1PIV4

Binding of the antiviral drug win51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
62
Chain Sequence
b'GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 3 (SUBUNIT VP1)
publication title Binding of the antiviral drug WIN51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14.
pubmed doi rcsb
source organism Poliovirus type 3 (strains p3/leon/37 and p3/leon 12a[1]b)
molecule tags Virus
total genus 4
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1piv400
1RUI4 1RUE4 1VRH4 4RHV4 1COV4 2R044 4Q4V4 1POV0 2HWB4 2R064 4Q4X4 1VBB4 1RUC4 1MQTD 1RUF4 2HWC4 4Q4W4 2RM24 1RUH4 1EV14 1VBA4 1VBE4 1PO24 1RUG4 2X5ID 2PLV4 1AR74 1H8TD 1HRI4 4GB34 4PDWD 1PVC4 3JD74 1EAH4 1RUD4 1AR94 1AR64 2RS34 1RUJ4 2RS14 1AR84 3J8F4 1NA1D 1AL24 1PO14 1HXS4 1VBC4 1Z7S4 2RMU4 1VBD4 3JBG4 1HRV4 1BEV4 1NCQD 2RR14 1RHI4 1K5MD 1ASJ4 1D4M4 1PIV4 1RMU4 1RVF4 2R074 1R094 2RS54 1OOPD 1R084 4Q4Y4
chains in the Genus database with same CATH superfamily
1NENA 1COV4 2HWB4 3VRBA 5C2TA 3CIRA 1KFYA 1RUH4 1EV14 2WU2A 3AEAA 2FBWA 1L0VA 1H8TD 2PW9A 2WP9A 3AE5A 3AEDA 3J8F4 1AL24 1PO14 3FI7A 2WDVA 3JBG4 3P4PA 2ACZA 1BEV4 2PY5A 2PZSA 3AE8A 2R074 3VR8A 1XHZA 1OOPD 4YSXA 4YT0A 1POV0 3AE6A 2PYLA 2RM24 3SFDA 2R7FA 1VBE4 1YQ4A 2PLV4 3ABVA 3AE4A 4PDWD 3VRAA 1RUD4 3GQHA 2WDRA 3SFEA 2EX3A 2RS14 2WDQA 3AE7A 1Z7S4 1VBC4 4YXDA 1HRV4 3AE2A 4YTNA 1NEKA 1NCQD 2PYJA 1RHI4 1RVF4 1PIV4 4YTPA 1R094 3P4QA 3AEFA 3SUCA 1KF6A 1RUI4 1RUE4 1VRH4 3AECA 4Q4X4 1RUC4 1RUF4 3AE1A 1ZP0A 3AEGA 1VBA4 2X5ID 1PO24 4GB34 1AR94 1YQ3A 4YTMA 2RS34 4YSYA 1AR84 1NA1D 3AE3A 2H88A 1ZOYA 5C3JA 2RR14 1RMU4 1K5MD 1ASJ4 1D4M4 4YSZA 2WQYA 1R084 4Q4Y4 3P4SA 4RHV4 2R044 4Q4V4 4KX6A 2R064 1VBB4 2HWC4 1MQTD 4Q4W4 2WU5A 1RUG4 1AR74 1XHXA 1HRI4 2B76A 3GQKA 1PVC4 3JD74 1EAH4 1AR64 3AEEA 1RUJ4 3P4RA 1HXS4 2RMU4 3AE9A 1VBD4 1XI1A 2H89A 3VR9A 3AEBA 2RS54 2WS3A
chains in the Genus database with same CATH topology
1RUI4 1RUE4 1VRH4 4RHV4 1COV4 2R044 4Q4V4 1POV0 2HWB4 2R064 4Q4X4 1VBB4 1RUC4 1MQTD 1RUF4 2HWC4 4Q4W4 2RM24 1RUH4 1EV14 1VBA4 1VBE4 1PO24 1RUG4 2X5ID 2PLV4 1AR74 1H8TD 1HRI4 4GB34 4PDWD 1PVC4 3JD74 1EAH4 1RUD4 1AR94 1AR64 2RS34 1RUJ4 2RS14 1AR84 3J8F4 1NA1D 1AL24 1PO14 1HXS4 1VBC4 1Z7S4 2RMU4 1VBD4 3JBG4 1HRV4 1BEV4 1NCQD 2RR14 1RHI4 1K5MD 1ASJ4 1D4M4 1PIV4 1RMU4 1RVF4 2R074 1R094 2RS54 1OOPD 1R084 4Q4Y4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUI 4;  1RUE 4;  1VRH 4;  4RHV 4;  1COV 4;  2R04 4;  4Q4V 4;  1POV 0;  2HWB 4;  2R06 4;  4Q4X 4;  1VBB 4;  1RUC 4;  1MQT D;  1RUF 4;  2HWC 4;  4Q4W 4;  2RM2 4;  1RUH 4;  1EV1 4;  1VBA 4;  1VBE 4;  1PO2 4;  1RUG 4;  2X5I D;  2PLV 4;  1AR7 4;  1H8T D;  1HRI 4;  4GB3 4;  4PDW D;  1PVC 4;  3JD7 4;  1EAH 4;  1RUD 4;  1AR9 4;  1AR6 4;  2RS3 4;  1RUJ 4;  2RS1 4;  1AR8 4;  3J8F 4;  1NA1 D;  1AL2 4;  1PO1 4;  1HXS 4;  1VBC 4;  1Z7S 4;  2RMU 4;  1VBD 4;  3JBG 4;  1HRV 4;  1BEV 4;  1NCQ D;  2RR1 4;  1RHI 4;  1K5M D;  1ASJ 4;  1D4M 4;  1PIV 4;  1RMU 4;  1RVF 4;  2R07 4;  1R09 4;  2RS5 4;  1OOP D;  1R08 4;  4Q4Y 4; 
#chains in the Genus database with same CATH topology
 1NEN A;  1COV 4;  2HWB 4;  3VRB A;  5C2T A;  3CIR A;  1KFY A;  1RUH 4;  1EV1 4;  2WU2 A;  3AEA A;  2FBW A;  1L0V A;  1H8T D;  2PW9 A;  2WP9 A;  3AE5 A;  3AED A;  3J8F 4;  1AL2 4;  1PO1 4;  3FI7 A;  2WDV A;  3JBG 4;  3P4P A;  2ACZ A;  1BEV 4;  2PY5 A;  2PZS A;  3AE8 A;  2R07 4;  3VR8 A;  1XHZ A;  1OOP D;  4YSX A;  4YT0 A;  1POV 0;  3AE6 A;  2PYL A;  2RM2 4;  3SFD A;  2R7F A;  1VBE 4;  1YQ4 A;  2PLV 4;  3ABV A;  3AE4 A;  4PDW D;  3VRA A;  1RUD 4;  3GQH A;  2WDR A;  3SFE A;  2EX3 A;  2RS1 4;  2WDQ A;  3AE7 A;  1Z7S 4;  1VBC 4;  4YXD A;  1HRV 4;  3AE2 A;  4YTN A;  1NEK A;  1NCQ D;  2PYJ A;  1RHI 4;  1RVF 4;  1PIV 4;  4YTP A;  1R09 4;  3P4Q A;  3AEF A;  3SUC A;  1KF6 A;  1RUI 4;  1RUE 4;  1VRH 4;  3AEC A;  4Q4X 4;  1RUC 4;  1RUF 4;  3AE1 A;  1ZP0 A;  3AEG A;  1VBA 4;  2X5I D;  1PO2 4;  4GB3 4;  1AR9 4;  1YQ3 A;  4YTM A;  2RS3 4;  4YSY A;  1AR8 4;  1NA1 D;  3AE3 A;  2H88 A;  1ZOY A;  5C3J A;  2RR1 4;  1RMU 4;  1K5M D;  1ASJ 4;  1D4M 4;  4YSZ A;  2WQY A;  1R08 4;  4Q4Y 4;  3P4S A;  4RHV 4;  2R04 4;  4Q4V 4;  4KX6 A;  2R06 4;  1VBB 4;  2HWC 4;  1MQT D;  4Q4W 4;  2WU5 A;  1RUG 4;  1AR7 4;  1XHX A;  1HRI 4;  2B76 A;  3GQK A;  1PVC 4;  3JD7 4;  1EAH 4;  1AR6 4;  3AEE A;  1RUJ 4;  3P4R A;  1HXS 4;  2RMU 4;  3AE9 A;  1VBD 4;  1XI1 A;  2H89 A;  3VR9 A;  3AEB A;  2RS5 4;  2WS3 A; 
#chains in the Genus database with same CATH homology
 1RUI 4;  1RUE 4;  1VRH 4;  4RHV 4;  1COV 4;  2R04 4;  4Q4V 4;  1POV 0;  2HWB 4;  2R06 4;  4Q4X 4;  1VBB 4;  1RUC 4;  1MQT D;  1RUF 4;  2HWC 4;  4Q4W 4;  2RM2 4;  1RUH 4;  1EV1 4;  1VBA 4;  1VBE 4;  1PO2 4;  1RUG 4;  2X5I D;  2PLV 4;  1AR7 4;  1H8T D;  1HRI 4;  4GB3 4;  4PDW D;  1PVC 4;  3JD7 4;  1EAH 4;  1RUD 4;  1AR9 4;  1AR6 4;  2RS3 4;  1RUJ 4;  2RS1 4;  1AR8 4;  3J8F 4;  1NA1 D;  1AL2 4;  1PO1 4;  1HXS 4;  1VBC 4;  1Z7S 4;  2RMU 4;  1VBD 4;  3JBG 4;  1HRV 4;  1BEV 4;  1NCQ D;  2RR1 4;  1RHI 4;  1K5M D;  1ASJ 4;  1D4M 4;  1PIV 4;  1RMU 4;  1RVF 4;  2R07 4;  1R09 4;  2RS5 4;  1OOP D;  1R08 4;  4Q4Y 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...