1PJ3A

Crystal structure of human mitochondrial nad(p)+-dependent malic enzyme in a pentary complex with natural substrate pyruvate, cofactor nad+, mn++, and allosteric activator fumarate.
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
553
structure length
553
Chain Sequence
IKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords NAD-dependent malic enzyme, mitochondrial
total genus 191
structure length 553
sequence length 553
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pj3A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pj3A01
5A06A 1SMKA 4JNKA 4W9NA 1E1KA 3PYXA 5ITWA 3AOEA 3KYCB 3L07A 3QY9A 1E3IA 4CQMB 5JCJA 3B20A 4JBHA 4LW8A 1LU9A 3DMTC 5BT9A 4QFCA 5CP8A 2ILTA 5I8WA 4DL9A 2AE1A 1SZJG 3TN7A 5IZ4A 2WSBA 1B7GO 4TRJA 5EERA 4XB1A 1PU2A 4BNJA 3R3SA 4RPJA 4ZRNA 4NBTA 3E5RA 4A5OA 1ISGA 3U3XA 2PZJA 1SAYA 1UJMA 1QR6A 1DC5A 1WW8A 2GPTA 4PLTA 1WDKA 3EDMA 1UP6A 2AEMA 3NTOA 1MLDA 3AY7A 2NLOA 4B79A 3NEPX 3QE3A 1TB4A 2I67A 4YRDA 4QX6A 1AN9A 4W4TA 3VH4A 2FN7A 6ADHA 4E5PA 3KHUA 4KTVE 1TLTA 3IC5A 3I3OA 3OA2A 1EUCA 1R4NB 4J2HA 4ALJA 1R4MA 1I33A 4LISA 4A7PA 3JYQA 4LCJA 5TT1A 3UOGA 3PLNA 4X54A 1JKFA 3JYLA 1N1GA 1IL0A 1C0KA 3LU1A 2FOIA 3VPXA 3ZWPA 1YKFA 5DP2A 4BB6A 5CDYA 3KYBA 4CLRB 3WIDA 3BMOB 1YJQA 3NYWA 3E5MA 1CRWG 1GUYA 2DTXA 3AY3A 4WLEA 1GZ6A 2AQKA 2V6FA 1Q0LA 3JD0A 3TL3A 1FMCA 1Z75A 5TLSA 1I2BA 2VT3A 5TGDA 4L4RA 5DDIP 3WTCA 3FD8A 1Q7GA 4CMEC 4CODB 2X9VA 1LC3A 4DLLA 4B4OA 1MC5A 4NI5A 2C2YA 1NQAO 1GZ3A 5CDUA 4R5MA 3BIOA 4J0FA 5GZ1A 2QYSA 1V3VA 3OJLA 4CM4A 3Q11A 1EZ4A 1I24A 2OFPA 2Q46A 1D1SA 3V8BA 1VL8A 3ZWWA 1ADGA 1OC4A 2A9FA 3LDHA 2D2IA 4L9RA 5T6BA 1UZNA 4IM7A 1CERA 4YAGA 2YV2A 2O48X 1GCOA 3ZV5A 4ILKA 3RAJA 1MP0A 3PWSA 1J4AA 2NSDA 5AYVA 4DQXA 1UXIA 1E3WA 1BMDA 3I4CA 1J0XO 4R1SA 4IJWA 3F46A 1EDOA 2E6UX 4I9NA 4JCOA 3R0IA 4LCEA 1DO8A 2HMTA 3SVTA 4L76A 4LMPA 2ZTLA 1PJQA 4CQLB 4OXKA 1R37A 1PWZA 4A73A 1D7OA 3RU9A 1MFPA 1LEHA 2X0RA 4UVDA 2PA3A 2Y99A 4TRRA 5EESA 3IQDB 2VYVD 1ZK1A 1WWKA 2QW8A 5BSEA 1H0KA 4BKUA 1UAGA 1R15A 4CMKA 3IAHA 1BSVA 1U4SA 2Q50A 1I10A 3GPIA 4IMPA 4PLZA 3VZPA 3CEAA 4JGBA 3TFOA 2DC1A 1PZGA 3K2BA 4CMEA 1KEWA 4CUJA 2FZEA 1UDAA 2C59A 1LUAA 1NBOA 2YYYA 1ZJYA 3VVCA 4MIOA 5FI5A 1M6HA 1P1JA 5EQFA 1JAYA 4BO7A 2GZ1A 2X0JA 4XIYA 3GK3A 4ZN6A 2O3SA 1QLHA 2PV7A 1A72A 3OQ1A 3FR7A 3BXXA 1ZMTA 4J4BA 5CPBA 4ZU3A 4BO0A 5B1YA 2X5KO 3GUYA 4CMJA 1UXJA 2E49A 5JAZA 5JDCC 3KXDA 3UXYA 3DWFA 3DBLA 3JQ9C 4FFOA 4BNYA 3B1KA 4FC7A 1CDOA 3PEFA 4JQCA 4JXKA 4DIOA 3DZIA 4P4GA 3U4HA 1UXKA 3I52A 3MWDB 4HKTA 4S1VA 3B1JA 1I3LA 3DOCA 4O59O 3WDSA 2FR0A 4OO3A 4FQ8A 5B37A 4MP8A 1WZEA 5BSGA 3JV7A 2Y1EA 3QRWA 3X2FA 2FHSA 4NPCA 1U3WA 1A4UA 4L0QA 3D1LA 4ALNA 3M1LA 1UDBA 3KYCA 4IZHA 1OFGA 4D46A 4UUNA 4NFHA 4A2CA 2RIRA 4RCVA 5IFLA 1LA2A 1E1NA 4CUKA 2IDZA 1DB3A 4MP6A 3PGJA 4XX0A 4KUHA 3VKUA 4OM8A 1W6UA 3QP9A 3A9WA 3UF0A 1EEHA 1X0XA 4MKXA 3FNEA 4OAQA 3KYDB 3NAQA 2ZB8A 4CM5A 3H9QA 3HHPA 4DQVA 1E3LA 4AICA 3O8QB 4Z9YA 4J16A 3RC2A 2VCYA 4CMAA 3ANNA 5JAMA 1WXDA 2GN4A 3AM3A 1CQJA 4G65A 5F5LA 4KUEA 3NTQA 1B15A 1EBFA 1Z6ZA 2QYTA 3OECA 1H2HA 4WOJA 3AOGA 3G49A 4FR5A 1N1EA 4E5MA 5DBFA 1JW9B 1U8XX 2BFOA 1XYGA 4U6SA 2WD8A 2W98A 1DFIA 3H6KA 4WLVA 4RDHA 2VUSA 2NTVA 3JQFA 3C1OA 3ADPA 2X4GA 3FF4A 1QP8A 4O0LA 1ZO8A 4YT5A 2LDBA 3V2UA 4N18A 3WR5A 1HTBA 3JQCA 1NQOA 1PJCA 2J3HA 4BGEA 3Q1LA 1C1XA 3FBTA 4BMSA 4GH5A 4RGBA 1T2CA 1P33A 4Z3KA 4IDCA 1BDBA 1PR3A 2EWMA 4A27A 3BTUA 4HUJA 2HDHA 3FRJA 4BQRA 1GEGA 3DB2A 5JPIA 3GNSA 3WJAA 4TZTA 5K6AC 2ZTVA 4CLHA 4BB5A 2FP4A 2VHWA 2ZQYA 4WCDA 1ZEJA 3S55A 3A4VA 3NDRA 3JYPA 3O9ZA 4E2YA 2J8ZA 3KYDA 3U4DA 4B4VA 1GPDG 3GMDA 1EK6A 1NHWA 1YQDA 4WJZA 5DZSA 5CAEA 4CR6A 1P0FA 3RUCA 3E9QA 3JQ8B 2CMDA 4XQEA 5ADHA 1PGQA 2X9NA 1BHSA 2EERA 4DVJA 2JD0A 4DBVO 3F9IA 4YYZA 3VDRA 1I5RA 3DTTA 4NJOA 2O3QA 2JCVA 1U5CA 1ENPA 4LVUA 3PQDA 2NTNA 1I2CA 3QHAA 2VYNA 1B0AA 2Y1FA 3EK2A 4QQRA 1U1IA 2C54A 3C1TA 3JD3A 5AXBA 1U2DA 4J2OA 3ZHXA 5CDTA 5JY6A 1AGNA 2Z95A 4P8RA 1VKOA 1M66A 3BMQB 4GWGA 1ZIDA 3F1LA 4RPHA 4CLDA 3D4OA 2BI8A 4QXMA 1HYGA 1YL6A 2WE8A 4XQGA 4R4JA 4YJDA 4GX5A 5CEFA 2NU7A 4D45A 4JX8A 3GOHA 1I8TA 4OJNA 5A02A 4CV1A 4Q39A 1BXKA 1VL0A 1EBUA 2DT5A 5KVQA 1F06A 4PRKA 2F1KA 4OMUA 1LTHR 2R6JA 5LCXA 3Q9UA 5A9SA 5DBGA 1NFRA 4EBFA 2DTEA 4RORA 4XCVA 3FHLA 4E5NA 4WPGA 1U3VA 1ADBA 3K73O 3HN7A 4CMBA 3INTA 1N5DA 4HP8A 3JCZA 4DC0A 1TT5B 5EN4A 3UCXA 5G0UA 5LDGA 5TF4A 3B6ZA 3PHIA 4RF2A 4YT8A 3DQPA 4ZQEA 5KWEA 3BZUA 1GYRA 4QFDA 5IDXA 3QVSA 3ETDA 2DBQA 4BGVA 3I4FA 1LSJA 4DPLA 5F3RA 2Y66A 4MVJP 2X7HA 3FBGA 4E33A 2OGUA 3WWZA 1R4NA 4BKQA 4XKJA 4FFMA 1DRUA 1I01A 4E13A 1V6AA 3D3WB 1Z7EA 1DC4A 1TA4A 4PLPA 4TROA 2BHLA 1CEQA 3NDJA 3PJEA 4LGVA 4ALKA 5I9LA 1G0NA 2O7QA 2PGJA 3JQ7A 5CEJA 4PRLA 4LK3A 5IN4A 4NU5A 2V65A 2NADA 2AEJA 3EVNA 5GMOA 2FRDA 1TT7A 3I6IA 2VZ8A 4CLOB 3KLPX 1HETA 3RC9A 4FCCA 2RBEA 2AG5A 4J7XA 2A92A 4J4TA 4WUVA 3WGGA 2P9CA 3AI3A 1MX3A 1E6WA 2ZK7A 1LRKA 1YWGO 3FSRA 3ROMA 1D1TA 5A5FA 4CM8B 5BNTA 3B70A 4TSKA 4RLSA 1V3UA 1VM6A 3KRTA 1CWUA 3V1TC 3W6UA 3ZU5A 4XGIA 3GHYA 1ZXBA 4EITA 4XGNA 2J5KA 3KLMX 3WBBA 4DMLA 4BV8A 1PZFA 1PQUA 5A5EA 1MG5A 1HSZA 2Z1MA 2UUPA 3VPGA 2NVUB 2VZ0A 2VZ9A 3O26A 1Q1NA 1Y5RA 3TNLA 4EJMA 2GYYA 3GZNB 1GV1A 3A06A 1E77A 1I0ZA 3AOEC 3GG9A 3DONA 2AQHA 1DBVO 4GQAA 4P4NA 1NVTA 3G1UA 5BNIA 1GCUA 3ADOA 3COSA 1ZK0A 3DEYX 3ORFA 4J91A 1Y8QA 5DOVA 5IDYA 5U4QA 2Y0EA 3GVIA 3PGXA 1DSSG 1XQ6A 2AXQA 2PR2A 4B8ZA 5TS3A 5L4NA 3GAZA 1FDWA 5T8KC 2VHYA 1ONOA 2V6MA 1MXFA 1NR1A 1LDMA 2ZCUA 1HT0A 4RVUA 4YT2A 3OQBA 2EJWA 2YV1A 2WEKA 4M8SA 4LN1A 3IKTA 3WJ7A 4NMHA 4BNMA 4D3FA 4R41A 4D42A 5BQFA 1IULA 5HWSA 4UUOA 3HFGA 1H2BA 5JYDA 5CDSA 3TZKA 5C7OO 4HNHA 1W4ZA 2JL1A 3NDIA 4CM8A 5KJ1A 4E5YA 3CIFA 4ZGWA 3GA0A 3UFXA 4DIFA 1GD1O 1PJBA 3CUKA 2P9EA 2JHFA 3CSDA 1T24A 4YJGA 4R16A 1QYCA 1SBYA 2GASA 2VYVA 3LK7A 2P5YA 1E3SA 2ET6A 4G5HA 5CPFA 1NPTO 2GZ3A 3IOYA 2QZ9A 3WGTA 3DZHA 1SCUA 3ZDFA 2YV3A 4PLWA 4RO0A 2NUAA 4FPXA 4J90A 1R0SA 5T8KA 2HMVA 1WPQA 4J4HA 3NX4A 3CE6A 2E37A 1BWSA 5A9TA 3F4LA 1VJ1A 4DUPA 3QWAA 2IZZA 1YONA 1T2FA 2R2GA 3T7EA 3ZWAA 2EEZA 2EW2A 1LDEA 2OORA 2H63A 4DPKA 4EI2A 1KEVA 3PZBA 3QW2A 4KP7A 4P4LA 1EVIA 1DIHA 1YOVA 5THQA 1UAYA 3VHRA 2Q1WA 1EUZA 2Z5LA 3DXFA 4IXWA 4PFJA 4XQCA 4R54A 4YAEA 1E7MA 3PXXA 3ROPA 3WG9A 5JY1A 4CMCA 4E2ZA 1GEEA 3RQSA 3T4EA 2ZTUA 4YAJA 1Z74A 3JQBC 3H2SA 2UUOA 3ANLA 3OETA 5ENVA 2Q49A 2DBVO 4YPOA 1VSUA 4U0KA 4B4UA 3N74A 4QO7A 1GADO 4XYMA 2CSUA 5U1PA 1ID1A 3JQEA 3JQ7B 2Q3EA 3WGQA 1R0LA 4IBOA 4OGWA 2TMGA 4OYRA 1E7YA 1U7TA 1YS4A 4NIMA 2FZWA 3OBBA 1FF9A 3G79A 2PH3A 2Q4BA 1V8BA 4WKGA 2ZTMA 1NVMB 1VI2A 4BNIA 2GERA 3WFIA 1HXHA 4RPKA 1HDCA 4CV2A 3L4BC 3SC6A 3UUWA 1LXCA 4BO5A 1HDOA 2NTJA 3M6IA 4BKOA 3I83A 3HADA 1Q2XA 1W8DA 1LRLA 2GLXA 1JAXA 4LSMA 1I2ZA 1TVEA 1NAIA 1QYDA 4B7CA 3GGGA 3E6AA 4OIMA 2G1UA 1EDZA 3VAZA 4BNLA 1PQWA 1ZEMA 2OXIA 5JO0A 3QWFA 5COAA 2VWGA 4PVDA 1D4FA 2PKRA 1N7GA 1BW9B 3DO5A 4Y67A 4NNJA 4CR8A 3Q0EA 2PK3A 2EF1A 3D4NA 2VWQA 4Y98A 3TJRA 1UDCA 5L4SA 1E7SA 2J5RA 3DZBA 3JQAA 4K28A 1RM5A 3GZNA 4PLHA 3VC7A 1PJLA 3WICA 3HB4X 3E9NA 5K9ZA 2DFDA 2D0IA 3W8EA 5T67A 4KZPA 3ITKA 1YGYA 3IP1A 4UVHA 2HK7A 4JJFA 5JC8A 1A9YA 1J6UA 1PGPA 3F5SA 3MJTA 4YAIA 2GSDA 1Z45A 4YEDA 2YQ5A 4DYDA 3TQHA 2RCYA 4TVOA 3DL2A 2BFAA 1DHRA 4ZJUA 4C4OA 4M49A 5EPOA 4ZA2A 1PJTA 4HFMA 2FSVA 4PZDA 3JD1A 3ZWNA 3ZHYA 4JN6B 5COQA 1Q7CA 3GQVA 5H83A 3ZI0A 1HE5A 2VHVA 3I9OA 3OM9A 4CV3A 4CPDA 2NWQA 3QWIA 4YT4A 4Q3DA 2OZPA 5BNFA 3ST7A 3WFJA 2C82A 3FPCA 7MDHA 3S2IA 2POQX 2VTEA 3LT1A 1JKJA 1M6WA 1XKQA 4QSMA 1GL3A 4ND2A 2A35A 3C3XA 3GFGA 1H5QA 4FFNA 1RKXA 3N58A 3AY6A 4M54A 1ZW1A 3JQ9A 5IXSA 5L40A 5CHEA 3EYWA 2EP5A 1A7KA 1R6DA 1SC6A 4OKIA 2X0NA 5C37A 4FGSA 4KOAA 3MZ0A 2ZQZA 4WLNA 3JQAB 4DYVA 4UUMA 4WLOA 4B3HA 3HDHA 4GVXA 5CG2A 4N54A 4CM9A 3CPSA 5EMHA 1B14A 1X7HA 2P68A 3ZU2A 1IE3A 4RF4A 2EHDA 1P74A 4FN4A 1PJ4A 2J6IA 1F12A 3P2OA 4J7CA 2Y67A 4XJTA 1AHHA 3I6QA 4B7XA 4BNUA 3SBOA 2FPIA 4HWKA 4I9HA 3VPSA 4E12A 4PLGA 1I3KA 1NVGA 2ZB4A 3JQ8A 4JK3A 1LC0A 2I99A 1AXGA 1QMGA 3PWKA 3OJ0A 4B8WA 4ND5A 1I3NA 1WDMA 3RC1A 3D0OA 2P2SA 4EEXA 2OMEA 4LRTB 2Q1UA 2GO1A 3BHMA 2XOXA 1LDNA 4H16A 2HRZA 5HA5A 4J7UA 1Y8RB 1JN0A 1PEDA 5JNLA 4O6VA 4MVJH 1RJWA 2DM6A 4R1TA 2PY6A 3OIGA 4Y6RA 3FR8A 2IODA 1YOVB 3WGYA 1BXZA 3QVTA 5I9NA 2CVQA 3U09A 4YRBA 3PLRA 2QQ5A 2FMUA 3GC6A 1FJHA 3U49A 1NASA 3Q3CA 2X5OA 1K0UA 3ABIA 4BNFA 8ADHA 3GDOA 3GDGA 3PIDA 1B3BA 4DLAA 2YQ4A 4ALMA 4IS2A 1B8PA 3OSUA 2NQTA 1YRLA 4CMHA 1CJCA 4MP3A 4KWIA 3F47A 3RSHA 4Y8VA 4XYEA 5F5NA 1GDHA 5HS6A 1ISIA 2VWHA 4OKNA 1P0CA 1SOWA 2QX7A 3ZN2A 2QRJA 1ISMA 3OIDA 3C24A 2GUGA 1VRWA 5HBRA 4H15A 4OQYA 5L9AA 3JD2A 3D64A 3PK0A 1ENOA 4K6CA 5L53A 4FBGA 3VPFA 1B8VA 2CNBA 4M86A 5A3JA 4CJXA 5KNLA 4W6ZA 4ESOA 4KDFA 4YJFB 4AJJA 5K0ZA 2IZ1A 3I9KA 5DOZA 1DIGA 5FEUA 3WQQA 3ZGYA 4OOEA 2HMUA 2B35A 2FR1A 3WMWA 4E3ZA 5DCYA 3JQAD 3GF4A 4IY1A 1F17A 3N7UA 3RIHA 3ZNOA 3KB6A 1MG0A 1A4IA 2YHIB 4A0SA 1DC3A 1SB9A 3I23A 1BXGB 2ZJ0A 4TWRA 4XR4A 3AM5A 1UP4A 3RFVA 3PPIA 1ORRA 1G6KA 1K2WA 1YB1A 1ZJZA 3B1FA 3H65A 3MJSA 4I5FA 3QVXA 3NJ4A 4J49A 1SEPA 4C7JA 1XSEA 3KEOA 4W9NC 3ENNA 4ALLA 3KEQA 1EQUA 1PZHA 2GRAA 3DHYA 5IF3A 1KBZA 2O3JA 3WYEA 1YQXA 1NQTA 2E82A 4RJTA 4Q3BA 1NFFA 1NPYA 4OXNA 4W7HA 3CKYA 1KVSA 4YCAA 3FNHA 2HUNA 3AI1A 1LLDA 3GR6A 3Q9NA 3E1KA 1NR7A 3CTMA 1QV6A 4XD2A 3DTYA 4LRSB 1YJ8A 2AHRA 4RVDA 1Y9EA 3TZ6A 4L4XA 1U7HA 2Q4EA 2G17A 4CMIB 1X15A 1DRWA 4NBWA 3RUFA 4BS9A 4JP3A 4NK4A 2OO5A 2VNSA 4E6PA 2WJPA 2PKQO 4YBZA 2YFHA 3I9JA 2HJRA 4CMGA 4FJ2A 1JKIA 1WLYA 4CM1A 3SJ7A 3UAGA 4R1NA 3TOZA 2X22A 4IIUA 5BR7A 2JKVA 4XGKA 1ISHA 4BO6A 3WGZA 5A4DA 4P22A 2O3RA 1H93A 4J0EA 2ZJ1A 3DAPA 2G5CA 1YB4A 3BMOA 1GTMA 3HJAA 4FSHA 3WGHA 4YR9A 2FWMX 3ZWYA 3VZSA 5TNXA 4AJEA 3SJUA 3D5QA 1PJSA 5B4TA 4TKLA 2EG9A 2GDZA 4ZQHA 3ZWXA 1X1TA 4JP2A 4Q3AA 5TSDA 9LDBA 1HL3A 3C8MA 3L9WA 4BNXA 1LLQA 4BNKA 2IZ0A 4PZCA 4XR9A 2EGGA 5ENDA 4QECA 1J49A 4NBVA 4LMRA 1JVBA 3KO8A 4RV9A 1OI7A 2CFCA 3GG2A 4GMFA 3RBXA 4CM4B 4IQGA 5IZCC 3MWEB 3HUDA 4HY3A 3UCEA 4RQUA 1HLPA 3KSZO 3IDSA 2Q2QA 1HF3A 1A7AA 1FK8A 3ZW9A 9LDTA 5MDHA 4WASA 2PNFA 3T4XA 2X23A 2FR8A 2I65A 4MVJF 3D3WA 3INGA 4ITUA 1JLLA 2VHZA 4CQMA 4NQZA 3VVBA 4N5LA 4D3SA 4OSPA 4Q3EA 1HDYA 4UULA 2Q1TA 3W4IA 1KERA 3JSAA 4WGGA 1V35A 4R1UA 2C5AA 4NU6A 2VRCD 1XEAA 4ZVVA 5DULA 4YWJA 2OBYA 5AXAA 2DUWA 3CMMA 3I9LA 3NGXA 4CQMD 1BTOA 1GYPA 4CUZA 2H5LA 4PG4A 2B69A 1I30A 3GY0A 4YB8A 3AU9A 3GUCA 3HNPA 3V1YA 1LI4A 2BRUA 3G0OA 4RVHA 1LSSA 1T2EA 1Q0QA 3PIIA 3CZMA 3NV9A 2EJVA 4TZKA 1K3TA 3D7LA 4U0JA 4WECA 2O50A 5IDQA 3P2YA 1GFSA 1F0YA 3GFBA 5KJCA 5ES3A 3IUPA 1EMDA 1LDBA 1W73A 1O95A 1ENZA 2EV9A 1R16A 5JMPA 1PR9A 4Z6KA 1VJ0A 4R3WA 1IHXA 2BFMA 3JQ6A 4MVJE 1GAEO 2GF2A 3H2ZA 2CDAA 4Z3DA 4FJ1A 3W6ZA 4DGSA 3WIEA 3RKUA 5JO9A 1HZZA 2BGLA 1ISJA 1NNUA 3H3FA 3PJGA 2B36A 3C1AA 3BMQA 3ZWBA 1OZAA 1JVSA 2H6EA 1SEVA 3JQBA 3PVZA 4WEQA 3V2GA 3GN2A 3P19A 3H9EO 3K9QO 5GZ6A 1E3EA 2X9GA 5JE8A 3ZWMA 5HM8A 4DXHA 5DNAA 4UEJA 1NAHA 4D43A 1HLDA 1OOEA 3I9NA 4WCFB 3DR3A 2I3GA 2PKQP 3P7MA 4JBGA 4UVGA 3QA9A 2NVUA 3KOUA 2QZZA 1PJ3A 4XYLA 3BA1A 3ETEA 2TMDA 1XDWA 3QWBA 3L4BA 1V9LA 1WMBA 3HN2A 1FDSA 4UEOA 5ITVA 3WQSB 3BTSA 4WNCA 1SB8A 1VL6A 1KVTA 2XAAA 4KUGA 3IUSA 4MVJG 5G0SA 3DOOA 1LDGA 1P31A 1ZKMA 1D8AA 1YB5A 2JAPA 2NNLD 2VHXA 3L4SO 3NUGA 3NT2A 4EEZA 4IGEA 1HEUA 4MVJA 5JS6A 1QSGA 4IDDA 3E18A 5KJEA 4Z9FA 1U8FO 2IE0A 3H8VA 4D0RA 3WGIA 3AJRA 4ZRMA 1U9JA 4WE3A 4AJ1A 4E21A 4GGOA 1IHYA 2FPPA 3WLEA 1ZSNA 2UV8A 1CIVA 3DZKA 1O5IA 4NFYA 3DAFA 3IKVA 3PQEA 3NT4A 4YRAA 4RLHA 1HE4A 1BDMA 3QVOA 2ZB7A 3VZRA 2BMAA 2GN8A 3GZ4A 2OHXA 2Y1DA 4NJMA 4GLOA 1WNTA 4HXYA 1MFZA 2O7SA 3V2HA 3R6DA 3S1LA 4RPLA 3VKVA 2V7PA 3QLJA 1PIWA 2RH4A 4XA8A 1QXSA 1EK5A 2YHUA 1JWAB 3ZNPA 5KKCA 4UREA 1T1RA 2I3AA 4H3VA 4YAKA 4OXYA 5ICMA 3LT0A 4OL9A 2PD4A 1PL7A 5JFOA 1KEUA 1T25A 4N7RA 4BNNA 2FPGA 4K26A 3OJOA 2H1SA 2C7VA 1Y9AA 4JJIA 2WMDA 4PLCA 2HLPA 4U8GA 5FFFA 3OA0A 2Y0DA 4AJ4A 1AHIA 1NWHA 2PGLA 4NBRA 5TQVA 2HSDA 4JBIA 4HFJA 5G0VA 4Q3NA 1DEHA 4BO3A 1U28A 1RM0A 5L95A 1HKUA 2BKAA 4BNVA 2CF6A 4KMSA 4GX0A 4NBUA 2YZ7A 2OBNA 3ON5A 3L6DA 1DIRA 4IXTA 1U5AA 2PZMA 3WB9A 1H94A 5A3VA 5F1OA 1IPEA 3BMCB 1BXGA 2HK8A 4D44A 1KVQA 3H5NA 1R0KA 4J1NA 5B4VA 1P1KA 3JYOA 1O94A 4BNHA 1C3VA 3LC7O 5L7YA 2X1HA 4XB2A 3LC2O 3GGPA 1UZMA 1BG6A 2CF5A 5KJFA 5A05A 1B8UA 3GEGA 3D4PA 4N5NA 4CLEA 3AU8A 1NX6A 3WSVA 4XQ9A 4QTZA 1LLCA 4WOKA 3ROQA 3K6JA 5THKA 1E6UA 1HWYA 3HDQA 3VZQA 3IMFA 3DAGA 1EE2A 4ND1A 1YQGA 3L77A 1XHLA 4B3IA 1Y8RA 3DHNA 3STHA 5AXDA 2CDCA 2WM3A 2D8AA 3ONDA 3OH8A 1PZEA 4BIIA 3ZWOA 4IS3A 1KC3A 1MGOA 2OOSA 1YBVA 1H9BA 4CQLA 2VUUA 3CINA 4XEHA 3CMCO 3I1JA 2XF8A 1H6AA 5DT9A 5I7VA 3DDNA 3PTZA 3A28A 2P4QA 2ZYAA 5GY7A 1ZSVA 1ZFNA 1TT5A 4JROA 3K92A 2PZLA 1QV7A 1ZNQO 4RPGA 1O9BA 2JFGA 4FW8A 5F1KA 2B4QA 3KSUA 3E8XA 1FDTA 4WCFA 1DRVA 2V6BA 2VOEA 2JCXA 2J5QA 2C0CA 3G1TA 4PCVA 3RC7A 3K96A 3WYCA 3HB5X 4TQGA 2B37A 4I08A 2VTDA 4P38A 3MJEA 5TJHA 3LT2A 1NYTA 2ZYGA 4K9DA 2C2XA 4L8VA 2IXBA 1C1XB 1EUDA 4EW6A 4XJSA 2ZIZA 3W8FA 1M76A 3RASA 1ZH8A 5T64A 3GH3A 3ZCXA 4DIBA 4NK5A 4JIGA 1ULSA 2ZKLA 4IJUA 4UVIA 4IDEA 5IJZA 1PS8A 4Z0TA 2BGMA 4NH4A 2OL4A 2UVDA 3FTNA 3MTJA 3GVPA 3K2EA 1LSUA 4OHUA 1X7GA 1Z73A 4I5GA 1KY4A 3DBRA 4E31A 4PG7A 3OHSX 5DP1A 2I6TA 3EZYA 4BOYA 4BNGA 1EQ2A 3V1UA 4XWYA 5COBA 2QRKA 3WBFA 3EZLA 5G0WA 4GAEA 4ZD6A 1PX0A 3HFSA 3DBLB 1RYDA 3ULKA 1QRRA 2IEDA 1GYQA 4KDEA 3RI3A 4A10A 3WLFA 3H7AA 3PHGA 5L4LA 1DOHA 1EVYA 3ZU4A 1PGJA 2Y0CA 1ARZA 3AUAA 3EW7A 1QORA 4ID9A 1LQUA 1DHTA 4PVCA 1KS9A 3FNGA 4GLLA 5JDIA 4FDAA 4PGFA 3V5NA 1CQIA 1E6EA 3AWDA 3M2PA 5AXCA 4KQXA 3IS3A 4O63O 1UR5A 3H9JA 3ANMA 3SLKA 1CF2O 2Y1GA 3PWZA 1Y1PA 1T2DA 4AJOA 2B5VA 4W7IA 3ZNQA 1XR3A 4II2A 3W4JA 5IDWA 4N5MA 1G1AA 3CH6A 3QWHA 1S6YA 4UVEA 1U2GA 4NZ9A 2Y1OA 1Z82A 1JTVA 5GZ3A 3Q2IA 1E1LA 2WWRA 3C7AA 2X58A 3RUHA 1QKIA 4MINA 4YXFA 2YUTA 4YDRA 5K6AA 2D3TA 3O8QA 5AQ1A 1HDXA 1QYWA 2NM0A 3H5AA 3K31A 3WGOA 1MXHA 2HRBA 1PJ2A 4IJVA 5I8ZA 1P1HA 3ZV3A 3GVXA 1ONNA 3QVWA 5BSHA 4R9RA 3JYNA 2X8LA 5DN9A 3GVHA 3H9GA 4RVGA 4GWKA 3ZW8A 4CLXA 3BMCA 4MKZA 4IZIA 2B0JA 2D5AA 3AK4A 1KETA 2VN8A 3OP4A 4PG8A 5AOVA 1DDOA 2D5CA 2BGKA 3GT0A 3WS7A 1GR0A 1GU7A 2HU2A 3ONEA 1O0SA 4ND3A 1WP4A 1DLIA 4DC1A 5U9CA 2GGSA 1DIBA 2XXBA 3H5RA 3O03A 1YBMA 4L75A 4R51A 3VPHA 4DPMA 4PLYA 4ZQGA 4CM7A 3ITDA 1N9GA 2Q99A 3IP3A 4IGFA 2IEBA 1B16A 2CUKA 1QLJA 3W1VA 1N7HA 1XG5A 4K1LA 3LYLA 4FFRA 1P1RA 1N92A 1VC2A 2D59A 2AQ8A 4A26A 2EKLA 1L7DA 5ICSA 1E3JA 1WVGA 2CD9A 3SC4A 3HWRA 4HFNA 3KBOA 4RVFA 4XDZA 1R12A 1XU7A 3JQDA 1NM5A 3KSDO 4J1SA 4PIVA 3FNFA 1UUFA 4CM9D 1NPDA 1TXGA 4WEOA 1RWBA 1ONPA 4EDFA 1BRMA 3L9XA 2AG8A 3GGOA 2O2YA 1UXGA 2J3JA 2B5WA 4AJKA 4Y6PA 4YACA 3WYBA 3JQGB 3PHJA 2HJSA 5C5IA 1XELA 1WDLA 1YO6A 3TPCA 1XU9A 3MOIA 4FOSA 1ULUA 4KWHA 4YJHB 2Y1CA 5KIAA 4M89A 5CFZA 3L6OO 3AUSA 1HDRA 3DMYA 3LLSA 1ZUD1 3TZQA 2HO5A 3F3SA 4MVJI 1ZCJA 3ONFA 3IJRA 4CV0A 5L51A 4PLFA 4BL5A 3GRPA 4GL4A 1YVEI 2D1YA 4BV9A 2JD1A 4QUKA 4XYBA 2IYOA 3LZ6A 2HMSA 1KOLA 4PLVA 5C7IO 2PGDA 2CVZA 4B7UA 2YHIA 2X6TA 3TL2A 1A27A 4INAA 3MOGA 1C0IA 1GUZA 3JTMA 4UAGA 3AFMA 3DFUA 3DHEA 1Y5MA 3ZWVA 3TZCA 5T5QA 1O89A 1A5ZA 2DUUA 4RF5A 1FXSA 2QG4A 4HFRA 2W2KB 1XIVA 4H7PA 4DA9A 1JWBB 2P91A 2C5EA 1NQ5A 3DC2A 2JFHA 1ENYA 4YVFA 2BLLA 4IDFA 5IN5A 1WAMA 5A9SB 2Q2VA 3ROKA 7ADHA 1WMAA 5F1PA 1LJ8A 3G3EA 1HE2A 3DBRB 5B4UA 2GN9A 3RUIA 2X86A 3LF1A 3GMSA 3AW9A 3H9UA 5DCUA 4R9SA 2Y05A 1Q7BA 3WMXA 1Q0HA 3TOXA 3W4KA 5KJ6A 1A71A 5JBIA 4HX5A 1AXEA 1LQTA 2VYND 4Y9DA 1FDVA 4U7WA 2Y93A 4ZHSA 3AI2A 3ICPA 3KZVA 4U5QA 4BO8A 1P45A 2DPHA 4K6FA 4MOWA 5L3ZA 3WNVA 4L73A 1OC2A 3L0DA 3UVEA 4IDGA 3PDUA 4UEKA 5TIIA 1HDZA 4BKPA 4L74A 1LSOA 3Q6IA 1UXHA 3QQPA 1IYZA 4GMGA 3ZHBA 5I7SA 4E30A 2J3KA 4RZHA 3WQRA 3OMLA 3AUUA 4BQPA 4IDBA 4AJLA 2B83A 1I36A 4MIEA 1CETA 3RVDA 3VH3A 1OBFO 2HCTA 3DBHA 3PYLA 1RYEA 2AA3A 3UKOA 1U3UA 2HMWA 1ZMOA 3UH1A 1IZ9A 4EUFA 1XA0A 2P4HX 3S2GA 2VNAA 2DTDA 2WYUA 3E9MA 4FFPA 4XDYA 2PLAA 4FFLA 5ER6A 5JAIA 2G82A 3OJEA 3M2TA 4HV4A 5JYEA 3PJDA 5EL0A 1ISFA 2C7GA 4IJKA 1IPFA 3BTOA 4MO2A 3IJPA 4ZQBA 4BO1A 1DIAA 2DU8A 2DFVA 1W0CA 2JD2A 1E7QA 3LQFA 1PQPA 4G81A 5IG2A 3RUEA 3S2FA 1KYQA 2NACA 4FGWA 1QG6A 1Y6JA 2O3TA 1PGNA 4EJ0A 4CLRA 4M1QA 2R00A 3GPDG 3OF2A 4W82A 2WTBA 4WCFC 2HK9A 2W2LA 4J1QA 3VDQA 3A1NA 4BUCA 1LRJA 1PL8A 4DLBA 2HAEA 1VJTA 2G76A 4WNIA 4BO2A 1YL5A 4FC6A 1KIFA 2A94A 1FDUA 4TKMA 1HZJA 1HYEA 5C7LO 2OUIA 3F6YA 4GI2A 4NFSA 1AUPA 3MCVA 2EXXA 3SLGA 3TFQA 3IL2A 2YFQA 3O38A 3K30A 3OICA 3NRCA 3PRJA 2WE7A 4Z9XA 5TT0A 3SXPA 4AL4A 2E4AA 1ZBQA 3WX0A 3PJFA 1K5HA 4F45A 1MA0A 3EC7A 5HS4A 4I5EA 3AFNA 4IQ0A 4DRYA 1X0VA 1C1DA 2VRCA 2UDPA 2BFPA 2F00A 2YY7A 1WZIA 1LLUA 3INRA 3UHAA 3TDKA 2W90A 1MB4A 3R3JA 3I5MA 1AE1A 3ETGA 4CMIA 5A1TA 1BGVA 1R66A 4PG5A 2FSSA 2V6GA 5FYDA 3UGKA 3S8MA 3RD5A 3FWNA 3KUXA 3WXBA 3KV3O 1X13A 1DJQA 2A4KA 3BHJA 4JLWA 3ZV6A 3QJ5A 4DBZA 2WYVA 2DKNA 2RHRA 5A03A 3E03A 3IIEA 3PHLA 4I1IA 4CLOA 1VKNA 3GAFA 4J1TA 3OJFA 3EY4A 1YH3A 1PWXA 5EIOA 4PG6A 2GCGA 4B3JA 5JMWA 2SCUA 4DQUA 1YL7A 3P5SA 3ENKA 5KVSA 5L45A 3WNQA 5KVVA 4NDNE 1Z7BA 4IIVA 3RUDA 4CL8A 1C0LA 3MTGA 5B12A 1B26A 1DFGA 4EZBA 4IPTA 5JC1A 3EMKA 3GEMA 4JJGA 4AJNA 1B3RA 3DBVO 4OQZA 5H81A 1PSDA 1K89A 3OQ6A 3U9LA 5ILOA 1SPXA 1VLLA 1Y7TA 3W8DA 4OSOA 1M67A 4A03A 2DPGA 2WYWA 2NU9A 3HE3A 1GV0A 2BH9A 3WWYA 4LVCA 2Y68A 1HDGO 4M55A 1VSVA 2W4QA 5KVCA 1EVZA 3EAGA 3RFXA 2QHXA 4GX1A 1I32A 4J3FA 4AJHA 4R68A 1ADFA 1J5PA 4D0SA 2O2SA 5EJ2A 5JXWA 2LDXA 2WD7B 2BF7A 5LDHA 2PD3A 4J43A 2YDXA 1P3DA 2NV6A 4ZICA 1ZSYA 5ILGA 3I9MA 2AW5A 4FD3A 3PI7A 4QT0A 2GNAA 3KM0A 4F46A 2O3UA 1XCBA 1DAOA 4XRRA 5JCXA 3RROA 1HSOA 1E1MA 5A9RA 3C7DB 3ZU3A 3RJ5A 3FPLA 2RAFA 4UUPA 3ZV4A 4MDHA 3EUWA 1GQQA 4I9UA 4GKBA 3JD4A 4I8XA 4EGFA 5TC4A 4F6LA 5I7FA 2X0IA 2DQ4A 2ZB3A 1S7CA 1DC6A 4CL3A 1LX6A 3E82A 1X7DA 2BELA 4MVJM 5A04A 4BNTA 3M1AA 1RM4A 4IINA 3NT5A 2Q1SA 2RHCA 3DZJA 4BMVA 3F4BA 1NWCA 2NU6A 2D4AA 4OOFA 4BKRA 4BHTA 3GDFA 3VTZA 4D79A 5JAQA 1C14A 1YE3A 2OP1A 1KVUA 3ZWCA 1P44A 2DLDA 2EGHA 1E3WB 2WD7A 4M87A 3BYZA 1C0PA 1Y81A 2VWPA 1HYHA 3OFSA 3RFTA 3H3JA 4TMFA 1GQYA 3RBZA 4BGIA 3AM4A 5BSFA 1V3TA 1T4DA 2EIHA 2IXAA 2P5UA 1GY8A 5TRTA 2AEFA 4IMRA 2XPCA 1N8KA 4DTIA 1U3TA 3R1IA 3K8ZA 3WTBA 1JU9A 4U6QA 5JSFA 3VTFA 4Q9NA 4HBGA 5FF9A 3UCFA 4J6FA 4RQTA 4BGUA 1JA9A 2I66A 4FIZA 4FOOA 5KCZA 4Z0HO 2XXJA 4FJ0A 5CG1A 4GKVA 1SOVA 4R01A 1H6CA 2DBZA 2O23A 4AFNA 3TZHA 2CVOA 4CR7A 3QV1A 1RM3A 1GPJA 4YQYA 2BD0A 2NQ8A 4GSKA 4ZQFA 3BMNA 4XIJA 2RH8A 4YQZA 4BO9A 1BVUA 4XZ3A 1GZ4A 1LDYA 4Q3CA 1SO8A 3LSYA 4ONEA 3SEFA 1OMOA 2AQIA 3NTRA 4WK6A 4DMMA 4MJLA 1D3AA 4AJ2A 1KVRA 2C29D 3UICA 1K6IA 1EFKA 2VUTA 3TF5A 4S3MA 3ASUA 1XLTA 4OH1A 3C7CB 4EUHA 1M2WA 3PZRA 1I3MA 4XRGA 3ZHZA 4PZEA 3RCBA 1PS0A 3TSCA 4NJMB 3F1KA 3VOSA 2EW8A 5IZCA 3RU7A 4HADA 1ADCA 3O4RA 5ER9A 2ZYDA 2NVWA 1XWFA 1EE9A 4GBJA 3ZNNA 4ND4A 5LC1A 5G2OA 3X2EA 3DMTA 4G2NA 1MV8A 2ZCVA 1JQBA 3GNTA 5G4KA 1MC4A 2PFGA 2QRLA 5T57A 1P1IA 4D3DA 3U5TA 1ZK3A 5JDIC 5HTOA 1IUKA 4IQ8A 2YDYA 2R00C 3QSGA 2I9PA 4LSWA 3NJ8A 2IRWA 3BMNB 1O6ZA 3FN4A 3FI9A 4B4WA 1SNYA 3U4CA 1IZ0A 3GLQA 4II3A 4C7KA 1Y8QB 4Y6SA 1ZXLA 3WSWA 3JQGA 4EUEA 4YA6A 5L7TA 1TEHA 1PTJA 3EHEA 2Q45A 1DJNA 1EVJA 2PWZA 4R5HA 4J9VA 3HDYA 4YJHA 1X14A 2JHGA 3DBHB 3NGLA 1L1FA 4F3YA 1YDWA 3CXRA 2Q2WA 3D3EA 3PQFA 5HRUA 3KTDA 2C20A 3MEQA 4BO4A 1KEPA 5G4LA 1XQ1A 1PL6A 4L4SA 3GVCA 4YJGB 3ZH2A 1KY5A 3T7CA 1UH5A 2C07A 4CM3A 3PDJA 4Z0PA 5CDGA 5G4KB 1LNQA 2JJYA 2GN6A 4R69A 3C85A 4QO8A 4TRNA 3WOHA 1E92A 2UAGA 1E7WA 1IY8A 2PTGA 3RJ9A 4EYEA 2O4CA 8LDHA 3GEDA 2H9IA 2E48A 3RBVA 3MJ4A 4ROSA 1T2AA 3F5QA 1LBEA 4E2XA 1XGKA 1EFLA 3K5PA 1JDJA 2VOJA 1PGOA 1E7RA 3PFWO 4IDAA 1F14A 2G0TA 2IYPA 2WDZA 5KKAA 3SX2A 1O8CA 3VH1A 3ICCA 1PS9A 1ZK4A 3G17A 1N2SA 3PYMA 1H9AA 5TX7A 1DAPA 3RUAA 1IOLA 4CM6A 5I9MA 1U4OA 4AJIA 1R4MB 5FWNA 1NP3A 2PZKA 3LT4A 3EVTA 2OP0A 1X1EA 3GN1A 3OEWA 2DVMA 3Q2KA 1NTOA 1RPNA 4E4YA 5KOIA 4AJPA 4GPD1 1M75A 1K6XA 2EKQA 2B4RO 3NKLA 5IAAA 4TRMA 1N9GB 3ASVA 1T26A 1QYVA 1VPDA 2GR9A 4YJFA 1V0JA 3FCOA 5JCJD 4WLUA 2FY8A 3U0BA 5C3MA 2QIOA 4I5DA 2ZATA 5FI3A 3E48A 5F21A 5MGBA 4BMNA 1BVRA 4R3NA 3DZGA 5KTKA 2VT2A 4IUYA 3LF2A 3D5TA 4MVJD 4XYGA 4E0BA 4FS3A 1IB6A 3HDJA 3OIFA 1F8GA 2I5PO 3DFZA 3MJVA 3OEYA 5DBIA 4GSLA 5J23A 1NFQA 1P1FA 1ZVMA 3BHIA 1P77A 1YXMA 4NHEA 2VRBA 2HKIA 3HG7A 5AVOA 3AUTA 4MPDA 5JDCA 5I7EA 2NVBA 4FB5A 5IXYA 4QEDA 4BNWA 4D7AA 4GX2A 4KTTE 5EQDA 2VQ3A 1BW9A 1KC1A 3L6EA 2W2LD 3PP8A 4BVAA 4HNGA 2AMFA 1DPGA 3GRKA 4GVLA 4O1MA 2UYYA 2DAPA 2EP7A 5JW6A 3UW3A 4D41A 3PHHA 4W99A 1H6DA 5L7WA 3FWZA 1TI7A 4RVSA 4EJ6A 3HSKA 3QIVA 1NXQA 4BNZA 2JFFA 4MIYA 1L7EA 3MJCA 2GZ2A 4RZIA 3U4IA 4RDIA 1GUFA 3VH2A 1CYDA 4AVYA 3CZRA 5DCWA 4ALIA 1B2LA 1YDEA 4NG5A 2BI7A 4F6CA 4AG3A 2CZCA 4WLFA 1GQ2A 4E32A 2NU8A 1QYXA 2HQ1A 2P9GA 4YTEA 4PN3A 4E5KA 1F8FA 3RKRA 5G0TA 2GD1O 3RWBA 4J9UE 3GNQA 1MUUA 3EGOA 4DWVA 4TVBA 4DREA 3KVOA 2W2KA 1A9ZA 4E2WA 1ML3A 3BAZA 1UP7A 1YBAA 2J3IA 2JCYA 3PFFA 3FTPA 1K6JA 1HE3A 1DXYA 3LLVA 5DF1A 6LDHA 1T1SA 3DOJA 3UN1A 1E5LA 1HRDA 3HZZA 3U62A 3S2EA 3ZZNA 2CDBA 1DFHA 2X5JO 5TJ9A 2YW9A 2PH5A 5JLAA 2I76A 3HQ4O 2EKPA 1P9LA 3BTVA 1C1DB 1G0OA 4KQWA 4NR0A 4RF3A 5EINA 3LVFO 3LC1O 2YJZA 5H82A 4O5OA 3JQFC 1OAAA 1E0DA 3DZFA 2B4TO 4GGPA 4RL6A 2Z1NA 2PD6A 4MKRA 4URFA 2W8ZA 2JAHA 3A14A 2AE2A 2CY0A 1VE9A 1NHGA 1ZK2A 3TWOA 1ZZEA 3GHHA 3H4VA 1UZLA 1T4BA 3KETA 1DLJA 1H6BA 1E5QA 2DBRA 3TRIA 2O4UX 5CEEA
chains in the Genus database with same CATH superfamily
3JASA 4HOYA 5ITWA 2G4LA 3PWTA 5FBRB 1XNRB 2OZLA 1RAIA 4YMUA 2COKA 5M29A 2WKRA 3WBJA 1O0CA 3B20A 2XYPA 4MW6A 4LW8A 1T6YA 1LU9A 3DMTC 4WXMA 2AXNA 3MGBA 2WZCA 1YKGA 3ZIAD 3FTDA 2Q4TA 3T35A 2UYCA 4GD3Q 3CH4B 5AVJA 3O21A 3RVOA 4D9NA 2WFAA 3A1FA 2A4MA 2JF0A 4QSHA 5EERA 3QMMA 3L4EA 3MQ2A 4UE3S 3EVBA 4CF6A 4RPJA 5BW5A 4RBNA 1PFGA 4NBTA 1QVVA 1AY0A 3MJHA 3PS9A 4BLQA 2JG3A 3U3XA 4B7ZA 1DEXA 4MUGA 1CUYA 1UK7A 3F7MA 4Q03A 4D0GA 4BUJA 1SCBA 2XMQA 4XCQA 2Z8YM 1WDKA 4X71A 3L7MA 3D8NA 4M0DA 4IJQA 1TB4A 4DILA 2I67A 3PQ8A 4MICA 4DUGA 4LMAA 3K0SA 1GJRA 3I61A 1AN9A 1FXUA 1EINA 1FU7A 1V16A 3DB1A 3IURA 1AD2A 4M76B 4NCNA 5CUQA 2NPOA 3R76A 1KZ9A 3ZD9A 5BN4A 1JIIA 2FEKA 3KHUA 3L7KA 4Y2UA 5TMPA 2QDKA 2Q9CA 1TLTA 2P6RA 4BQSA 1EUCA 4J2HA 1W5BA 4Y0VA 4A7PA 3JYQA 3VU0A 1WB6A 3P9NA 1MQSA 3PLNA 1U2DC 4S24A 1BHQ1 3VYUB 1JKFA 4MH0R 4YLGA 4XB6B 4EKIA 5LUAA 3V80A 4TXLA 2H8GA 1YMQA 1GPAA 4BB6A 1OWLA 5DM4A 3HB0A 4EMBA 5K05A 4JR2A 4D1YA 3SF0A 4Z4CA 2KS6A 5ISMA 3AY3A 3M3DA 1KEEB 2AQKA 2OG1A 3TL3A 4CI9A 1FMCA 1F60A 1YCGA 1JPUA 3IFSA 3RS2A 2REXB 4L4RA 2F8MA 4XI9A 5BVGA 4G0MA 3BD8A 2O2DA 3KJGA 4BQNA 4HD8A 1TZKA 1LC3A 2E4WA 4CMEC 4CODB 3ZJTA 3NC4A 4YIKA 3OOJA 4NI5A 1N3YA 1H1LB 2D3WA 1VDMA 3EIEA 3HBAA 1GZ3A 2C4MA 3WYAA 4L22A 4QXOA 3UB2A 4BLVA 4R5MA 3BIOA 4ZTBA 4J0FA 2QYSA 2XYGA 4U7TB 1M6YA 5EXPA 3Q11A 4CM4A 4HVLA 4S12A 1JHPA 3Q8XB 2A1UB 1DRKA 4DDWA 7REQA 1VL8A 2JIZD 4X84A 3ZWWA 1ADGA 2A9FA 3LDHA 2Q3CA 2D2IA 5T6BA 2NSYA 5J2UA 1UZNA 2AW3A 3F7TA 2W6CX 3C41J 5AWFC 3A3KA 2ZS8A 3F7NA 4MRVA 1K7FB 3SG0A 2OHGA 3RAJA 1MP0A 2AFHB 1YSCA 5CK5A 3GCXA 5KYYB 1R6XA 3N9IA 4PPYA 2XWBF 1E3WA 3I4CA 4WZ6A 4F91B 2WJIA 3HCCA 5HJ5A 3F46A 3OHMA 1D4AA 2QAJA 1FFXA 3A58B 3R0IA 2AFIA 3LQ1A 5E6RB 2HMTA 2Z9BA 3SVTA 4L76A 2P6NA 4EFNA 2WAMA 3EEFA 1PJQA 1DO2A 1GKUB 3O8OA 2Z09A 3N2KB 2AG0A 3VPCA 4CQLB 4OLAA 3B8HA 2PX2A 4MQ6A 3N8DA 1LBQA 1NVUQ 5JY6A 4Z4IA 1RZUA 1C8KA 2X0RA 3HR4A 4NP6A 5FL3A 2Y99A 1MC1A 4J03A 2O8DA 3IQEA 3O4JA 2F62A 4N0DA 3RUPA 3T06B 3W8NA 5B6JA 3C6KA 3Q7PA 5C1IA 1WWKA 4UBJA 1ECPA 3RYCA 5DXJA 3SX0A 4BXOA 4TWJA 1RABA 3IAHA 3LDAA 3MJDA 1I10A 1J8VA 3VZPA 4GGMX 1D2CA 4JGBA 1LPAB 1YRWA 2GO7A 3V1NA 1IG0A 1UQUA 2V8BA 4ZDKA 5KNBH 4HG2A 4P3KA 3O0TA 4LYYA 1NBOA 2YYYA 3RADC 2PUGA 3DDHA 3PDIA 5EUQB 1E1DA 1V9CA 1DTSA 3DO6A 2HXSA 1P1JA 5EQFA 3SPXA 4AWBA 2XH8A 1RKQA 4OL0A 1TQ6A 2GZ1A 1NUHA 2O3SA 3ER8A 2PNJA 3B1XA 3RDPA 3F5DA 2VDLB 2FG5A 4UZSA 2ASVA 3HY6A 3K5WA 1X80B 1OXBB 4NYJR 3RS8A 4UTVA 2E49A 3UNXA 1EESA 1I4OA 3ZU6A 1NJGA 1F8UA 3QKRB 2XMBA 2W58A 4QGGA 1Y9ZA 3UXYA 5FUQA 2I4MA 3QY0A 3I37X 3PEFA 3M6AA 1EKXA 4ZEVA 2C8JA 4R1OA 3U4HA 2YUIA 1V2HE 3I52A 3IVCA 1K5PA 5AUNB 1IN6A 4N41A 5BN5B 1DJPA 3B1JA 4O59O 2FR0A 2EG5A 1AS0A 5B37A 4KN8A 4EFDA 4QG3A 2W8BA 3CONA 2WWIA 3P26A 3OQVA 5BSGA 1NBEA 2Y1EA 3EXFB 4NJEA 2A0YA 2WJVA 4RFLA 2D0PB 4BYMA 2R8EA 2Y71A 4XX1A 1F1BA 2ODQA 1G59A 4HPXB 3NWJA 1XLTC 4ALNA 4B32A 4DGQA 1DBRA 1N77A 4RNCA 3G13A 4JYBA 1TUBB 4GMXA 3U5ZB 4UUNA 4NFHA 4HRAA 1RWOA 3TD9A 5CNKA 1L4HA 3DLIA 3O0DA 1ADJA 3AF1A 1RXYA 4RCVA 4KITB 3DW1X 2XMPA 1XZBA 2IDZA 3LNCA 3HBLA 1UMBB 3FMGA 4MV6A 5IJXA 4C0JA 4EK9A 2G0AA 2I6FA 4KUHA 2FZ4A 1XMVA 5IKMA 1X0XA 2H0AA 4OQMA 2X2PA 1P2BA 1KA9H 1T35A 3FNEA 4ZZ1A 1O6GA 5J4LA 2EU8A 4CM5A 4JLVA 2K2WA 3OFVA 1FTYA 1HT3A 1TTHA 1X9GA 3Q7QA 1W4RA 1ZCAA 5JZBA 4B83A 4J16A 3RC2A 1LGYA 4WJLA 1S9DA 2Z4RA 2OGWA 5FWYA 2AFIE 4E88A 2CNLA 3EZ2A 2O8BA 4TKVB 2XUZA 1EBFA 1Z6ZA 2OZVA 2Q7OE 2EW1A 4CT0A 3KEFA 1YZGA 4WOJA 3G49A 4AP6A 4E5MA 3F8TA 1PSZA 1IH8A 5AESA 2I1WA 2BFOA 5BY2A 5JS2A 5EGSA 1XYGA 2RGGA 4WAUA 2UYGA 5FJIA 4RZSA 5CFLA 4P6VF 2NTVA 2HJGA 1WU8A 3VU9B 1KZGB 2Z2KA 4JI5B 1SUDA 1YZHA 3BIWA 4MO9A 5BNWA 5JSHA 1XPUA 1DG3A 3FPAA 4O0LA 5DCLA 2LDBA 5E4JA 4N18A 4WKOA 4Y0NA 2BV3A 3SK0A 4C4ZA 1HTBA 1HUQA 1NQOA 4R1PA 1AGYA 4BGEA 1LBSA 1WM1A 3Q1LA 9ABPA 1RPTA 1T2CA 2HU8A 4IDCA 4QEZA 1PR3A 2D5BA 2BMFA 2CNDA 3GIDA 1MVNA 2HDHA 3FRJA 4AY4A 4LNHA 3DB2A 4MQLA 5JPIA 3CLRC 2QD4A 5D3MB 3GNSA 3EPHA 2ZTVA 4BB5A 2FP4A 5GM1A 5D3KA 4Z0NA 1IUOA 1RI4A 1CUAA 3TRKA 5I6DA 3S55A 3KUUA 3W3AA 1ZHFA 1ZN7A 4PAOA 3NDRA 4FDVA 3SSNA 2IH4A 3SYTA 2V7VA 1ZM9A 4H6XA 3EIQA 1K4MA 3ZLTA 2H57A 1JIQA 5AI5A 4I50B 2VS1A 3A3OA 3NS7A 4WJZA 2MSLA 4LFCB 4ENWA 1P0FA 2C3MA 2AFIB 1AKMA 1G3IA 4B9EA 2B1RA 4P32A 1PGQA 2WRZA 2X9NA 3ZX4A 5IT5A 1BHSA 3MXTA 2JD0A 3N0TA 2XMRA 5DHSA 3SMVA 1IEVA 4ZHQB 3W7AA 3A2LA 3F9IA 4KVGA 1CFZA 2E55A 2C2OA 4RGQA 4F1JA 1I5RA 2XIQA 3DTTA 4U2BA 4UOQA 4YYZA 1GKKA 4PTZA 5I48A 2GAAA 2BW0A 3QZUA 2BGIA 2QV7A 3NEYA 4RV5A 1KMNA 2BZ1A 4ZCQA 3ZHOA 4EB8A 4Z1OA 5B1EA 3PQDA 3R7WA 4AIIA 3AXSA 1I2CA 3C7TA 4TLAA 4RD3A 3FWHA 4M1OA 2QMEA 1WW2A 4NOJA 2I3BA 3I62A 3O93A 1V1RB 3D1JA 5F76A 5CDTA 1SHLA 3B3AA 5EJEA 3UMYA 5EWJA 4OGFA 1K92A 4MK4A 4P8RA 1GZHB 2DH6A 1DOAA 1Y98A 3BMQB 2YZ2A 1ZIDA 2PX3A 2WJYA 2EJCA 1C80A 1EGAA 4YRQA 5ALMA 1SKUA 3O91A 5C8YB 3Q8MA 4M36A 1RTTA 3MUEA 4NV3A 4IKOA 4CLDA 4S1OA 3X1MA 2HA5A 3PHBE 3FUWA 1CQIB 1L5YA 3AHFA 2JJMA 3LKDA 3CX3A 3P9ZA 4INJA 2QAIA 5CEFA 4ZO9A 2Z43A 2C83A 2C7BA 5HKKD 4JX8A 2D00A 2YWCA 1W34A 2X9QA 5AK4A 4CL0A 4RHYA 1M74A 2ZVJA 4QWMA 3V34A 1WUKS 2PUBA 1BXKA 2QW0X 1XJCA 4KYIB 5KVQA 1NV9A 1ZA1A 3EZ6A 4UM8B 1LX7A 1ZD5A 2F1KA 4LWOA 4C7OA 2WIBA 1Z83A 1NVWQ 1XA4A 5A9SA 1IWBB 4JEHA 1KAEA 5AKZA 3MMNA 1DV2A 2LE0A 1NFRA 2NW6A 5JVDB 4EBFA 1JE1A 3FHLA 2QL5A 5PNTA 3ZCSA 4CFYA 4CXMA 1U3VA 4R8SA 3K73O 2JI4A 3HN7A 1GAQA 4CMBA 1SCQA 1G9XA 2CN1A 4HP8A 1M9NA 3LS2A 5EN4A 5KX5A 4ENRA 5AHOA 3X44A 5LDGA 4MHOA 5BYKA 3D2AA 1N6OA 3B6ZA 6YASA 5SZIA 2OILA 4ZAZA 5BMVF 2B7LA 3IE2A 4QFDA 4RD4A 1Z2AA 2JFYA 3GLHE 2ZS7A 1BOFA 3ETDA 4L8YA 4CIXA 1F0KA 1IXZA 2PMCA 2IW1A 3L7YA 3KQMA 5FIUA 2AG6A 4DA6A 4JLOA 4MVJP 1EHYA 2OGUA 3JQPA 1EUCB 1RQNA 4FFMA 1DEOA 1JDPA 1T8TA 3IVRA 3LCRA 1Z5PA 4XKJA 1V6AA 3HCOA 2AN4A 3HXMA 1DC4A 3ROZA 1WJGA 3VMFA 4C08A 1N6LA 3LOUA 4DCNA 2NYAA 3HB1A 5JMOA 4HZIA 5A7HA 1E0KA 3CZ9A 4LGVA 2JEOA 5CHYA 1OLSA 5D6NA 1QFXA 4PRZA 3SKVA 5B3AA 3CNBA 4NU5A 4AF6A 1H2XA 2ZDGA 4AP5A 4IR7A 4CIDA 2V65A 1N25A 2XB6A 2NU8B 2YV4A 2EL9A 5KDLA 1DCKA 4Q9KA 4KLCA 2FRDA 1PJRA 3JAWA 1RMYA 4GOLD 2WTNA 1W94A 4K0KB 1YJ5A 3RW9A 1GQOA 2DR2A 2O7NA 3HU2A 2PUVA 2ZWAA 3KLPX 3ORYA 3QLVA 4S1PA 1N6IA 2P2NA 4FCCA 4WINA 4R7GA 4D02A 2BGGA 1SXIA 3TSWA 4J4TA 4WUVA 1EEXB 2Q27A 1LRKA 1UJCA 3TMYA 4C0WA 5BUSA 1KJNA 5ALZA 3ROMA 1B00A 1YS7A 2VIIA 5DSTA 2QAGB 4QGBA 4MQMA 1EFRD 1NKSA 1PG5A 3B70A 3BHNA 2C2ZA 4KFTA 4X41A 4M0CA 4Y2JA 3M6MD 1V3UA 2MMCA 3DHWC 4Y1EA 1MMFB 1JEJA 1Z26A 1JQJC 2XRMA 3BFXA 4J3JA 5BWNA 1G5FA 4JBNA 3SQLA 2ZJZA 2BFFB 5JVDF 4CF4A 2WWHA 1GT91 3OD1A 5FHQA 1MG5A 1L4KA 3M1IA 1FTSA 2V97A 1HSZA 2XTNA 2Z1MA 4ZVSA 2VJBA 2DT8A 4IH9A 3VPGA 2NVUB 4D4IA 1NBMA 2ENUA 2QTZA 1Q1NA 1Y5RA 2QB5A 3PDIB 4G85A 1OFUX 4EJMA 2QMUA 4MR7B 5IXJA 2A14A 5LSAA 3AYZB 3AR3A 5DNWA 1I0ZA 4JB2A 2OVFA 5TPZA 4HB3A 4U2FA 2Y1XA 3C0KA 3DONA 4PC7A 4P4NA 3K94A 4BAZA 5BNIA 3G1UA 4YNBA 3ADOA 1JFVA 1TJ5A 4MYDA 1ZHOA 3DEYX 1JHAA 3ORFA 3QEJA 5DTMA 2QTNA 4J91A 4MPJA 3U31A 5MN6A 1SQSA 2L17A 1ABFA 1SUAA 3N0WA 5FX2A 5KEIA 3KT6A 1DSSG 5H9WA 3FF1A 2AXQA 1TU3A 2ZIVB 5TS3A 3GAZA 3IBTA 3UK2A 1FDWA 5T8KC 2Z83A 1G3MA 1E20A 1ONOA 4MGKR 5EI5A 1I6LA 4LF6B 1YV9A 1X7XB 2ZCUA 2MT9A 1SVMA 3CNNA 3F97A 4N8DA 5TPWB 4Q4HB 2EJWA 1FEZA 3JQQA 4OYYA 2YV1A 5HFJA 5TGZA 2QF7A 4DZZA 4P5EA 4Y2GA 4PFSA 3HKDB 1KTVA 4NZOA 4DR2B 1C8VB 3QG5A 5ECWA 1E99A 2AVDA 2A0KA 2X8JA 4C76A 3WZLA 4FI3F 4D3FA 4D42A 3E2PA 5HWSA 5JAPA 1FCJA 5DU2A 1NVBA 1POWA 1KSGA 3X1JA 4AZ0B 4CFZA 4QOHA 5CDSA 3WYGA 3TZKA 1K9VF 1QCZA 4D9CA 5C7OO 3H04A 3MW8A 1W4ZA 2JL1A 3NDIA 5SYAA 3NXKA 1CUBA 4MRRA 3TB6A 4P53A 2EFEB 3CIFA 3VR4A 3ZTWA 1S0UA 1UBSB 4BLPA 3UFXA 3HMKA 4DEVA 3AJDA 1Q3TA 1PUJA 3LC0A 4WY2A 1BO6A 1KO8A 4NEQA 4ZDWA 1WDTA 4Z7QB 3BQ9A 3T1TA 4BFVA 4HWRA 2ZRIA 2G9UA 4V0RA 3I64A 3IODA 5FTJA 4AS3A 5JJCA 4KPUA 3WA7A 1EPUA 2GASA 3FAKA 3LK7A 4DT1B 2P5YA 2VP5A 4PZZA 2PQMA 3LPAA 3M6UA 1M0WA 3AW8A 2GZ3A 2X77A 3DAOA 1PWEA 3DKKA 1N9ZA 3MILA 4F9EA 1SCUA 1JDNA 1DC8A 1UODA 3PC2A 1G4AE 2PCLA 4FT2A 1UQRA 4FE3A 2FPLA 5DLYA 1GGKA 4AZVA 4M0KA 3CH5A 3TK1A 2HB6A 3M89A 5FJJA 3CCCA 2EX4A 1WB5A 2QL9A 2YTZA 2KM1A 3ENWA 3GLUA 2ONZA 4UAVA 5DXFA 4TLCA 3AF4A 3SHQA 1VJDA 2VH2A 2DLNA 3LY7A 1BWSA 1O77A 2GK7A 4ROTA 4K9LA 3DFIA 1I5OA 4M8KA 1N33B 4RH0A 5BSTA 4KC0A 4P7KA 2IZZA 2R2GA 3Q3JB 5IH3A 2EEZA 5AT1A 1WZNA 1ZW6A 3I05A 5EZYF 2H1HA 4ZMSA 3QW2A 2R87A 5THQA 3UAVA 4DCTA 1DIHA 4B0OA 4O1IA 5C8VA 2J0VA 4XH9B 2C8LA 2Z5LA 2AC7A 3RVKA 1XRLA 1H3FA 4KODA 3G5LA 3WG9A 5JY1A 2GK3A 5A0FA 3RQSA 2YBEA 3KQHA 3JQBC 3H2SA 4N3AA 2ALJA 2JFXA 2JIQA 2PUWA 3ZE7A 5CBPA 3WNZA 3PQ6A 2NSJA 3U26A 1GADO 4XVHA 3NORA 2IS4A 4PAWA 5YASA 5FR2A 4KVAA 3KOZA 2L19A 4ND6A 4WY8A 3BA6A 2P90A 1Q19A 1UIRA 3JQEA 4E94A 5B7PA 3L41A 1T3SA 4D57A 2W83A 4OYRA 3A2MA 3T95A 4YRNA 1E7YA 5DSXA 4EW3A 1YI1A 3KHTA 4NIMA 1P5HA 4HN9A 1PP4A 3OBBA 3G79A 4IHJB 4OIFA 3JW8A 4BCDA 1TEXA 1OZFA 2ZTMA 1KJZA 3GJQA 4WKGA 3TTTA 3NZEA 1VI2A 2ZRCA 4FEYA 1RWMA 1SK9A 2GERA 2GK6A 5C8YF 2R6HA 1F3LA 4Q6BA 4NCBA 4OGLA 3ZUGA 1Z88A 3GEIA 1QLWA 4X61A 1USIA 5IAJA 4BVJA 4EI9A 4HUQA 1GPUA 4BO5A 2A30A 4LYGA 2BAGA 4MR9B 3DUFB 5C5EA 3Q5EA 1AMUA 4MV5A 2VQDA 3CUSA 3LGXA 1J2EA 2VJAA 1LRLA 4BEJA 2EATA 2C7RA 3TOSA 4LSMA 2VT7A 1TVEA 5C0OE 3W6PA 1NNEA 2VA8A 4JDPA 4FVTA 4GLBA 1XZIA 1SQ6A 2HZ7A 2G1UA 2RI1A 1Y6GA 4KKXB 3AESA 4HJRA 2GILA 3QE2A 5I3CA 4Z53A 4MKHA 4K6KA 1QX4A 3RTCA 1VJRA 3QLUC 1M6EX 3Q0EA 4LHXA 1N32B 2EF1A 2VWQA 3B89A 1XTQA 1ZJ5A 4XPIB 2JIDA 1E7SA 1X1SA 3DZBA 1KMQA 2W6PA 5C8YA 1XK7A 3HB4X 4O2AF 3LPCA 3AC0A 1G1MA 2PT7A 1RJ9B 5K9ZA 3ICOA 2ASEA 4CHTA 1KR2A 2V5VA 1IHOA 3RS7A 3ITKA 1RJDA 2FN9A 2PA0A 3IP1A 3AKCA 1RRPA 1QM5A 1ZI6A 1V5GA 2HK7A 3B7PA 3F9RA 4JJFA 3VQTA 2V3WA 3QPUA 3R0QA 4GI5A 3H2HA 5EKDA 3RHFA 1GZSA 2ZRNA 2V5UA 2AN3A 2YQ5A 1N3IA 3PE3A 4YEDA 2IU3A 1V5FA 4TVOA 3S1AA 2BFAA 4BE7B 3RAEC 3SHWA 4D8TA 4C4OA 2K7FA 3DJYA 4V2IA 4Y6QA 2WYOA 4GG1A 3FPEA 3PGLA 1EFVB 5B55A 2J0QA 3TBFA 2PYIA 4HFMA 4IWNA 2L82A 2GPBA 3FA2A 2IUFA 5AKYA 3O2SB 4MWGA 4Q4HA 4MYUA 3VNAA 2JFUA 1ZGBA 1KSFX 2ECKA 2CGEA 3NHFA 3OM9A 4UASA 1TIBA 4CV3A 2F3SA 4QTYA 4KQIA 1CUIA 4BMYA 1QGED 2NWQA 2EVWX 1Z4JA 2PL9A 3QWIA 3W06A 4EVRA 4FGJA 5KNCH 2ZRQA 1WSWA 3TW6A 2OZPA 3L6CA 2QQ0A 3U80A 3KELA 5FBZA 2X2EA 3UG6A 3VX3A 5BNFA 3ST7A 1L7QA 1ZRNA 3WFJA 2WNSA 3QU9A 1N6PA 3TD2A 1JXAA 4OFWA 5KTYA 4C04A 2POQX 4O33A 1TM4E 1JKJA 2RAPA 3AEKB 4QSMA 3QU2A 4ND2A 2A35A 3C3XA 2HM7A 4MAAA 5D3ZA 4F9GA 3HDTA 1J25A 3N58A 2BTQA 1CVRA 2BOVA 1DI0A 2UVPA 3SY8A 2BCJQ 3UAZA 4F9TA 3UBTA 2KW5A 2EP5A 3CF4G 4QT4A 1SC6A 2YZMA 3H75A 4UHJA 2NG1A 5AKLA 1VLJA 3AEQB 2Q5JA 4RZXA 4KOAA 3K72B 5HIMA 1ND5A 3X43A 2XYVA 1NULA 3DWIA 1WR8A 1Q91A 2QRVA 5HIJA 3MCWA 4WLNA 4UUMA 4B3HA 4KV9A 3V8QA 4N54A 1NBIA 4I99A 1W1WA 3L0OA 2AZTA 4YPVA 2BY4A 3WL4A 4A0QA 1IE3A 4ISCA 3CUUA 4UARA 2JZCA 4KR0A 3PXAA 4XJVA 5JJKA 1Q7EA 5JANA 1QG2A 1A8QA 2J6IA 3DKPA 2Y67A 4XJTA 1TW3A 2BGRA 2J3LA 3WDLA 1L5FA 4L5JA 2W6NA 4B7XA 3CZCA 1FLVA 3P9SA 4BFUA 3TQRA 1E1YA 1ODLA 2XNDA 4I9HA 4RWEA 3UB3A 1IPHA 3WKCA 1K2VN 1F3OA 2D2XA 2IDJA 3TS1A 1EBBA 3UY4A 2WVJA 3EIOA 3ZZMA 4N76A 1TYBE 1XP8A 1NXTA 2FSUA 1AXGA 1QMGA 2VAMA 2ES4A 2IA5A 2VJOA 3DF9A 3OJ0A 4B8WA 3RC1A 1TEZA 3D0OA 3HXKA 3JAWB 4KDRA 1O95C 3BHMA 2XLBA 5D87A 4URVR 2HRZA 2WUEA 3AEUB 3OCZA 3RC8A 5KWIA 1Q1GA 2AL7A 3PHCA 4J7UA 4Y1RB 3KVRA 4YCBA 3D02A 5I5EA 3VX4A 1VHQA 1EFUA 1RJWA 2DM6A 3KOYA 1MA3A 2OKGA 3X2SA 5JNTA 3GLRA 5E9AA 3AO0B 1A7UA 4HBZA 1FMTA 1JYSA 1L4NA 3DNMA 3FR8A 5BYAA 1YOVB 2KBEA 4ZI7A 3GJ6A 2OFXA 1EE1A 1TM3E 2FMUA 4M99A 2E2WA 1E94E 4MV3A 2J0EA 3ZXIA 3UJ7A 2RHDA 3Q3CA 1NURA 4RGYA 1K0UA 2C7QA 4N40A 4GHWA 3ABIA 4YQFA 3S7TA 3MT7A 5AO9A 4B45A 4BLRA 2XGOA 5GIPE 3GRAA 4NZYA 2WHPA 2CJYA 4DLAA 2B94A 1OU0A 1E9SA 2JCBA 3LZDA 4XDHA 1C9DB 4QA9A 1H5UA 2BSQA 4ENSA 1B4DA 2JFPA 2RGCA 3WK9A 1B8PA 3OSUA 4YAWA 2NQTA 4IG9A 4MLPA 1KE2A 1DTWB 5K4HA 4N1AA 1KBOA 3F47A 4DDUA 4Y8VA 2J3DA 4LEIA 1YE5A 1G98A 1CY6A 3GFFA 1R88A 3FCYA 5F5NA 3HM9A 1Z6AA 2EWVA 4NV1A 3QQ5A 4O2BB 2J5BA 4UXHA 3E4CA 3G2MA 3J81k 1NI3A 2HJVA 4RHXA 1ISMA 1SZDA 3OIDA 4NE9A 2GUGA 5EMLA 4KO8A 2D13A 2VHUA 3CG4A 3G2PA 2JASA 3MYYA 3UT6A 3D64A 5GJVC 4L6IA 5ECYA 4FBGA 3VPFA 2Y77A 4JJ6A 5REQB 4UPEA 1C7EA 1DBSA 4M86A 3UWDA 1RRFA 2Q9UA 3EJWA 1OWOA 1E2GA 2NXWA 4KDFA 1T4CB 3TKLA 2F3PA 3FOBA 3OFNA 1U8AA 4DMRA 2QMZA 1USVA 2NZXA 3E61A 3LBYA 4NBKA 4PCAA 4WXPA 4YCSA 4OOEA 3WMFA 3DYIA 1JHRA 1SZCA 3DXZA 1F8YA 1RT9A 4D8UA 3GF4A 2A58A 4FSXA 3A4YA 1F17A 3RYHA 4CEJA 1YB2A 3MERA 4FWIB 1SCUB 1OILA 1MG0A 1VZ3A 4LXHA 5GADl 4QL3A 3THXB 3I23A 2HRCA 1BXGB 3ZDDA 1W19A 3IAEA 2XGGA 3RSGA 3PPIA 1U2QA 1YB1A 1ZJZA 3H65A 4I5FA 2P2LA 3UO8B 1Z5UA 4IKEA 1R0CA 4J49A 2QGZA 3BGIA 4C7JA 5JXGA 2PGNA 4ZMRA 4RK4A 2C7OA 2DQZA 4A1OA 4FKZA 3IRVA 1B0PA 3KT3A 1GPYA 4ETNA 3MINB 2AZXA 2GRAA 2I55A 3GT7A 1KBZA 5F64A 5CVJA 5IF3A 1A77A 3L0ZA 2YBDA 1NQTA 3ENQA 4RJTA 5I7OA 2FQ1A 4R0VA 4UM9B 1RFLA 4W7HA 1E32A 2Z30A 1RD4A 3QTTA 4DLUA 1KVSA 1OFIA 2V7TA 3BXZA 5JQWA 2YC4C 3UW1A 3A70A 4F4JA 2ORVA 3U3ZA 1XDSA 1E61A 3GMIA 2J5XA 2JCGA 4E5SA 1NN5A 5CR9A 1JEQA 1SA0B 1USKA 3KWJA 2AHRA 4RVDA 4RXMA 4G1BA 5CFQA 4QGSA 2H59A 1T9GR 2N3ZA 3E9RA 2G17A 1DRWA 3M4NA 3U4AA 2B4KA 4M83A 4JR0A 3ELDA 3HYTA 4ZYWA 3D7MA 3ETJA 3VNSA 1H66A 4W9MC 3TTVA 2HIMA 3L7AA 3P9RA 4YBZA 2ZI7A 5JQGA 3GFRA 2JVKA 1HT2E 1UC8A 4CM1A 3N3BC 2QYHA 1RXWA 4TYPA 5FLYA 4R1NA 2X22A 4F4HA 3TRFA 1NVDA 1ECJA 1CHDA 2EWWA 4RS3A 4BO6A 2R6R1 4ZI2A 3S8YA 4ZPJA 4Y3UA 2E87A 2C8VA 2XNSA 1DVRA 2IPLA 3JR3A 3OPYA 4HH3C 2GZAA 1N0IA 1T8UA 1YB4A 1AUOA 2G5CA 1GTMA 3BMOA 3IAS1 4FN5A 4O4JF 4ATNA 1PFYA 3ZWYA 4YR9A 1ZGJA 5D5PA 3SQXA 2V59A 2F1OA 1JP7A 5A7GA 4RD0A 1KF0A 3I53A 4MNTA 4PTYA 2QZSA 2I8CA 4AW9A 2CV0A 4V24A 3C8MA 3L9WA 1WMEA 5DX8A 5K0EA 3VKHA 4AROA 4HLUA 1Z5OA 1TGYA 4BNKA 4PZCA 5ALFA 1XNGA 4PYRA 2HF2A 4QECA 2YHAA 1H2RS 4NBVA 3AL3A 1C9KA 1DAKA 3ESZA 5ALRA 2P8SA 2BEUB 4XGRA 2C9CA 2PKXA 4QIHA 5IZCC 1D2AA 5D5HA 1OYYA 1R18A 4RQUA 3NBUA 4LJYA 1BEEA 1T13A 2WUDA 5A2GA 3COVA 4US0R 2UYOA 1EGVB 1WTAA 3KB8A 4I4CA 1H2WA 1FK8A 5EHIA 4XYLA 1N5JA 9LDTA 2AKEA 1RXVA 5HZGA 1PEKE 4Z4GA 4MVJF 1Y6RA 3D3WA 4N5HX 3NNSA 5EJ6A 3INGA 4ITUA 1WPRA 1IUNA 4L0MA 4ZT6A 4UXJA 3Q6MA 5DLPA 3QXGA 1QK4A 3DAHA 4OSPA 1C7ZA 1U0HC 5E7MA 1MR3F 4RJIA 4FCTA 2HW8A 4RIIA 4JR1A 5B1SA 3W4IA 3EY9A 2WF7A 1V35A 2C5AA 3ESAA 4GOND 4MPPA 4CKBA 4HAVA 1P7CA 4ZVVA 1P75A 2FW8A 3CLRD 3I9LA 3NGXA 3UEOA 2JHPA 1BTOA 1GYPA 1X1BA 2PWYA 2H5LA 4PG4A 1EFTA 1J23A 1LV7A 1EJ0A 1RC1A 2QYOA 3GY0A 4YB8A 3HNPA 1QVZA 2JIOA 1GITA 1XD2B 3TJMA 1BC5A 1UWCA 3F74A 2FW9A 4JX9A 3STTA 3NV9A 4Z54A 1I7QB 2EJVA 2LD4A 1PJ8A 4TQ9A 4U0JA 4WECA 4I46A 2O50A 4C5BA 3I9V6 1P7ZA 4UFPA 1M54A 5CW1A 3GFBA 1NXWA 3E4DA 4ETWA 3DKIA 2QN1A 1LDBA 1QZXA 5E1BA 1KKUA 1RZRA 2F8SA 1ZD1A 3MSCA 3O5AA 1I0LA 2EV9A 1R16A 3PFGA 5EZYA 3HWX1 3PTAA 3PT5A 1I94B 1RE0A 1XUOA 2BFMA 3C16C 1KIAA 3JQ6A 4EKNB 2COEA 2ERYA 2M1ZA 1GAEO 2QN2A 3LYUA 3H2ZA 4MVJE 4PS0A 2QLJA 1Y3DE 2PGXA 3LECA 4JL6A 2ZI6A 3VSDA 2B3DA 2P0AA 2XGSA 3VBEA 4F60A 4KREA 1WP9A 5AI9A 1P8JA 1AQJA 3PJGA 5EKSA 2XB4A 3H3FA 1WHTA 2WUGA 3K35A 4LJ4A 1FW6A 2X40A 4N0EA 3STXA 1C81A 2J32A 1ICIA 3P2IA 5GONA 1QTNA 2X3UA 1D4ZA 1G16A 4BP9A 1NBHA 1SG6A 3FCUB 1E3EA 3ZWMA 1NV8A 1R2QA 2IQ5A 2QI9F 2QWXA 4MHSA 4UEJA 5DNAA 4D43A 2JGFA 5HM8A 4WT7A 1Q17A 2BFCB 2ODEA 3SZMA 2EKBA 4I4LA 1H2FA 2XSZA 4I50F 1QNFA 3ADBA 2WIGA 3M9WA 3DR3A 1UOQA 3AB7A 3QLEA 3MIIA 3ZBQA 4WESB 4KQKA 2NVUA 1R50A 1U0FA 1UMDA 2QZZA 4FHFA 3GMTA 3ETEA 1QDLB 3VYWA 4H7IA 1AQIA 3GBVA 3LFHA 1U2GC 3TEJA 4UEOA 1IJEA 1RKBA 4GZLA 2CNOA 3BTSA 2UUCB 1WY7A 5ICSA 1QRUA 2CLEB 1G9TA 3QM1A 1KVTA 4MGYR 1ZNZA 1TVKA 1CKEA 4J94A 3L4JA 5TR9A 1P31A 1SC9A 1FMJA 2JAPA 3NT2A 4OQ4A 5JS6A 1KEKA 1ZLYA 8ABPA 4TQAA 2H18A 2C58A 1VMIA 3NIBA 1L7RA 1S2MA 1U8FO 3C48A 3UT5A 4MS3A 2GX6A 1JG3A 2C04A 2HTEA 3ZCRA 1H1TA 2O8FA 4QVGA 1N6KA 1OH6A 1NYRA 1SUFA 5LQDA 2F67A 2IPAB 4XM1A 5EWMB 3ZBPA 1BZYA 1TMOA 1ZSNA 2PH1A 1CIVA 4G3XA 4D3DA 5LJIA 4NFYA 5BOSB 5BRJA 13PKA 3DGEC 4UEWA 4BX0A 3WKDA 3QVOA 2ZB7A 3NM5A 5HEKA 2GN8A 3U39A 5HOEA 2PSEA 4BECA 1ECCA 2OHXA 1R1DA 1NF8A 2Y1DA 4H1HA 4WMLA 4NJMA 1UEIA 5K3BA 4AX4A 4U3JA 3AONB 1MFZA 2VUHB 5LOVB 3SSAA 3HXQA 2HRDA 1XXHB 3SVLA 1UC4B 1DMRA 3S1LA 4P58A 4NEGA 1E66A 1WHSB 3FNIA 1PIWA 3IUNA 4XA8A 3SZRA 1OH8A 2GK4A 1O87A 3T5MA 4XVQA 5FYQA 2XMCA 5IKEA 4QFBA 2A7XA 3MD9A 5IM5A 4DCUA 4M1EA 4YAKA 2I4RA 3LT0A 4OL9A 4IRUB 1VPEA 2FZLA 2PD4A 1PL7A 3DMGA 3WJ2A 2DFLA 4BU0A 1KEUA 2FNAA 3RVBA 3CGWA 3ZVLA 1T3LA 3FHJA 4HQOA 1U3CA 1Y9AA 4JJIA 1UBUS 4MB2A 4U2EA 4CWAA 3FTEA 3OKFA 4PLCA 2HLPA 2ID9A 2YXPX 1IQ0A 3E58A 2X1LA 2C31A 3NHRA 5FFFA 2VPYA 5KNCD 3CVYA 2VPQA 3OA0A 1BYIA 4AJ4A 2RGDA 5IT9A 3FE2A 2PGLA 5EHQA 5TQVA 3R7WB 3WLLA 1P2SA 2BN4A 2HSDA 1G64A 2IX9A 4DJEC 2JBAB 4HFJA 3QX3A 3IUYA 1DEHA 4YFYA 3HO6A 2YWDA 3EC1A 3W9BA 3L8CA 3OX4A 1QZUA 4N8EA 4RYLA 3A6DA 4EPWA 2Z3WA 2YZ7A 3NKFA 1M2GA 3MYRA 4L8FA 1MPTA 5ALYA 2IUUA 5KDOA 3PC6A 1T5TA 2IZ7A 4OB6A 3ROXA 3TVTA 3V7NA 4KYUA 3C3AA 3SN6A 3WB9A 1DJLA 5LZ5A 2WR8A 5DK6A 4FWBA 5F1OA 3W79A 1BXGA 3SZLA 2G63A 1KVQA 4QDUA 3H5NA 3B9PA 1JAZA 4LA4A 1P1KA 5D51S 1Z4OA 3AEZA 2FEWB 3V1KA 5BXYA 3T12A 1C3VA 2L69A 1EVEA 1SKAA 4ZWNA 4W5JA 4XB2A 5EXEA 1QG4A 4ECEA 2WJ3A 4JJKA 1PK9A 3LHSA 1P17A 2I4LA 3G8DA 2OLEA 1TA0A 3H16A 1U1GA 3SDSA 2CF5A 3CUWA 1EJBA 4Z5XA 1D6SA 5KJFA 2I29A 2NSLA 3FFAA 3R40A 1G4HA 3AF3A 1E4EA 3LBIA 1XYVA 4FINA 3D4PA 3G5MA 4FKMA 4TYQA 4COKA 4XUDA 3AU8A 3KWMA 1NX6A 3ZHVA 2GRJA 5B2EA 3F6BX 3VR2A 5BSRA 2DPMA 1PBTA 4XD7A 3MPOA 4GNKA 4JJ8A 4F1WA 3VZQA 5JALA 3HUEA 3DE2X 4ND1A 5HVNA 1Z39A 1LNZA 2QTGA 1NOJA 1XTUA 1KQFA 3STHA 4YJKA 2CDCA 2WM3A 5FWDA 4BLTA 3OH8A 1JEYB 2AD5A 3DE1X 3U7IA 3CZ4A 3LYAA 4F11A 4NMLA 1KC3A 1YBVA 1XMSA 1ZGZA 2WHXA 1CBUA 2VPXA 1BXRA 2ZEJA 1YQTA 2XVXA 3I2FA 1RBYA 4KV7A 5LYJB 2P5SA 2XF8A 4FHCA 5AICA 3K09C 5I7VA 2F9MA 2WJ6A 3A3NA 1QIIA 1CDEA 3QE0A 1FY2A 1UANA 2PT5A 4HDAA 5SV2A 2W6QA 4GC5A 4JROA 5E8RA 2XGMA 3WLJA 1ZNQO 4A0HA 5IJ9B 5I9SA 1ZUHA 1V4NA 5F1KA 1U94A 3PUIA 5HCNA 4JSTA 3SXUB 3IMCA 3DFMA 3GDHA 1HO3A 1ZRMA 2V6BA 1SGWA 2VOEA 2J5QA 2QXYA 4Z1MA 4DCMA 2OMKA 2VPTA 1CU1A 5D3MA 2GBCA 3GJ8A 3BREA 3K96A 3RC7A 4OXXA 4YHBA 3ND5A 4DHEA 1APBA 2B37A 3VJKA 3E9DA 2QPAA 3MJEA 1GAJA 5TJHA 4I1VA 3FOCA 3S44A 3LT2A 5KYUA 1FNMA 1S8OA 2QRMA 4DR3B 4GI1A 2ZRJA 1I4LD 2MSNA 1EUDA 2PWPA 3HXTA 4G0PA 1XZHA 4QUBA 4R1LA 2ZIZA 3RASA 2B6NA 1D2NA 1ZH8A 5T64A 3T52A 3GH3A 4JCCA 4RJ2A 2GTIA 4DIBA 1F0PA 4JIGA 3QE9Y 1ULSA 3OEHA 4IJUA 4UVIA 1NMXA 1O97C 1SQ0A 1PS8A 3AIOA 3G9ZA 1KZYC 1R8SA 3AHCA 2KQUA 3MTJA 4Z0TA 5ADUS 1L7PA 5B5SA 3K2EA 3TD6A 1R6BX 2FK7A 2O1WA 2SICE 4OHUA 2H31A 2G80A 2Q1YA 4RLQA 3U56A 1JIJA 2WPDA 3MCAA 4JQYA 4KAFA 3SHTA 4OI0A 3K53A 3DBRA 4GIBA 4JQZA 1SOAA 4E31A 4PG7A 1BHJA 1XEWX 5DP1A 2I6TA 2DKFA 3G59A 3TEMA 4DV2B 4GRAA 4BCCA 3EZYA 4QU5A 4RAQA 4OU4A 3V1UA 2D2VA 2O2GA 4BNGA 5COBA 2YJGA 3A1SA 3WBFA 5G0WA 2F17A 1ZIYA 4PXYA 3HFSA 4RZ2A 5CAEB 3DBLB 1R9MA 4H08A 3ULKA 4OFBA 4DQ0A 1RRVA 1IQUA 1II9A 2P11A 3GT4A 4N6GA 3WAKA 5DBEX 4MA0A 3H7AA 2PMKA 3U6BA 1KZ7B 2AFVA 4WY5A 1ULZA 3QVUA 3ZU4A 1YRYE 1ARZA 5AW3A 1QORA 2JJQA 4A6EA 1SUSA 3BSWA 1EP3B 1P60A 4EG1A 2Q3JA 3FNGA 2P1ZA 4DDKA 5JDIA 4DV5B 2BMVA 3CLVA 3V5NA 2IZ5A 3NHYA 5IBRA 4PINA 2OPBA 5KQLA 3IS3A 3UYKA 2FEXA 4ZYYA 5K8UA 3H9JA 4F12A 2P62A 3PX3A 4F71A 1ZD3A 3KDPA 3NHLA 3P45A 5K3DA 1FVHA 2Y1GA