1PJBA

L-alanine dehydrogenase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
361
structure length
361
Chain Sequence
MEIGVPKEIKNQEFRVGLSPSSVRTLVEAGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRVGLTAIAYETVELPNRSLPLLTPMSIIAGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVPNMPGAVPWTATQALNNSTLPYVVKLANQGLKALETDDALAKGLNVQAHRLVHPAVQQVFPDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structure and substrate binding of Phormidium lapideum alanine dehydrogenase.
pubmed doi rcsb
source organism Phormidium lapideum
molecule tags Oxidoreductase
molecule keywords L-ALANINE DEHYDROGENASE
total genus 112
structure length 361
sequence length 361
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA02
3FN4A 1MFZA 2RCYA 1E7MA 4JN6B 3GPDG 4Q39A 1NR1A 2HQ1A 1UZNA 3JQAD 3OJFA 3GF4A 3U62A 5KJ6A 3RC7A 4Q3NA 4BNHA 5HWSA 4NU6A 3QV1A 3LF1A 1EK6A 4OKNA 4OXNA 1UAYA 3KLMX 4YJGA 4BO1A 3WYBA 1XSEA 1EVJA 4YRAA 3WYCA 1PL6A 2Q1WA 3V5NA 1PJ2A 1GV0A 5L4LA 4XR9A 5EMHA 2BI7A 3I9JA 3LC2O 5G4KB 3I6QA 1FK8A 4CR6A 2NTJA 4BIIA 1F0YA 3AJRA 4W99A 2PZJA 4RO0A 1O94A 1Y9AA 3GY0A 1T2EA 2EW2A 4KZPA 2Y67A 4CUJA 2CDAA 2LDXA 4DQUA 3PYLA 1UUFA 2YV3A 1E3JA 2ZATA 1BW9B 2PY6A 3CE6A 3IC5A 2GZ3A 2PZKA 4B4UA 1ML3A 3DMYA 3FBTA 3L4BC 1BHSA 1EUZA 2EXXA 3WLEA 4RORA 1YBMA 4MP6A 4HXYA 4ZQGA 4AJ4A 2WM3A 4GI2A 2B69A 1MG0A 3Q1LA 1NNUA 1HT0A 5COAA 4KDEA 4A10A 5B37A 3NDJA 2OFPA 5DCWA 4GSLA 3JD2A 3UW3A 2JHGA 2HMTA 3GG2A 1NPYA 1LRLA 2P9GA 2O2SA 4BO0A 1PJCA 2HMUA 4XYMA 4ND5A 5I7EA 5A1TA 5MGBA 4IPTA 2FRDA 2YV1A 4RF2A 1GDHA 1QYWA 1H5QA 3L0DA 4JJFA 1FJHA 1E1LA 3E1KA 3DAFA 4QEDA 4E2XA 5BNFA 3F6YA 1ZCJA 2IZZA 1F8FA 1YL5A 3NJ4A 3DBHA 2ZB8A 4HY3A 3QRWA 3IP1A 4RQUA 5JPIA 3RUAA 3UF0A 1GYPA 3L07A 4GWGA 3LC7O 2JD0A 5L9AA 1NVMB 3QW2A 1A27A 3HDJA 3MTJA 1E92A 3ONFA 3A28A 3UXYA 2CY0A 1I32A 1IPEA 1ISHA 2PD6A 3FPLA 2Q2QA 1HYEA 1P31A 4RPKA 1WDKA 3VPGA 2RH8A 1YJQA 4G5HA 5DDIP 2EGGA 4TMFA 3HDQA 4DIOA 3E8XA 2J5KA 2O50A 3ZHZA 5BT9A 3QLJA 4BL5A 1X15A 1TVEA 5K9ZA 4L76A 1M67A 3CXRA 5DZSA 1CETA 4K9DA 4L4RA 4TZTA 2B4RO 4AG3A 3I1JA 4YRBA 3HSKA 4NJMA 1BDMA 1KVUA 2C82A 1QKIA 1ZMTA 3DTYA 3HN7A 3M6IA 4BGIA 4E21A 4CLRA 3B6ZA 4CM3A 3I9KA 1BMDA 2RHCA 4CQMB 5ADHA 1JKFA 1IYZA 5I8WA 3K73O 5KJ1A 1EVIA 1A71A 4DXHA 3DXFA 3P5SA 2NV6A 1LX6A 4I1IA 9LDTA 4CMHA 4EEZA 3DZJA 1KEUA 1P33A 2GLXA 4XCVA 4P8RA 3ZWWA 4U7WA 3LC1O 3VZQA 3PJDA 4QX6A 1F14A 3H6KA 4Y6RA 2CMDA 1KY5A 2A35A 1DJNA 5CDGA 3FSRA 1HDGO 3SXPA 3WMXA 3RUHA 4CV3A 2VOJA 1Q7GA 2VYNA 4DMLA 3AY6A 2HLPA 1X7GA 2J3KA 2QG4A 3I9LA 5HBRA 2WTBA 1ARZA 4GH5A 3WBBA 1PZFA 3WXBA 4B3JA 2WJPA 2O4CA 3EGOA 4PLHA 2I3AA 4U0JA 1HDRA 3FNHA 3Q0EA 2D2IA 4LCEA 2YHIB 4W6ZA 3VPFA 3JYLA 1B0AA 4NDNE 1U9JA 4B3IA 1ZSNA 3EZYA 3E9MA 4NPCA 5JDCA 1PJ3A 5IDYA 3NUGA 4CM5A 1R66A 1UXKA 2B4TO 3KSDO 4K6CA 4ZRMA 2G5CA 1LDYA 5EQDA 2JHFA 4RQTA 3NT2A 4I9NA 5JAQA 5A03A 4RVUA 4WLUA 1VL8A 4FPXA 3PGJA 3PHHA 3VPXA 3V1UA 3IIEA 3H9QA 1NVTA 1T2DA 3AU8A 4LN1A 3H9UA 1DC5A 4NH4A 2VRCA 3G1TA 1KIFA 4TRMA 3PEFA 4J90A 4B4WA 2NU9A 1LDNA 1ULSA 3Q11A 4Y6SA 3RI3A 5C7OO 3WNQA 1Y5MA 2GN9A 2HMVA 4KQWA 1PJLA 4JLWA 1I8TA 2DBVO 2H6EA 1C0PA 3W8FA 2C54A 3D4NA 5TF4A 3RU9A 3WGHA 4EUFA 1LA2A 5IZCC 3BHIA 5TNXA 4M89A 4D3SA 2ZCUA 3AM4A 4PRKA 5JDIC 5TJHA 4RF5A 3EMKA 2BKAA 3GHHA 3AW9A 5ER9A 2WSBA 1IPFA 4CLXA 5MDHA 2GRAA 1A9YA 3N74A 1I33A 4GGPA 1K6JA 4AJPA 1JTVA 3VZRA 5CP8A 1ADGA 3ZV6A 2G0TA 4LW8A 1GY8A 4R68A 3A14A 5I8ZA 1U1IA 5IAAA 3GT0A 4ILKA 1XKQA 4P38A 2ZJ0A 2D0IA 3GUCA 2RH4A 1B2LA 3DMTA 1V3UA 2NSDA 4XYGA 1OAAA 4XYLA 4CR8A 1H9BA 1N9GA 4XWYA 3JQFC 5FI5A 1L1FA 1JKIA 1VKOA 4FOOA 4JP3A 2RHRA 3F9IA 1LLCA 3UICA 2X6TA 1UXGA 2FPGA 2J8ZA 4RZIA 4AVYA 1WPQA 2X0RA 3C8MA 4YCAA 3PQDA 5JXWA 4ALMA 2GDZA 2BI8A 1SCUA 1N5DA 2GZ1A 1CF2O 5AQ1A 1SB9A 4BKUA 4CMEC 3K31A 3Q2IA 3IJPA 1ISFA 3HJAA 5CPBA 1GU7A 5L7YA 2PGLA 1P1HA 5HRUA 4WPGA 3TZHA 1PX0A 2O3UA 4DL9A 4ZQHA 1IE3A 1JAYA 3QQPA 5CPFA 3ON5A 2YHIA 4RLSA 3DHYA 3JQ6A 4W9NC 3W8EA 2Z1MA 2VUUA 1K3TA 1PQPA 2Y68A 3GAFA 2IZ0A 3W4JA 4HNGA 2F1KA 3O38A 4L8VA 2AXQA 2FWMX 4DLAA 2GSDA 3RJ9A 4DBZA 1I2CA 3ADOA 1U3VA 4ZJUA 4CM7A 3PHIA 1B3BA 3D7LA 4FFMA 1H2BA 2Y66A 4N18A 5HTOA 3H9JA 2PNFA 1JN0A 1E1MA 3PHJA 4JNKA 5ILGA 1HE3A 5AYVA 1HDXA 1QLHA 3F47A 5AXAA 5JCJD 2EV9A 4H7PA 4I8XA 5ICSA 4FSHA 1GZ3A 5IXSA 3WGIA 1M66A 1E6UA 4MP3A 4ALLA 4BOYA 5IZ4A 4WKGA 1VSUA 1YOVB 3AOEC 3EZLA 2W90A 3TL3A 1DHRA 2OXIA 4CQMA 4JBGA 3CZRA 1E7WA 4NBWA 4WK6A 4NK5A 2Y0CA 3W1VA 2PA3A 2A4KA 3ROPA 2X8LA 2VZ9A 3PRJA 1EE9A 4NJMB 4IDBA 3OP4A 3AI2A 3VDQA 1O8CA 3MEQA 3R3JA 3S2EA 4J4HA 3FHLA 3ONEA 2PKQO 5CFZA 5T6BA 2D5AA 4HP8A 4CJXA 4F3YA 1VJ1A 1Y81A 2HK7A 2HSDA 1NYTA 3ZGYA 2NM0A 2NUAA 1GPJA 4RLHA 1T4BA 4IIVA 1EFLA 3RUFA 3AY7A 4XQEA 3I4CA 2VCYA 5DULA 2XXJA 3LU1A 5U9CA 3QWIA 4GVLA 4JCOA 3FR8A 3M1LA 3ZH2A 1WXDA 5DCUA 2O3QA 1R4MB 1T1SA 3HG7A 5A9TA 1PR3A 2GR9A 1U7HA 4DQVA 2A92A 1XR3A 2ZB3A 1R37A 3NJ8A 3RASA 3DBHB 4FIZA 4J1SA 5AXBA 1RM5A 3LVFO 5C3MA 4O5OA 5EQFA 3BTSA 3AUTA 2X0JA 2YYYA 1V3TA 4XB2A 5GZ6A 1CJCA 4CM9A 2B37A 1ZUD1 1B14A 2X5KO 5I7VA 4DTIA 3OBBA 1ZJZA 1Z7BA 1DB3A 3HB5X 4KUEA 4FDAA 3R3SA 2H5LA 5EL0A 1EDZA 4KP7A 1ADBA 2W4QA 1HE2A 3ST7A 1YBAA 3MWDB 5IN5A 2OO5A 3KO8A 3WS7A 2IZ1A 4IDDA 2VT3A 4S3MA 4LMPA 3NDIA 4BKOA 2BFPA 2HRZA 2O48X 4R9SA 2IDZA 3MJCA 3OJLA 3LLSA 4HFNA 5IG2A 3DBRA 4UVHA 4EJ6A 4E3ZA 1NP3A 4O0LA 1HYGA 3OIGA 5AOVA 4LRSB 1LTHR 2WDZA 2Y1FA 1UAGA 4P22A 4AJNA 2R00A 3ENKA 3JTMA 1E7YA 2JAPA 3GFBA 4PVDA 3DL2A 4OH1A 3GVHA 3CPSA 1NHGA 1BWSA 3JQAB 1K6IA 4W9NA 1XLTA 4YAEA 5IDWA 2BGMA 3HDYA 3QWBA 4G2NA 3PWSA 3VPHA 1MA0A 2HCTA 1XDWA 4HFRA 4IQ0A 1KC1A 5BSFA 2IYOA 1AGNA 3JQAA 3I9MA 2ZB7A 1GUFA 3RIHA 1R0KA 4PG8A 1M6WA 4BKQA 4RV9A 4A0SA 1NQ5A 2JCVA 4IDCA 3M1AA 3I3OA 3WWZA 1OMOA 3ADPA 4RL6A 3ZWCA 1C1XB 3QE3A 4KUGA 4J2HA 2DTDA 1QYXA 1ENPA 3FTPA 3BAZA 1R15A 3JD4A 1NVGA 4CQLA 4TKLA 5JDCC 2X9GA 3GNSA 4LVUA 4XX0A 2V65A 3HFGA 3IUPA 4BNXA 3U0BA 2VWGA 4UEKA 1E1KA 3NDRA 1DAPA 1ZK2A 2QRLA 3KV3O 4J4TA 5ENVA 4BB5A 2JCYA 1GUYA 3PYXA 1OBFO 4IQGA 1QLJA 4YPOA 5BSEA 1E3SA 4BO4A 4Z0TA 3NTRA 3LK7A 1YQGA 4BNTA 3O26A 4XR4A 5G0UA 1JWAB 4M55A 4YAIA 4XRGA 4LRTB 3K6JA 2J3JA 4II2A 3KM0A 1SC6A 3GVXA 1P3DA 1K89A 1NQAO 1Q0LA 4UVIA 4WEOA 4NBVA 3UKOA 4DBVO 2VHZA 4PRLA 4B4OA 1MGOA 3MTGA 3OQ1A 4UAGA 1B8PA 2EWMA 4BNKA 4CM8B 3F4LA 4YWJA 4MVJE 1P74A 4RPJA 4CLRB 3I23A 1SBYA 4UREA 1Y6JA 4QXMA 3U9LA 4BVAA 2GERA 1K6XA 3H5RA 3AUAA 3DR3A 3BTVA 1UP7A 4O1MA 1MXFA 3VVCA 4GLOA 4BNYA 2Q4BA 1LDGA 3E03A 2JJYA 5EESA 4PLPA 2VTEA 1J49A 3C1TA 2PR2A 3V2HA 3WIEA 2I66A 4E30A 3JQBC 1NXQA 1PGNA 2FSVA 4PLYA 4XGKA 1HLDA 1YXMA 4OQZA 2BELA 3TOXA 3ZN2A 3E82A 3INTA 2OUIA 4NMHA 1QYDA 2A9FA 2H9IA 4IDFA 3WGTA 4BO2A 4ZVVA 3TOZA 1LSSA 4LSWA 1LXCA 3MJ4A 2C07A 2YDYA 2E48A 4PVCA 4UULA 3VHRA 3Q2KA 1DIAA 2W2KA 2VWPA 4JX8A 5GZ1A 2B35A 1DBVO 3FR7A 4BKPA 3PDUA 3NT4A 3TWOA 5FI3A 3KSUA 4J3FA 2BD0A 2HKIA 2V6GA 1W73A 1GQ2A 3KHUA 1YWGO 4CL3A 2O23A 4EZBA 5IF3A 4UEOA 1BRMA 5JY6A 1GEGA 2W98A 1ISMA 3DZHA 2FZEA 3HWRA 4OL9A 1GL3A 4L75A 4I5EA 4Z3KA 4WJZA 1E3WA 3RKRA 1U5AA 4MIYA 2D59A 1GZ6A 4DLBA 2AEMA 3P2YA 4J7CA 4HNHA 4NBRA 2AMFA 3K30A 3VVBA 1KEWA 1ZIDA 3JQGA 3DOJA 1QG6A 2UUOA 3H2ZA 3G1UA 3GOHA 2ZK7A 3GNTA 2ZTVA 5DN9A 2AQ8A 2IEBA 3TNLA 4DUPA 1TT5B 2R00C 5JCJA 4DMMA 4K26A 3PVZA 4BQPA 2NU8A 1T2FA 3RU7A 4L4XA 4EDFA 5I9NA 1I3NA 1NQOA 1RYEA 1PJSA 1C1XA 4CMJA 3KTDA 1VPDA 3JD1A 1GCOA 3KYDB 4NJOA 4NFSA 4DYVA 4BNMA 2PH3A 1M2WA 1K5HA 2C29D 1PS9A 1BXZA 2BFOA 4FN4A 4OGWA 4IINA 4R41A 3VZSA 4YAJA 2EKLA 1U5CA 4W7IA 4RDIA 1BTOA 4OM8A 5L4NA 4KUHA 1J0XO 2WEKA 5GMOA 1MC5A 5CDSA 1Y8RA 5B4TA 1DIRA 2VYND 2WD8A 4OSPA 4W7HA 4A5OA 3OH8A 3H5AA 5A4DA 1MG5A 2QZ9A 5AVOA 3QVTA 1HXHA 1LC3A 2B5VA 3PZBA 3ZWAA 2CF5A 1Q1NA 2HDHA 4RZHA 1RPNA 4BNWA 3BMQA 1K0UA 3IKTA 1YL6A 3NX4A 3PHLA 4YQYA 5ER6A 1PR9A 1JVSA 1G1AA 3PDJA 4JBIA 1TB4A 1A9ZA 1VKNA 2GZ2A 1LLUA 4GSKA 4FJ2A 1TEHA 2YZ7A 3C85A 3WTBA 1PGQA 3WYEA 4P4GA 1UDAA 3QVSA 4R5MA 3ONDA 1Y1PA 3KZVA 4KDFA 3TZ6A 4E5YA 4D3FA 3GA0A 4OSOA 2D8AA 2HJSA 4LCJA 4Z3DA 1E1NA 2X22A 4BNUA 1DOHA 1F06A 4Y6PA 2XF8A 3NRCA 5KKAA 2YW9A 1P9LA 5TQVA 3L6EA 3OM9A 4CLEA 1I36A 3A9WA 1DHTA 1NR7A 3GVIA 4MVJF 4OOFA 4CUKA 1H6CA 4FFRA 4WLEA 2CZCA 1XU9A 3RUDA 1YGYA 1CQIA 1OZAA 1P1FA 4YT5A 4MO2A 2FMUA 3V1YA 3WNVA 4I5GA 4PLFA 4FJ0A 2EIHA 2RBEA 2UDPA 2P9CA 3MJEA 1L7EA 5I7FA 3RVDA 7MDHA 1PGPA 4A26A 1T4DA 1ZH8A 3A06A 1HEUA 1WDMA 3BMCA 2XOXA 4L0QA 4ZICA 5KOIA 4IJVA 3GEGA 4J9UE 3C7DB 1VSVA 3I6IA 4CLOA 4D46A 3V1TC 1ENOA 1QSGA 4EI2A 1Q2XA 3AY3A 4YT4A 1ZBQA 1N1GA 4OQYA 1GUZA 1UH5A 2CSUA 3ZU3A 3AI1A 1R6DA 4CUZA 2EG9A 3TQHA 2C20A 2Q50A 3G79A 2YJZA 4CM1A 1TT5A 4HFMA 2DFVA 3OEWA 4RVDA 5FEUA 3WDSA 4UUPA 2D1YA 3JYPA 2B83A 3ZU4A 3JYOA 3FWNA 4XB1A 3K2EA 1CIVA 4FJ1A 2FHSA 2QHXA 3FI9A 3VKVA 3RWBA 4LGVA 1B26A 1X1TA 4MKZA 4XEHA 3NV9A 3R1IA 5KNLA 2Y0DA 5JSFA 2TMDA 2HMWA 4CPDA 4CODB 1HSOA 2BFAA 4X54A 3PYMA 3HFSA 4R5HA 4CMKA 4ALIA 4CLOB 4TRJA 3JQ9C 5H83A 4J9VA 3WGZA 2NU7A 1X0XA 4Y67A 3PGXA 2BH9A 3ZW8A 4LMRA 3KETA 3KBOA 1LQUA 3RKUA 4B8ZA 1HWYA 3G0OA 4J49A 3QJ5A 2RAFA 4TWRA 1E5LA 5COQA 2J5QA 3TSCA 1EDOA 2EEZA 4HFJA 2QIOA 4NZ9A 1T2AA 3JV7A 3D64A 4B3HA 2Y99A 1DRVA 3LLVA 5A04A 1A7KA 4I08A 3OA0A 1E7SA 1V8BA 2NVBA 1RM4A 2IEDA 3VPSA 2BMAA 3LSYA 1CWUA 2ZQZA 3L77A 1Z74A 3F5SA 1BXKA 5TC4A 1V3VA 1QMGA 1Z75A 3JYQA 4AJKA 3H2SA 1NPDA 3EVTA 5BQFA 5IDXA 1DRUA 1B3RA 4BGUA 1I5RA 4O59O 4WLVA 1EE2A 4GQAA 3SC6A 1FXSA 5KTKA 3H5NA 3D0OA 5FFFA 8LDHA 3BMCB 3OQBA 4KMSA 3DQPA 4CV1A 2C7GA 4OAQA 1N2SA 1QXSA 3O9ZA 3WQSB 3ICCA 3SC4A 4R3NA 1HE5A 1JKJA 3H3FA 2CFCA 1PZHA 3ZWOA 1CYDA 1HDOA 2PWZA 2FR0A 1U4OA 4KQXA 1AXEA 1UDCA 3PFWO 3UN1A 2GYYA 2PD3A 2HJRA 1ZXLA 2I6TA 1DAOA 1DLIA 3B1FA 3BYZA 2X1HA 2UV8A 2RIRA 3IMFA 4YAKA 1AXGA 3EY4A 1KS9A 5T64A 1KEVA 4FW8A 2Q49A 2GD1O 1EFKA 2DBRA 3QSGA 4FCCA 1NFFA 3DZIA 1SAYA 4JP2A 1PS8A 2VN8A 1ISIA 4BNJA 2Q45A 3DMTC 5L40A 4HUJA 2C59A 1NAIA 3JQ8A 4JJIA 4DIBA 4CQLB 2H1SA 3P2OA 3DZBA 4FOSA 4TZKA 1PL8A 1ZKMA 1Z7EA 3AOGA 1PWZA 4I9HA 1T24A 5T8KA 4GMGA 2I3GA 5EIOA 1E6WA 2VOEA 4WNIA 3I52A 3K96A 4L4SA 5G0TA 1WDLA 4J0FA 3WJ7A 5HS6A 4MVJP 4FBGA 1VRWA 4N5LA 4IJWA 4BUCA 5JDIA 1H6AA 3PJGA 4BO7A 1Q0QA 1EBUA 4IZIA 3ROKA 3ANMA 1I3KA 4MJLA 3JSAA 3WX0A 3WBFA 5KJFA 4RVFA 4BQRA 4XQ9A 4D42A 4MDHA 4XIYA 5DBFA 3ZWVA 1WLYA 3ZWPA 1F8GA 3D5QA 1N92A 3K8ZA 5T5QA 3U4DA 3QY9A 4F45A 3ZNQA 4UUMA 4WOJA 4ITUA 4J91A 2Y05A 4CMIA 5TT1A 3AM5A 2Q4EA 5J23A 1GV1A 2DTXA 3ITDA 1PZGA 5DP2A 4NIMA 4YJHB 1PIWA 1QV6A 3RC1A 1R4NB 3BZUA 1N8KA 1XHLA 2YUTA 1LRJA 1X13A 2TMGA 5EERA 4E32A 2W2LD 4PZCA 4MINA 4YQZA 3CZMA 3HDHA 2NVUA 1OFGA 1E3EA 2QYTA 3VKUA 2ZQYA 4ALKA 1U3UA 2YQ5A 4D0SA 3D5TA 4KWHA 2G1UA 4Q3DA 3DBVO 5B4VA 1VLLA 1C0IA 3W6UA 4WCFA 4CM4B 1NQTA 3G17A 1PJBA 3VDRA 4EYEA 3DFZA 1EK5A 1NFQA 1B7GO 4A73A 2PTGA 1NWHA 4UUNA 3TZQA 4WASA 1CRWG 2I65A 5I9LA 1B8VA 4ND3A 2PV7A 4ZU3A 4B8WA 4GX1A 4WCFC 3ZWBA 4CLHA 4Z6KA 1UZMA 1E7QA 1QYCA 2AEFA 4R01A 6ADHA 1UJMA 2EW8A 1ZO8A 3HHPA 4DPKA 4U5QA 5IDQA 4G81A 3MOIA 1P45A 4OO3A 2EP7A 2ILTA 5JFOA 3D1LA 3GMDA 2NTVA 3TDKA 3I83A 4LSMA 5JAZA 2BF7A 5KVCA 4BO3A 4XDZA 5A5FA 5CG2A 2UUPA 4URFA 3T4XA 1RKXA 5C37A 1YONA 4OYRA 1HRDA 4JK3A 3F46A 1YDWA 1H6DA 3ITKA 2NU6A 2X58A 3KLPX 3WIDA 2ZYDA 1FF9A 3COSA 4UVGA 5DCYA 1GZ4A 5JE8A 3CMMA 3WTCA 3BHJA 1P44A 4C7KA 1I2ZA 2UVDA 3GDGA 2JAHA 3CKYA 3E9QA 4E2WA 4IMPA 1IHYA 1PU2A 2X5OA 3AM3A 5CAEA 4GKVA 2J5RA 2X0IA 4CV2A 3EAGA 5DBGA 1XELA 2J3IA 4GKBA 1DDOA 2X7HA 1OI7A 1OC4A 1LRKA 3L9XA 2B5WA 1UXIA 4IGFA 1RYDA 4NBUA 4DLLA 3WICA 1W6UA 3TFOA 4E13A 1KVRA 3TFQA 1ZEMA 4MVJG 1MX3A 4CLDA 1RJWA 1EUDA 3GVPA 5A06A 4H3VA 3W4KA 3V2GA 1NASA 3ULKA 3HQ4O 3RQSA 2DM6A 3ZWXA 2BHLA 4JROA 3DTTA 3LZ6A 3B20A 4YT8A 4YAGA 4QUKA 2Y1CA 1XWFA 1X7HA 2VTDA 1C1DB 3L9WA 4D7AA 1EQUA 1I24A 1U2GA 3BMNA 4G65A 1HE4A 4YRDA 4U6QA 5FWNA 2AE2A 2AE1A 2NTNA 4PFJA 3ZWMA 3LYLA 4DQXA 3GPIA 1CEQA 4FQ8A 3RBZA 3FBGA 1A4UA 2GN4A 3RC2A 3CEAA 4R1TA 3ZV3A 2Q1UA 4TVBA 1NPTO 3KYCB 4CMBA 1XG5A 2R6JA 4EJ0A 2DUWA 3TJRA 3NGXA 4ND2A 5DNAA 4ZRNA 5C5IA 3IUSA 2B0JA 3DZKA 2OGUA 3Q9NA 1JLLA 4GLLA 3GR6A 4PG4A 4BNZA 2V6MA 1RWBA 4C7JA 1LDEA 1QR6A 3GEMA 6LDHA 3PI7A 3EVNA 3SLKA 4YT2A 2IODA 3K5PA 5I7SA 1HL3A 1CDOA 3PJEA 1BVUA 4J7XA 1GD1O 4U6SA 4DREA 4NHEA 1Q0HA 3U49A 1XGKA 2OORA 2EERA 3FNGA 3GRKA 4J1QA 4I5FA 2EGHA 3WQRA 2VUTA 1TT7A 2W2KB 3KVOA 3JQDA 3ZV5A 3PK0A 3AU9A 5A5EA 4PG7A 1Z45A 1TI7A 1U7TA 1NWCA 2JFHA 1FDUA 2ZCVA 4TVOA 5TLSA 2FP4A 2VHYA 1G6KA 5JO0A 3N58A 3CMCO 2O4UX 4JJGA 3KOUA 1BSVA 3RD5A 1DRWA 4INAA 4QTZA 3P19A 1FDVA 4XQCA 3S2FA 4AICA 3RCBA 2VRCD 1C14A 1ENZA 2VHWA 1MLDA 4GL4A 4K1LA 1RM3A 1X0VA 4PIVA 4AL4A 1PGOA 4CM8A 4IS2A 1WAMA 4AJ2A 3LQFA 4RF4A 4BS9A 1NAHA 3KYBA 5JMPA 1ZFNA 5ES3A 4E6PA 5AXDA 4E2ZA 3Q3CA 3C24A 1XCBA 4FFPA 1S6YA 1ADFA 4YTEA 3JQEA 3ROMA 1YB4A 3TN7A 2C2XA 5TRTA 2ZIZA 1DIBA 3MZ0A 3H9EO 1E5QA 3WMWA 1LSOA 1EZ4A 4PG6A 4YJFB 4MVJH 3RC9A 1DO8A 5H82A 2X9VA 1J6UA 1P1IA 1A7AA 2C2YA 3ZU5A 3ZWYA 4RCVA 3PXXA 4A2CA 1O5IA 2P68A 3HB4X 2EJVA 2PD4A 1AHIA 1AHHA 3D3WB 1TLTA 4D41A 1ONNA 3GAZA 5U1PA 1LBEA 1PGJA 1SPXA 2EKQA 3FNFA 4CMAA 2QQ5A 3L6OO 2YFQA 1EMDA 2ZTMA 1WZIA 3S2IA 4XD2A 4CMCA 1WVGA 1CQJA 3O8QA 5DT9A 3FF4A 3DEYX 4II3A 4DPMA 3AWDA 2DFDA 4OMUA 1BW9A 1DXYA 2PK3A 3H3JA 1VE9A 2D4AA 2LDBA 1JDJA 3QVXA 4RVHA 3ZNOA 5KVVA 3WLFA 3PZRA 3VAZA 5L95A 2YV2A 1O0SA 5A9SA 2PGDA 1WWKA 2J6IA 5L3ZA 4ID9A 3GN1A 4FFOA 2DLDA 4CM9D 3JQ7A 2DPHA 2Q3EA 3MCVA 4IQ8A 5CHEA 1GADO 4A03A 4RDHA 4ALJA 4HWKA 3S2GA 1I3MA 1IOLA 1HZZA 2AA3A 3TRIA 5CDUA 5JC8A 1LLQA 2X5JO 5G4KA 2PH5A 4FR5A 4PLVA 1DC3A 2IXAA 4W82A 1PJTA 2E82A 4GX0A 5A05A 1J5PA 4XDYA 1BXGA 2FY8A 2O3JA 4WCFB 2DBQA 2D5CA 2VNSA 3GUYA 3SBOA 5G2OA 1XEAA 2B4QA 3BMOB 4J7UA 4DPLA 4ZQEA 4ONEA 3Q6IA 2P9EA 4Z9FA 2DQ4A 2AEJA 2E4AA 1JU9A 2P5UA 1T2CA 3AUUA 2GUGA 1IY8A 4CMEA 4FFNA 3OHSX 3WGOA 3OEYA 3VH2A 1H94A 3OIFA 4D45A 4D0RA 5L7WA 3K9QO 3EDMA 1R16A 1EUCA 4Q3EA 3KRTA 4MPDA 3VZPA 3ZDFA 4F6CA 1PQWA 4GGOA 3OFSA 4ND1A 1XA0A 3L6DA 1YO6A 2CNBA 3F5QA 4K28A 2NLOA 5B1YA 1ZJYA 1HDZA 2B36A 4JGBA 4PZDA 2Z5LA 5CG1A 3ABIA 7ADHA 3WB9A 1L7DA 3DONA 2O3RA 3QWAA 1XU7A 3S8MA 2O7SA 4HV4A 4BV9A 1GYRA 3HNPA 3NEPX 4QSMA 3B1JA 1TA4A 4XRRA 1VJTA 5DP1A 5L45A 5JAIA 3T7EA 2E37A 1I01A 4IJKA 3IOYA 1YQDA 3X2FA 3PWKA 1H6BA 3SJ7A 3E9NA 4ND4A 5DF1A 2WYVA 2Q1SA 2YQ4A 1F12A 5T67A 2G76A 3B70A 1KY4A 5KVSA 1E7RA 4GX5A 5C7IO 3WGGA 2D3TA 2DKNA 4QFCA 1YJ8A 1WW8A 4R4JA 3ZWNA 3FPCA 4YBZA 1Z6ZA 4IBOA 3I5MA 4L9RA 3GNQA 9LDBA 1EEHA 3DZGA 3QIVA 4M1QA 4Q3AA 1MC4A 4FC6A 3WR5A 3VC7A 4ALNA 4AJ1A 4ESOA 4WOKA 1KETA 4MVJD 4C4OA 4QO7A 2WWRA 2BRUA 2O3SA 1GAEO 1C3VA 3VOSA 4R3WA 2A94A 3AOEA 4YJHA 2ZTUA 3GGOA 2BFMA 2YFHA 1T25A 2OL4A 3OF2A 4HKTA 2VUSA 5TJ9A 5KCZA 4P4NA 4YEDA 3V2UA 2XPCA 4GMFA 3D3EA 4Z0HO 4ZHSA 4YYZA 3ZU2A 3OQ6A 4ZN6A 3DBLB 1Z82A 4O6VA 1XQ6A 4N5NA 1YE3A 4GAEA 3PHGA 1Y8RB 1KBZA 1G0OA 3OECA 2DU8A 1U3TA 4R1UA 2JL1A 3JD3A 3ZHYA 3DWFA 5K6AA 1PWXA 1VJ0A 4XYBA 3IL2A 3DC2A 2R2GA 3IKVA 4U0KA 4WE3A 4J1NA 4WLOA 1H0KA 1EQ2A 2QRJA 4KTVE 5FYDA 1SOWA 1GTMA 2PZLA 2AG8A 3IQDB 2NVUB 5G0VA 1ZXBA 3RUCA 2O3TA 1H2HA 1U3WA 4MOWA 1I30A 4AFNA 3ZW9A 2POQX 5KIAA 4ZQBA 3GZ4A 1LSJA 1ZVMA 4BO6A 1C1DA 5BSHA 4GPD1 1A72A 4BV8A 2DUUA 2X86A 1ZSVA 3UAGA 2CUKA 4D43A 4PN3A 1P1RA 1Q7CA 1NTOA 3QHAA 3QWHA 2OP0A 3LT1A 5A3JA 1FMCA 2WMDA 2Y1OA 5BSGA 4YJFA 1SOVA 2Q99A 3ASVA 2CDCA 3GHYA 4FGWA 4YXFA 3ZNNA 1YDEA 3CSDA 4R1SA 5L4SA 1YB1A 5K6AC 2VWHA 4FS3A 2WYUA 3H65A 3C1OA 4D3DA 4DC1A 4XJTA 1YH3A 3TZCA 1Y7TA 1VL0A 4N5MA 4B4VA 1R4MA 4BNNA 4M8SA 3GK3A 3DO5A 4DA9A 2CVQA 1DSSG 2XXBA 3AFMA 4MIOA 3D4PA 2OBNA 3JQBA 4CQMD 3PLNA 1DFGA 3IS3A 4RVGA 4D79A 4ZA2A 1U2DA 1LLDA 1MUUA 2DAPA 3SX2A 1KERA 3ZHBA 4FC7A 3WJAA 3DDNA 2UAGA 3E5MA 2GPTA 1E3IA 3KEQA 4BO5A 4B7UA 4A7PA 3U4CA 3ORFA 4TQGA 5G0SA 4A27A 3GZNA 1QP8A 1HETA 4ROSA 5L53A 2IRWA 2HK9A 1KVQA 2IE0A 3GDFA 2Y1DA 2I67A 3RBXA 5TT0A 3RAJA 2C5EA 4PLGA 1I0ZA 1W4ZA 3UCXA 2VYVA 2VHVA 4CV0A 1IULA 1I3LA 1Y8QA 1PZEA 2I5PO 4E2YA 1F17A 1E3LA 1SEVA 2PKRA 4R9RA 4ZQFA 2E49A 4WNCA 4IJUA 4BMNA 5EN4A 3WFJA 4LVCA 2O7QA 5G0WA 4CR7A 2F00A 5LDGA 3ZZNA 1SO8A 1YVEI 1ISJA 3UUWA 1DEHA 4EBFA 4RJTA 4IY1A 4OKIA 3MOGA 5A9SB 1N9GB 4M49A 2YDXA 3H4VA 4E0BA 1PJ4A 3W4IA 3O4RA 1C0KA 3GG9A 1KVSA 3MJTA 3ZCXA 4GX2A 3L4BA 3NTOA 4BNFA 3GRPA 1LEHA 1ZK1A 2HAEA 2W8ZA 3GZNB 4NQZA 2WYWA 2GN6A 2HO5A 2Q2WA 4N7RA 2FOIA 1LNQA 2Y93A 1K2WA 3FD8A 1N1EA 4F46A 5B4UA 1C0LA 4J6FA 3JQ8B 2PKQP 4NU5A 5TSDA 1EBFA 2I76A 3ICPA 3DB2A 2GNAA 3C3XA 3T4EA 1WZEA 1LSUA 4IXWA 1V9LA 4CL8A 4DVJA 4MIEA 5EJ2A 1KVTA 5LC1A 1ZK3A 2AW5A 3GEDA 4OJNA 3GVCA 4J0EA 3CUKA 3I4FA 1RM0A 2P4QA 3EYWA 3NAQA 2FN7A 1EVZA 3PWZA 3EW7A 1D1SA 3H8VA 3V8BA 4O63O 2E6UX 5HS4A 2HK8A 4CM6A 4QO8A 1E0DA 2IYPA 3BTOA 2BGLA 5TIIA 4N54A 4TROA 4PCVA 1O95A 1GR0A 2FPPA 3DOCA 3F3SA 2FZWA 3RFXA 1ONOA 2GASA 2VRBA 5GY7A 2HMSA 3PIDA 4F6LA 5DBIA 2OHXA 2FPIA 1PJQA 2Q1TA 5LCXA 5KJCA 4UVEA 1O89A 2YHUA 4J43A 1A4IA 1BG6A 4J2OA 1D1TA 3NTQA 4R69A 3TL2A 3VTZA 4ZGWA 4MKRA 4AJEA 3ZV4A 2NQ8A 1HSZA 5EPOA 1V0JA 5BNTA 4JQCA 3KYCA 1NX6A 2V7PA 4HBGA 3FRJA 1H9AA 3F1KA 3WOHA 2WD7A 2BGKA 5IN4A 2GGSA 2P2SA 3LT4A 4Z0PA 3WFIA 3ZI0A 4YA6A 4MP8A 1A5ZA 5A3VA 3VH1A 2HUNA 2OBYA 3W8DA 3E5RA 3LDHA 2V6BA 2FR8A 1JQBA 1XQ1A 3Q9UA 5ENDA 2ZB4A 3PJFA 1DIHA 1LQTA 3JQFA 1ZSYA 1HKUA 3CIFA 3D3WA 3GH3A 2H63A 1MB4A 3IJRA 1ZNQO 1KYQA 1LC0A 1WMBA 2HRBA 1GYQA 4XYEA 1B8UA 4NK4A 2NNLD 4IXTA 5CEJA 1G0NA 3DHEA 1O6ZA 1VI2A 3EHEA 4M87A 4QFDA 3RFTA 1DFIA 3U4IA 1ID1A 1M75A 2VHXA 3QA9A 1R0SA 1YQXA 4GWKA 5IJZA 1GEEA 1MV8A 1VC2A 2O2YA 1NFRA 5JY1A 1YRLA 2WE8A 1HYHA 3PQFA 3T7CA 3RROA 1AUPA 1PQUA 1O9BA 1UR5A 2ZYGA 4E5PA 1E77A 3S1LA 5ICMA 1JVBA 3BHMA 2CVZA 3DOOA 4BMSA 4PG5A 1HF3A 3UVEA 1IB6A 5CDTA 4TRNA 1XIVA 4QT0A 4RPGA 2QW8A 3EUWA 4EUHA 3GMSA 4XGIA 1EVYA 3I9NA 4CMGA 1B16A 5CEEA 4EGFA 1ZK4A 3P7MA 4BHTA 3O03A 3TPCA 3BMQB 2CD9A 3N7UA 5COBA 2C5AA 5AXCA 4FGSA 3OJ0A 3WG9A 4Q9NA 1WP4A 1BXGB 3INGA 3R6DA 4B7XA 4BMVA 2DVMA 5JC1A 2Z1NA 1YOVA 3FTNA 3H7AA 4I9UA 3RBVA 2FSSA 1NM5A 1DFHA 3C1AA 1VL6A 1NBOA 1JAXA 4YJGB 4D44A 1DC4A 4EW6A 2VQ3A 4J1TA 3FCOA 1SNYA 1R0LA 3A1NA 5ITWA 2GF2A 3UCEA 3E6AA 4JIGA 4R54A 5DOVA 1SB8A 1U8FO 1OC2A 1V35A 2ET6A 3NKLA 1QV7A 3G3EA 2ZKLA 4HADA 5BR7A 3JQ9A 2V6FA 4CM4A 5JS6A 4XGNA 4H16A 4AJJA 1BDBA 4UUOA 5FF9A 1DIGA 1P1KA 3VH4A 5ILOA 3H9GA 4BNIA 3B1KA 5IZCA 4DIFA 1QORA 1Y5RA 3UGKA 3AK4A 2PZMA 1X1EA 1LI4A 3CTMA 3JQGB 4BB6A 3OJEA 2AQHA 4GBJA 1WMAA 1UDBA 3W6ZA 3HADA 3E48A 3LT0A 5HA5A 3BMOA 2EHDA 4BO8A 2NADA 5B12A 1M76A 1P0CA 4BNVA 2HU2A 3AI3A 2JFGA 3UOGA 2Q2VA 1E3WB 2AHRA 1YS4A 3GGPA 4PLTA 1J4AA 1P77A 1I2BA 1HZJA 3QP9A 4DRYA 5A9RA 1PS0A 3MJSA 4JBHA 5THQA 4YB8A 5GZ3A 3WQQA 1D4FA 1X14A 2I9PA 4PZEA 3SJUA 4IDAA 3PP8A 4NG5A 1JA9A 4RVSA 3G49A 3GFGA 5K0ZA 3DFUA 4E4YA 1U8XX 1BVRA 3OSUA 3PQEA 1W8DA 3DHNA 2DBZA 1Y9EA 4IDGA 2AG5A 4XQGA 5CEFA 4NNJA 2JCXA 3LF2A 1CERA 1GQQA 4OXYA 4YVFA 5BNIA 3GQVA 1GPDG 2DTEA 1B15A 4AJHA 4R1NA 2Y1GA 3JCZA 1GCUA 3ETGA 1S7CA 1ORRA 3SVTA 4E5NA 4WECA 4I5DA 2DT5A 4Y9DA 4BKRA 4NBTA 1PEDA 2EJWA 3QWFA 2UYYA 3WGYA 4WEQA 3IDSA 1ADCA 2OP1A 3L4SO 1KC3A 2X9NA 3M2PA 3WWYA 1YBVA 1YKFA 4P4LA 4WUVA 4J4BA 4UVDA 4BO9A 1HDYA 3QVWA 1PL7A 2WE7A 2X4GA 4OXKA 3ZNPA 4CMIB 1ZEJA 4IMRA 2G82A 1IZ0A 5JLAA 8ADHA 4EEXA 4NFYA 4YDRA 5JW6A 4LK3A 5JNLA 4TKMA 3RJ5A 2X23A 1ZK0A 3FNEA 3ASUA 2QRKA 4IGEA 5C7LO 1UZLA 2NVWA 1ZZEA 4DYDA 3S55A 4DWVA 5F5NA 4AJLA 1JWBB 3ANLA 1SMKA 1FDWA 2VZ8A 3ENNA 3EK2A 4XIJA 1I10A 1MFPA 1SZJG 5F1KA 2VZ0A 5U4QA 1Y8QB 3KYDA 5F21A 3OICA 2X0NA 4EITA 4IM7A 1ZW1A 1ONPA 2GCGA 3KXDA 4OIMA 1UXJA 1W0CA 2OOSA 2OZPA 4RGBA 1UP6A 5TS3A 4RPHA 3O8QB 4MKXA 2AQIA 2EKPA 2QZZA 3K92A 4Z9XA 3SEFA 3UHAA 1Q7BA 4R16A 3WGQA 3VTFA 2VNAA 2DC1A 4E5MA 2CF6A 4AJIA 1R12A 1N7GA 4M54A 2VT2A 3KEOA 2P5YA 3BTUA 4Y98A 1KEPA 2AQKA 3U3XA 1M6HA 3STHA 3WSWA 4E12A 3UCFA 3AFNA 4NI5A 4KOAA 3I9OA 1D3AA 3DZFA 3GLQA 4GVXA 4L74A 3JYNA 1LDMA 3ROQA 3NYWA 2ZJ1A 2OMEA 1JW9B 3PFFA 4DGSA 1V6AA 3SLGA 1MXHA 4IS3A 5CDYA 3CH6A 3GGGA 3PPIA 4R51A 5F3RA 4QECA 4BNLA 1U4SA 1DJQA 2W2LA 2JFFA 1YL7A 2EP5A 2GO1A 3HN2A 1AN9A 4RPLA 5TGDA 4PGFA 3C7AA 3VH3A 1PSDA 1DPGA 3C7CB 2CVOA 4MVJI 2NWQA 4YACA 3MWEB 4BGEA 3CINA 4Q3CA 2P4HX 4QQRA 5KJEA 5KKCA 5JYDA 1TXGA 1OOEA 2J3HA 3U09A 2QYSA 1P1JA 3BIOA 2Z95A 3F1LA 4IZHA 1ZMOA 4WGGA 2C0CA 3DBRB 3U5TA 1NHWA 5I9MA 3GDOA 5LDHA 4S1VA 1GQYA 3BXXA 2BLLA 3KUXA 1UXHA 3D4OA 3NGLA 5L51A 1E6EA 3FWZA 1LUAA 4OHUA 2PFGA 4FD3A 5JCXA 3HUDA 1SEPA 3IAHA 3OETA 5H81A 4B79A 4XZ3A 1FDSA 1R4NA 1IZ9A 2QX7A 1DLJA 4Y8VA 5THKA 3PLRA 4JXKA 4XKJA 4YJDA 1HLPA 4E31A 1ISGA 2IXBA 3JQCA 3RFVA 1AE1A 1XYGA 5T8KC 3DAPA 4NR0A 5IXYA 5TX7A 1IHXA 4IDEA 5HM8A 2SCUA 5EINA 4BGVA 4TRRA 2VWQA 4WLFA 3E18A 3JD0A 5F1PA 4UEJA 4YR9A 2G17A 4Q3BA 3RSHA 3U4HA 1ULUA 4PLZA 2XAAA 4H15A 4K6FA 1IUKA 1YB5A 4NFHA 3MJVA 2I99A 4EJMA 2FR1A 2PGJA 3DAGA 1N7HA 4OOEA 3NT5A 4RF3A 5A02A 1T1RA 4J16A 1D8AA 3HZZA 5F5LA 3A4VA 3GN2A 4ZD6A 4U8GA 2EF1A 3LT2A 5DOZA 5L7TA 5KWEA 3R0IA 3HE3A 3BA1A 4KWIA 4WLNA 3WSVA 1P0FA 1T26A 3F4BA 3UH1A 2Q46A 5ITVA 1QRRA 2NACA 2Y0EA 4AJOA 5JMWA 3OJOA 3ETDA 5JYEA 1HDCA 3OMLA 2ZYAA 4MVJM 1UP4A 3RUIA 1X7DA 2VYVD 2DPGA 4W4TA 2P91A 1BGVA 2JD1A 3M2TA 4FFLA 2NQTA 3BMNB 4PLWA 2JKVA 3KSZO 3ETEA 2CDBA 2YY7A 3ANNA 3EC7A 4MVJA 5JAMA 1KOLA 3UFXA 4E33A 1ENYA 1LJ8A 4Z9YA 4HX5A 5T57A 4EUEA 2ZTLA 3OIDA 1LU9A 3DBLA 3K2BA 3RUEA 2JD2A 4L73A 3ZHXA 2GN8A 3GC6A 4BNGA 4E5KA 3JQ7B 1H93A 1U28A 1FDTA 1MP0A 4IUYA 4M86A 3TF5A 4TSKA 5JO9A 4B7CA 3AUSA 4FB5A 3OA2A 1DC6A 3KB6A 2C7VA 4IIUA 4XA8A 5JBIA 3TZKA 3INRA 2Y1EA 4PLCA 3X2EA 1GFSA 4DC0A 1D7OA 4LISA 4XJSA 2PLAA 5F1OA 3IP3A 1LDBA 3PIIA 4WCDA 3QVOA 5G4LA 2WD7B 1VM6A 1QYVA 5KVQA 1WNTA 1HTBA 3PTZA 1Z73A 4KTTE 1PTJA 1IL0A 5IFLA
chains in the Genus database with same CATH superfamily
1LKZA 3FN4A 2XNHA 3N5KA 2OCAA 1T0IA 2RCYA 2W6MA 2YN2A 1H4TA 4Q39A 1FBNA 5MF6A 1DMSA 3RC7A 3BCHA 4YY3B 2C1EA 4BNHA 1U0FA 5HWSA 1X8KA 4NU6A 2OILA 2WWFA 3QV1A 4OI1A 2QSUA 4MV1A 3E7XA 1W36D 4G0ZA 4PQGA 6Q21A 1R0WA 4XWTA 1Q14A 1WW3A 5C1BA 1Z3IX 2E5LB 4YRAA 3WNBA 3N2LA 1PL6A 3STWA 3LWBA 2Q1WA 4F56A 2JH3A 4G8BA 1GV0A 2XSZA 1FUUA 4XR9A 5IEBA 2BI7A 4S12A 2O5VA 3MD0A 1ZR4A 3C43A 3OWHA 4EW3A 3H6GA 3HP4A 4L3WA 3UFBA 1E1DA 3P2EA 4TTIA 3DOIA 1NSFA 1L3BA 3GY0A 2OV2A 2Y67A 2YOHA 1CDDA 4LXUA 5KSPA 2RH9B 1WBDA 3EZNA 2I1QA 5DVZA 2LDXA 3FYSA 4YNBA 4DQUA 5IMSA 1QB7A 4Q01A 5KS2A 1W85A 5H1YA 1BW9B 2WWWA 2GI4A 3OPQA 2PFKA 4Q12A 5FV4A 4YPVA 1MGPA 1UQTA 4TUYA 1OHHA 4B4UA 3DMYA 3P45A 1MX5A 1BHSA 1EUZA 3KL2A 3QBTA 4B33A 3UPUA 5FTWA 2V96A 4CRWB 1YUNA 1NA5A 2V1XA 4P5EA 5FBHA 1XCLA 2PS3A 4AIRA 2RC5A 4B9EA 2B69A 1MG0A 2OM6A 3Q1LA 3QI2A 1FX1A 4YK7A 3HA5A 4KRXA 1IWPB 3OEHA 2IF2A 3PNLA 5DCWA 5GINE 1AMNA 3JD2A 2OVBA 2JHGA 1CF9A 2KX7A 2HMTA 3GG2A 2O1SA 3HJGA 2P9GA 3LL4A 3Q7RA 4M0DA 1PJCA 5KNDA 1KJQA 3EIFA 2WJ4A 5I7EA 2FRDA 2FEMA 1O1YA 3DEAA 1QYWA 3FUUA 3GMIA 4HH4A 1HG0A 1LB1B 1N6IA 4RKYA 5HFNA 2WKPA 3WDKA 1FXWF 3AVUA 1BE6A 3DHWC 1FDIA 1YZUA 1NIPA 1HYQA 1OYOA 1OBCA 2JA1A 4IMIB 5TB5A 1BVYF 1WCIB 2IZZA 4KE8A 4JI8B 2BLNA 1YL5A 3NJ4A 2YV4A 4IHAA 5JPIA 5BURA 3UF0A 3IP1A 1P5RA 1F0PA 1V4BA 1XZPA 3L07A 4ZO6A 2FW8A 4JFAA 5CYGA 4MMZB 1NVMB 1QGAA 1A27A 2INGX 2Q21A 4ANFA 5G3YA 4KBGA 3I5XA 5AJWA 1JI3A 4MUEA 1LVUA 2BBOA 1JMVA 2CY0A 3RKUA 1EFVB 2WKSA 1GRVA 1GQFA 1XDBA 4GUAA 4R8VA 5KX5A 4NDAA 1OH6A 2WTUA 1XAHA 1KBOA 2EGGA 3HDQA 4KMRA 5ARDA 3G02A 3VJLA 4DIOA 1SUDA 3I6YA 2J5KA 3H18A 3OX4A 1QVRA 3HH8A 4JUCA 3SQXA 1SC4A 1GKKA 1H69A 4B6PA 1X15A 5BYBA 1TVEA 4LOLA 2OQRA 1ZMBA 2X9QA 4HVCA 2W4MA 1ODTC 5EJMA 4YXWD 4DV4B 1EX1A 3TTUA 1X77A 4K9DA 5FAKA 2XMBA 2CDNA 1WXWA 1XXLA 1KVUA 1TYCA 4MK4A 4KI0A 3ZW7A 1IAQA 1EP3B 5JFGA 4JDUA 5IUJC 4G9EA 3NBKA 3M6IA 1YS1X 1TKCA 4CLRA 4G0UA 4PR3A 2PA0A 3ZD9A 2W6PA 5DHTA 2FK7A 5K2MA 2FUNB 4KHPB 1U3GA 2HGSA 4V0SA 5D85A 3ADCA 2OCXA 3RNOA 1X2EA 3I8XA 4IOKA 3ASYA 1O8BA 3K73O 3QKSB 4PAGA 1EVIA 1A71A 1WKVA 2WJYA 3TLXA 2ZRLA 4AS3A 1CR2A 4HDAA 3IA7A 2XJ9A 3OUTA 5HIMA 5B2FA 1B8OA 3N8IA 1N32B 3A6GA 1P4GA 3DZJA 1N8TA 4LZOA 4Q37A 3QBDA 5HTKA 4Z53A 1BFKA 2C3OA 2GLXA 1OX5A 1Z36A 1EB9A 2ZM5A 2BR3A 1TK3A 1OV6A 1W93A 3H6KA 2CMDA 3LJKA 1BXRB 2DY0A 4UNSA 4Y6RA 3RVSA 5KHOC 3RIEA 1ULZA 3H1GA 3FSRA 1T5OA 4KKVA 4CV3A 2XNJA 3DFFA 1ISPA 4DMLA 3OTHA 3T9CA 3G68A 4BFXA 2H31A 4CEHA 1X7GA 1FSSA 3NHKA 5HKAA 2J3KA 3S40A 4KPGA 5JI3E 1XNQB 2XNCA 1I80A 4CTOA 4DN6A 5HBRA 2XI4A 4BECA 3C0KA 3HKCB 4DAEA 1XRJA 2WJPA 1OLXA 1WO8A 1Y63A 2O4CA 3D1JA 1EM8B 2I6SA 4JLSA 4MWEA 5JLJA 5GOTA 1SCDA 4W6ZA 1ZNXA 4JYMA 3DCIA 5GJCA 1TGYA 4NAUA 3UJ3X 4C5AA 4FDMA 3JYLA 9MHTA 1TECE 3EHDA 4JI4B 1UK9A 4FP9A 1VI5A 4B3IA 5F7ZA 5HGXA 4HLCA 2FFJA 3LOPA 5CRIA 3DTNA 3LX5A 1Y4ZA 2ATIA 1UXKA 3UK1A 3KSDO 1VA5A 1PDWA 2NZVG 4U8HA 4ZRMA 3MHTA 3TO5A 5IWCA 2F90A 1VHLA 2JHFA 3PNMA 4BBZA 1AN0A 2RARA 3TZLA 4R1OA 3DWEX 3ZYCA 2GK4A 4WLUA 1VL8A 4FPXA 4C5CA 4D3YA 3IOMA 5LMZA 1EFCA 3PHHA 3QXCA 4JL5A 5CXSA 4DSNA 1T13A 1NVTA 1ZNZA 3LW7A 4FYJA 4WGFA 5HKLA 3H9UA 4NH4A 3RVQA 1E8MA 1XZQA 3G1TA 3CT4A 1KIFA 1RAGA 5AW0A 2IC5A 4RWEA 4C2UA 2JJ1A 3S1AA 2CJWB 4Y6SA 1ULSA 1LS6A 4OMCA 5CDFE 3VXKA 1M6YA 1QKKA 2HMVA 1ZITA 3PXDA 4JLWA 1I8TA 3R24A 3BCSA 1LBIA 2H2DA 3TNDA 4AMZA 3PQ4A 5TMDA 3JWGA 4BX8A 3WGHA 4LKOA 3J80A 3W6PA 2PJUA 2A86A 1YR6A 5LNK1 1QF6A 2MR5A 2AFHA 1T9HA 1VCOA 4ZAZA 1IHDA 3NH6A 4M89A 1R6XA 4ECAA 3VOBA 4PRKA 3WLOA 4OK5A 4RF5A 5JZSA 1YIDA 3H42B 5EPUA 3EMKA 1GGNA 1VLHA 3EQ6A 3NHWA 2E1RA 4P33A 5K4GA 1QVAA 2VBCA 1IPFA 4AW9A 5E1OA 4CHGA 1BHJA 3M4ZA 4CLXA 4WOPA 2FN3A 3L0SA 4RTPA 1GPWB 1C3XA 1KP3A 4GGPA 1K6JA 4AJPA 4EY6A 1JTVA 3MPOA 3X1YA 1SD1A 3EAFA 3ZV6A 4LW8A 4R68A 2FA9A 4GL2A 4F4CA 1O4VA 2AG6A 5I8ZA 3LQ1A 2NMVA 3QFCA 2ZJ0A 4GLBA 2F3RA 2JIBA 4MQFB 2HT1A 3DMTA 3VI3B 2NSDA 1HMYA 1M8PA 1EFUA 2I6FA 3FWHA 4XYGA 5EXEA 5JSUA 2A7QA 3LCVB 4GRAA 4XWYA 3RKSA 3QHQA 3PQ2A 3VR4A 1KAQA 1TTHA 1HLGA 5E1DA 4O4IB 4X44A 4W5NA 4KYVA 3FOAA 5C8YA 2FPXA 2RHRA 4HUQA 5JRZA 1GN9A 3GWZA 3IB6A 2J8ZA 4QNMA 3SDZA 3IO5A 2VH2A 4WZAA 3I5YA 1NRWA 1XZIA 2WQZA 4X84A 3JVVA 4RULA 3D6VA 1M2FA 5JXWA 5CFMA 4DSUA 5HUJA 2BI8A 3D7NA 3ZUPA 1CHDA 3ML1A 3I5AA 2FVXA 3EEFA 4GDFA 4CMEC 1Y3BE 2G1KA 3F8WA 1XZAA 3VI4B 3K31A 3Q2IA 1HGXA 2BISA 4W63A 3EZ2A 2JDID 3GFTA 3HFRA 2XD4A 3DLAA 2D3WA 1NBMA 4NKRA 1EFHA 1OFHA 2GJ8A 1GRRA 4O4HA 1AT1A 1JAYA 2AVNA 2OV6A 2QTFA 2XCIA 2HY7A 2QP3A 4RLSA 4W9NC 2Y4OA 2OZLA 1Y6FA 2D74A 5DIFA 4F9GA 1JE1A 3VQTA 3BXFA 1NJ6A 2IZ0A 1K7EB 3LP6A 1VZ2A 2QD1A 3LV8A 3PV0A 4U6NA 5BO5A 1KZGB 3ADOA 4HDRB 4CM7A 1Q0RA 2H9YA 3D7LA 3RYFB 3ZZ0A 1LPPA 5E2IA 4RXUA 3H9JA 1XLVA 3OIUA 1COZA 1E1MA 3PHJA 5AMXA 4PO8A 3JSXA 1GL6A 3A05A 4EMTA 2CVPA 2D4HA 2ZWPA 1AF7A 2JF0A 3O8OB 3PF9A 4HAZA 4IRXA 4L0MA 4L8LA 4F6RB 1EDEA 2R44A 3B6IA 3GELA 5ICSA 1RQXA 1MMFB 1GZ3A 1TM1E 1XP5A 2IIQA 2XIQA 1ORHA 3WYAA 2YFKA 1I0IA 5MN5A 3WGIA 3FPFA 4TXJA 4ZHQF 1I94B 1MNQA 3N53A 4BOYA 3OP1A 4PPFA 5CFPA 3FBWA 3G89A 2CL6X 1S8AA 3AOEC 3Q9SA 5EKUA 2YASA 2ODPA 1N6KA 3FJOA 4PHTA 4TLDA 5C9ZA 1J8VA 2XF2A 1B42A 3HSSA 5CIYA 4ERXA 4NBWA 4WK6A 1DBPA 1Q0SA 2H1HA 3MCAA 2H3EA 2C1XA 3R40A 2B98A 4X6LA 1I4DD 3UA4A 2BCJQ 5E7MA 3RSSA 1P6XA 4IKOA 4FYXA 4LNUA 4DV1B 1FUKA 1KP9A 2J3LA 3PRJA 3IBSA 4LE0A 4R8RA 3W5AA 2PQ2A 1PP4A 1T8PA 2LD4A 1S4QA 1XTTA 2VP9A 3AI2A 1XTBA 1O8CA 2GJKA 2IIVA 2WSLA 1Z8DA 2BFFA 2QJFA 3I0NA 2LVBA 3R3JA 4J4HA 3SQDA 1DKRA 4OQLA 1KO1A 5FI0B 3SIPA 4PQFA 2QBYB 5T6BA 2D5AA 1VJ1A 1QG0A 1NYTA 2NM0A 2OLEA 2VHQA 4TXNA 1T4BA 1QBKC 3N05A 1ZUIA 1J07A 1FFAA 3VUFA 2QJWA 4FMDB 2XXJA 5EMNA 5U9CA 5GJVC 1E5XA 2BL4A 2FX2A 2FZLA 1DAKA 3OZVA 1RBQA 1NI4B 5AW8A 1WXDA 4AMUA 1V25A 4AN0A 1GPAA 1ZGBA 2O3QA 5JZ9A 3HG7A 4L08A 2I7DA 4MITA 1MJGA 2CL5A 2O0LA 3VHXB 1WB6A 2RGYA 3DNFA 4DA0A 5K0CA 3O2SB 1U7HA 3TQCA 2M1XA 4DQVA 2D5LA 2PV0A 4LWOA 3UTDA 2O5RA 1RPJA 2G25A 4J1SA 3QFRA 3NCHA 5C3MA 2QN3A 3BAFA 1YZYA 3ELUA 4WW0A 3PFHA 3UT6A 3EDQA 3NJRA 4MZDA 4UBNA 5MN6A 1UM9A 2N1BA 1BC5A 2VXYA 5J9FA 3M33A 4YXWA 5I7VA 1THMA 5DT2A 4HTFA 2JI4A 5IANA 1ODJA 1MOZA 4I3HA 2W11A 4KUEA 2WU3A 1JFRA 2ZJZA 3R3SA 1K0FA 2PZFA 5KINB 1WA5A 2QD3A 4R2IA 1ADBA 5J1TB 1P39A 1X7XA 3FCAA 3KXPA 5J1SB 1HE2A 5IM4A 3UJ8A 2C78A 5LP1A 2C5FA 3MWDB 5IN5A 4OXQA 3WS7A 1T0BA 2IZ1A 5TVGA 4L9SA 1ISSA 2WF9A 4BKOA 1ZIOA 4MZXA 1JP7A 1CY2A 4AI6A 4HFNA 2B20A 2PRZA 4PZZA 1CS4C 1M0SA 5FBWB 2XCTB 1ECFA 4EJ6A 2JLWA 3GXOA 1VE6A 1EWYA 4P9NA 5ALVA 3ZE9A 3V4LA 2F1RA 5AI4A 3PGKA 1BS1A 3OPMA 1W85B 1RJDA 2X3FA 2WDZA 3PJRA 2Y1FA 4P53A 1O87A 4AJNA 3ED1A 1NURA 1E7YA 2DR2A 4B6EA 1FDOA 4RLFA 1KRHA 3DL2A 4FU0A 2B3TA 4CDNA 5A3RA 2DLCX 1G42A 1H66A 4FGUA 1KZ9A 1NHGA 4UAVA 1DBRA 1S2OA 1Z22A 5CVJA 1XTQA 1G63A 1VECA 3JQAB 4W9NA 4YAEA 3URMA 4KO8A 4UHHA 1XDGA 1RZ3A 3CG0A 4G2NA 3SN6A 3PWSA 4NU0A 2P7IA 3VPHA 2W6JD 3L0IB 3WIVA 4OP2A 3TECE 2VEOA 2J3MA 2XGSA 4HFRA 1D2GA 4IIHA 2IYOA 2ZREA 4C88A 1NU8A 2F59A 3AVQA 1K9SA 4N0EA 3G0HA 2ZB7A 1FUYB 2HZBA 2P9FA 3WK8A 1GUFA 2VDMB 4HNAA 4KYTA 3WLLA 3EISA 3R76A 5B7NA 3KKQA 1DV1A 1MO3A 4R6WA 4BKQA 4MDEA 5LP6A 5FCDA 2FW9A 3MLEA 2JCVA 2R1VA 4FKZA 4N0DA 5HIJA 4PGMA 3M1AA 3AEYA 1CUHA 2QUHA 3ADPA 4RL6A 1C9YA 4PZUA 4DNQA 4RMGA 2C0QA 3K0KA 1SUIA 3C6KA 4C3ZA 1XP8A 3I04M 1JJFA 1GGFA 4Q82A 2ARKA 1EZ1A 4WA8A 4Q7KA 4B80A 3N8KA 1O6CA 4FX2A 1YZHA 1X1DA 4DCJA 4GLJA 3HP7A 2I4LA 3HFGA 2XCQA 4BMOB 1IWBB 1FY2A 2YJ5A 4GP6A 3U0BA 1PK7A 1TVCA 2YXLA 4IX1A 3P97A 2P3LA 4KGVA 1DAPA 1ZK2A 2YXDA 3PEEA 4J4TA 5KX5B 4HEA1 3G7SA 2CV2A 4L9WA 1OBFO 5EWJB 1QLJA 1DP4A 4YPOA 5K99A 3UNXA 4Z0TA 5IVIA 1JQLB 1Y3FE 4RFSB 1NZFA 1VJ5A 3CZ9A 3UMGA 2C42A 3EJ6A 2CV0A 4KB5A 2W9XA 2H57A 3N0TA 5DM0A 3NO4A 2RI1A 4XRGA 3QPDA 2J3JA 2KPOA 4G56A 4II2A 5JCOA 2PMDA 3GVXA 2JVJA 3U7GA 5HHTA 4BQNA 4WFIA 4AKSA 1Q0LA 3GDHA 4UVIA 1U8EA 3VKWA 2VHZA 3LDUA 5EHGA 2C4KA 3OPYA 3MTGA 4KLCA 4EA6A 3I34X 1B8PA 1EHCA 2EWMA 4OQQA 4BNKA 5BN1A 4YP1A 4TWJA 4CKYA 1QFYA 2P1DA 2X42A 4CLRB 2VBFA 3I23A 1JE0A 4BBPA 3OCWA 5DLYA 4B44A 2GERA 4D92A 4EJSB 3H5RA 3GUUA 3VR5D 3KLOA 4BTVA 4B87A 1BOOA 1GL7A 2AWNA 3LDFA 1CJUC 1FUIA 5BR4A 4BGDA 2Q4BA 1OGJA 4F3KA 1EWQA 3TAHA 1DAEA 4FYVA 1N5JA 2N1MA 5JWOA 3V2HA 3RYCB 2Z57A 1T8RA 3V8NA 4E30A 3D7RA 4JJZA 1NXQA 2GCOB 4ZRDA 1CULC 4HZUA 3FCSB 3FTDA 3BRWA 2IUYA 2BJHA 2I4IA 4B32A 1SPBS 4CEJA 2BELA 1AUQA 2RK3A 1IG3A 3EXHC 4N39A 4BLVA 2OUIA 4DDHA 4NMHA 821PA 3FPJA 2H9IA 2P77A 3WGTA 1YZLA 3GFFA 3GBPA 4BRUA 1E63A 4LSWA 3MJ4A 2N75A 4WZZA 2J08A 3GD5A 3MNFA 3ZVKA 2E48A 4D56A 4F96A 4RC9A 3REGA 3EGCA 1CIPA 2B35A 2AEEA 3FR7A 4MPTA 3O31A 3NT4A 3PDUA 4TLBA 5ALXA 3TWOA 3ASZA 5L3VA 1NBME 3AFGA 3IOBA 3AR5A 4NAVA 4EZBA 1WVMA 1BRMA 4XSGA 2O2GA 2FPMA 3BE8A 3K94A 1C8KA 4M1KA 4HUQB 2BV3A 2BW0A 4P80A 3OZTA 4AF7A 4DLWA 4KVFA 4A0GA 2AJDA 4DMCA 4FMBB 1RBZA 1NVVQ 3D7SA 2HF9A 3RRYA 1V4NA 3FG9A 1T0HB 2D7JA 1RC8A 3FLEA 3K8YA 2AOXA 2X77A 2QPTA 1GZ6A 1ZD9A 3G2LA 4W1SA 4A16A 4DLBA 3HB1A 1YDHA 3HYCA 3MTBA 4NULA 4NBRA 3KFVA 1GKLA 3AF1A 3K30A 3ETCA 4CG1A 3E9ZA 5FA6A 2IHTA 1J99A 3FPGA 5LU8A 1JEQA 5H0IA 5C4GB 2DJIA 2NP7A 4XLTA 2BEWB 3ORRA 2HXYA 3GOHA 2ZJ4A 2WZDA 5KAPA 3U3OA 5LMNB 1P91A 1GNPA 3FJ1A 1GQOA 4PIPA 2LCIA 2ODQA 4YAFA 5DN9A 4AO8A 2IEBA 1VSTA 1ZHFA 5DLQC 2GPJA 1YMVA 2GFIA 4EDFA 1UFRA 1I3NA 1ZIXA 1JDBC 1MB9A 1WKBA 2CE7A 2DJ5A 4F4FA 1PJSA 2ASVA 2ID9A 1E3QA 3JD1A 2H2GA 2ZKIA 3DT9A 5IRCD 3EQZA 5BQ5A 3D43A 1TRHA 4BNMA 1QGDA 1M2WA 2XE7A 3L2OB 3AKDA 1PS9A 4N3BA 4RZQA 2WAOA 4FN4A 4RHEA 3VJMA 5B3LA 4P4TA 3REQB 4ZAFA 1TTTA 2WHPB 3EXFA 1U5CA 3OKFA 1BTOA 3WKCA 4ZYUA 3JVUA 2O9JA 4KUHA 4CFYA 5L4NA 2YL2A 4NE9A 1J8YF 2WD8A 1H85A 3CWCA 3HUTA 1DRKA 2NPFA 3K3PA 3IT3A 1LBHA 1I7QB 4ERNA 1KO7A 2I2CA 3ZJUA 4KXYA 1CR4A 4MUYA 3Q1KA 2I2DA 3ZWAA 1XZHA 3RRMA 3T5TA 5JRDS 1Q1NA 1ZAYA 2HDHA 4RZHA 4Y9SA 3EIWA 1BYIA 2AZTA 1DTWB 2RHHA 3FWKA 3JVDA 3NX4A 3PHLA 1PEYA 4GI1A 5JYBA 4L51A 4IV0A 1TB4A 2GCIA 1IM2A 3DDZX 3GWGA 5DK6A 4PSVA 2IH2A 1J70A 4ISCA 3M89A 1JLRA 2EZ4A 2FFAA 1L4YA 1YRYE 1DEKA 5CT8A 1E4EB 4MIKA 1YB6A 5AJYA 2XYGA 1NQUA 3WTBA 1JDZA 1C7JA 3QVSA 4EGAA 5JH7A 2VR1A 3A1CA 1Y1PA 2UYQA 5FUMA 4KDFA 3FOFC 4LJAA 3TZ6A 4E5YA 1XJWA 3CUWA 4FHGA 4A36A 3GA0A 1RZUA 4YJ2F 5FQOA 2WWIA 2XTNA 4OL0A 2QE6A 2OSBA 4YI5A 3EOZA 3CJRA 1JQKA 5CB8A 1KK2A 3GJQA 2JIZD 4MI6A 1WEKA 3WFZA 1SUEA 4EBBA 3ZHTA 4GEGA 1GG9A 4CLEA 2AB0A 1DHTA 3ZQJA 4E5SA 3AHJA 4YASA 4CUKA 4OXIA 1FSGA 2IF0A 2AFHE 1CNFA 3P9XA 4HSGA 1V8FA 4GE0A 4E15A 1GAQA 2BGJA 1OZAA 4GI3A 3OAAD 3WRVA 4V24A 4YT5A 5KWJA 3WNVA 2G4LA 1KDTA 4AMBA 4PLFA 4EW1A 1WVIA 2I3DA 1L7EA 3VR0A 3SIXA 3K9WA 3O4HA 5HKKD 1ZH8A 3FOBA 1HEUA 1MN6A 1WDMA 1JHXA 4ZICA 1CZRA 2Y0BA 5A4AA 4UZEA 3TLCA 2QN9A 3ND7A 2CUTA 3VR5A 1X7YA 4XWKA 3NXSA 1ENOA 1L5GB 3DF7A 3CZ5A 4MAAA 3DE5X 5LQAA 3W77A 4RW0A 2BGTA 4MQFA 3RYIB 1W48A 4FNAA 2G70A 4C6SA 4OU5A 1PVVA 4CE6A 4X1KB 1F6DA 1VKHA 1YJ5A 3RIGA 1P6UA 1GGMA 4FFSA 1ZM3A 3QLVC 2C92A 3TNYA 3ZX4A 4CUZA 4ZCSA 3BGSA 3RVNA 3G79A 3I8SA 2YJZA 3OQMA 4J3NA 3BM5A 4OMDA 1FSPA 3AO0B 4HFMA 4XVUA 1YU9A 2D13A 3OWOA 4E11A 2PX0A 4Z49A 1GG2A 1O6BA 4RVDA 3ERCA 3JATA 1FOEB 1BU8A 3MGKA 5GV7A 1RQ7A 3QLUA 2B83A 1K27A 4EO4A 4EVQA 5CXUA 3OCXA 2QHXA 5FHQA 4PXYA 1XMJA 3FI9A 1LPAB 4QUJA 2G6TA 3KQTA 3RHFA 3RWBA 3THXA 1GSAA 2OPHA 4AULA 3IR6A 1SHLA 3D8HA 4MGIR 3VO9A 2RDMA 3EVDA 3NVAA 3R1IA 5KNLA 1ZZGA 1XDUA 4A3SA 3B48A 3CG4A 2CLOB 1K75A 4CPDA 1EHIA 1AS0A 1N3IA 1HSOA 3OCCA 3VGJA 3PYMA 3ZKAA 2NV2B 4ALIA 3KWFA 4D9MA 2Q6LA 5H83A 5GTDA 2UXBB 5FI1B 3HMQA 3WGZA 2PT9A 3NB0A 3P94A 2D00A 1F3OA 3W2IA 2QRUA 1KWKA 2O20A 4FE7A 2HCFA 2BH9A 3I28A 3L82B 3KETA 3GRRA 3KBOA 5G53C 5AM1A 4E1VA 4B8ZA 3SQOA 3EGVA 1QIKA 3I58A 3QXJA 1LPBB 4YRNA 1QIGA 4LJ9A 4F60A 5LQRA 2A9RA 5AI6A 4QELA 2QRVA 1B6RA 2C4WA 2J31A 2QVZX 2J5QA 3IP9A 4TLMB 5COQA 2QG6A 2BMVA 1RLUA 1T2AA 4NECA 3HJHA 4RD0A 3BXHA 4ZREA 1SHKA 2RB4A 5KHLB 4LF8B 3DL7A 2QW0X 2W8BA 3LLVA 3R4VA 1A7KA 3GYBA 4MWDA 5ALJA 3I01M 5EQJB 4TKUB 2NSLA 5FWXB 5IAOA 3L6CA 4WL0A 2IEDA 4Y6GB 4MW0A 4M0MA 1E4OA 1KFJB 2D1TA 2QGZA 3AFIA 4MS3A 5FTJA 5EJAA 4Q4LA 5KYWA 1RYYA 2CXRA 4NYMR 1JDPA 1Z74A 2NNWB 1BXKA 3F5SA 1QG2A 5TC4A 1JXMA 2OD7A 4HAOA 4OQPA 1V5FA 2DUNA 3EGEA 3H0KA 2ZVDA 1KMQA 3JYQA 4G8DA 4YO7A 4ZOBA 3SU8A 1X7XB 1J8FA 3V7WA 4C29A 5CB4B 2WPDA 1OWNA 1SKUA 2MSWA 5IDXA 1DCKA 3N7AA 4BGUA 4O59O 4WLVA 3CSUA 4G24A 5AVRA 4GQAA 3B13B 1FXSA 3SC6A 4E03A 2XCRB 3H5NA 1OU4A 5FFFA 2IYTA 2I29A 4CIAA 4KMSA 4CV1A 1DXQA 3WQSB 4QQFA 4E4TA 1M83A 3DOHA 5E3JA 4B74A 2XZLA 2PUCA 4M9SA 4EZIA 2IHKA 1XI2A 3F0TA 3H3FA 4H3HB 4H1UA 2CFCA 4TTPA 1PZHA 5B3JC 1RRFA 1P8AA 2CJPA 1H4VB 2YBEA 3GXBA 1E1QD 3L8ZA 4IG9A 1Z88A 4M8NE 1HDOA 4QQNA 4YMIA 2PWZA 4KQXA 2ADMA 4EPXA 2IY9A 1II8A 1UZAA 5AW7A 3UN1A 2O2ZA 4G36A 5KNCH 1DAOA 5EWLA 1T43A 1Z68A 1C8BA 3A4LA 3DE2X 2GRJA 1AXGA 2PUAA 2CHEA 2RGDA 2Y9PB 2QXTA 1Z6TA 1SBQA 1KEVA 2IHJA 4JWKA 2L69A 2Q1YA 2Q49A 4JNCA 2GD1O 4A6DA 4NJEB 5DGHA 1L7OA 3CH4B 5IBRA 5KYUB 1P29A 1SAYA 4X3CA 1JIXA 1PR0A 4NL4H 5LBIA 3DMTC 3Q3EA 1EPUA 2ID4A 4YQFA 5ICCA 2EEPA 1OLXB 1G66A 2R6CA 3ZY3A 4DY6A 4US1R 2WJHA 1UK7A 2H1SA 3P2OA 5CM8B 1NN3A 1ZKMA 1UQRA 4LGCA 4X1OA 3GX1A 2OE2A 1LH0A 5DNVA 3DUFB 2J0VA 2I3GA 2NTYC 4RU1A 5EIOA 3U37A 3AFOA 1KJZA 3LUAA 4L4SA 4X85A 5IBPA 1UMBA 3OZCA 2OORC 3OOJA 4UC0A 5DHPA 2DWUA 5HS6A 3VR6D 5CD9A 2P1ZA 1L8AA 4PF1A 1OXKB 3ZVLA 2JC3A 3UAOA 3LZCA 2L42A 4N5LA 1K8YB 3IJ5A 1DI0A 3ZBTA 1H6AA 3PJGA 3R9XB 3AP3A 5J59A 3SYLA 4BO7A 2YTZA 1WZCA 1WPXA 4N5IX 1QAOA 1RWQA 3EGXA 1YK1A 4IXMA 1W19A 2BFBA 3L8FA 1NLZA 2QLTA 1I3KA 1QQTA 3JSAA 1ZYUA 3HY3A 3WBFA 5HXAA 3SVLA 1QHXA 1WX1A 2Q6VA 2UZIR 4BQRA 3HDTA 5FLKA 4D6XA 5IU6A 4X66B 5DXFA 1L5LA 3ZWVA 5FOXA 3U4DA 2H85A 1JR4A 3ND5A 5AQEA 3TDNA 3QY9A 3T9BA 2DULA 4PV7A 1RXCA 2R8RA 2R25B 2D0PB 1L5HB 1N25A 2HFKA 4M1YA 4BV3A 4J91A 5DI3B 4AY4A 1AGXA 9ATCA 2V7WA 3MJRA 4FDVA 4WNAA 4EM6A 3FDZA 3AM5A 2Q4EA 3I39X 5J23A 3RAFC 2DTXA 1WETA 1Y7LA 2G0AA 3ITDA 3QVUA 5I7UA 5DP2A 1CZLA 2FRDC 1GTJ1 1SVUA 1ZX1A 1CEEA 1E8NA 1P81A 2IYQA 1PIWA 2YWRA 1WXGA 2OYRA 1XHLA 4WN9B 4G6ZA 4LDQA 5EERA 1H2YA 4K81B 3BH0A 4PZCA 4XVQA 4E32A 4MINA 2J7KA 1VE7A 4YQZA 3V8MA 3ZOZA 1J56A 2HXGA 2WVGA 2YMPA 3I2FA 3IYLW 1ODIA 9ABPA 2XCUA 4CIBA 1FJGB 1SBZA 1LPNA 2HEIA 4ALKA 2ZIFA 1U3UA 1A2QA 5ESDA 5J2TA 3U44A 4Y9TA 4UJ5A 1F2TB 2GCEA 1U8TA 2CNOA 5B4VA 4HWGA 1SK8A 2VP5A 1C0IA 2WBLC 2H1VA 3DD1A 1NC3A 1NQTA 4CM4B 3VDRA 3DW3X 3DCNA 1EK5A 3DFZA 4N7BA 3RU3A 2H0QA 1N2XA 2RBKA 2DSNA 1NWHA 2HIHA 2XSZD 5ALPA 2JGLA 3TZQA 4DDTA 2PV7A 1WQ1R 4HYYA 1JDUA 2QYHA 8MHTA 2PLNA 3GEEA 5EQTA 1AC5A 3H1FA 4MYSA 3KP1A 4R01A 2BYTA 4OJMX 2P0EA 3RK4A 4J0JA 3O83A 4KIGA 3QENA 2HWYA 3GJXC 3I2HA 1PRYA 4JLAA 3WISA 4QUAA 1FFGA 5SYMA 2EP7A 3RPEA 3AR3A 5JFOA 3D1LA 3SSAA 5DTJA 4YV1A 2GYVA 3CRQA 2X1MA 1W2WB 4TV8F 3M6UA 2BF7A 5A5FA 3BQNB 1B74A 1RKXA 1VL5A 3HCPA 4M8LA 4DC9A 4BLTA 3ORYA 4ZZ1A 1YDWA 2V3CC 2JH8A 2NU6A 1P9OA 5EJ8A 1IEXA 1Z33A 3UJ9A 1D2MA 1MDBA 1ELOA 3Q5EA 4K46A 5DLPA 3COSA 4UVGA 4NOMA 2XYHA 2HR1A 2YMQA 2VHUA 3AJ9A 2C9DA 3WTCA 3GLIB 1HM5A 1KQPA 4NZPA 2IEGA 1EVKA 3LKVA 3PT5A 3QE9Y 3L7NA 4PYOA 2WHQA 3DMDA 5GVSA 3ETJA 1SXJA 3E9QA 1QMPA 5HE9A 3U81A 3J7TA 1IHYA 2CDRA 2PS9A 4G01B 1FJ2A 2ODNA 4BVKA 1OJLA 1CUFA 3RVBA 2AZXA 1OLUB 2AC7A 4WH0A 2J5RA 3EAGA 5DBGA 2YWBA 1KQNA 2F4NA 4XM2A 1FVHA 1XELA 2J3IA 2BMJA 3H3XA 4GKBA 3TKLA 4DR5B 1UWKA 3H0EA 3NHZA 2Z3WA 4LOIA 1OI7A 1OC4A 3DE7X 2H7XA 4V0NA 5IAGA 5BXQC 2QXUA 2PIDA 2R8EA 3FI0A 4BVEA 5I47A 1UBJS 1C7ZA 3TAXA 3PENA 5CHYA 4ZXPA 3A58B 3SF8A 4DZZA 1RBYA 3MTDA 1AQ6A 1KJ9A 1X1QA 1VG9B 5FJJA 3KKPA 1REQA 2XY4A 1NASA 3IH5A 4HS9A 1M8FA 4FMPA 3DTTA 4BFZA 1IQUA 2GEBA 3OQVA 2QV0A 3ZZ1A 4YT8A 1NJSA 4J0KA 3VOTA 3RB8A 5BOVA 4ZYVA 2EYUA 1HE8B 1C1DB 2AH5A 4P84A 4UUBA 3SICE 5A4JA 4RX1A 1HE4A 3DDHA 4DFDA 4D9FA 3Q8LA 1U9CA 2O2HA 1V11A 1JEAA 1F2TA 1ZHHA 4PFJA 4U6QA 5SICE 1J5EB 1OXSC 1ZQ1A 3EPHA 3GPIA 4LECA 5KNCA 4LYFA 2Z6AA 2GN4A 4MYHA 3K1TA 2V0NA 3A7EA 3LRXA 5F2NA 3X1MA 3ZV3A 2YBDA 4HZIA 2MSNA 4BU1A 4XWAA 1PEAA 5F9MA 3E0XA 1IEWA 2BUBA 2ORIA 4P2BA 4JI6B 3F7OA 3V00A 5DNAA 3I1YA 1OT5A 4F3NA 5C5IA 5K0GA 1PI3A 1M7GA 4A91A 3NG1A 4HC4A 1FNCA 2ZI5A 2OGUA 4M9RA 1R0XA 5CLGA 3IPYA 1E2MA 2YRXA 4LMBA 1XDSA 1JLLA 4GLLA 2AV6A 1E0JA 1DDGA 4WERA 2Z2JA 4Y1EA 4EYSA 2YVQA 1OH5A 3FYUB 4XTCS 4BNZA 2REOA 2DPYA 2QY9A 3Q15C 4MLPA 2P6NA 4X7BA 4WKNA 1H1TA 5B58T 4BLOA 2R4TA 3HB9A 4Q1BA 4MCIA 3D3QA 3URKA 1U7ZA 2GZSA 1CDOA 2WVAA 4U6SA 4J7XA 1GD1O 3AR4A 5LYJA 5I7SA 3G13A 1KIAA 5KCMA 1TJNA 2WV7A 1XL1A 2DHEA 2OORA 2EERA 4MRAA 1RFLA 4MJ7A 1C3LA 1ZN7A 3VSCA 2BM9A 2EGHA 2YH2A 16PKA 1TT7A 5A0VA 1NUAA 2J4DA 1KO4A 3KVOA 5A6SA 3BMXA 4CNBA 3PK0A 1WB5A 2X19A 3IAUA 3QTTA 3EX7C 3CLTD 4BB0A 2ZCJA 3KSRA 3IKLA 4JLVA 1K1EA 4BMDA 5EJ6A 2B34A 4IH9A 4PG7A 4QA9A 4C2BA 3R5HA 1GRQA 2FPKA 1NWCA 2GS9A 4WACA 1GZUA 2RGGA 4B40A 4OFZA 3HL4A 3KQOA 2NUPB 2WHRA 4QHTA 5JO0A 1T6BY 1YNSA 5TR9A 1QCYA 4Q7EA 3NOVA 2PUEA 3QITA 2CNWD 2O4UX 4GSYA 4FNOA 5LXTB 1TTQB 4FW9A 1OLSA 1TEXA 4YRLA 1CRZA 4INAA 4Z7NB 3M0EA 1Y9JA 3JS5A 3QU4A 3RCBA 3O82A 1KAMA 3NORA 5CT5A 1P4JA 3CUUA 3RVOA 3WLPA 3H4TA 4K1LA 5CCBA 5JD6A 2PYZA 3UMFA 1Z06A 1FXWA 1TJYA 3FKSD 5H8WA 1K6EA 1H8ED 2VAPA 4K0RA 4OHPA 3TL6A 2WSYB 1T2UA 3NTUA 3K0FA 4D1YA 5CA0A 3N39C 3GBSA 3L7DA 3Q8WA 3LQFA 1NMSA 1H1LB 3O5AA 4GYYA 4BS9A 1NAHA 2QR2A 3B2EA 4E2ZA 3QMWA 4F72A 3K0AB 1S6YA 1ADFA 3BFKA 3JQEA 1R8JA 1IB0A 1YB4A 1PR6A 4YECA 1T2NA 2C2XA 3EC2A 3W2GA 2ZIZA 2ZI4A 3L5OA 1H4SA 3K2IA 4Q4CA 4QDTA 3TFWA 3GBVA 3VNRA 1PJZA 3WMWA 1LSOA 3HEAA 1H3FA 4YJFB 1ZOIA 2HCRA 5A2QA 4MVJH 1HRKA 3RC9A 5H82A 3A2KA 3V33A 2VAXA 4GT1A 1JBKA 3ESXA 4MQEA 1JL3A 2HJ9A 1A7AA 4H7EA 3ZU5A 3PXXA 2BH2A 5IJAA 1QVWA 2BFCA 3HB4X 4PAWA 5DNUA 1AHIA 3JTEA 3THRA 1ONNA 4FGJA 5U1PA 2V5UA 3P32A 2F17A 1DKLA 4QJIA 5BWMA 1EQAA 4GNRA 4LY3A 3ZE2B 3I09A 1MOPA 5B1IA 1PGJA 3IESA 3FNFA 4OD0A 1O5TA 3X43A 4ZYYA 1W9MA 2YFQA 1DQPA 2VDKB 2ZTMA 3OZIA 2C4TA 5FEMA 1DMRA 4EG1A 5E4YA 3F73A 3SXUA 3KALA 4XD2A 5BWBA 1FZQA 2DPLA 3O8QA 4Y2RA 3ZY5A 3B78A 2BR5A 2ZE6A 1ZGJA 1B6SA 2OKGA 5DT9A 3RLFA 1MEOA 2HMYB 2LCFA 2FMHA 3AWDA 3S27A 3UAYA 6YASA 1MO4A 1UBFA 3MAAC 4KNVA 4JA2A 3GFOA 3EQ9A 2LDBA 3JPYA 2Y2VA 2QS9A 2WNSA 3HCAA 4RVHA 4C89A 5IT4A 1A0OA 1JS1X 3VSAA 3SKYA 4NXMB 5JMOA 3C39A 4X0EA 4HGNA 4M0CA 1G3MA 3PC8A 3HU1A 4YROA 2A6PA 3ZY2A 2J3QA 3GN1A 3A10A 3PA6A 2CMHA 1IEVA 1WCV1 5EWMB 3WZLA 4F1WA 4O4HF 1GADO 5SYNA 4A03A 2I2WA 2PRYA 2TS1A 3KB8A 4RDHA 4MHOA 1M0EA 5EJFA 4HT3B 2VNJA 1IOLA 1O4WA 2ACWA 2Z9DA 4IO0A 1UKAA 4TGLA 4PPQA 3M82A 2WIAA 3D6AA 3IEIA 3V9PA 4YV0A 5L3SA 4M6WB 1Y6GA 3STXA 3VYRB 4DLZA 2J1LA 1KZ7B 4BY9E 3PQCA 1BGWA 1BXGA 1PJRA 4RL4A 3W8RA 2DBQA 4EDHA 5D5HA 3ZBUA 5FKJA 5G2OA 5REQB 3VRHA 5GAJA 4D5EA 1O97D 1XA4A 4JQZA 1SVNA 2JA2A 5D6OA 4DPLA 3QEAZ 1PG5A 4FKMA 3FF1A 4J03A 4ZCTA 3EXG2 2DQ4A 1N2IA 1KEEB 5CTJA 1KKLA 2P5UA 1T2CA 5EP4A 2GUGA 4CMEA 2RI6A 1NYLA 2JGDB 1PSWA 1R10A 2PU5A 1G8KA 1XAGA 3LWZA 1V9CA 1VBKA 4KQKA 4YJ3A 5BP7A 1R16A 3AEKA 4Q3EA 3LGSA 3UG7A 3OQJA 3N2NA 3ZXIA 3AVTA 4KPUB 4UD2A 1N6RA 4PZ0A 2IPXA 3I73A 4LJ6A 4Q1DA 1N2CA 1Z5ZA 1ZVKA 1UOEA 2P78A 3HCBA 4TWZA 1AB6A 1G55A 4OY3A 1PDOA 1W5AA 1G8HA 1DWPA 4BP3A 3QM1A 1HL7A 1NJ1A 2I78A 4KXMA 4UHEA 2FEWB 2GF9A 1I4TD 3E84A 5AVQA 1HDZA 1RE0A 1IZZA 3FNRA 4K9MA 5EIWA 4YMHA 4CKEB 3V4RA 1CKEA 3S68A 5CG1A 3EXIA 5LOVA