1PIV4

Binding of the antiviral drug win51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 3 (SUBUNIT VP1)
publication title Binding of the antiviral drug WIN51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14.
pubmed doi rcsb
source organism Poliovirus type 3 (strains p3/leon/37 and p3/leon 12a[1]b)
molecule tags Virus
total genus 4
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1piv400
2RS14 1AR84 1RUC4 1AR94 1EAH4 1K5MD 1PIV4 3J8F4 2RM24 1H8TD 2R044 2X5ID 1RVF4 1MQTD 1R094 1RMU4 2HWB4 1RUI4 1NCQD 1VBD4 2RMU4 2RS34 1RUH4 1AR74 4Q4Y4 1ASJ4 1RUG4 4Q4W4 1Z7S4 1RUF4 1PO24 1VBA4 1NA1D 1PVC4 4GB34 2PLV4 1VBB4 2HWC4 1D4M4 2R064 1RUE4 3JBG4 4Q4X4 1AL24 1BEV4 1COV4 1PO14 4PDWD 4Q4V4 4RHV4 1R084 2RS54 2R074 1OOPD 1RHI4 1RUD4 3JD74 1VBC4 1HXS4 1RUJ4 2RR14 1HRV4 1AR64 1VRH4 1HRI4 1VBE4 1POV0 1EV14
chains in the Genus database with same CATH superfamily
2RS14 3J8F4 2WU5A 2RM24 1H8TD 1KFYA 2H88A 2R044 4KX6A 2RS34 2R7FA 3AE9A 3AEGA 3P4QA 4YSZA 3AEBA 1VBA4 1PVC4 3JBG4 2WDRA 1AL24 1BEV4 4RHV4 2ACZA 2WQYA 3JD74 1NEKA 1NENA 5C2TA 1RUJ4 2RR14 3AE3A 2PYJA 1HRI4 4YTNA 3AECA 3VR9A 2WS3A 3AE4A 1R094 3P4SA 1NCQD 1YQ3A 1RUH4 4Q4Y4 5C3JA 1ASJ4 2PYLA 4YTPA 4YSXA 1XI1A 1PO24 2H89A 1NA1D 3P4RA 1VBB4 3FI7A 3VRBA 1COV4 3AE6A 1OOPD 1RHI4 1RUD4 1VBC4 3AE5A 1HXS4 1AR64 3AEAA 1VBE4 1RVF4 1AR84 1RUC4 3AEFA 2X5ID 1MQTD 2RMU4 2HWB4 1RUI4 1VBD4 3AEDA 1ZOYA 2WDQA 1XHZA 1RUF4 2B76A 2PZSA 3SUCA 2R064 4YXDA 3AEEA 3GQKA 4YTMA 4Q4V4 1R084 3ABVA 2EX3A 3AE2A 1L0VA 1VRH4 4YSYA 1EV14 4YT0A 1AR94 1EAH4 1K5MD 1PIV4 2PW9A 1ZP0A 1KF6A 1XHXA 1RMU4 1AR74 3VRAA 3SFEA 4Q4W4 1Z7S4 4GB34 2PLV4 2WU2A 2HWC4 1D4M4 3AE1A 1RUE4 3SFDA 3CIRA 4Q4X4 1PO14 4PDWD 2WP9A 2RS54 2R074 1YQ4A 3AE8A 2FBWA 2PY5A 3P4PA 1HRV4 2WDVA 3VR8A 3AE7A 1RUG4 1POV0 3GQHA
chains in the Genus database with same CATH topology
2RS14 1AR84 1RUC4 1AR94 1EAH4 1K5MD 1PIV4 3J8F4 2RM24 1H8TD 2R044 2X5ID 1RVF4 1MQTD 1R094 1RMU4 2HWB4 1RUI4 1NCQD 1VBD4 2RMU4 2RS34 1RUH4 1AR74 4Q4Y4 1ASJ4 1RUG4 4Q4W4 1Z7S4 1RUF4 1PO24 1VBA4 1NA1D 1PVC4 4GB34 2PLV4 1VBB4 2HWC4 1D4M4 2R064 1RUE4 3JBG4 4Q4X4 1AL24 1BEV4 1COV4 1PO14 4PDWD 4Q4V4 4RHV4 1R084 2RS54 2R074 1OOPD 1RHI4 1RUD4 3JD74 1VBC4 1HXS4 1RUJ4 2RR14 1HRV4 1AR64 1VRH4 1HRI4 1VBE4 1POV0 1EV14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS1 4;  1AR8 4;  1RUC 4;  1AR9 4;  1EAH 4;  1K5M D;  1PIV 4;  3J8F 4;  2RM2 4;  1H8T D;  2R04 4;  2X5I D;  1RVF 4;  1MQT D;  1R09 4;  1RMU 4;  2HWB 4;  1RUI 4;  1NCQ D;  1VBD 4;  2RMU 4;  2RS3 4;  1RUH 4;  1AR7 4;  4Q4Y 4;  1ASJ 4;  1RUG 4;  4Q4W 4;  1Z7S 4;  1RUF 4;  1PO2 4;  1VBA 4;  1NA1 D;  1PVC 4;  4GB3 4;  2PLV 4;  1VBB 4;  2HWC 4;  1D4M 4;  2R06 4;  1RUE 4;  3JBG 4;  4Q4X 4;  1AL2 4;  1BEV 4;  1COV 4;  1PO1 4;  4PDW D;  4Q4V 4;  4RHV 4;  1R08 4;  2RS5 4;  2R07 4;  1OOP D;  1RHI 4;  1RUD 4;  3JD7 4;  1VBC 4;  1HXS 4;  1RUJ 4;  2RR1 4;  1HRV 4;  1AR6 4;  1VRH 4;  1HRI 4;  1VBE 4;  1POV 0;  1EV1 4; 
#chains in the Genus database with same CATH topology
 2RS1 4;  3J8F 4;  2WU5 A;  2RM2 4;  1H8T D;  1KFY A;  2H88 A;  2R04 4;  4KX6 A;  2RS3 4;  2R7F A;  3AE9 A;  3AEG A;  3P4Q A;  4YSZ A;  3AEB A;  1VBA 4;  1PVC 4;  3JBG 4;  2WDR A;  1AL2 4;  1BEV 4;  4RHV 4;  2ACZ A;  2WQY A;  3JD7 4;  1NEK A;  1NEN A;  5C2T A;  1RUJ 4;  2RR1 4;  3AE3 A;  2PYJ A;  1HRI 4;  4YTN A;  3AEC A;  3VR9 A;  2WS3 A;  3AE4 A;  1R09 4;  3P4S A;  1NCQ D;  1YQ3 A;  1RUH 4;  4Q4Y 4;  5C3J A;  1ASJ 4;  2PYL A;  4YTP A;  4YSX A;  1XI1 A;  1PO2 4;  2H89 A;  1NA1 D;  3P4R A;  1VBB 4;  3FI7 A;  3VRB A;  1COV 4;  3AE6 A;  1OOP D;  1RHI 4;  1RUD 4;  1VBC 4;  3AE5 A;  1HXS 4;  1AR6 4;  3AEA A;  1VBE 4;  1RVF 4;  1AR8 4;  1RUC 4;  3AEF A;  2X5I D;  1MQT D;  2RMU 4;  2HWB 4;  1RUI 4;  1VBD 4;  3AED A;  1ZOY A;  2WDQ A;  1XHZ A;  1RUF 4;  2B76 A;  2PZS A;  3SUC A;  2R06 4;  4YXD A;  3AEE A;  3GQK A;  4YTM A;  4Q4V 4;  1R08 4;  3ABV A;  2EX3 A;  3AE2 A;  1L0V A;  1VRH 4;  4YSY A;  1EV1 4;  4YT0 A;  1AR9 4;  1EAH 4;  1K5M D;  1PIV 4;  2PW9 A;  1ZP0 A;  1KF6 A;  1XHX A;  1RMU 4;  1AR7 4;  3VRA A;  3SFE A;  4Q4W 4;  1Z7S 4;  4GB3 4;  2PLV 4;  2WU2 A;  2HWC 4;  1D4M 4;  3AE1 A;  1RUE 4;  3SFD A;  3CIR A;  4Q4X 4;  1PO1 4;  4PDW D;  2WP9 A;  2RS5 4;  2R07 4;  1YQ4 A;  3AE8 A;  2FBW A;  2PY5 A;  3P4P A;  1HRV 4;  2WDV A;  3VR8 A;  3AE7 A;  1RUG 4;  1POV 0;  3GQH A; 
#chains in the Genus database with same CATH homology
 2RS1 4;  1AR8 4;  1RUC 4;  1AR9 4;  1EAH 4;  1K5M D;  1PIV 4;  3J8F 4;  2RM2 4;  1H8T D;  2R04 4;  2X5I D;  1RVF 4;  1MQT D;  1R09 4;  1RMU 4;  2HWB 4;  1RUI 4;  1NCQ D;  1VBD 4;  2RMU 4;  2RS3 4;  1RUH 4;  1AR7 4;  4Q4Y 4;  1ASJ 4;  1RUG 4;  4Q4W 4;  1Z7S 4;  1RUF 4;  1PO2 4;  1VBA 4;  1NA1 D;  1PVC 4;  4GB3 4;  2PLV 4;  1VBB 4;  2HWC 4;  1D4M 4;  2R06 4;  1RUE 4;  3JBG 4;  4Q4X 4;  1AL2 4;  1BEV 4;  1COV 4;  1PO1 4;  4PDW D;  4Q4V 4;  4RHV 4;  1R08 4;  2RS5 4;  2R07 4;  1OOP D;  1RHI 4;  1RUD 4;  3JD7 4;  1VBC 4;  1HXS 4;  1RUJ 4;  2RR1 4;  1HRV 4;  1AR6 4;  1VRH 4;  1HRI 4;  1VBE 4;  1POV 0;  1EV1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...