL8B 4MK0B 4HDJA 3PXSD 4J77A 3SN6B 1N6EA 1T2XA 2H13A 4U7AA 1QFSA 4J8GA 3CFSB 5EM2B 2H9MA 3MZKA 5EAMA 4OWRA 2P9IC 4RE5A 2H68A 3IIWA 4AOWA 4BH6A 3IUQA 3BG0A 4AMZA 3C75H 3L4OD 3SMRA 3IJEA 2YNPA 4JT6C 2G9AA 4O1QD 2YNNA 4JD2C 4L1MA 4D0KA 1K32A 5HE3B 4FA1D 3I2NA 3PVWB 1A0RB 5AFU3 4J0XA 1SQJA 1O6FA 3HFQA 3NIFA 1K3IA 4CZYA 2QC5A 4LGNA 1TYEA 3MUOA 4O3TB 2P9UC 3JRPA 4O02A 2OIZA 5EAPA 4QRJA 2EBSA 5HE2B 5FKRA 4O3UB 2UZYB 3EI3A 2VDOA 4GGCA 2I3SA 4PC0A 4FWWA 3NVXA 4X60B 4CY1A 1GOGA 2H9NA 3SXTD 4Y7RA 4X63B 3V7DB 2P9PC 4E54B 4A0AA 2XZGA 1L0QA 1TYQC 1VYHC 5I5IA 3MXXA 3NVQA 4GQ2P 2H6NA 4J82A 3SBRA 3OTTA 5IJ8E 1TBGA 2IUVA 3C99A 4GGAA 1H2ZA 3N0EA 4Z7NA 3I89A 4A0BB 2I3TA 4CY3A 5I5MA 3EQ9A 3QHYB 4CZVA 3EQ8A 3MMYA 1QNIA 3MZLA 1JOFA 4BP9A 4JHNA 5M5SA 3C9CA 3EMHA 4WK0A 3FRXA 5THAA 2EIBA 4GM3A 4WJKA 2WQ8A 4ZN4A 2O9KA 3UKRC 2EIDA 5GSAA 4FA4D 2CN2A 3CFVA 3IJ0A 3E0CA 3O4IA 4IA9A 2IUQA 4G55A 2I0TA 3EG6A 4A11B 3OF7A 4KFMB 2GNQA 3UVMA 4JHPC 2H9LA 5HQGA 4J0WA 3MVDK 4Z8LA 2H9PA 5CYKA 3O4GA 2PM9A 5C86A 2VDMA 4L3HD 3OKWA 1L5GA 3CIKB 3EI1A 1JMZB 1E8MA 2XE4A 2HESX 5C9ZB 2XYIA 4X3EA 4E5ZA 3FCSA 4PSXB 4AX4A 1ERJA 3DWLC 5EMMB 2OVQB 2CNXA 3VI3A 3F3PA 4A2LA 1C9IA 3SFZA 3K26A 5C92A 3EI4A 3PXWD 4CY2A 5EMKB 5SXMA 3F3GA 3B7FA 4J79A 2BBKH 5B4WA 4DNUA 3V9FA 2IWKA 1P22A 3W15A 4JSXC 3I7KA 3T3PA 3GREA 3OW8A 4A2MA 3RSEC 1UTCA 3IUMA 3DDUA 4QT8A 2H14A 4BL0A 4QAMA 2HU5A 3EQ7A 4TZ4A 5M5VA 1NEXB 2VC2A 2YB8B 1JMXB 4NC4A 2HU7A 5TDHB 4ZOXA 3SCYA 5M5RA 4J86A 3UVNA 2AGLA 5KDOB 3ZE0A 4J73A 4NAAA 5GXHA 4RE6A 5CXBA 3GC3B 3I8EA 4CI1A 2B4EA 4ESGA 1M1XA 4UM8A 1RI6A 4PBZA 3T3MA 2VDLA 4XYHA 5EARA 3SBQA 4FHLA 4JXMA 2J55H 3IURA 2PM6B 4JT5C 2P9SC 5K19A 4R7AB 4CI3A 3U4YA 3JZGA 2CO0A 2Q7QA 2J57G 2P9KC 3OL2A 3SWSD 5H17A 3AH8B 1PGUA 1BPOA 3RLMD 4CZXA 4QL1A 3O4JA 1R5MA 5H14A 2QZPA 5EMJB 1OLZA 1U2VC 4A0AB 4GGDA 5EALA 2YBAA 3I7OA 3IIYA 2JKXA 5E6RA 3EI2A 2B5LA 1SQ9A 2XDWA 3I7HA 3C5MA 3ZE1A 2MTAH 3V4PA 4UM9A 4FB1D 4Z7QA 3OKYA 4FA9D 1UOOA 3IULA 3JB9L 3UVOA 2OK6A 4ERQA 5GMKn 5FFOA 4GM9A 4A09A 2IUPA 2UZXB 3SHFA 4IMMA 3SJLD 2HKMA 2W18A 3IVMA 2VDQA 1N6DA 3FCUA 3I7NA 3KRXB 4DNWA 2HJBA 5GXIA 5FLXg 2YMUA 1JJUB 4OZUA 5H1MA 4E54A 4FA5D 1U8CA 3NIGA 3K27A 5FA5B 4L1QD 4A08A 1UOPA 2G99A 3V5WB 3VGZA 4BUJC 1A12A 3I7PA 5CYKB 5A2Qg 4IRZA 1JV2A 1XHMA 3EI1B 2I0RA 4LG8A 2EICA 3EWEA 3SVWD 4FAVD 2VDNA 4ZOZA 3J81g 4E5ZB 2CE8A 3P4FA 5E6UA 2EIEA 3PXTD 5HE0B 4CY5A 4MMYA 3K6SA 1N6FA 3VA6A 4CI2A 2BCJB 4QQEA 4CI8A 2AH1A 2AGZA 4GM8A 4O2WA 3RN0D 3KRWB 5FKTA 3UKUC 3PSCB 1GG2B 4WK2A 3JROA 3BWSA 4GZ8A 5K1CC 3GD1I 2XL2A 3EU7A 2IWFA 3RMZD 4AEZA 3BG1A 1S4UX 1K8KC 4H5IA
chains in the Genus database with same CATH topology
4K3ID 4FAND 1SHYB 4PSWB 3IJ1A 1GXRA 3ULEC 5CXCA 4XEIC 3SLED 3UR4A 5IJ7E 4H5JA 4UI9R 1PBYB 5EMLB 3UVKA 5I5JA 2Z2NA 1XKSA 4G56B 5TF2A 2AGWA 2PM7B 2P9NC 4J87A 2Z2PA 2TRCB 3ODTA 3AL8A 3OKTA 4K3JB 2AGYA 4JSVC 4EWRA 3IJCA 5FKSA 1PEVA 3FGBA 2H3XA 4CC9A 3I7LA 4J78A 5EM2A 3OL2B 4L9OA 5C2VB 4GMBA 3PSLA 5IGQA 2Z2OA 3EI3B 5C2WB 2XU7A 4I79A 4NSXA 4O45A 2HXCA 2OJYA 3RRMC 3L4MD 2OVRB 2QXVA 3AL9A 3EI2B 3NVNA 1PI6A 1B9YA 4D6VA 4O9DA 1FWXA 4YVDA 3DXKC 4J8BA 3OKYB 2AGXA 4N14A 4PXWA 3VH0A 5HYNB 4A09B 2P9LC 3SBPA 2XL3A 1YFQA 3MKQA 4PNKB 4J81A 2HYEA 1B9XA 3PE7A 4A08B 3FM0A 3JZHA 4PBYA 3DXMC 3MKSB 4ES0A 4JSNC 4GQ1A 5FXYA 3JZNA 3A0FA 2PM9B 1MDAH 3ZWLB 3IKOA 2HKRA 3J80g 2YNOA 2HJ4A 1XIPA 1OMWB 4A0BA 5IC7A 3DM0A 4ZOYA 4A7JA 1U4CA 5AJAA 1MG2A 2J56H 4Y5RD 2B5NA 2CE9A 3F3FA 3EI4B 3I8CA 5HE1B 4XYIA 5FQDA 4A11A 1MG3A 4L3GD 3AFCA 4ERYA 3DSMA 3PVUB 4ERZA 4X61B 2AH0A 3RN1D 4GQBB 3RFGA 2GC7A 3ORVD 2CO0C 4U1EI 2GC4A 3RFHA 5CXCB 2PBIB 2OVPB 3N0DA 1NR0A 4LG9A 1GP2B 2H6KA 5AMSA 5TEEA 2AQ5A 2H6QA 3JAMg 5IT9g 2OK4A 2IAAA 4JSPC 2I0SA 5JWZA 1Q47A 2CN3A 1GOTB 3GFCA 5TEFA 5FKQA 4J84A 4ZOVA 5IGOA 3UVLA 2B5MA 2IURA 3JPXA 5CXBB 2H47A 3AL8B 4MK0B 4HDJA 3PXSD 4J77A 3SN6B 1N6EA 2H13A 4U7AA 4J8GA 3CFSB 5EM2B 2H9MA 3MZKA 5EAMA 4OWRA 2P9IC 2H68A 3IIWA 4AOWA 4BH6A 3BG0A 3C75H 3L4OD 3SMRA 2YNPA 4JT6C 2G9AA 4O1QD 2YNNA 4JD2C 4D0KA 1K32A 5HE3B 4FA1D 3I2NA 3PVWB 1A0RB 5AFU3 4J0XA 1SQJA 3HFQA 4CZYA 2QC5A 4LGNA 4O3TB 2P9UC 3JRPA 2OIZA 5EAPA 4QRJA 2EBSA 5HE2B 5FKRA 4O3UB 2UZYB 3EI3A 4PC0A 4GGCA 2I3SA 4FWWA 3NVXA 4X60B 4CY1A 2H9NA 3SXTD 4Y7RA 4X63B 3V7DB 2P9PC 4E54B 4A0AA 1L0QA 1TYQC 1VYHC 5I5IA 3MXXA 3NVQA 4GQ2P 2H6NA 4J82A 3SBRA 3OTTA 5IJ8E 1TBGA 2IUVA 3C99A 4GGAA 3N0EA 3I89A 4A0BB 2I3TA 4CY3A 5I5MA 4CZVA 3MMYA 1QNIA 3MZLA 1JOFA 3C9CA 3EMHA 5THAA 3FRXA 4GM3A 4ZN4A 2O9KA 3UKRC 5GSAA 4FA4D 2CN2A 3CFVA 3IJ0A 3E0CA 4IA9A 2IUQA 2I0TA 3EG6A 4A11B 4KFMB 3UVMA 2GNQA 2H9LA 5HQGA 4J0WA 4Z8LA 2H9PA 5CYKA 2PM9A 4L3HD 3OKWA 3CIKB 3EI1A 1JMZB 2HESX 5C9ZB 2XYIA 4X3EA 4E5ZA 4PSXB 1ERJA 3DWLC 5EMMB 2OVQB 2CNXA 4A2LA 3F3PA 3SFZA 3K26A 3EI4A 3PXWD 4CY2A 5EMKB 5SXMA 3F3GA 3B7FA 4J79A 2BBKH 5B4WA 3V9FA 2IWKA 1P22A 3W15A 4JSXC 3I7KA 3GREA 3OW8A 4A2MA 3RSEC 4QT8A 2H14A 4BL0A 4TZ4A 1NEXB 2YB8B 1JMXB 5TDHB 4ZOXA 3SCYA 4J86A 3UVNA 2AGLA 5KDOB 4J73A 5GXHA 5CXBA 3I8EA 4CI1A 2B4EA 4ESGA 1RI6A 4PBZA 4XYHA 5EARA 3SBQA 4FHLA 4JXMA 2J55H 2PM6B 4JT5C 2P9SC 5K19A 4R7AB 4CI3A 3U4YA 3JZGA 2CO0A 2Q7QA 2J57G 2P9KC 3OL2A 3SWSD 5H17A 3AH8B 1PGUA 4CZXA 3RLMD 4QL1A 1R5MA 5H14A 5EMJB 1OLZA 1U2VC 4A0AB 4GGDA 5EALA 2YBAA 3I7OA 3IIYA 3EI2A 2B5LA 1SQ9A 3I7HA 3C5MA 2MTAH 4FB1D 3OKYA 4FA9D 3JB9L 3UVOA 2OK6A 4ERQA 5GMKn 4A09A 4GM9A 2IUPA 2UZXB 3SHFA 4IMMA 3SJLD 2HKMA 2W18A 1N6DA 5GXIA 3I7NA 3KRXB 2HJBA 5FLXg 2YMUA 1JJUB 4OZUA 5H1MA 4E54A 4FA5D 3K27A 5FA5B 4L1QD 4A08A 2G99A 3V5WB 3VGZA 4BUJC 3I7PA 5CYKB 5A2Qg 1XHMA 3EI1B 2I0RA 4LG8A 3EWEA 3SVWD 4FAVD 4ZOZA 3J81g 4E5ZB 2CE8A 3P4FA 3PXTD 5HE0B 4CY5A 1N6FA 3VA6A 4CI2A 2BCJB 4QQEA 4CI8A 2AH1A 2AGZA 4GM8A 3RN0D 3KRWB 5FKTA 3UKUC 3PSCB 1GG2B 3JROA 3BWSA 4GZ8A 5K1CC 2XL2A 3EU7A 2IWFA 3RMZD 4AEZA 3BG1A 1S4UX 1K8KC 4H5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3I D;  4FAN D;  1SHY B;  4PSW B;  3IJ1 A;  1GXR A;  3ULE C;  5CXC A;  4XEI C;  3SLE D;  3UR4 A;  5IJ7 E;  4H5J A;  4UI9 R;  1PBY B;  5EML B;  3UVK A;  5I5J A;  2Z2N A;  1XKS A;  4G56 B;  5TF2 A;  2AGW A;  2PM7 B;  2P9N C;  4J87 A;  2Z2P A;  2TRC B;  3ODT A;  3AL8 A;  3OKT A;  4K3J B;  2AGY A;  4JSV C;  4EWR A;  3IJC A;  5FKS A;  1PEV A;  3FGB A;  2H3X A;  4CC9 A;  3I7L A;  4J78 A;  5EM2 A;  3OL2 B;  4L9O A;  5C2V B;  4GMB A;  3PSL A;  5IGQ A;  2Z2O A;  3EI3 B;  5C2W B;  2XU7 A;  4I79 A;  4NSX A;  4O45 A;  2HXC A;  2OJY A;  3RRM C;  3L4M D;  2OVR B;  2QXV A;  3AL9 A;  3EI2 B;  3NVN A;  1PI6 A;  1B9Y A;  4D6V A;  4O9D A;  1FWX A;  4YVD A;  3DXK C;  4J8B A;  3OKY B;  2AGX A;  4N14 A;  4PXW A;  3VH0 A;  5HYN B;  4A09 B;  2P9L C;  3SBP A;  2XL3 A;  1YFQ A;  3MKQ A;  4PNK B;  4J81 A;  2HYE A;  1B9X A;  3PE7 A;  4A08 B;  3FM0 A;  3JZH A;  4PBY A;  3DXM C;  3MKS B;  4ES0 A;  4JSN C;  4GQ1 A;  5FXY A;  3JZN A;  3A0F A;  2PM9 B;  1MDA H;  3ZWL B;  3IKO A;  2HKR A;  3J80 g;  2YNO A;  2HJ4 A;  1XIP A;  1OMW B;  4A0B A;  5IC7 A;  3DM0 A;  4ZOY A;  4A7J A;  1U4C A;  5AJA A;  1MG2 A;  2J56 H;  4Y5R D;  2B5N A;  2CE9 A;  3F3F A;  3EI4 B;  3I8C A;  5HE1 B;  4XYI A;  5FQD A;  4A11 A;  1MG3 A;  4L3G D;  3AFC A;  4ERY A;  3DSM A;  3PVU B;  4ERZ A;  4X61 B;  2AH0 A;  3RN1 D;  4GQB B;  3RFG A;  2GC7 A;  3ORV D;  2CO0 C;  4U1E I;  2GC4 A;  3RFH A;  5CXC B;  2PBI B;  2OVP B;  3N0D A;  1NR0 A;  4LG9 A;  1GP2 B;  2H6K A;  5AMS A;  5TEE A;  2AQ5 A;  2H6Q A;  3JAM g;  5IT9 g;  2OK4 A;  2IAA A;  4JSP C;  2I0S A;  5JWZ A;  1Q47 A;  2CN3 A;  1GOT B;  3GFC A;  5TEF A;  5FKQ A;  4J84 A;  4ZOV A;  5IGO A;  3UVL A;  2B5M A;  2IUR A;  3JPX A;  5CXB B;  2H47 A;  3AL8 B;  4MK0 B;  4HDJ A;  3PXS D;  4J77 A;  3SN6 B;  1N6E A;  2H13 A;  4U7A A;  4J8G A;  3CFS B;  5EM2 B;  2H9M A;  3MZK A;  5EAM A;  4OWR A;  2P9I C;  2H68 A;  3IIW A;  4AOW A;  4BH6 A;  3BG0 A;  3C75 H;  3L4O D;  3SMR A;  2YNP A;  4JT6 C;  2G9A A;  4O1Q D;  2YNN A;  4JD2 C;  4D0K A;  1K32 A;  5HE3 B;  4FA1 D;  3I2N A;  3PVW B;  1A0R B;  5AFU 3;  4J0X A;  1SQJ A;  3HFQ A;  4CZY A;  2QC5 A;  4LGN A;  4O3T B;  2P9U C;  3JRP A;  2OIZ A;  5EAP A;  4QRJ A;  2EBS A;  5HE2 B;  5FKR A;  4O3U B;  2UZY B;  3EI3 A;  4PC0 A;  4GGC A;  2I3S A;  4FWW A;  3NVX A;  4X60 B;  4CY1 A;  2H9N A;  3SXT D;  4Y7R A;  4X63 B;  3V7D B;  2P9P C;  4E54 B;  4A0A A;  1L0Q A;  1TYQ C;  1VYH C;  5I5I A;  3MXX A;  3NVQ A;  4GQ2 P;  2H6N A;  4J82 A;  3SBR A;  3OTT A;  5IJ8 E;  1TBG A;  2IUV A;  3C99 A;  4GGA A;  3N0E A;  3I89 A;  4A0B B;  2I3T A;  4CY3 A;  5I5M A;  4CZV A;  3MMY A;  1QNI A;  3MZL A;  1JOF A;  3C9C A;  3EMH A;  5THA A;  3FRX A;  4GM3 A;  4ZN4 A;  2O9K A;  3UKR C;  5GSA A;  4FA4 D;  2CN2 A;  3CFV A;  3IJ0 A;  3E0C A;  4IA9 A;  2IUQ A;  2I0T A;  3EG6 A;  4A11 B;  4KFM B;  3UVM A;  2GNQ A;  2H9L A;  5HQG A;  4J0W A;  4Z8L A;  2H9P A;  5CYK A;  2PM9 A;  4L3H D;  3OKW A;  3CIK B;  3EI1 A;  1JMZ B;  2HES X;  5C9Z B;  2XYI A;  4X3E A;  4E5Z A;  4PSX B;  1ERJ A;  3DWL C;  5EMM B;  2OVQ B;  2CNX A;  4A2L A;  3F3P A;  3SFZ A;  3K26 A;  3EI4 A;  3PXW D;  4CY2 A;  5EMK B;  5SXM A;  3F3G A;  3B7F A;  4J79 A;  2BBK H;  5B4W A;  3V9F A;  2IWK A;  1P22 A;  3W15 A;  4JSX C;  3I7K A;  3GRE A;  3OW8 A;  4A2M A;  3RSE C;  4QT8 A;  2H14 A;  4BL0 A;  4TZ4 A;  1NEX B;  2YB8 B;  1JMX B;  5TDH B;  4ZOX A;  3SCY A;  4J86 A;  3UVN A;  2AGL A;  5KDO B;  4J73 A;  5GXH A;  5CXB A;  3I8E A;  4CI1 A;  2B4E A;  4ESG A;  1RI6 A;  4PBZ A;  4XYH A;  5EAR A;  3SBQ A;  4FHL A;  4JXM A;  2J55 H;  2PM6 B;  4JT5 C;  2P9S C;  5K19 A;  4R7A B;  4CI3 A;  3U4Y A;  3JZG A;  2CO0 A;  2Q7Q A;  2J57 G;  2P9K C;  3OL2 A;  3SWS D;  5H17 A;  3AH8 B;  1PGU A;  4CZX A;  3RLM D;  4QL1 A;  1R5M A;  5H14 A;  5EMJ B;  1OLZ A;  1U2V C;  4A0A B;  4GGD A;  5EAL A;  2YBA A;  3I7O A;  3IIY A;  3EI2 A;  2B5L A;  1SQ9 A;  3I7H A;  3C5M A;  2MTA H;  4FB1 D;  3OKY A;  4FA9 D;  3JB9 L;  3UVO A;  2OK6 A;  4ERQ A;  5GMK n;  4A09 A;  4GM9 A;  2IUP A;  2UZX B;  3SHF A;  4IMM A;  3SJL D;  2HKM A;  2W18 A;  1N6D A;  5GXI A;  3I7N A;  3KRX B;  2HJB A;  5FLX g;  2YMU A;  1JJU B;  4OZU A;  5H1M A;  4E54 A;  4FA5 D;  3K27 A;  5FA5 B;  4L1Q D;  4A08 A;  2G99 A;  3V5W B;  3VGZ A;  4BUJ C;  3I7P A;  5CYK B;  5A2Q g;  1XHM A;  3EI1 B;  2I0R A;  4LG8 A;  3EWE A;  3SVW D;  4FAV D;  4ZOZ A;  3J81 g;  4E5Z B;  2CE8 A;  3P4F A;  3PXT D;  5HE0 B;  4CY5 A;  1N6F A;  3VA6 A;  4CI2 A;  2BCJ B;  4QQE A;  4CI8 A;  2AH1 A;  2AGZ A;  4GM8 A;  3RN0 D;  3KRW B;  5FKT A;  3UKU C;  3PSC B;  1GG2 B;  3JRO A;  3BWS A;  4GZ8 A;  5K1C C;  2XL2 A;  3EU7 A;  2IWF A;  3RMZ D;  4AEZ A;  3BG1 A;  1S4U X;  1K8K C;  4H5I A; 
#chains in the Genus database with same CATH topology
 4NBM A;  4K3I D;  4FAN D;  1H2W A;  1I2M B;  1E5T A;  1SHY B;  4PSW B;  3IJ1 A;  1GOF A;  1GXR A;  3ULE C;  5CXC A;  4XEI C;  3SLE D;  4DNV A;  3UR4 A;  5IJ7 E;  4H5J A;  4UI9 R;  5M61 A;  1PBY B;  5EML B;  3UVK A;  5I5J A;  2Z2N A;  3QI0 A;  1XKS A;  4G56 B;  3IUJ A;  1E8N A;  3VI4 A;  5TF2 A;  2AGW A;  4G1E A;  2PM7 B;  3O4H A;  2P9N C;  4J87 A;  2Z2P A;  5M5T A;  1YR2 A;  2TRC B;  3ODT A;  3AL8 A;  3OKT A;  4K3J B;  3K71 A;  2AGY A;  4JSV C;  3K72 A;  1O6G A;  4EWR A;  3IJC A;  5FKS A;  3ZDY A;  1PEV A;  3FGB A;  2H3X A;  4CC9 A;  3I7L A;  4J78 A;  5EM2 A;  3OL2 B;  3NID A;  4L9O A;  4NEN A;  4D9S A;  2VDK A;  5C2V B;  5M5U A;  4GMB A;  3PSL A;  3MUN A;  5IGQ A;  2Z2O A;  4AN1 A;  3EI3 B;  5C2W B;  2XU7 A;  5E6S A;  4I79 A;  4NSX A;  4O45 A;  2HXC A;  2OJY A;  3RRM C;  3L4M D;  2OVR B;  2QXV A;  3AL9 A;  3EI2 B;  3NVN A;  1PI6 A;  1B9Y A;  4D6V A;  2VZ1 A;  4O9D A;  1FWX A;  4YVD A;  3DXK C;  4J8B A;  2VDP A;  3OKY B;  2AGX A;  4N14 A;  4PXW A;  1H2Y A;  3VH0 A;  5HYN B;  4MMX A;  4A09 B;  2P9L C;  3SBP A;  2XL3 A;  1YFQ A;  3MKQ A;  4PNK B;  4J81 A;  1GOH A;  4BCD A;  3ZDZ A;  2HYE A;  4BCC A;  4WK4 A;  1B9X A;  3PE7 A;  4MMZ A;  4A08 B;  3V4V A;  3FM0 A;  3JZH A;  4PBY A;  3DXM C;  3MKS B;  4ES0 A;  4JSN C;  4GQ1 A;  2HU8 A;  2VDR A;  3JZN A;  5FXY A;  2VZ3 A;  3A0F A;  2PM9 B;  1MDA H;  3ZWL B;  3IKO A;  2HKR A;  4AN0 A;  3J80 g;  2YNO A;  2HJ4 A;  1XIP A;  4BP8 A;  1OMW B;  4A0B A;  5IC7 A;  3DM0 A;  4ZOY A;  4A7J A;  1JTD B;  2BKL A;  1U4C A;  5AJA A;  1MG2 A;  2J56 H;  4Y5R D;  2B5N A;  2CE9 A;  3F3F A;  3EI4 B;  2QR5 A;  3I8C A;  5HE1 B;  4XYI A;  5FQD A;  4A11 A;  5FFG A;  1MG3 A;  4L3G D;  4Z7O A;  3AFC A;  4ERY A;  3DSM A;  3PVU B;  4BCB A;  4ERZ A;  4X61 B;  2AH0 A;  3RN1 D;  1QFM A;  4GQB B;  1VZ3 A;  3KCI A;  1H2X A;  3RFG A;  2GC7 A;  1VE6 A;  3ORV D;  2CO0 C;  4AMY A;  4G1M A;  5HDB A;  4U1E I;  2GC4 A;  3RFH A;  5CXC B;  3IUN A;  2PBI B;  2OVP B;  3N0D A;  1NR0 A;  4LG9 A;  1GP2 B;  2H6K A;  5AMS A;  1C9L A;  1VE7 A;  2AQ5 A;  2H6Q A;  5TEE A;  1UOQ A;  1VZ2 A;  3JAM g;  5IT9 g;  2OK4 A;  2IAA A;  4JSP C;  2I0S A;  5JWZ A;  1Q47 A;  2CN3 A;  1GOT B;  3ZDX A;  3GFC A;  5TEF A;  5FKQ A;  4J84 A;  4ZOV A;  5IGO A;  3UVL A;  2B5M A;  2IUR A;  3JPX A;  5CXB B;  2H47 A;  3ZE2 A;  3AL8 B;  4MK0 B;  4HDJ A;  3PXS D;  4J77 A;  3SN6 B;  1N6E A;  1T2X A;  2H13 A;  4U7A A;  1QFS A;  4J8G A;  3CFS B;  5EM2 B;  2H9M A;  3MZK A;  5EAM A;  4OWR A;  2P9I C;  4RE5 A;  2H68 A;  3IIW A;  4AOW A;  4BH6 A;  3IUQ A;  3BG0 A;  4AMZ A;  3C75 H;  3L4O D;  3SMR A;  3IJE A;  2YNP A;  4JT6 C;  2G9A A;  4O1Q D;  2YNN A;  4JD2 C;  4L1M A;  4D0K A;  1K32 A;  5HE3 B;  4FA1 D;  3I2N A;  3PVW B;  1A0R B;  5AFU 3;  4J0X A;  1SQJ A;  1O6F A;  3HFQ A;  3NIF A;  1K3I A;  4CZY A;  2QC5 A;  4LGN A;  1TYE A;  3MUO A;  4O3T B;  2P9U C;  3JRP A;  4O02 A;  2OIZ A;  5EAP A;  4QRJ A;  2EBS A;  5HE2 B;  5FKR A;  4O3U B;  2UZY B;  3EI3 A;  2VDO A;  4GGC A;  2I3S A;  4PC0 A;  4FWW A;  3NVX A;  4X60 B;  4CY1 A;  1GOG A;  2H9N A;  3SXT D;  4Y7R A;  4X63 B;  3V7D B;  2P9P C;  4E54 B;  4A0A A;  2XZG A;  1L0Q A;  1TYQ C;  1VYH C;  5I5I A;  3MXX A;  3NVQ A;  4GQ2 P;  2H6N A;  4J82 A;  3SBR A;  3OTT A;  5IJ8 E;  1TBG A;  2IUV A;  3C99 A;  4GGA A;  1H2Z A;  3N0E A;  4Z7N A;  3I89 A;  4A0B B;  2I3T A;  4CY3 A;  5I5M A;  3EQ9 A;  3QHY B;  4CZV A;  3EQ8 A;  3MMY A;  1QNI A;  3MZL A;  1JOF A;  4BP9 A;  4JHN A;  5M5S A;  3C9C A;  3EMH A;  4WK0 A;  3FRX A;  5THA A;  2EIB A;  4GM3 A;  4WJK A;  2WQ8 A;  4ZN4 A;  2O9K A;  3UKR C;  2EID A;  5GSA A;  4FA4 D;  2CN2 A;  3CFV A;  3IJ0 A;  3E0C A;  3O4I A;  4IA9 A;  2IUQ A;  4G55 A;  2I0T A;  3EG6 A;  4A11 B;  3OF7 A;  4KFM B;  2GNQ A;  3UVM A;  4JHP C;  2H9L A;  5HQG A;  4J0W A;  3MVD K;  4Z8L A;  2H9P A;  5CYK A;  3O4G A;  2PM9 A;  5C86 A;  2VDM A;  4L3H D;  3OKW A;  1L5G A;  3CIK B;  3EI1 A;  1JMZ B;  1E8M A;  2XE4 A;  2HES X;  5C9Z B;  2XYI A;  4X3E A;  4E5Z A;  3FCS A;  4PSX B;  4AX4 A;  1ERJ A;  3DWL C;  5EMM B;  2OVQ B;  2CNX A;  3VI3 A;  3F3P A;  4A2L A;  1C9I A;  3SFZ A;  3K26 A;  5C92 A;  3EI4 A;  3PXW D;  4CY2 A;  5EMK B;  5SXM A;  3F3G A;  3B7F A;  4J79 A;  2BBK H;  5B4W A;  4DNU A;  3V9F A;  2IWK A;  1P22 A;  3W15 A;  4JSX C;  3I7K A;  3T3P A;  3GRE A;  3OW8 A;  4A2M A;  3RSE C;  1UTC A;  3IUM A;  3DDU A;  4QT8 A;  2H14 A;  4BL0 A;  4QAM A;  2HU5 A;  3EQ7 A;  4TZ4 A;  5M5V A;  1NEX B;  2VC2 A;  2YB8 B;  1JMX B;  4NC4 A;  2HU7 A;  5TDH B;  4ZOX A;  3SCY A;  5M5R A;  4J86 A;  3UVN A;  2AGL A;  5KDO B;  3ZE0 A;  4J73 A;  4NAA A;  5GXH A;  4RE6 A;  5CXB A;  3GC3 B;  3I8E A;  4CI1 A;  2B4E A;  4ESG A;  1M1X A;  4UM8 A;  1RI6 A;  4PBZ A;  3T3M A;  2VDL A;  4XYH A;  5EAR A;  3SBQ A;  4FHL A;  4JXM A;  2J55 H;  3IUR A;  2PM6 B;  4JT5 C;  2P9S C;  5K19 A;  4R7A B;  4CI3 A;  3U4Y A;  3JZG A;  2CO0 A;  2Q7Q A;  2J57 G;  2P9K C;  3OL2 A;  3SWS D;  5H17 A;  3AH8 B;  1PGU A;  1BPO A;  3RLM D;  4CZX A;  4QL1 A;  3O4J A;  1R5M A;  5H14 A;  2QZP A;  5EMJ B;  1OLZ A;  1U2V C;  4A0A B;  4GGD A;  5EAL A;  2YBA A;  3I7O A;  3IIY A;  2JKX A;  5E6R A;  3EI2 A;  2B5L A;  1SQ9 A;  2XDW A;  3I7H A;  3C5M A;  3ZE1 A;  2MTA H;  3V4P A;  4UM9 A;  4FB1 D;  4Z7Q A;  3OKY A;  4FA9 D;  1UOO A;  3IUL A;  3JB9 L;  3UVO A;  2OK6 A;  4ERQ A;  5GMK n;  5FFO A;  4GM9 A;  4A09 A;  2IUP A;  2UZX B;  3SHF A;  4IMM A;  3SJL D;  2HKM A;  2W18 A;  3IVM A;  2VDQ A;  1N6D A;  3FCU A;  3I7N A;  3KRX B;  4DNW A;  2HJB A;  5GXI A;  5FLX g;  2YMU A;  1JJU B;  4OZU A;  5H1M A;  4E54 A;  4FA5 D;  1U8C A;  3NIG A;  3K27 A;  5FA5 B;  4L1Q D;  4A08 A;  1UOP A;  2G99 A;  3V5W B;  3VGZ A;  4BUJ C;  1A12 A;  3I7P A;  5CYK B;  5A2Q g;  4IRZ A;  1JV2 A;  1XHM A;  3EI1 B;  2I0R A;  4LG8 A;  2EIC A;  3EWE A;  3SVW D;  4FAV D;  2VDN A;  4ZOZ A;  3J81 g;  4E5Z B;  2CE8 A;  3P4F A;  5E6U A;  2EIE A;  3PXT D;  5HE0 B;  4CY5 A;  4MMY A;  3K6S A;  1N6F A;  3VA6 A;  4CI2 A;  2BCJ B;  4QQE A;  4CI8 A;  2AH1 A;  2AGZ A;  4GM8 A;  4O2W A;  3RN0 D;  3KRW B;  5FKT A;  3UKU C;  3PSC B;  1GG2 B;  4WK2 A;  3JRO A;  3BWS A;  4GZ8 A;  5K1C C;  3GD1 I;  2XL2 A;  3EU7 A;  2IWF A;  3RMZ D;  4AEZ A;  3BG1 A;  1S4U X;  1K8K C;  4H5I A; 
#chains in the Genus database with same CATH homology
 4K3I D;  4FAN D;  1SHY B;  4PSW B;  3IJ1 A;  1GXR A;  3ULE C;  5CXC A;  4XEI C;  3SLE D;  3UR4 A;  5IJ7 E;  4H5J A;  4UI9 R;  1PBY B;  5EML B;  3UVK A;  5I5J A;  2Z2N A;  1XKS A;  4G56 B;  5TF2 A;  2AGW A;  2PM7 B;  2P9N C;  4J87 A;  2Z2P A;  2TRC B;  3ODT A;  3AL8 A;  3OKT A;  4K3J B;  2AGY A;  4JSV C;  4EWR A;  3IJC A;  5FKS A;  1PEV A;  3FGB A;  2H3X A;  4CC9 A;  3I7L A;  4J78 A;  5EM2 A;  3OL2 B;  4L9O A;  5C2V B;  4GMB A;  3PSL A;  5IGQ A;  2Z2O A;  3EI3 B;  5C2W B;  2XU7 A;  4I79 A;  4NSX A;  4O45 A;  2HXC A;  2OJY A;  3RRM C;  3L4M D;  2OVR B;  2QXV A;  3AL9 A;  3EI2 B;  3NVN A;  1PI6 A;  1B9Y A;  4D6V A;  4O9D A;  1FWX A;  4YVD A;  3DXK C;  4J8B A;  3OKY B;  2AGX A;  4N14 A;  4PXW A;  3VH0 A;  5HYN B;  4A09 B;  2P9L C;  3SBP A;  2XL3 A;  1YFQ A;  3MKQ A;  4PNK B;  4J81 A;  2HYE A;  1B9X A;  3PE7 A;  4A08 B;  3FM0 A;  3JZH A;  4PBY A;  3DXM C;  3MKS B;  4ES0 A;  4JSN C;  4GQ1 A;  5FXY A;  3JZN A;  3A0F A;  2PM9 B;  1MDA H;  3ZWL B;  3IKO A;  2HKR A;  3J80 g;  2YNO A;  2HJ4 A;  1XIP A;  1OMW B;  4A0B A;  5IC7 A;  3DM0 A;  4ZOY A;  4A7J A;  1U4C A;  5AJA A;  1MG2 A;  2J56 H;  4Y5R D;  2B5N A;  2CE9 A;  3F3F A;  3EI4 B;  3I8C A;  5HE1 B;  4XYI A;  5FQD A;  4A11 A;  1MG3 A;  4L3G D;  3AFC A;  4ERY A;  3DSM A;  3PVU B;  4ERZ A;  4X61 B;  2AH0 A;  3RN1 D;  4GQB B;  3RFG A;  2GC7 A;  3ORV D;  2CO0 C;  4U1E I;  2GC4 A;  3RFH A;  5CXC B;  2PBI B;  2OVP B;  3N0D A;  1NR0 A;  4LG9 A;  1GP2 B;  2H6K A;  5AMS A;  5TEE A;  2AQ5 A;  2H6Q A;  3JAM g;  5IT9 g;  2OK4 A;  2IAA A;  4JSP C;  2I0S A;  5JWZ A;  1Q47 A;  2CN3 A;  1GOT B;  3GFC A;  5TEF A;  5FKQ A;  4J84 A;  4ZOV A;  5IGO A;  3UVL A;  2B5M A;  2IUR A;  3JPX A;  5CXB B;  2H47 A;  3AL8 B;  4MK0 B;  4HDJ A;  3PXS D;  4J77 A;  3SN6 B;  1N6E A;  2H13 A;  4U7A A;  4J8G A;  3CFS B;  5EM2 B;  2H9M A;  3MZK A;  5EAM A;  4OWR A;  2P9I C;  2H68 A;  3IIW A;  4AOW A;  4BH6 A;  3BG0 A;  3C75 H;  3L4O D;  3SMR A;  2YNP A;  4JT6 C;  2G9A A;  4O1Q D;  2YNN A;  4JD2 C;  4D0K A;  1K32 A;  5HE3 B;  4FA1 D;  3I2N A;  3PVW B;  1A0R B;  5AFU 3;  4J0X A;  1SQJ A;  3HFQ A;  4CZY A;  2QC5 A;  4LGN A;  4O3T B;  2P9U C;  3JRP A;  2OIZ A;  5EAP A;  4QRJ A;  2EBS A;  5HE2 B;  5FKR A;  4O3U B;  2UZY B;  3EI3 A;  4PC0 A;  4GGC A;  2I3S A;  4FWW A;  3NVX A;  4X60 B;  4CY1 A;  2H9N A;  3SXT D;  4Y7R A;  4X63 B;  3V7D B;  2P9P C;  4E54 B;  4A0A A;  1L0Q A;  1TYQ C;  1VYH C;  5I5I A;  3MXX A;  3NVQ A;  4GQ2 P;  2H6N A;  4J82 A;  3SBR A;  3OTT A;  5IJ8 E;  1TBG A;  2IUV A;  3C99 A;  4GGA A;  3N0E A;  3I89 A;  4A0B B;  2I3T A;  4CY3 A;  5I5M A;  4CZV A;  3MMY A;  1QNI A;  3MZL A;  1JOF A;  3C9C A;  3EMH A;  5THA A;  3FRX A;  4GM3 A;  4ZN4 A;  2O9K A;  3UKR C;  5GSA A;  4FA4 D;  2CN2 A;  3CFV A;  3IJ0 A;  3E0C A;  4IA9 A;  2IUQ A;  2I0T A;  3EG6 A;  4A11 B;  4KFM B;  3UVM A;  2GNQ A;  2H9L A;  5HQG A;  4J0W A;  4Z8L A;  2H9P A;  5CYK A;  2PM9 A;  4L3H D;  3OKW A;  3CIK B;  3EI1 A;  1JMZ B;  2HES X;  5C9Z B;  2XYI A;  4X3E A;  4E5Z A;  4PSX B;  1ERJ A;  3DWL C;  5EMM B;  2OVQ B;  2CNX A;  4A2L A;  3F3P A;  3SFZ A;  3K26 A;  3EI4 A;  3PXW D;  4CY2 A;  5EMK B;  5SXM A;  3F3G A;  3B7F A;  4J79 A;  2BBK H;  5B4W A;  3V9F A;  2IWK A;  1P22 A;  3W15 A;  4JSX C;  3I7K A;  3GRE A;  3OW8 A;  4A2M A;  3RSE C;  4QT8 A;  2H14 A;  4BL0 A;  4TZ4 A;  1NEX B;  2YB8 B;  1JMX B;  5TDH B;  4ZOX A;  3SCY A;  4J86 A;  3UVN A;  2AGL A;  5KDO B;  4J73 A;  5GXH A;  5CXB A;  3I8E A;  4CI1 A;  2B4E A;  4ESG A;  1RI6 A;  4PBZ A;  4XYH A;  5EAR A;  3SBQ A;  4FHL A;  4JXM A;  2J55 H;  2PM6 B;  4JT5 C;  2P9S C;  5K19 A;  4R7A B;  4CI3 A;  3U4Y A;  3JZG A;  2CO0 A;  2Q7Q A;  2J57 G;  2P9K C;  3OL2 A;  3SWS D;  5H17 A;  3AH8 B;  1PGU A;  4CZX A;  3RLM D;  4QL1 A;  1R5M A;  5H14 A;  5EMJ B;  1OLZ A;  1U2V C;  4A0A B;  4GGD A;  5EAL A;  2YBA A;  3I7O A;  3IIY A;  3EI2 A;  2B5L A;  1SQ9 A;  3I7H A;  3C5M A;  2MTA H;  4FB1 D;  3OKY A;  4FA9 D;  3JB9 L;  3UVO A;  2OK6 A;  4ERQ A;  5GMK n;  4A09 A;  4GM9 A;  2IUP A;  2UZX B;  3SHF A;  4IMM A;  3SJL D;  2HKM A;  2W18 A;  1N6D A;  5GXI A;  3I7N A;  3KRX B;  2HJB A;  5FLX g;  2YMU A;  1JJU B;  4OZU A;  5H1M A;  4E54 A;  4FA5 D;  3K27 A;  5FA5 B;  4L1Q D;  4A08 A;  2G99 A;  3V5W B;  3VGZ A;  4BUJ C;  3I7P A;  5CYK B;  5A2Q g;  1XHM A;  3EI1 B;  2I0R A;  4LG8 A;  3EWE A;  3SVW D;  4FAV D;  4ZOZ A;  3J81 g;  4E5Z B;  2CE8 A;  3P4F A;  3PXT D;  5HE0 B;  4CY5 A;  1N6F A;  3VA6 A;  4CI2 A;  2BCJ B;  4QQE A;  4CI8 A;  2AH1 A;  2AGZ A;  4GM8 A;  3RN0 D;  3KRW B;  5FKT A;  3UKU C;  3PSC B;  1GG2 B;  3JRO A;  3BWS A;  4GZ8 A;  5K1C C;  2XL2 A;  3EU7 A;  2IWF A;  3RMZ D;  4AEZ A;  3BG1 A;  1S4U X;  1K8K C;  4H5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...