1PI6A

Yeast actin interacting protein 1 (aip1), orthorhombic crystal form
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
612
structure length
606
Chain Sequence
b'SSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDDGDSKVPPVVQFTGHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPISDISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVGDDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTVNPLISGSYDGRIMEWSSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKHEFGSQPKVASANNDGFTAVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQNYVAVGLEEGNTIQVFKLSDLEVSFDLKTPLRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTSRWAFRTSKINAISWKPAEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Actin interacting protein 1
publication title The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 161
structure length 606
sequence length 612
ec nomenclature
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pi6A02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1pi6A01
4H5IA 2AH0A 3FRXA 3K27A 3I7HA 4L9OA 4BL0A 3C75H 4FA1D 1K8KC 3IIYA 3N0EA 4LGNA 3ULEC 3OKYA 2Z2NA 4IA9A 2H47A 2OVPB 1S4UX 3JZGA 3JZHA 3F3PA 2BBKH 5IT9g 4JT6C 5HE0B 4JXMA 3IJCA 1OLZA 2AGWA 2G9AA 2OJYA 5CYKB 4E5ZB 4E54B 1PEVA 5EMKB 2HKMA 1B9YA 2AGLA 4J0WA 3A0FA 5FXYA 5EM2A 2I3SA 2G99A 4O3TB 5EMLB 4ES0A 3C9CA 3MKQA 4HDJA 2PBIB 3GFCA 3SFZA 1GOTB 3DSMA 4IMMA 4CI1A 4ERYA 2H9LA 2H14A 3JRPA 4X61B 3ORVD 4LG9A 4L3HD 4J0XA 5CXCB 4H5JA 2OK6A 1JOFA 2YBAA 3UR4A 4JSXC 4FA4D 5IGOA 3UKRC 3BWSA 3AL8A 2HYEA 4EWRA 2CO0C 3V7DB 3SLED 5JWZA 4J86A 4A2LA 2CN3A 1OMWB 3DXMC 4J8BA 4CC9A 3EG6A 4A09B 2IWFA 3UVOA 4KFMB 4QL1A 5K1CC 2P9KC 3PE7A 3ZWLB 5CYKA 1ERJA 4E54A 5IJ8E 1JJUB 2H13A 3AFCA 3IJ0A 3HFQA 3DWLC 3MZKA 4X63B 3UVLA 4FAVD 2OK4A 3DXKC 2AGXA 5THAA 4GM8A 4FWWA 5EMJB 4K3ID 4X60B 3SBRA 1SHYB 1MG2A 5CXCA 4GGAA 4QQEA 2HKRA 4PXWA 2XU7A 3V5WB 1FWXA 4XYHA 5I5MA 2H6NA 3OKTA 2OVQB 5GXIA 2UZYB 4FAND 4PBZA 2IUQA 5TDHB 4PSXB 3CFVA 3K26A 3J81g 2GC4A 2YNPA 3RLMD 3VH0A 4A09A 3U4YA 2GC7A 2Z2PA 4PSWB 4XYIA 1K32A 3SBPA 5IGQA 1VYHC 4OZUA 1JMXB 2YB8B 4J81A 4R7AB 3I8EA 5HE2B 1L0QA 3UVNA 3AL8B 3IKOA 3MMYA 2PM9B 1QNIA 3RFHA 3SMRA 4JSNC 4FA9D 4ESGA 3NVNA 3UVKA 4O45A 2HJBA 3JAMg 5FA5B 3B7FA 5GSAA 2AGYA 4FB1D 4U7AA 3I7OA 2J56H 4A0BB 1GG2B 3RN1D 3V9FA 3PXWD 3PVUB 4U1EI 5IC7A 5AFU3 5HYNB 4Y5RD 4G56B 3PVWB 4QT8A 4J78A 5GMKn 2W18A 4CY1A 5A2Qg 4J84A 2IWKA 3SCYA 4GM9A 2YMUA 4CI8A 1XKSA 4PBYA 1TBGA 1JMZB 5C2WB 3RSEC 3I7NA 2HESX 4Y7RA 2J57G 4J79A 5HQGA 2PM9A 2IURA 3JZNA 3EU7A 4J87A 3PXTD 4CZXA 2OVRB 1U4CA 3MXXA 5FKRA 2QXVA 1MG3A 2XL2A 1Q47A 3NVXA 2PM6B 3I89A 1XHMA 3J80g 1GP2B 2H68A 4L1QD 3FGBA 4GMBA 2AH1A 3SHFA 3IIWA 3AH8B 4A0BA 4QRJA 4UI9R 3OL2B 3I7KA 1B9XA 1SQJA 2H9MA 2P9UC 3GREA 4OWRA 2AGZA 4PNKB 2B5NA 2I0RA 4NSXA 1PI6A 5EARA 5HE3B 1PBYB 1RI6A 2PM7B 3EI1A 3ODTA 4ZOZA 4FHLA 4GQBB 2P9NC 2IUPA 5GXHA 2H6KA 2YNOA 3W15A 5TF2A 1U2VC 4CY5A 1P22A 2OIZA 4ZOVA 3MKSB 3EI4A 3KRXB 4A08B 3L4OD 2H6QA 3MZLA 4I79A 4YVDA 4O1QD 2CE8A 3SBQA 4Z8LA 4D0KA 4GGCA 2H9NA 2H3XA 5SXMA 3OL2A 1GXRA 4GM3A 1SQ9A 2P9PC 2GNQA 2MTAH 2XL3A 3AL9A 2CN2A 4BUJC 2CE9A 2IUVA 3EI3A 4N14A 3PXSD 2CO0A 5CXBB 2I0TA 3C5MA 5H17A 4L3GD 4D6VA 5I5JA 2Q7QA 3RMZD 2HJ4A 5FKSA 3OKWA 5AJAA 4TZ4A 4ZOXA 5C9ZB 4CI3A 2AQ5A 2Z2OA 3SN6B 5AMSA 5EALA 4AOWA 5TEEA 3OTTA 5I5IA 4A08A 4PC0A 2I3TA 1XIPA 2P9SC 3BG1A 4LG8A 3EI1B 2QC5A 4A0AA 3VGZA 2B5MA 3L4MD 5EAMA 5FKQA 3PSCB 3SJLD 4J73A 2YNNA 3RN0D 4X3EA 3EI2A 1YFQA 4JSVC 4CZVA 4A11A 1N6FA 2TRCB 1NR0A 5FQDA 4ZOYA 5CXBA 3RRMC 3F3GA 4BH6A 4CI2A 2P9IC 3EI4B 5H1MA 3JB9L 2P9LC 5IJ7E 5EAPA 5K19A 3CFSB 3F3FA 2CNXA 5EMMB 3EMHA 5HE1B 4ERQA 3E0CA 3VA6A 2XYIA 2J55H 1N6DA 5TEFA 3RFGA 3SXTD 2B5LA 3JPXA 3EI3B 4CZYA 5B4WA 3I8CA 4E5ZA 2HXCA 3SWSD 2BCJB 3SVWD 3N0DA 2B4EA 4JSPC 1N6EA 4J82A 4O3UB 2EBSA 4J8GA 3PSLA 3OKYB 4O9DA 5C2VB 4K3JB 4ERZA 1TYQC 3BG0A 3JROA 4GQ2P 4XEIC 4GGDA 3CIKB 5FKTA 4GZ8A 5KDOB 4MK0B 4FA5D 4CY3A 2O9KA 1R5MA 3UKUC 3C99A 3DM0A 3NVQA 3I7PA 1PGUA 4AEZA 4ZN4A 3EWEA 1A0RB 4A0AB 5FLXg 2IAAA 2H9PA 4A2MA 5EM2B 5H14A 4JT5C 3IJ1A 2I0SA 2UZXB 3OW8A 3EI2B 4GQ1A 3FM0A 3UVMA 1NEXB 4A11B 3I2NA 4J77A 4A7JA 3I7LA 3KRWB 4CY2A 3P4FA 4JD2C 1MDAH
chains in the Genus database with same CATH superfamily
4H5IA 1O6GA 2AH0A 3FRXA 3K27A 3I7HA 2VDMA 4L9OA 4BL0A 1C9LA 3C75H 4FA1D 1K8KC 3IIYA 3N0EA 1H2ZA 4LGNA 3ULEC 3OKYA 2Z2NA 4IA9A 2H47A 3O4HA 2OVPB 1L5GA 1TYEA 1S4UX 3JZGA 3JZHA 2HU5A 3F3PA 2BBKH 5IT9g 1E5TA 4JT6C 5HE0B 4JXMA 3IJCA 1OLZA 4RE6A 2AGWA 2G9AA 2OJYA 5CYKB 4E5ZB 2EICA 4E54B 4JHNA 1PEVA 5EMKB 1JV2A 2HKMA 1B9YA 2AGLA 4J0WA 3A0FA 5FXYA 4UM9A 4JHPC 2I3SA 5EM2A 1UOPA 2G99A 4O3TB 5EMLB 4ES0A 3C9CA 3MKQA 4HDJA 2PBIB 3GFCA 3IURA 3ZDZA 3SFZA 1GOTB 3DSMA 4IMMA 4BCBA 4ERYA 4CI1A 2H9LA 2H14A 3JRPA 4X61B 3ORVD 4O2WA 5E6UA 4LG9A 4L3HD 4J0XA 5CXCB 4H5JA 2OK6A 1JOFA 2YBAA 3UR4A 4JSXC 4FA4D 3ZDYA 3NIDA 5IGOA 1H2WA 3UKRC 3BWSA 3AL8A 2HYEA 4EWRA 2CO0C 3V7DB 3SLED 5JWZA 4BCCA 3T3MA 3OF7A 4J86A 4DNVA 4A2LA 2CN3A 1OMWB 3DXMC 4J8BA 4CC9A 3EG6A 4A09B 2IWFA 3DDUA 4KFMB 3UVOA 4QL1A 5K1CC 2P9KC 3PE7A 2VZ1A 3ZWLB 5CYKA 1ERJA 4E54A 5IJ8E 1JJUB 2H13A 3AFCA 3IJ0A 3HFQA 3DWLC 3MZKA 4X63B 3UVLA 4FAVD 2OK4A 2XZGA 2AGXA 3DXKC 5THAA 4GM8A 3QHYB 4FWWA 5EMJB 4K3ID 4X60B 3SBRA 1SHYB 1MG2A 5CXCA 5M5SA 4GGAA 4QQEA 5E6RA 4MMXA 2HKRA 4PXWA 2XU7A 1E8MA 3V5WB 1FWXA 4XYHA 5I5MA 2H6NA 3OKTA 2OVQB 5GXIA 2UZYB 4AN0A 4FAND 4PBZA 2IUQA 5TDHB 4WK2A 4PSXB 3CFVA 3K26A 3J81g 2GC4A 1UOQA 2YNPA 3RLMD 3VH0A 4A09A 3U4YA 1VZ2A 2GC7A 5C86A 2Z2PA 4PSWB 4XYIA 1BPOA 1K32A 3SBPA 5IGQA 4G1EA 1VYHC 4OZUA 1JMXB 2YB8B 4J81A 4R7AB 3I8EA 5HE2B 1L0QA 3UVNA 3AL8B 3IKOA 3MMYA 2PM9B 5M5UA 1QNIA 3RFHA 2VDLA 3SMRA 4JSNC 4FA9D 3ZDXA 4ESGA 1GOHA 2VDPA 3NVNA 3UVKA 2VC2A 2HJBA 4O45A 3JAMg 5FA5B 4NENA 3B7FA 5GSAA 2AGYA 4FB1D 1H2YA 3NIFA 1E8NA 4U7AA 3I7OA 2J56H 4A0BB 1GG2B 3RN1D 4DNUA 3V9FA 3PXWD 3PVUB 4U1EI 5IC7A 5AFU3 5HYNB 1UOOA 4Y5RD 4G56B 3PVWB 4QT8A 4J78A 5GMKn 1GOGA 2W18A 1I2MB 4CY1A 5A2Qg 4J84A 4WK0A 4DNWA 2IWKA 3IUNA 3FCSA 3SCYA 4IRZA 4GM9A 2YMUA 4G1MA 4CI8A 1XKSA 4PBYA 1TBGA 1JMZB 4L1MA 5C2WB 3RSEC 3I7NA 2HESX 4Y7RA 3MUNA 2J57G 3IUJA 4J79A 5HQGA 1O6FA 1QFSA 2PM9A 2IURA 4MMYA 3JZNA 3O4GA 3GC3B 4BP9A 3EU7A 3T3PA 4J87A 3PXTD 4CZXA 4AMYA 2OVRB 1U4CA 3MXXA 5FKRA 2QXVA 1MG3A 2XL2A 1Q47A 3NVXA 2PM6B 3I89A 1XHMA 3EQ9A 3J80g 1GP2B 4Z7QA 2H68A 4L1QD 3FGBA 4GMBA 2AH1A 3SHFA 3IIWA 3AH8B 4A0BA 4QRJA 1VE7A 3EQ8A 4D9SA 4UI9R 3OL2B 3I7KA 1B9XA 5M5VA 1SQJA 2H9MA 2P9UC 5FFGA 3GREA 3FCUA 2AGZA 4OWRA 1JTDB 4PNKB 2B5NA 2I0RA 4NSXA 1PI6A 3QI0A 3K72A 5EARA 5HE3B 1PBYB 1RI6A 2PM7B 3EI1A 2HU7A 3ODTA 4ZOZA 4FHLA 4GQBB 2P9NC 2IUPA 3IUMA 5GXHA 3IVMA 2H6KA 2YNOA 3W15A 1VZ3A 5TF2A 5M61A 1U2VC 4CY5A 1P22A 2OIZA 4NAAA 4ZOVA 3MKSB 3EI4A 3KRXB 4A08B 1U8CA 3MUOA 3L4OD 2H6QA 3MZLA 4I79A 4YVDA 4O1QD 2CE8A 3SBQA 4Z8LA 4D0KA 4GGCA 2H9NA 2H3XA 4MMZA 4NC4A 5SXMA 3OL2A 1GXRA 4GM3A 1SQ9A 2P9PC 2GNQA 2MTAH 2XL3A 2VDRA 3AL9A 2CN2A 4BUJC 3K71A 2CE9A 2IUVA 3EI3A 4N14A 5M5RA 3PXSD 3K6SA 2CO0A 3ZE2A 5CXBB 2I0TA 2EIDA 3C5MA 3NIGA 5H17A 4L3GD 1A12A 3O4JA 4WK4A 1GOFA 2QR5A 4D6VA 2VDNA 2BKLA 5I5JA 2Q7QA 3RMZD 2HJ4A 5FKSA 3OKWA 5AJAA 4TZ4A 1QFMA 4ZOXA 5C9ZB 4CI3A 2AQ5A 2Z2OA 3SN6B 5AMSA 5EALA 4AOWA 5TEEA 3ZE1A 3OTTA 1C9IA 3IULA 5I5IA 4A08A 4O02A 4PC0A 3EQ7A 2I3TA 1M1XA 1XIPA 1K3IA 2P9SC 3BG1A 4LG8A 3EI1B 2QC5A 3V4PA 4A0AA 3VGZA 2B5MA 3L4MD 5EAMA 5FKQA 3PSCB 3SJLD 4J73A 2YNNA 2XE4A 4AX4A 3RN0D 4X3EA 5C92A 2HU8A 3EI2A 2VZ3A 4BP8A 1YFQA 4JSVC 4CZVA 4AMZA 4A11A 2VDQA 1N6FA 2TRCB 1NR0A 5FQDA 4ZOYA 5CXBA 4AN1A 3RRMC 3F3GA 2VDOA 4BH6A 4CI2A 2P9IC 3EI4B 1H2XA 5H1MA 4QAMA 3JB9L 2P9LC 5IJ7E 5M5TA 5EAPA 3MVDK 2EIEA 5K19A 3CFSB 3F3FA 2CNXA 3VI3A 5EMMB 3EMHA 1YR2A 5HE1B 4ERQA 3E0CA 3VA6A 2XYIA 3O4IA 2J55H 1N6DA 5TEFA 3RFGA 3SXTD 2B5LA 3JPXA 3EI3B 3GD1I 4NBMA 4CZYA 4Z7NA 5B4WA 3I8CA 4G55A 4E5ZA 2HXCA 3SWSD 2BCJB 4BCDA 3SVWD 3V4VA 3N0DA 2B4EA 4JSPC 1N6EA 4UM8A 4J82A 4O3UB 2EBSA 4J8GA 3PSLA 3OKYB 4O9DA 5HDBA 5C2VB 4K3JB 4ERZA 1TYQC 3BG0A 3JROA 4GQ2P 4XEIC 4GGDA 3CIKB 5FKTA 4GZ8A 5KDOB 5E6SA 4MK0B 4FA5D 4CY3A 2O9KA 1R5MA 1UTCA 1T2XA 3IUQA 3C99A 3UKUC 3DM0A 2XDWA 3NVQA 3I7PA 1PGUA 4AEZA 4RE5A 5FFOA 4ZN4A 2QZPA 3EWEA 1A0RB 4A0AB 4Z7OA 5FLXg 2IAAA 2H9PA 3IJEA 4A2MA 5EM2B 5H14A 4JT5C 3KCIA 2VDKA 3ZE0A 3IJ1A 2I0SA 2UZXB 3OW8A 3EI2B 4GQ1A 3FM0A 3VI4A 3UVMA 1NEXB 4A11B 2JKXA 3I2NA 4J77A 4A7JA 2EIBA 1VE6A 3I7LA 3KRWB 4CY2A 4WJKA 3P4FA 4JD2C 2WQ8A 1MDAH
chains in the Genus database with same CATH topology
4H5IA 2AH0A 3FRXA 3K27A 3I7HA 4L9OA 4BL0A 3C75H 4FA1D 1K8KC 3IIYA 3N0EA 4LGNA 3ULEC 3OKYA 2Z2NA 4IA9A 2H47A 2OVPB 1S4UX 3JZGA 3JZHA 3F3PA 2BBKH 5IT9g 4JT6C 5HE0B 4JXMA 3IJCA 1OLZA 2AGWA 2G9AA 2OJYA 5CYKB 4E5ZB 4E54B 1PEVA 5EMKB 2HKMA 1B9YA 2AGLA 4J0WA 3A0FA 5FXYA 5EM2A 2I3SA 2G99A 4O3TB 5EMLB 4ES0A 3C9CA 3MKQA 4HDJA 2PBIB 3GFCA 3SFZA 1GOTB 3DSMA 4IMMA 4CI1A 4ERYA 2H9LA 2H14A 3JRPA 4X61B 3ORVD 4LG9A 4L3HD 4J0XA 5CXCB 4H5JA 2OK6A 1JOFA 2YBAA 3UR4A 4JSXC 4FA4D 5IGOA 3UKRC 3BWSA 3AL8A 2HYEA 4EWRA 2CO0C 3V7DB 3SLED 5JWZA 4J86A 4A2LA 2CN3A 1OMWB 3DXMC 4J8BA 4CC9A 3EG6A 4A09B 2IWFA 3UVOA 4KFMB 4QL1A 5K1CC 2P9KC 3PE7A 3ZWLB 5CYKA 1ERJA 4E54A 5IJ8E 1JJUB 2H13A 3AFCA 3IJ0A 3HFQA 3DWLC 3MZKA 4X63B 3UVLA 4FAVD 2OK4A 3DXKC 2AGXA 5THAA 4GM8A 4FWWA 5EMJB 4K3ID 4X60B 3SBRA 1SHYB 1MG2A 5CXCA 4GGAA 4QQEA 2HKRA 4PXWA 2XU7A 3V5WB 1FWXA 4XYHA 5I5MA 2H6NA 3OKTA 2OVQB 5GXIA 2UZYB 4FAND 4PBZA 2IUQA 5TDHB 4PSXB 3CFVA 3K26A 3J81g 2GC4A 2YNPA 3RLMD 3VH0A 4A09A 3U4YA 2GC7A 2Z2PA 4PSWB 4XYIA 1K32A 3SBPA 5IGQA 1VYHC 4OZUA 1JMXB 2YB8B 4J81A 4R7AB 3I8EA 5HE2B 1L0QA 3UVNA 3AL8B 3IKOA 3MMYA 2PM9B 1QNIA 3RFHA 3SMRA 4JSNC 4FA9D 4ESGA 3NVNA 3UVKA 4O45A 2HJBA 3JAMg 5FA5B 3B7FA 5GSAA 2AGYA 4FB1D 4U7AA 3I7OA 2J56H 4A0BB 1GG2B 3RN1D 3V9FA 3PXWD 3PVUB 4U1EI 5IC7A 5AFU3 5HYNB 4Y5RD 4G56B 3PVWB 4QT8A 4J78A 5GMKn 2W18A 4CY1A 5A2Qg 4J84A 2IWKA 3SCYA 4GM9A 2YMUA 4CI8A 1XKSA 4PBYA 1TBGA 1JMZB 5C2WB 3RSEC 3I7NA 2HESX 4Y7RA 2J57G 4J79A 5HQGA 2PM9A 2IURA 3JZNA 3EU7A 4J87A 3PXTD 4CZXA 2OVRB 1U4CA 3MXXA 5FKRA 2QXVA 1MG3A 2XL2A 1Q47A 3NVXA 2PM6B 3I89A 1XHMA 3J80g 1GP2B 2H68A 4L1QD 3FGBA 4GMBA 2AH1A 3SHFA 3IIWA 3AH8B 4A0BA 4QRJA 4UI9R 3OL2B 3I7KA 1B9XA 1SQJA 2H9MA 2P9UC 3GREA 4OWRA 2AGZA 4PNKB 2B5NA 2I0RA 4NSXA 1PI6A 5EARA 5HE3B 1PBYB 1RI6A 2PM7B 3EI1A 3ODTA 4ZOZA 4FHLA 4GQBB 2P9NC 2IUPA 5GXHA 2H6KA 2YNOA 3W15A 5TF2A 1U2VC 4CY5A 1P22A 2OIZA 4ZOVA 3MKSB 3EI4A 3KRXB 4A08B 3L4OD 2H6QA 3MZLA 4I79A 4YVDA 4O1QD 2CE8A 3SBQA 4Z8LA 4D0KA 4GGCA 2H9NA 2H3XA 5SXMA 3OL2A 1GXRA 4GM3A 1SQ9A 2P9PC 2GNQA 2MTAH 2XL3A 3AL9A 2CN2A 4BUJC 2CE9A 2IUVA 3EI3A 4N14A 3PXSD 2CO0A 5CXBB 2I0TA 3C5MA 5H17A 4L3GD 4D6VA 5I5JA 2Q7QA 3RMZD 2HJ4A 5FKSA 3OKWA 5AJAA 4TZ4A 4ZOXA 5C9ZB 4CI3A 2AQ5A 2Z2OA 3SN6B 5AMSA 5EALA 4AOWA 5TEEA 3OTTA 5I5IA 4A08A 4PC0A 2I3TA 1XIPA 2P9SC 3BG1A 4LG8A 3EI1B 2QC5A 4A0AA 3VGZA 2B5MA 3L4MD 5EAMA 5FKQA 3PSCB 3SJLD 4J73A 2YNNA 3RN0D 4X3EA 3EI2A 1YFQA 4JSVC 4CZVA 4A11A 1N6FA 2TRCB 1NR0A 5FQDA 4ZOYA 5CXBA 3RRMC 3F3GA 4BH6A 4CI2A 2P9IC 3EI4B 5H1MA 3JB9L 2P9LC 5IJ7E 5EAPA 5K19A 3CFSB 3F3FA 2CNXA 5EMMB 3EMHA 5HE1B 4ERQA 3E0CA 3VA6A 2XYIA 2J55H 1N6DA 5TEFA 3RFGA 3SXTD 2B5LA 3JPXA 3EI3B 4CZYA 5B4WA 3I8CA 4E5ZA 2HXCA 3SWSD 2BCJB 3SVWD 3N0DA 2B4EA 4JSPC 1N6EA 4J82A 4O3UB 2EBSA 4J8GA 3PSLA 3OKYB 4O9DA 5C2VB 4K3JB 4ERZA 1TYQC 3BG0A 3JROA 4GQ2P 4XEIC 4GGDA 3CIKB 5FKTA 4GZ8A 5KDOB 4MK0B 4FA5D 4CY3A 2O9KA 1R5MA 3UKUC 3C99A 3DM0A 3NVQA 3I7PA 1PGUA 4AEZA 4ZN4A 3EWEA 1A0RB 4A0AB 5FLXg 2IAAA 2H9PA 4A2MA 5EM2B 5H14A 4JT5C 3IJ1A 2I0SA 2UZXB 3OW8A 3EI2B 4GQ1A 3FM0A 3UVMA 1NEXB 4A11B 3I2NA 4J77A 4A7JA 3I7LA 3KRWB 4CY2A 3P4FA 4JD2C 1MDAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H5I A;  2AH0 A;  3FRX A;  3K27 A;  3I7H A;  4L9O A;  4BL0 A;  3C75 H;  4FA1 D;  1K8K C;  3IIY A;  3N0E A;  4LGN A;  3ULE C;  3OKY A;  2Z2N A;  4IA9 A;  2H47 A;  2OVP B;  1S4U X;  3JZG A;  3JZH A;  3F3P A;  2BBK H;  5IT9 g;  4JT6 C;  5HE0 B;  4JXM A;  3IJC A;  1OLZ A;  2AGW A;  2G9A A;  2OJY A;  5CYK B;  4E5Z B;  4E54 B;  1PEV A;  5EMK B;  2HKM A;  1B9Y A;  2AGL A;  4J0W A;  3A0F A;  5FXY A;  5EM2 A;  2I3S A;  2G99 A;  4O3T B;  5EML B;  4ES0 A;  3C9C A;  3MKQ A;  4HDJ A;  2PBI B;  3GFC A;  3SFZ A;  1GOT B;  3DSM A;  4IMM A;  4CI1 A;  4ERY A;  2H9L A;  2H14 A;  3JRP A;  4X61 B;  3ORV D;  4LG9 A;  4L3H D;  4J0X A;  5CXC B;  4H5J A;  2OK6 A;  1JOF A;  2YBA A;  3UR4 A;  4JSX C;  4FA4 D;  5IGO A;  3UKR C;  3BWS A;  3AL8 A;  2HYE A;  4EWR A;  2CO0 C;  3V7D B;  3SLE D;  5JWZ A;  4J86 A;  4A2L A;  2CN3 A;  1OMW B;  3DXM C;  4J8B A;  4CC9 A;  3EG6 A;  4A09 B;  2IWF A;  3UVO A;  4KFM B;  4QL1 A;  5K1C C;  2P9K C;  3PE7 A;  3ZWL B;  5CYK A;  1ERJ A;  4E54 A;  5IJ8 E;  1JJU B;  2H13 A;  3AFC A;  3IJ0 A;  3HFQ A;  3DWL C;  3MZK A;  4X63 B;  3UVL A;  4FAV D;  2OK4 A;  3DXK C;  2AGX A;  5THA A;  4GM8 A;  4FWW A;  5EMJ B;  4K3I D;  4X60 B;  3SBR A;  1SHY B;  1MG2 A;  5CXC A;  4GGA A;  4QQE A;  2HKR A;  4PXW A;  2XU7 A;  3V5W B;  1FWX A;  4XYH A;  5I5M A;  2H6N A;  3OKT A;  2OVQ B;  5GXI A;  2UZY B;  4FAN D;  4PBZ A;  2IUQ A;  5TDH B;  4PSX B;  3CFV A;  3K26 A;  3J81 g;  2GC4 A;  2YNP A;  3RLM D;  3VH0 A;  4A09 A;  3U4Y A;  2GC7 A;  2Z2P A;  4PSW B;  4XYI A;  1K32 A;  3SBP A;  5IGQ A;  1VYH C;  4OZU A;  1JMX B;  2YB8 B;  4J81 A;  4R7A B;  3I8E A;  5HE2 B;  1L0Q A;  3UVN A;  3AL8 B;  3IKO A;  3MMY A;  2PM9 B;  1QNI A;  3RFH A;  3SMR A;  4JSN C;  4FA9 D;  4ESG A;  3NVN A;  3UVK A;  4O45 A;  2HJB A;  3JAM g;  5FA5 B;  3B7F A;  5GSA A;  2AGY A;  4FB1 D;  4U7A A;  3I7O A;  2J56 H;  4A0B B;  1GG2 B;  3RN1 D;  3V9F A;  3PXW D;  3PVU B;  4U1E I;  5IC7 A;  5AFU 3;  5HYN B;  4Y5R D;  4G56 B;  3PVW B;  4QT8 A;  4J78 A;  5GMK n;  2W18 A;  4CY1 A;  5A2Q g;  4J84 A;  2IWK A;  3SCY A;  4GM9 A;  2YMU A;  4CI8 A;  1XKS A;  4PBY A;  1TBG A;  1JMZ B;  5C2W B;  3RSE C;  3I7N A;  2HES X;  4Y7R A;  2J57 G;  4J79 A;  5HQG A;  2PM9 A;  2IUR A;  3JZN A;  3EU7 A;  4J87 A;  3PXT D;  4CZX A;  2OVR B;  1U4C A;  3MXX A;  5FKR A;  2QXV A;  1MG3 A;  2XL2 A;  1Q47 A;  3NVX A;  2PM6 B;  3I89 A;  1XHM A;  3J80 g;  1GP2 B;  2H68 A;  4L1Q D;  3FGB A;  4GMB A;  2AH1 A;  3SHF A;  3IIW A;  3AH8 B;  4A0B A;  4QRJ A;  4UI9 R;  3OL2 B;  3I7K A;  1B9X A;  1SQJ A;  2H9M A;  2P9U C;  3GRE A;  4OWR A;  2AGZ A;  4PNK B;  2B5N A;  2I0R A;  4NSX A;  1PI6 A;  5EAR A;  5HE3 B;  1PBY B;  1RI6 A;  2PM7 B;  3EI1 A;  3ODT A;  4ZOZ A;  4FHL A;  4GQB B;  2P9N C;  2IUP A;  5GXH A;  2H6K A;  2YNO A;  3W15 A;  5TF2 A;  1U2V C;  4CY5 A;  1P22 A;  2OIZ A;  4ZOV A;  3MKS B;  3EI4 A;  3KRX B;  4A08 B;  3L4O D;  2H6Q A;  3MZL A;  4I79 A;  4YVD A;  4O1Q D;  2CE8 A;  3SBQ A;  4Z8L A;  4D0K A;  4GGC A;  2H9N A;  2H3X A;  5SXM A;  3OL2 A;  1GXR A;  4GM3 A;  1SQ9 A;  2P9P C;  2GNQ A;  2MTA H;  2XL3 A;  3AL9 A;  2CN2 A;  4BUJ C;  2CE9 A;  2IUV A;  3EI3 A;  4N14 A;  3PXS D;  2CO0 A;  5CXB B;  2I0T A;  3C5M A;  5H17 A;  4L3G D;  4D6V A;  5I5J A;  2Q7Q A;  3RMZ D;  2HJ4 A;  5FKS A;  3OKW A;  5AJA A;  4TZ4 A;  4ZOX A;  5C9Z B;  4CI3 A;  2AQ5 A;  2Z2O A;  3SN6 B;  5AMS A;  5EAL A;  4AOW A;  5TEE A;  3OTT A;  5I5I A;  4A08 A;  4PC0 A;  2I3T A;  1XIP A;  2P9S C;  3BG1 A;  4LG8 A;  3EI1 B;  2QC5 A;  4A0A A;  3VGZ A;  2B5M A;  3L4M D;  5EAM A;  5FKQ A;  3PSC B;  3SJL D;  4J73 A;  2YNN A;  3RN0 D;  4X3E A;  3EI2 A;  1YFQ A;  4JSV C;  4CZV A;  4A11 A;  1N6F A;  2TRC B;  1NR0 A;  5FQD A;  4ZOY A;  5CXB A;  3RRM C;  3F3G A;  4BH6 A;  4CI2 A;  2P9I C;  3EI4 B;  5H1M A;  3JB9 L;  2P9L C;  5IJ7 E;  5EAP A;  5K19 A;  3CFS B;  3F3F A;  2CNX A;  5EMM B;  3EMH A;  5HE1 B;  4ERQ A;  3E0C A;  3VA6 A;  2XYI A;  2J55 H;  1N6D A;  5TEF A;  3RFG A;  3SXT D;  2B5L A;  3JPX A;  3EI3 B;  4CZY A;  5B4W A;  3I8C A;  4E5Z A;  2HXC A;  3SWS D;  2BCJ B;  3SVW D;  3N0D A;  2B4E A;  4JSP C;  1N6E A;  4J82 A;  4O3U B;  2EBS A;  4J8G A;  3PSL A;  3OKY B;  4O9D A;  5C2V B;  4K3J B;  4ERZ A;  1TYQ C;  3BG0 A;  3JRO A;  4GQ2 P;  4XEI C;  4GGD A;  3CIK B;  5FKT A;  4GZ8 A;  5KDO B;  4MK0 B;  4FA5 D;  4CY3 A;  2O9K A;  1R5M A;  3UKU C;  3C99 A;  3DM0 A;  3NVQ A;  3I7P A;  1PGU A;  4AEZ A;  4ZN4 A;  3EWE A;  1A0R B;  4A0A B;  5FLX g;  2IAA A;  2H9P A;  4A2M A;  5EM2 B;  5H14 A;  4JT5 C;  3IJ1 A;  2I0S A;  2UZX B;  3OW8 A;  3EI2 B;  4GQ1 A;  3FM0 A;  3UVM A;  1NEX B;  4A11 B;  3I2N A;  4J77 A;  4A7J A;  3I7L A;  3KRW B;  4CY2 A;  3P4F A;  4JD2 C;  1MDA H; 
#chains in the Genus database with same CATH topology
 4H5I A;  1O6G A;  2AH0 A;  3FRX A;  3K27 A;  3I7H A;  2VDM A;  4L9O A;  4BL0 A;  1C9L A;  3C75 H;  4FA1 D;  1K8K C;  3IIY A;  3N0E A;  1H2Z A;  4LGN A;  3ULE C;  3OKY A;  2Z2N A;  4IA9 A;  2H47 A;  3O4H A;  2OVP B;  1L5G A;  1TYE A;  1S4U X;  3JZG A;  3JZH A;  2HU5 A;  3F3P A;  2BBK H;  5IT9 g;  1E5T A;  4JT6 C;  5HE0 B;  4JXM A;  3IJC A;  1OLZ A;  4RE6 A;  2AGW A;  2G9A A;  2OJY A;  5CYK B;  4E5Z B;  2EIC A;  4E54 B;  4JHN A;  1PEV A;  5EMK B;  1JV2 A;  2HKM A;  1B9Y A;  2AGL A;  4J0W A;  3A0F A;  5FXY A;  4UM9 A;  4JHP C;  2I3S A;  5EM2 A;  1UOP A;  2G99 A;  4O3T B;  5EML B;  4ES0 A;  3C9C A;  3MKQ A;  4HDJ A;  2PBI B;  3GFC A;  3IUR A;  3ZDZ A;  3SFZ A;  1GOT B;  3DSM A;  4IMM A;  4BCB A;  4ERY A;  4CI1 A;  2H9L A;  2H14 A;  3JRP A;  4X61 B;  3ORV D;  4O2W A;  5E6U A;  4LG9 A;  4L3H D;  4J0X A;  5CXC B;  4H5J A;  2OK6 A;  1JOF A;  2YBA A;  3UR4 A;  4JSX C;  4FA4 D;  3ZDY A;  3NID A;  5IGO A;  1H2W A;  3UKR C;  3BWS A;  3AL8 A;  2HYE A;  4EWR A;  2CO0 C;  3V7D B;  3SLE D;  5JWZ A;  4BCC A;  3T3M A;  3OF7 A;  4J86 A;  4DNV A;  4A2L A;  2CN3 A;  1OMW B;  3DXM C;  4J8B A;  4CC9 A;  3EG6 A;  4A09 B;  2IWF A;  3DDU A;  4KFM B;  3UVO A;  4QL1 A;  5K1C C;  2P9K C;  3PE7 A;  2VZ1 A;  3ZWL B;  5CYK A;  1ERJ A;  4E54 A;  5IJ8 E;  1JJU B;  2H13 A;  3AFC A;  3IJ0 A;  3HFQ A;  3DWL C;  3MZK A;  4X63 B;  3UVL A;  4FAV D;  2OK4 A;  2XZG A;  2AGX A;  3DXK C;  5THA A;  4GM8 A;  3QHY B;  4FWW A;  5EMJ B;  4K3I D;  4X60 B;  3SBR A;  1SHY B;  1MG2 A;  5CXC A;  5M5S A;  4GGA A;  4QQE A;  5E6R A;  4MMX A;  2HKR A;  4PXW A;  2XU7 A;  1E8M A;  3V5W B;  1FWX A;  4XYH A;  5I5M A;  2H6N A;  3OKT A;  2OVQ B;  5GXI A;  2UZY B;  4AN0 A;  4FAN D;  4PBZ A;  2IUQ A;  5TDH B;  4WK2 A;  4PSX B;  3CFV A;  3K26 A;  3J81 g;  2GC4 A;  1UOQ A;  2YNP A;  3RLM D;  3VH0 A;  4A09 A;  3U4Y A;  1VZ2 A;  2GC7 A;  5C86 A;  2Z2P A;  4PSW B;  4XYI A;  1BPO A;  1K32 A;  3SBP A;  5IGQ A;  4G1E A;  1VYH C;  4OZU A;  1JMX B;  2YB8 B;  4J81 A;  4R7A B;  3I8E A;  5HE2 B;  1L0Q A;  3UVN A;  3AL8 B;  3IKO A;  3MMY A;  2PM9 B;  5M5U A;  1QNI A;  3RFH A;  2VDL A;  3SMR A;  4JSN C;  4FA9 D;  3ZDX A;  4ESG A;  1GOH A;  2VDP A;  3NVN A;  3UVK A;  2VC2 A;  2HJB A;  4O45 A;  3JAM g;  5FA5 B;  4NEN A;  3B7F A;  5GSA A;  2AGY A;  4FB1 D;  1H2Y A;  3NIF A;  1E8N A;  4U7A A;  3I7O A;  2J56 H;  4A0B B;  1GG2 B;  3RN1 D;  4DNU A;  3V9F A;  3PXW D;  3PVU B;  4U1E I;  5IC7 A;  5AFU 3;  5HYN B;  1UOO A;  4Y5R D;  4G56 B;  3PVW B;  4QT8 A;  4J78 A;  5GMK n;  1GOG A;  2W18 A;  1I2M B;  4CY1 A;  5A2Q g;  4J84 A;  4WK0 A;  4DNW A;  2IWK A;  3IUN A;  3FCS A;  3SCY A;  4IRZ A;  4GM9 A;  2YMU A;  4G1M A;  4CI8 A;  1XKS A;  4PBY A;  1TBG A;  1JMZ B;  4L1M A;  5C2W B;  3RSE C;  3I7N A;  2HES X;  4Y7R A;  3MUN A;  2J57 G;  3IUJ A;  4J79 A;  5HQG A;  1O6F A;  1QFS A;  2PM9 A;  2IUR A;  4MMY A;  3JZN A;  3O4G A;  3GC3 B;  4BP9 A;  3EU7 A;  3T3P A;  4J87 A;  3PXT D;  4CZX A;  4AMY A;  2OVR B;  1U4C A;  3MXX A;  5FKR A;  2QXV A;  1MG3 A;  2XL2 A;  1Q47 A;  3NVX A;  2PM6 B;  3I89 A;  1XHM A;  3EQ9 A;  3J80 g;  1GP2 B;  4Z7Q A;  2H68 A;  4L1Q D;  3FGB A;  4GMB A;  2AH1 A;  3SHF A;  3IIW A;  3AH8 B;  4A0B A;  4QRJ A;  1VE7 A;  3EQ8 A;  4D9S A;  4UI9 R;  3OL2 B;  3I7K A;  1B9X A;  5M5V A;  1SQJ A;  2H9M A;  2P9U C;  5FFG A;  3GRE A;  3FCU A;  2AGZ A;  4OWR A;  1JTD B;  4PNK B;  2B5N A;  2I0R A;  4NSX A;  1PI6 A;  3QI0 A;  3K72 A;  5EAR A;  5HE3 B;  1PBY B;  1RI6 A;  2PM7 B;  3EI1 A;  2HU7 A;  3ODT A;  4ZOZ A;  4FHL A;  4GQB B;  2P9N C;  2IUP A;  3IUM A;  5GXH A;  3IVM A;  2H6K A;  2YNO A;  3W15 A;  1VZ3 A;  5TF2 A;  5M61 A;  1U2V C;  4CY5 A;  1P22 A;  2OIZ A;  4NAA A;  4ZOV A;  3MKS B;  3EI4 A;  3KRX B;  4A08 B;  1U8C A;  3MUO A;  3L4O D;  2H6Q A;  3MZL A;  4I79 A;  4YVD A;  4O1Q D;  2CE8 A;  3SBQ A;  4Z8L A;  4D0K A;  4GGC A;  2H9N A;  2H3X A;  4MMZ A;  4NC4 A;  5SXM A;  3OL2 A;  1GXR A;  4GM3 A;  1SQ9 A;  2P9P C;  2GNQ A;  2MTA H;  2XL3 A;  2VDR A;  3AL9 A;  2CN2 A;  4BUJ C;  3K71 A;  2CE9 A;  2IUV A;  3EI3 A;  4N14 A;  5M5R A;  3PXS D;  3K6S A;  2CO0 A;  3ZE2 A;  5CXB B;  2I0T A;  2EID A;  3C5M A;  3NIG A;  5H17 A;  4L3G D;  1A12 A;  3O4J A;  4WK4 A;  1GOF A;  2QR5 A;  4D6V A;  2VDN A;  2BKL A;  5I5J A;  2Q7Q A;  3RMZ D;  2HJ4 A;  5FKS A;  3OKW A;  5AJA A;  4TZ4 A;  1QFM A;  4ZOX A;  5C9Z B;  4CI3 A;  2AQ5 A;  2Z2O A;  3SN6 B;  5AMS A;  5EAL A;  4AOW A;  5TEE A;  3ZE1 A;  3OTT A;  1C9I A;  3IUL A;  5I5I A;  4A08 A;  4O02 A;  4PC0 A;  3EQ7 A;  2I3T A;  1M1X A;  1XIP A;  1K3I A;  2P9S C;  3BG1 A;  4LG8 A;  3EI1 B;  2QC5 A;  3V4P A;  4A0A A;  3VGZ A;  2B5M A;  3L4M D;  5EAM A;  5FKQ A;  3PSC B;  3SJL D;  4J73 A;  2YNN A;  2XE4 A;  4AX4 A;  3RN0 D;  4X3E A;  5C92 A;  2HU8 A;  3EI2 A;  2VZ3 A;  4BP8 A;  1YFQ A;  4JSV C;  4CZV A;  4AMZ A;  4A11 A;  2VDQ A;  1N6F A;  2TRC B;  1NR0 A;  5FQD A;  4ZOY A;  5CXB A;  4AN1 A;  3RRM C;  3F3G A;  2VDO A;  4BH6 A;  4CI2 A;  2P9I C;  3EI4 B;  1H2X A;  5H1M A;  4QAM A;  3JB9 L;  2P9L C;  5IJ7 E;  5M5T A;  5EAP A;  3MVD K;  2EIE A;  5K19 A;  3CFS B;  3F3F A;  2CNX A;  3VI3 A;  5EMM B;  3EMH A;  1YR2 A;  5HE1 B;  4ERQ A;  3E0C A;  3VA6 A;  2XYI A;  3O4I A;  2J55 H;  1N6D A;  5TEF A;  3RFG A;  3SXT D;  2B5L A;  3JPX A;  3EI3 B;  3GD1 I;  4NBM A;  4CZY A;  4Z7N A;  5B4W A;  3I8C A;  4G55 A;  4E5Z A;  2HXC A;  3SWS D;  2BCJ B;  4BCD A;  3SVW D;  3V4V A;  3N0D A;  2B4E A;  4JSP C;  1N6E A;  4UM8 A;  4J82 A;  4O3U B;  2EBS A;  4J8G A;  3PSL A;  3OKY B;  4O9D A;  5HDB A;  5C2V B;  4K3J B;  4ERZ A;  1TYQ C;  3BG0 A;  3JRO A;  4GQ2 P;  4XEI C;  4GGD A;  3CIK B;  5FKT A;  4GZ8 A;  5KDO B;  5E6S A;  4MK0 B;  4FA5 D;  4CY3 A;  2O9K A;  1R5M A;  1UTC A;  1T2X A;  3IUQ A;  3C99 A;  3UKU C;  3DM0 A;  2XDW A;  3NVQ A;  3I7P A;  1PGU A;  4AEZ A;  4RE5 A;  5FFO A;  4ZN4 A;  2QZP A;  3EWE A;  1A0R B;  4A0A B;  4Z7O A;  5FLX g;  2IAA A;  2H9P A;  3IJE A;  4A2M A;  5EM2 B;  5H14 A;  4JT5 C;  3KCI A;  2VDK A;  3ZE0 A;  3IJ1 A;  2I0S A;  2UZX B;  3OW8 A;  3EI2 B;  4GQ1 A;  3FM0 A;  3VI4 A;  3UVM A;  1NEX B;  4A11 B;  2JKX A;  3I2N A;  4J77 A;  4A7J A;  2EIB A;  1VE6 A;  3I7L A;  3KRW B;  4CY2 A;  4WJK A;  3P4F A;  4JD2 C;  2WQ8 A;  1MDA H; 
#chains in the Genus database with same CATH homology
 4H5I A;  2AH0 A;  3FRX A;  3K27 A;  3I7H A;  4L9O A;  4BL0 A;  3C75 H;  4FA1 D;  1K8K C;  3IIY A;  3N0E A;  4LGN A;  3ULE C;  3OKY A;  2Z2N A;  4IA9 A;  2H47 A;  2OVP B;  1S4U X;  3JZG A;  3JZH A;  3F3P A;  2BBK H;  5IT9 g;  4JT6 C;  5HE0 B;  4JXM A;  3IJC A;  1OLZ A;  2AGW A;  2G9A A;  2OJY A;  5CYK B;  4E5Z B;  4E54 B;  1PEV A;  5EMK B;  2HKM A;  1B9Y A;  2AGL A;  4J0W A;  3A0F A;  5FXY A;  5EM2 A;  2I3S A;  2G99 A;  4O3T B;  5EML B;  4ES0 A;  3C9C A;  3MKQ A;  4HDJ A;  2PBI B;  3GFC A;  3SFZ A;  1GOT B;  3DSM A;  4IMM A;  4CI1 A;  4ERY A;  2H9L A;  2H14 A;  3JRP A;  4X61 B;  3ORV D;  4LG9 A;  4L3H D;  4J0X A;  5CXC B;  4H5J A;  2OK6 A;  1JOF A;  2YBA A;  3UR4 A;  4JSX C;  4FA4 D;  5IGO A;  3UKR C;  3BWS A;  3AL8 A;  2HYE A;  4EWR A;  2CO0 C;  3V7D B;  3SLE D;  5JWZ A;  4J86 A;  4A2L A;  2CN3 A;  1OMW B;  3DXM C;  4J8B A;  4CC9 A;  3EG6 A;  4A09 B;  2IWF A;  3UVO A;  4KFM B;  4QL1 A;  5K1C C;  2P9K C;  3PE7 A;  3ZWL B;  5CYK A;  1ERJ A;  4E54 A;  5IJ8 E;  1JJU B;  2H13 A;  3AFC A;  3IJ0 A;  3HFQ A;  3DWL C;  3MZK A;  4X63 B;  3UVL A;  4FAV D;  2OK4 A;  3DXK C;  2AGX A;  5THA A;  4GM8 A;  4FWW A;  5EMJ B;  4K3I D;  4X60 B;  3SBR A;  1SHY B;  1MG2 A;  5CXC A;  4GGA A;  4QQE A;  2HKR A;  4PXW A;  2XU7 A;  3V5W B;  1FWX A;  4XYH A;  5I5M A;  2H6N A;  3OKT A;  2OVQ B;  5GXI A;  2UZY B;  4FAN D;  4PBZ A;  2IUQ A;  5TDH B;  4PSX B;  3CFV A;  3K26 A;  3J81 g;  2GC4 A;  2YNP A;  3RLM D;  3VH0 A;  4A09 A;  3U4Y A;  2GC7 A;  2Z2P A;  4PSW B;  4XYI A;  1K32 A;  3SBP A;  5IGQ A;  1VYH C;  4OZU A;  1JMX B;  2YB8 B;  4J81 A;  4R7A B;  3I8E A;  5HE2 B;  1L0Q A;  3UVN A;  3AL8 B;  3IKO A;  3MMY A;  2PM9 B;  1QNI A;  3RFH A;  3SMR A;  4JSN C;  4FA9 D;  4ESG A;  3NVN A;  3UVK A;  4O45 A;  2HJB A;  3JAM g;  5FA5 B;  3B7F A;  5GSA A;  2AGY A;  4FB1 D;  4U7A A;  3I7O A;  2J56 H;  4A0B B;  1GG2 B;  3RN1 D;  3V9F A;  3PXW D;  3PVU B;  4U1E I;  5IC7 A;  5AFU 3;  5HYN B;  4Y5R D;  4G56 B;  3PVW B;  4QT8 A;  4J78 A;  5GMK n;  2W18 A;  4CY1 A;  5A2Q g;  4J84 A;  2IWK A;  3SCY A;  4GM9 A;  2YMU A;  4CI8 A;  1XKS A;  4PBY A;  1TBG A;  1JMZ B;  5C2W B;  3RSE C;  3I7N A;  2HES X;  4Y7R A;  2J57 G;  4J79 A;  5HQG A;  2PM9 A;  2IUR A;  3JZN A;  3EU7 A;  4J87 A;  3PXT D;  4CZX A;  2OVR B;  1U4C A;  3MXX A;  5FKR A;  2QXV A;  1MG3 A;  2XL2 A;  1Q47 A;  3NVX A;  2PM6 B;  3I89 A;  1XHM A;  3J80 g;  1GP2 B;  2H68 A;  4L1Q D;  3FGB A;  4GMB A;  2AH1 A;  3SHF A;  3IIW A;  3AH8 B;  4A0B A;  4QRJ A;  4UI9 R;  3OL2 B;  3I7K A;  1B9X A;  1SQJ A;  2H9M A;  2P9U C;  3GRE A;  4OWR A;  2AGZ A;  4PNK B;  2B5N A;  2I0R A;  4NSX A;  1PI6 A;  5EAR A;  5HE3 B;  1PBY B;  1RI6 A;  2PM7 B;  3EI1 A;  3ODT A;  4ZOZ A;  4FHL A;  4GQB B;  2P9N C;  2IUP A;  5GXH A;  2H6K A;  2YNO A;  3W15 A;  5TF2 A;  1U2V C;  4CY5 A;  1P22 A;  2OIZ A;  4ZOV A;  3MKS B;  3EI4 A;  3KRX B;  4A08 B;  3L4O D;  2H6Q A;  3MZL A;  4I79 A;  4YVD A;  4O1Q D;  2CE8 A;  3SBQ A;  4Z8L A;  4D0K A;  4GGC A;  2H9N A;  2H3X A;  5SXM A;  3OL2 A;  1GXR A;  4GM3 A;  1SQ9 A;  2P9P C;  2GNQ A;  2MTA H;  2XL3 A;  3AL9 A;  2CN2 A;  4BUJ C;  2CE9 A;  2IUV A;  3EI3 A;  4N14 A;  3PXS D;  2CO0 A;  5CXB B;  2I0T A;  3C5M A;  5H17 A;  4L3G D;  4D6V A;  5I5J A;  2Q7Q A;  3RMZ D;  2HJ4 A;  5FKS A;  3OKW A;  5AJA A;  4TZ4 A;  4ZOX A;  5C9Z B;  4CI3 A;  2AQ5 A;  2Z2O A;  3SN6 B;  5AMS A;  5EAL A;  4AOW A;  5TEE A;  3OTT A;  5I5I A;  4A08 A;  4PC0 A;  2I3T A;  1XIP A;  2P9S C;  3BG1 A;  4LG8 A;  3EI1 B;  2QC5 A;  4A0A A;  3VGZ A;  2B5M A;  3L4M D;  5EAM A;  5FKQ A;  3PSC B;  3SJL D;  4J73 A;  2YNN A;  3RN0 D;  4X3E A;  3EI2 A;  1YFQ A;  4JSV C;  4CZV A;  4A11 A;  1N6F A;  2TRC B;  1NR0 A;  5FQD A;  4ZOY A;  5CXB A;  3RRM C;  3F3G A;  4BH6 A;  4CI2 A;  2P9I C;  3EI4 B;  5H1M A;  3JB9 L;  2P9L C;  5IJ7 E;  5EAP A;  5K19 A;  3CFS B;  3F3F A;  2CNX A;  5EMM B;  3EMH A;  5HE1 B;  4ERQ A;  3E0C A;  3VA6 A;  2XYI A;  2J55 H;  1N6D A;  5TEF A;  3RFG A;  3SXT D;  2B5L A;  3JPX A;  3EI3 B;  4CZY A;  5B4W A;  3I8C A;  4E5Z A;  2HXC A;  3SWS D;  2BCJ B;  3SVW D;  3N0D A;  2B4E A;  4JSP C;  1N6E A;  4J82 A;  4O3U B;  2EBS A;  4J8G A;  3PSL A;  3OKY B;  4O9D A;  5C2V B;  4K3J B;  4ERZ A;  1TYQ C;  3BG0 A;  3JRO A;  4GQ2 P;  4XEI C;  4GGD A;  3CIK B;  5FKT A;  4GZ8 A;  5KDO B;  4MK0 B;  4FA5 D;  4CY3 A;  2O9K A;  1R5M A;  3UKU C;  3C99 A;  3DM0 A;  3NVQ A;  3I7P A;  1PGU A;  4AEZ A;  4ZN4 A;  3EWE A;  1A0R B;  4A0A B;  5FLX g;  2IAA A;  2H9P A;  4A2M A;  5EM2 B;  5H14 A;  4JT5 C;  3IJ1 A;  2I0S A;  2UZX B;  3OW8 A;  3EI2 B;  4GQ1 A;  3FM0 A;  3UVM A;  1NEX B;  4A11 B;  3I2N A;  4J77 A;  4A7J A;  3I7L A;  3KRW B;  4CY2 A;  3P4F A;  4JD2 C;  1MDA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...