1PJBA

L-alanine dehydrogenase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
361
structure length
361
Chain Sequence
MEIGVPKEIKNQEFRVGLSPSSVRTLVEAGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRVGLTAIAYETVELPNRSLPLLTPMSIIAGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVPNMPGAVPWTATQALNNSTLPYVVKLANQGLKALETDDALAKGLNVQAHRLVHPAVQQVFPDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structure and substrate binding of Phormidium lapideum alanine dehydrogenase.
pubmed doi rcsb
source organism Phormidium lapideum
molecule tags Oxidoreductase
molecule keywords L-ALANINE DEHYDROGENASE
total genus 112
structure length 361
sequence length 361
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA02
4A2CA 1SB9A 5I7FA 5IG2A 4KTVE 4DLAA 4JJFA 3H65A 3EHEA 1I3MA 1O6ZA 4YAEA 3I6IA 5DCWA 3UVEA 2B4RO 5C7OO 2BD0A 1HYHA 4Z0TA 2D2IA 3AWDA 3IAHA 2HO5A 3GNSA 3I83A 3TZKA 2QX7A 3QE3A 3OICA 2HMVA 4L4SA 4A27A 1FDTA 4XGIA 3VZPA 3JQ6A 3QVXA 3X2FA 2PLAA 4YJHB 2JFHA 2QHXA 1FK8A 1VL8A 4BV8A 1HE2A 2W2LA 3AM3A 1NR7A 3BTSA 1GDHA 3JCZA 1K6IA 4W7IA 4CL3A 3KBOA 1TLTA 3LC2O 4L9RA 1E3SA 4BO4A 4ESOA 2GCGA 3W1VA 3E5MA 3H5AA 1NYTA 2JD1A 3KO8A 4IIUA 4EEZA 2J5KA 1LLUA 5MDHA 1OZAA 1MP0A 4CMIB 4BHTA 4BV9A 4UVDA 5HBRA 1O95A 2JKVA 3JD0A 1P1RA 1TA4A 5JY6A 5AXDA 4EJ6A 3GVPA 1OI7A 1EBUA 4MVJD 3IQDB 1SBYA 4WK6A 4CR7A 2X23A 5I9LA 1P33A 4BNWA 4KZPA 5ICSA 3MOGA 4JROA 2NTNA 4XQCA 1B14A 1P74A 1NTOA 2O3JA 5GY7A 3EVNA 3T7EA 5EMHA 3OF2A 4J7CA 3ZV5A 4YACA 3D4NA 2Y1CA 1Z73A 2EIHA 3WQQA 1ZSVA 3S2FA 2FR0A 1UXHA 5CDGA 5CP8A 5L7YA 3ZWBA 1GD1O 2AEJA 4XYMA 5L95A 4UVHA 5CFZA 1X0VA 4TKMA 3Q1LA 5K6AA 4TMFA 4OH1A 3DZHA 4JP2A 2ZCVA 5FEUA 2GO1A 4IJWA 3B1FA 1T2CA 1N9GA 1CDOA 4KWIA 3T4EA 2WYUA 4WUVA 5U1PA 4IM7A 4ND4A 5ER6A 5AXAA 1PS8A 1DB3A 4KDEA 2BGKA 4NU6A 4KWHA 5JMWA 4JK3A 4CLOA 5KJFA 2BGLA 2DBRA 5FI5A 3O38A 4JBGA 3OJOA 4MIEA 3KB6A 3A28A 3TQHA 3QRWA 3TF5A 2JFFA 1A72A 5IFLA 4FJ2A 2QQ5A 2HK9A 4AL4A 3H9QA 1XYGA 3V2GA 3GN1A 4HNGA 4E5PA 1I2CA 1MV8A 2XF8A 2IRWA 4OXYA 4L0QA 2OBNA 3GGGA 2JD2A 3GRKA 3ZNOA 2A35A 4TVOA 3GRPA 3WFJA 1EVIA 4H16A 4GWKA 3MJSA 1VPDA 4FN4A 3GDFA 4QQRA 4PGFA 4WLEA 3D64A 5EQFA 3DZFA 4XGNA 1HXHA 1T2AA 4LVUA 5KVVA 3WOHA 1KEPA 4CM5A 1JVBA 4CV2A 1EE9A 3BA1A 1GUZA 3DONA 3UW3A 4R1SA 1UP4A 2ZQZA 4J9VA 2RHCA 3KEQA 2VZ0A 1DO8A 3E82A 1RM4A 2GD1O 4OM8A 1E1LA 1PJTA 2FPPA 4UULA 4BMVA 5B4TA 1O5IA 3D5TA 1BW9B 2VTDA 1ENPA 3JQAB 1XIVA 2PZJA 1E77A 4GMFA 1BWSA 1ZIDA 2EJWA 4EW6A 1LSJA 4PVCA 1BXGB 1YB5A 2RBEA 2VUUA 4UUMA 2I67A 3JQCA 2D1YA 3NGLA 3F46A 1LDBA 3SC6A 3I1JA 4INAA 1CF2O 2A9FA 3SC4A 4A73A 2NNLD 1AHHA 4QX6A 5THKA 4P4GA 1KVRA 1UXJA 4DQXA 1RYDA 4H7PA 3JYNA 4HP8A 3KETA 1GPDG 2V6BA 2F1KA 2Z5LA 4R3NA 1JAXA 3JQ9A 1LQUA 2GDZA 1U7TA 3DAGA 4CR8A 1R12A 1UDCA 4JCOA 1NQ5A 1E7MA 2YQ5A 3L0DA 4AJ4A 2P4QA 1NPYA 1DPGA 1LNQA 3NJ4A 1ORRA 4IINA 4NK5A 4BNHA 3FWNA 4GKBA 4N5LA 1XG5A 3K9QO 4IY1A 4QFDA 3HHPA 3TZCA 2BFPA 3UCFA 1ENOA 1YB1A 3GVXA 1BXZA 1SPXA 1UZMA 3LQFA 4KDFA 4GSLA 3ZWCA 1PGNA 3ADPA 4LRTB 3RUDA 1LDEA 3N7UA 4CMEA 3G17A 1DEHA 4ND1A 2X22A 4K1LA 1IY8A 2IZ0A 2H63A 3RBVA 4KMSA 2FSVA 1NASA 4ROSA 1MFZA 5U4QA 5CDUA 3LDHA 1R0KA 4N18A 2CZCA 1C14A 1UJMA 3F47A 4DPLA 4J91A 3EDMA 3BTUA 4HY3A 1B8UA 4BNUA 3AY3A 1GADO 1W6UA 2PKQP 4BKUA 2IYOA 1YKFA 2GN9A 4CQLB 3F1KA 3C7CB 5A03A 1SC6A 4D45A 5EESA 4CM3A 1HSOA 4IQGA 2G17A 5C5IA 1GPJA 4YT2A 4R01A 3QA9A 1F8GA 4J7XA 4MINA 1MXFA 4ALNA 1PGPA 1I8TA 1O89A 4MVJG 2YHIB 4KUHA 4DL9A 1D8AA 1ZO8A 3M2PA 3ORFA 3UH1A 2WD8A 1RM5A 4DYDA 3Q6IA 1E92A 5COQA 2CF5A 2X6TA 3PQDA 1N92A 3QJ5A 1U2GA 3DR3A 1PQWA 1QSGA 4ZN6A 3T7CA 1I24A 2O7SA 4BO1A 2VUSA 4AJIA 4LGVA 5DBFA 1IPFA 3BTOA 2Q2VA 4RPJA 4QTZA 4ZQGA 3BMOB 1ZJZA 4U8GA 3BYZA 1BXGA 3DB2A 1Y8RA 3M1LA 1VLLA 5HS6A 3SJ7A 3HQ4O 4CLDA 2BKAA 1MLDA 3PYLA 3HB4X 4XWYA 4AJHA 2PY6A 1VSVA 2ZTMA 4NBVA 2GASA 1K3TA 3L6OO 3CPSA 1PEDA 2DPGA 3RC9A 1ULSA 1UAYA 4P8RA 3GAZA 1YJQA 3ETDA 1HDCA 5ICMA 1FJHA 1PZFA 5HWSA 3JV7A 4BQRA 1X1EA 4DQUA 5JAMA 1DIRA 1QP8A 1LSSA 3JQGB 4P4LA 2JCYA 4U0JA 5IZCA 2D5AA 6LDHA 3PJEA 3P2YA 4RVSA 2QW8A 3H9UA 1C1DA 3R3JA 4R1UA 4TZKA 3UAGA 4TRJA 3SEFA 3E5RA 3RUFA 2DLDA 2NVBA 2R00A 1SAYA 4E3ZA 4PLYA 1ID1A 1KYQA 2Y0EA 3DBLB 3HDHA 3HDJA 3V1YA 2FRDA 5JCXA 4MIOA 4D7AA 2Y99A 4Y67A 2X4GA 3AI2A 2Q1UA 3AFNA 5KIAA 3GEMA 2Q50A 4BO8A 1LDMA 1Y6JA 2I3GA 1EZ4A 3JQ7B 2UUPA 1BHSA 4DC0A 1KEUA 1RM0A 1PJLA 4B79A 3QLJA 3QVTA 2J5RA 1A27A 1I3NA 1Y8RB 1VRWA 4RF3A 1T4BA 4C7JA 3BMOA 4MVJA 3F5QA 1KVUA 1NM5A 2NTJA 3ETGA 2NQ8A 4YT5A 1WDMA 4OSOA 1B8PA 4CQLA 5HS4A 4AJKA 3GA0A 5L45A 2IEBA 2LDXA 4LW8A 5G4KA 4R54A 3W6ZA 1GQ2A 2JHGA 4LN1A 1GR0A 1ARZA 2PGJA 3QHAA 1ZUD1 5AXCA 1AE1A 1H2HA 3H9EO 4TSKA 4XR4A 4Z9XA 4M54A 1R4NB 5T64A 2WE8A 4BGIA 1XKQA 4ZQFA 1YBVA 3BIOA 3JYQA 3RAJA 5C7LO 1HDXA 2NM0A 5A06A 1EUDA 4MJLA 4RPHA 3EYWA 4II3A 4J6FA 2V65A 5G0SA 3KEOA 4CQMB 4BO5A 4ZRNA 1P1IA 4BB6A 3AM4A 3PZBA 4J1QA 4YJFB 1E3EA 2YW9A 4B4UA 1QKIA 4LISA 2C5AA 2PGDA 2O7QA 4ZA2A 2YFHA 3FNFA 1WMBA 3KTDA 5F3RA 3AI1A 4D79A 2ET6A 3H3FA 1TT7A 1KY4A 3DMYA 4YVFA 5KOIA 1E6WA 4XX0A 3D3EA 3ZW8A 3FNGA 5IN4A 1OMOA 5T8KA 2EW2A 2JL1A 3HSKA 3MJTA 3JQEA 5TIIA 1PJCA 5KKAA 1H6DA 2BLLA 1RWBA 4TKLA 4U7WA 4S3MA 1EVZA 4NIMA 2I6TA 5K0ZA 4WJZA 4DMLA 1T2DA 4L75A 1KC3A 4NU5A 1ZVMA 4CLRB 3OIGA 2C5EA 2PFGA 4M87A 4CQMA 1U2DA 3Q9UA 2X9GA 3RROA 4RPLA 4YTEA 1E1NA 5F5NA 1ZMOA 4K6CA 1WZIA 4GWGA 4P22A 4DC1A 1WNTA 3GPDG 5IDQA 2ZJ1A 3Q9NA 1E7QA 3RI3A 5DOVA 3OHSX 3W6UA 4A10A 1YBAA 3D4OA 1UXIA 3PWKA 2I65A 2VWQA 1HTBA 4RLHA 3ASUA 2XOXA 1XQ1A 3A1NA 5BT9A 5IDXA 4EGFA 1Z6ZA 3ANMA 4Z9FA 4L8VA 4HXYA 2WTBA 4J43A 4QO7A 3BMNB 3ZGYA 2Q1WA 3MTJA 5G4LA 4GGPA 2QRJA 5C3MA 3AFMA 2BFOA 1E3WA 2I99A 2V7PA 1MA0A 4HX5A 5KVCA 3EZYA 1F17A 1QMGA 4YR9A 1ULUA 1ZSNA 3FF4A 2CNBA 1WW8A 3GFBA 4HADA 4YYZA 3D0OA 5MGBA 5A1TA 5JS6A 5DBIA 2XPCA 5A9SA 1BW9A 4BKOA 4Y6RA 4XCVA 1BG6A 1NWCA 3SVTA 2YDXA 2H1SA 3PGJA 2R6JA 3IC5A 4EYEA 4F46A 1GZ4A 4H3VA 1QLJA 2ZB8A 1D7OA 4D0SA 2D4AA 4DTIA 5FI3A 5I8WA 4A26A 1BVRA 2W2KB 3PJDA 2J3IA 1GV1A 1ZK0A 4GVLA 4PLPA 3RJ9A 2GZ3A 3DBHA 3PPIA 1N1GA 1KVQA 1MGOA 1PU2A 5B4UA 5TF4A 3OA2A 1WVGA 3FNEA 3P2OA 1J0XO 4K28A 2EXXA 4BNXA 4IDAA 3CINA 3IP1A 1M66A 3A06A 3ZHXA 4MVJF 1KS9A 5JO0A 3A14A 2PNFA 3BXXA 1JN0A 3GGOA 1M67A 3B20A 4FOSA 3JQBC 1I01A 1DJQA 1U3WA 3OA0A 2NU8A 3KYBA 1Y1PA 3EZLA 2QZZA 3E9MA 4W9NC 1L1FA 1EDOA 5TNXA 2Y0CA 4QEDA 3P19A 1DRUA 3V1UA 1ZEJA 4KTTE 3KYCB 2J3HA 3GZNA 3WQRA 3P5SA 1YWGO 4NFYA 4RF2A 1AXEA 4Z9YA 3RD5A 3A9WA 2EP7A 2NACA 4G65A 5IF3A 2O4CA 2AXQA 1HDZA 4R16A 4RV9A 1E3WB 5ENVA 1UDAA 3CE6A 1RPNA 1UZNA 3GZ4A 4WOJA 1HEUA 2CDAA 4R3WA 4O1MA 4Q3BA 1X7GA 2WD7A 3AUAA 1NBOA 5CDTA 1BXKA 1LSOA 3GN2A 4P4NA 4UVIA 1B7GO 2HJSA 4FFRA 2DBQA 3VKVA 3ZWVA 4XB2A 1QRRA 4Y6PA 2VRBA 2WM3A 1LDNA 4LVCA 4GLLA 5G4KB 3U4CA 1GU7A 5H83A 2DTXA 2FZWA 1BVUA 1GEGA 1SZJG 5AXBA 4CMKA 4CUKA 3D1LA 1V3VA 2FOIA 5FFFA 4PIVA 1IOLA 4TRNA 4WCFC 4TVBA 1Q2XA 3G3EA 3GC6A 4N54A 3ZNQA 4AJJA 4NJMA 1Q7BA 3KYCA 3W8FA 5IAAA 1QYWA 5CPBA 1MUUA 3BMCB 3JQAA 5BNFA 2DFVA 2EKLA 3NX4A 4BL5A 5L7TA 3PFWO 1HF3A 5DCYA 3DBVO 3VTFA 5JAZA 1Q7CA 3GNTA 4XIJA 2PD4A 3DHYA 5ES3A 5BSHA 1HRDA 3L4BC 5KJEA 4IDCA 4YRAA 5A5FA 4X54A 1PGOA 3KSZO 3M1AA 5EPOA 2DTDA 3M2TA 4R9RA 5DT9A 4CM4B 3LK7A 4RO0A 4YBZA 4I1IA 1VJ1A 4CM9A 1WLYA 3AOGA 2OGUA 2NWQA 5KCZA 4Q3AA 2NVUA 3Q2IA 3NKLA 5EJ2A 1XSEA 5JMPA 4HBGA 3F1LA 2UV8A 4YEDA 4QT0A 5JE8A 3UUWA 5KVQA 1W73A 2FMUA 2X0JA 3CKYA 3VKUA 1QXSA 3WIDA 4ALIA 5KJCA 2E48A 4RLSA 4QUKA 3ZHYA 2AG5A 5JBIA 4B8ZA 2O2SA 3MJCA 1SMKA 3JQFC 1Q0QA 5F1KA 5JYEA 1F8FA 4WPGA 3E8XA 4IXTA 2YQ4A 3ZU4A 1ZMTA 1ISIA 1DBVO 3GHHA 5A05A 4XYBA 3EK2A 4WCFA 2B5VA 1H6CA 3COSA 4IGEA 2YZ7A 4BNKA 1B26A 3K92A 4ZD6A 3E48A 4CLOB 1GV0A 4FJ0A 2NQTA 4XRGA 2FPIA 4PG8A 3OM9A 4XYLA 2PR2A 3ZU5A 2RH4A 4B3HA 3WNVA 3GT0A 4RVUA 4WCFB 5JCJA 4HV4A 4GX1A 3H5NA 2X9NA 3TL2A 3BMNA 3S2GA 1N8KA 4AJEA 4BIIA 5BQFA 5GZ1A 6ADHA 5DZSA 3RUEA 2IODA 1OC2A 3VVCA 2CDBA 4YWJA 4CM4A 3Q11A 1A4UA 1FDUA 5LDHA 3DBLA 3DBRA 3ZNNA 3LZ6A 3LT1A 1IYZA 3GH3A 4WEQA 1EVYA 3I5MA 4FC7A 4M49A 3E6AA 3OMLA 1D3AA 3WYEA 8LDHA 3E9QA 3OJ0A 2GPTA 4E30A 1A4IA 1ZXLA 4DQVA 5A9RA 3ROQA 1R15A 2HUNA 4OSPA 3ZWMA 3PDUA 3VDQA 4CR6A 1E1KA 3K73O 2ZIZA 1GQQA 2WMDA 2YV3A 3AOEA 3D3WB 4JNKA 3WFIA 4AJPA 2FN7A 3FTPA 3OIFA 1LDGA 4LRSB 3PFFA 1YL6A 1PWZA 4XYGA 4F6LA 1U3VA 4MKXA 1V3TA 4PN3A 2HDHA 3GG2A 3VOSA 3RUHA 1F14A 2GZ1A 2VHWA 3NDRA 3PHGA 4MKRA 4Y8VA 3VZRA 4LK3A 4RL6A 1ZK3A 9LDBA 4K6FA 1H5QA 2VOEA 4C4OA 3FD8A 5BSEA 4KP7A 2E82A 1P0CA 2P5YA 4E21A 4J9UE 3I23A 1D1TA 3ZWOA 2CVOA 2A92A 2GERA 2WYVA 4LSMA 3LT2A 3PJGA 2YHUA 4DYVA 1K0UA 3VAZA 5A4DA 2W98A 2W90A 1E5LA 4P38A 4U5QA 3VPFA 1YL7A 3C7DB 2AMFA 1PZGA 2VHXA 2O2YA 3HN7A 3PLRA 3VHRA 3U4HA 3OECA 2Y0DA 1H9AA 3DC2A 4JLWA 2IYPA 4KOAA 3FN4A 3H3JA 2DT5A 2HK7A 1B0AA 3JSAA 1JQBA 1WAMA 3LT0A 3AOEC 1XELA 3MWDB 4Z3DA 1NNUA 1E1MA 4Z0HO 2UUOA 3VH1A 1RJWA 5TSDA 4J4TA 3PHLA 1VKNA 3G79A 2HLPA 3ZCXA 4BQPA 4R68A 1XWFA 4RORA 3I9JA 3TN7A 4HFRA 1W4ZA 2WJPA 3C1AA 1IZ9A 3O03A 3Q3CA 4LMPA 3ONEA 2AA3A 4W99A 2PZMA 4RVFA 3UXYA 3ZV3A 4D46A 2ILTA 2J3KA 3HB5X 2DUUA 2AHRA 1VM6A 2Z95A 3JQ7A 3KLMX 3WGGA 4GPD1 2VCYA 3GFGA 3I3OA 3FPCA 3ZWWA 4FBGA 4FB5A 2O3TA 1A9YA 2W2KA 1PS0A 1BRMA 3TFOA 2X5OA 4XKJA 1R4MA 4FFLA 4BKRA 3G1UA 2AQHA 5L53A 3F5SA 2C2YA 1FDWA 2B36A 2B37A 4N5MA 1C0IA 2DTEA 2IXBA 1LDYA 4ND3A 3V8BA 1W0CA 4O0LA 2CVZA 2BMAA 3PYMA 4J0EA 2SCUA 3DTYA 2BRUA 4ALKA 1NHGA 4NFSA 4C7KA 1XDWA 1PWXA 4Z0PA 1ISMA 2GNAA 5KJ6A 1V6AA 2HSDA 1XA0A 4W6ZA 1EK5A 5KWEA 1FDVA 3O8QB 4ID9A 3IUPA 4II2A 5ILOA 2EHDA 5JDCA 4IDDA 4CLXA 3H5RA 4ZHSA 2VNAA 3DL2A 3ICCA 5K6AC 1E0DA 3NDJA 2IDZA 1X7DA 4PRKA 3PEFA 1DAPA 3GVHA 2CVQA 7ADHA 4OO3A 4PLHA 2W8ZA 3C85A 4MO2A 4NBWA 3ABIA 1OOEA 1RM3A 1PJ3A 3NJ8A 5CG1A 1GUFA 3RASA 2B5WA 3U62A 3V1TC 2JFGA 1EK6A 1I30A 3DEYX 1VC2A 1E7RA 5TT0A 1KBZA 1CYDA 3TJRA 1VSUA 2O23A 4G5HA 4YCAA 4BNMA 3U0BA 1U8FO 4Q9NA 1IPEA 1ONNA 4YAJA 1SCUA 3K6JA 3GOHA 5AVOA 4D42A 1E6UA 1PSDA 2J8ZA 3PWSA 1U1IA 3JQDA 4O5OA 3L77A 4GKVA 4CUZA 4Q3CA 3WLFA 4B3IA 4YA6A 4XYEA 3PDJA 1U4SA 1LRKA 2ZCUA 1U4OA 5DP2A 4UEKA 3STHA 3R3SA 2ZB7A 5TGDA 3GQVA 4DIOA 2GN4A 3VDRA 1H94A 3RC7A 2GYYA 3QWHA 4MIYA 5TJHA 4FJ1A 1JTVA 1Z7EA 3G49A 1Z82A 1HDRA 3KM0A 4AG3A 5ILGA 1EQ2A 2I5PO 1J6UA 4NHEA 3O26A 4XB1A 3U3XA 3N74A 4NH4A 3PIIA 4PG4A 3QWBA 2C7VA 3LYLA 3GY0A 4IDBA 3ADOA 1P31A 2NADA 1UAGA 5JDIA 2EEZA 3IMFA 3EMKA 2X0NA 1Q0LA 2Q99A 3NT4A 2QG4A 3LF1A 3CMCO 1MXHA 4E13A 4RPGA 1SB8A 1E7SA 5AOVA 1IULA 3F9IA 3PRJA 3INRA 3G0OA 1T4DA 2P9CA 2EGHA 4AJLA 3K2EA 3P7MA 2DFDA 3MEQA 3LF2A 5JW6A 1UZLA 3DZJA 4MPDA 1WWKA 2FWMX 1JA9A 4AFNA 1CQJA 4F6CA 4JGBA 4F3YA 1H2BA 1MC4A 5F21A 1LSUA 5T6BA 4ZJUA 4DBZA 3WTBA 5CEJA 4GGOA 2C07A 2PH3A 3ZWAA 2PD3A 2RIRA 1YB4A 3QSGA 2G1UA 2H6EA 2YV1A 1QV7A 3EC7A 4CLHA 1NVGA 4TRMA 3B1KA 4HWKA 5G0VA 1QV6A 2R00C 3PIDA 4XGKA 3WICA 4IUYA 1DAOA 3CH6A 4R41A 4DIFA 2TMDA 3CIFA 3PXXA 3WWYA 1YQXA 4CM1A 3RVDA 3DZKA 3R6DA 5G0UA 2BGMA 1XR3A 4ZVVA 4Y9DA 5COAA 2ZK7A 4RVDA 4XQ9A 4O63O 4O59O 4ZICA 1QYCA 3AK4A 3OP4A 1V9LA 4I8XA 3RKUA 5LCXA 3PHJA 2O48X 1SEPA 1PIWA 1H93A 3UOGA 5IDWA 4FFMA 9LDTA 2EG9A 4R1TA 4YB8A 1B16A 2HJRA 4PG6A 1I32A 1LU9A 1M6WA 1U28A 3DOJA 4E33A 3LT4A 5A9TA 4BO0A 1NXQA 2GRAA 3RFTA 1KOLA 1X0XA 1P77A 1Z45A 1KEWA 3RUAA 4Y98A 3EW7A 4J2OA 3DZIA 4HFJA 3DAPA 1KETA 1YS4A 2Y68A 4RZIA 3HE3A 3BZUA 1OC4A 1CWUA 4MVJE 3U9LA 4BNIA 4O6VA 3F6YA 1L7EA 2GGSA 1ONOA 3HUDA 1E7YA 2IZ1A 1ADFA 3OQ6A 2P68A 3WGOA 5IZ4A 3ANLA 4Q39A 4BNJA 3WB9A 1JW9B 3DOOA 1CETA 2WSBA 5CHEA 3N58A 3FPLA 1L7DA 4DPKA 1O8CA 5EERA 3I9KA 1NQOA 4FFOA 4XDZA 2Z1MA 1ZH8A 3MJ4A 4E31A 5L4NA 4WLVA 1MC5A 3H6KA 2ZKLA 1E3IA 4NPCA 3PTZA 1LX6A 3OJLA 2VYVD 2G82A 1JAYA 4IMRA 4DRYA 3C1TA 2DKNA 1T26A 4LSWA 2C0CA 2VTEA 3OFSA 4I08A 3PHIA 4WNCA 3UF0A 1A9ZA 2X86A 4YAGA 5L4LA 4J49A 2D0IA 3ZV6A 4YXFA 3QY9A 2XAAA 2ZATA 3H8VA 4B4VA 4XDYA 3F3SA 3FBGA 3LSYA 1K6JA 5CAEA 4WKGA 5DDIP 3WSVA 2P91A 1BDBA 4GVXA 4I9NA 3DOCA 3HZZA 5L3ZA 1B3RA 1WXDA 4M8SA 3NRCA 4E2ZA 5DCUA 1NP3A 1B2LA 5CEEA 1ZXBA 1TI7A 1PJQA 1TT5B 4J1SA 2HRBA 3H2ZA 2VUTA 5HTOA 1X1TA 1SNYA 4FD3A 4UVEA 4WGGA 4OKIA 4NJMB 1GZ3A 1LC3A 2FY8A 4J1NA 2Y1DA 1PQUA 2P9GA 1K5HA 1LQTA 3TNLA 2WEKA 4PZCA 3I9MA 3D3WA 3JYOA 4IIVA 4Y6SA 5EQDA 5I7VA 1JKIA 4RVHA 4D43A 1TXGA 3HG7A 3WWZA 1JKJA 1NR1A 1DFHA 3IS3A 3NTQA 3OJFA 1T25A 2OL4A 4CMEC 3IP3A 3GHYA 3LLSA 4K26A 3DBHB 2PWZA 5JYDA 2BFAA 4U0KA 1KERA 1NFQA 1GCOA 1GZ6A 3RFVA 1IZ0A 4TQGA 4GQAA 2EW8A 1KC1A 4CM6A 1U5CA 3OEYA 3KYDA 4UREA 1C1XA 4G2NA 1GL3A 2YY7A 4YJHA 4E5MA 1ISJA 3PZRA 3TZHA 4YQZA 2P4HX 3JTMA 4MVJH 3AY6A 2JCXA 1GQYA 1GYPA 3GK3A 5B12A 1N5DA 4BNVA 4RJTA 1E3LA 1LLDA 3VTZA 1Y8QB 2CUKA 1ZK1A 3GZNB 1M75A 3LLVA 4RF5A 3E03A 3VPXA 5LDGA 4ZRMA 2ZQYA 3TL3A 1HLPA 2IE0A 2HMUA 1XQ6A 3HJAA 3X2EA 4DBVO 2NU7A 4L76A 1HL3A 4I5EA 2FHSA 3UHAA 4BNLA 4EBFA 1TVEA 4D44A 5A3JA 5L4SA 1A7KA 1JDJA 2DPHA 4GI2A 1LTHR 4GBJA 2OP0A 5GMOA 1O9BA 4BGUA 4JIGA 3RQSA 1BMDA 3K30A 2BF7A 5HM8A 5IXSA 4FDAA 3ZHZA 2VOJA 1P45A 1C0KA 1LA2A 3QWAA 1NVTA 1I33A 2ZTVA 1WMAA 4OXKA 4BVAA 3B6ZA 2OFPA 1R4MB 2J5QA 3ZDFA 1I2BA 3DWFA 3GUCA 2HU2A 2WDZA 4A03A 4B7CA 1SOVA 4DPMA 4TZTA 3QWFA 3GVCA 4YT8A 2PKQO 1YQDA 2OUIA 3BMQB 1HSZA 2RAFA 3TOZA 3WYBA 3DMTA 3PYXA 3D7LA 4NNJA 5FYDA 4BUCA 3HNPA 5JNLA 5H81A 4OXNA 1GYRA 3PQFA 1H6BA 4H15A 4WASA 4BS9A 3RIHA 2OZPA 2EKPA 3TRIA 1S6YA 1B8VA 3GUYA 5EL0A 4BGEA 2AE1A 4YT4A 2O3QA 4CL8A 3KUXA 1AUPA 2AEFA 1NFFA 1LLCA 3GPIA 5BSGA 3QQPA 4EEXA 2YJZA 3FNHA 3FI9A 4AJ1A 1CRWG 1ENZA 2Q4EA 3PP8A 5BNIA 3GEDA 3SXPA 3U4DA 2GF2A 2AQ8A 4M86A 4EITA 1N1EA 3GMDA 4ZGWA 1Z74A 4FPXA 3RSHA 4DLBA 4PLFA 3KZVA 2TMGA 1ZKMA 2YUTA 4ZQHA 2P5UA 2YHIA 1DSSG 1WDLA 2ZB4A 4OGWA 4WCDA 3WBBA 1ZK2A 1RYEA 1IB6A 4OKNA 2VYND 4ILKA 2OOSA 4BGVA 1F0YA 3KRTA 5ADHA 2CD9A 1YRLA 3ZHBA 4I5GA 4QO8A 2VWGA 1NAHA 3MCVA 1DIGA 2OP1A 1LJ8A 2PA3A 1P9LA 1MG0A 1T1RA 2BI8A 4MVJI 5THQA 4RDHA 4UEJA 3CZMA 4AJOA 5BSFA 1X15A 5IZCC 5CEFA 3MJEA 4MKZA 5C7IO 3A4VA 2JD0A 1Z75A 3MWEB 5JPIA 2Q2WA 4ZU3A 1J4AA 4PRLA 3ULKA 2X1HA 2HMWA 2DM6A 2JAPA 1P3DA 3ROMA 1UXGA 1V35A 1AGNA 1EEHA 1DFIA 1HDOA 1QR6A 2PTGA 4IGFA 1M76A 3DFUA 3E9NA 5DN9A 3DHEA 1PJ2A 2E49A 3U4IA 3IDSA 5B37A 2Q2QA 3UCXA 2PV7A 4D0RA 3AU8A 3FBTA 4PVDA 1YL5A 3U09A 1J49A 3R1IA 4R51A 1HZZA 3H4VA 4OIMA 1XU9A 2AE2A 3ONDA 1HDYA 4TWRA 4BNFA 4KQWA 1YVEI 4HUJA 4FOOA 4DREA 4GX0A 2D8AA 2WD7B 1U3UA 5FF9A 2AQIA 4QECA 1U5AA 4CLEA 3K8ZA 4ALMA 1U7HA 3F4LA 3DXFA 3NDIA 4Q3DA 2G0TA 5A9SB 5HRUA 4JQCA 3JQ8B 4N7RA 4CV1A 5U9CA 2I76A 5T57A 1R66A 3CEAA 3K2BA 1ML3A 2OO5A 4RPKA 4D3SA 2F00A 2CF6A 4A7PA 4BKPA 2E37A 1XCBA 1QORA 3JQ8A 4PG5A 3RUCA 1R0LA 3KLPX 3S55A 1YOVB 2PH5A 1EFKA 3JQBA 2BH9A 2UAGA 5TC4A 3OJEA 1KIFA 1YJ8A 2QRKA 2OORA 2OMEA 2DBZA 3FSRA 2Z1NA 4MVJM 4IPTA 4PLGA 3KSDO 1JWBB 3RJ5A 4OOEA 1YONA 5JO9A 2X8LA 4B8WA 5JAQA 3ANNA 3HADA 1VI2A 3U5TA 3GG9A 1E5QA 2WYWA 1CEQA 2YDYA 1OAAA 2Y1GA 4L4XA 5CG2A 3IOYA 1P1JA 1LRJA 5LC1A 2NLOA 2C82A 2B69A 4J16A 2FSSA 4CLRA 1GFSA 4EUFA 2A4KA 2IEDA 3G1TA 4NI5A 2GLXA 1EUZA 3PQEA 5DNAA 3FRJA 4EUEA 3HFGA 5B4VA 1YQGA 4IQ8A 2I3AA 1DDOA 3IUSA 3O4RA 3JQ9C 1P1HA 1ADGA 4EDFA 3AUSA 3IKTA 3AUTA 3BHMA 1CERA 4IJUA 3S1LA 1DFGA 4WLFA 4AJ2A 3QVSA 1ENYA 4IQ0A 1PX0A 2C20A 3UCEA 3VC7A 2IXAA 3H2SA 4YAIA 3DAFA 4OOFA 3C8MA 3FCOA 3WIEA 3ROPA 4IJVA 5JSFA 2CY0A 5C37A 2H5LA 5I7EA 3HDYA 2QZ9A 4JX8A 3I9LA 4FSHA 1IE3A 4OAQA 4WLUA 1IL0A 1GAEO 4J4BA 3VPGA 4UUPA 3CUKA 4ND2A 4UUOA 2JHFA 3WJ7A 4K9DA 2VQ3A 2VZ9A 4CM8A 1Y5MA 4E12A 2VHVA 1O0SA 3AM5A 3JD3A 4LCJA 4PCVA 5T67A 1LLQA 5G2OA 5KKCA 4XR9A 4PZEA 2EV9A 3RUIA 2DQ4A 3MTGA 4QXMA 3KXDA 2BHLA 1DOHA 1Q0HA 2PZLA 4LMRA 4QFCA 4PLTA 1YGYA 3ZH2A 4UUNA 4CMAA 3LVFO 1Y7TA 3AI3A 3H7AA 3UICA 3WGHA 1PJ4A 4XEHA 4J0FA 4CMIA 2Y67A 4XRRA 3TOXA 2PZKA 1CQIA 4PLWA 5JDCC 3GLQA 3RBZA 3VH3A 1FDSA 1PTJA 1VJTA 4E2XA 3V5NA 3VVBA 4E32A 3ITDA 4EI2A 2EWMA 3EY4A 4FS3A 2AW5A 2A94A 4GX5A 3DO5A 1DRWA 1T2EA 2QRLA 1PR3A 2P9EA 3L9WA 5T5QA 3IKVA 1HDGO 1UXKA 4OYRA 1HE4A 2ZB3A 4ITUA 5JFOA 1C1DB 3TZQA 1P1KA 1EBFA 4LCEA 4BNNA 1DIBA 4L4RA 2DAPA 2NTVA 1GY8A 2Y66A 3OBBA 4B7UA 1DLJA 5EIOA 5T8KC 4JJIA 4IZIA 3LU1A 1BDMA 1QYXA 4IDFA 4WNIA 3W4JA 4BNYA 2X7HA 1X7HA 3CTMA 1GUYA 1Q7GA 3Q2KA 1A7AA 4FR5A 5ITWA 1T1SA 2PD6A 2V6GA 2XXBA 2YYYA 4B4WA 4XQEA 3CSDA 5JY1A 3ONFA 1UDBA 2PK3A 1GEEA 2X0RA 5IDYA 3PVZA 4NG5A 4R9SA 3VZSA 1WZEA 3F4BA 4WEOA 5JAIA 5TLSA 2Q3EA 1D4FA 1R0SA 3DMTC 4FW8A 3INGA 4CV3A 2JCVA 1ZBQA 1ZK4A 1E7WA 2B4QA 1ZJYA 3GNQA 2UDPA 1V3UA 1N9GB 4E5KA 1JKFA 1WDKA 2ZTUA 1ZCJA 1OFGA 4NFHA 3RU7A 1EUCA 1EDZA 5GZ6A 2CDCA 1ISGA 2GR9A 2O4UX 1MFPA 1J5PA 3WQSB 3RC1A 5EN4A 3PK0A 5A04A 1IHXA 2EJVA 4E6PA 3KSUA 4OQZA 2VWHA 1YDEA 4IBOA 1YXMA 3D4PA 4BKQA 3NAQA 1P0FA 4RGBA 2BELA 3FR7A 5L7WA 3EVTA 4FGSA 5L40A 3PJFA 4RZHA 2OBYA 3WYCA 2R2GA 1DC4A 3OQBA 5TS3A 5TJ9A 5J23A 3BHIA 1PZEA 4WE3A 4D3FA 1VL0A 4IDGA 3T4XA 2NVUB 1HE5A 2LDBA 3L07A 4OJNA 2QIOA 2IZZA 1VL6A 2Q49A 4TROA 4WLOA 2AQKA 1R6DA 4IXWA 5DOZA 4UVGA 3QP9A 4NK4A 3BAZA 2C59A 1GCUA 4PG7A 1G6KA 1I3LA 2CMDA 3JD1A 4W7HA 3ZWPA 3WSWA 4XZ3A 4J7UA 3AY7A 4E0BA 1AHIA 2NUAA 3ZW9A 4KUGA 3WGIA 4DIBA 3BMCA 3KV3O 2NVWA 3ZU2A 2ZYGA 1P1FA 1ZFNA 4GL4A 2UVDA 1U8XX 4CODB 4MDHA 8ADHA 1YDWA 3SJUA 4GAEA 2O3RA 2HRZA 4FCCA 2DU8A 1GYQA 4NDNE 1SOWA 2HQ1A 3TDKA 1M2WA 4HNHA 4YJFA 2OHXA 2W4QA 4BO2A 3WX0A 4E2YA 2Q1SA 1F12A 4IJKA 2FZEA 4PLZA 2HAEA 3I52A 2ZTLA 3GMSA 2DVMA 3UN1A 3NV9A 4BNZA 4B3JA 1V0JA 4WOKA 1HYGA 3OETA 3SLGA 4CM9D 1Z7BA 1PS9A 2Y1EA 2GSDA 1R4NA 2C54A 1ZZEA 4MVJP 3FR8A 3FHLA 2D5CA 1ONPA 2FR1A 3K5PA 1IUKA 2D59A 3WR5A 1DC3A 3O9ZA 4FFNA 4CM8B 1ZEMA 3C3XA 3I9OA 1PR9A 4R4JA 3UKOA 2I9PA 4ALJA 3LC1O 5KVSA 1KVTA 1ADCA 1T2FA 2EKQA 1PGQA 4E5YA 1M6HA 1PQPA 1JU9A 3JYLA 3SBOA 2GN8A 4YAKA 4J1TA 4RDIA 4DGSA 2H9IA 2VRCA 3V2HA 1DLIA 1X13A 3BTVA 4CMHA 3QV1A 3ITKA 4YJDA 3RWBA 4BNTA 1XEAA 4U6SA 1E6EA 1DC6A 1XLTA 4ZQEA 1Y8QA 3I6QA 3O8QA 4KUEA 1LUAA 4CMGA 2C2XA 4MOWA 3AW9A 2XXJA 2AG8A 4NBRA 1ISFA 1PJSA 3ASVA 1A71A 3GAFA 1B3BA 1PL7A 3WGZA 4D3DA 1HETA 1H9BA 3PHHA 1DIHA 4YPOA 3WGYA 3OQ1A 2V6FA 3AU9A 3DHNA 1I2ZA 3KYDB 4RQUA 3FTNA 2EGGA 3K96A 3EGOA 2CSUA 3WMXA 5AYVA 2Q4BA 4XQGA 1BTOA 1VJ0A 3WGTA 3OEWA 3AJRA 2VYVA 4R1NA 2VRCD 5JDIC 2B35A 3NT5A 4PZDA 1EVJA 4RF4A 4DXHA 3CMMA 1CIVA 4BMSA 1ZNQO 3B1JA 3JQGA 2O3UA 4YQYA 1PZHA 4BOYA 1DC5A 4YRBA 3ZWXA 2W2LD 1D1SA 1MB4A 2NU9A 2X5KO 4DLLA 1KY5A 3E18A 5ER9A 2EERA 1DHRA 3JQAD 3C7AA 3ZZNA 5IXYA 5JCJD 3ST7A 4BO3A 4J90A 3IJRA 1NPTO 3B70A 3NT2A 4PLVA 1QYDA 5CPFA 1FF9A 1YOVA 3NGXA 2Y1OA 3TFQA 1KVSA 4CMBA 4CJXA 4FIZA 1W8DA 3PI7A 1YBMA 3NTOA 1TT5A 4ND5A 3TSCA 1U9JA 5JC1A 3ZV4A 2G5CA 1CJCA 4GMGA 4RQTA 3W4IA 3MJVA 3D5QA 3GDOA 4EZBA 2YV2A 3AUUA 1EQUA 1TEHA 3UFXA 2Q1TA 1C0PA 2VT2A 2C29D 5K9ZA 1LXCA 5DF1A 3IL2A 3NUGA 4R5MA 5BNTA 3Q0EA 3W4KA 3W8EA 4HFNA 1K6XA 2Q45A 3ZN2A 3SX2A 3WXBA 3CZRA 1Y81A 5I8ZA 2EF1A 3IJPA 2HMTA 2G76A 5DULA 1O94A 1NQAO 2RHRA 1NAIA 1XU7A 1BSVA 1NFRA 1U3TA 1H6AA 3ZNPA 5ITVA 2HK8A 4BO6A 1VKOA 4JP3A 3QVWA 1G1AA 1P44A 3BHJA 3VH4A 4OMUA 1VE9A 4EUHA 3WS7A 1F06A 1HT0A 2O50A 4FGWA 4XJTA 4RVGA 2HMSA 5TT1A 2ZYDA 1LC0A 2FP4A 5H82A 3DQPA 1NVMB 5B1YA 4BB5A 4ONEA 1ADBA 4FC6A 1QYVA 3KVOA 3ROKA 3L6EA 4L74A 3HN2A 4DA9A 4IDEA 5L51A 2WWRA 1I5RA 3L9XA 1DXYA 2VT3A 3MOIA 4JJGA 4OHUA 4CQMD 3WNQA 3GDGA 2RH8A 3RFXA 2P2SA 3WGQA 1NPDA 4I5FA 3S2EA 3NEPX 4UEOA 1HKUA 1I10A 3GR6A 4CPDA 5EINA 4R69A 3K31A 2JAHA 1C3VA 3DBRB 4KQXA 2GUGA 4JBIA 5I9MA 3TPCA 4AJNA 2BFMA 3L4SO 3PWZA 3RKRA 2VHYA 3HDQA 4URFA 4GLOA 2D3TA 5KTKA 5IJZA 2CFCA 2AEMA 4IS3A 3ZWNA 5L9AA 4XD2A 5A5EA 5TX7A 4IMPA 1YE3A 1MX3A 3WTCA 1C0LA 2B0JA 1X14A 3CXRA 2QYTA 3QIVA 4CV0A 2X9VA 1WPQA 3VPHA 4WECA 3S8MA 4XA8A 4E5NA 4MP8A 4NQZA 4S1VA 3RBXA 4CMCA 3RC2A 4EJMA 4IZHA 1NX6A 1I36A 1YO6A 2E6UX 2POQX 1EFLA 2FPGA 1N7HA 3ENNA 3RU9A 2I66A 2V6MA 3ENKA 3MZ0A 3OSUA 1K89A 4ZQBA 5JXWA 3DDNA 5DBGA 2B4TO 1Y9EA 2VN8A 4J2HA 2X58A 4B4OA 1N7GA 3DTTA 3HFSA 1DJNA 3H9JA 1OBFO 3OH8A 2QYSA 2NU6A 2ZJ0A 5JLAA 3S2IA 1SEVA 4FFPA 4MP6A 4W82A 3WJAA 3VH2A 4RCVA 2BI7A 1UP6A 2VZ8A 3DFZA 4E4YA 2FR8A 2JJYA 4CUJA 3I4FA 1LEHA 1H0KA 3QW2A 1C1XB 1I3KA 3JQFA 3WMWA 1NQTA 4U6QA 4NZ9A 3L6DA 1GTMA 3GEGA 4MP3A 1T24A 4JXKA 1LI4A 4W9NA 3OIDA 2UYYA 7MDHA 4GH5A 5F1OA 3KHUA 1FXSA 5TRTA 4UAGA 1FMCA 4M89A 1K2WA 1S7CA 2X0IA 5FWNA 1HLDA 4YDRA 4DWVA 3ZWYA 1JVSA 1KEVA 2J3JA 4J3FA 1PJBA 5DP1A 3GGPA 3M6IA 4DMMA 3GVIA 4NR0A 1NHWA 4CM7A 1XHLA 4G81A 4I9HA 2E4AA 5I9NA 1PGJA 3L4BA 4IS2A 1UH5A 2DBVO 2OXIA 5JC8A 2Y05A 3JD4A 3PLNA 3ETEA 1TB4A 3VPSA 4BO9A 1DHTA 4F45A 4BO7A 4R5HA 4GSKA 4NMHA 4A0SA 1I0ZA 4JN6B 2VHZA 2J6IA 3EUWA 3I9NA 1HWYA 4Z6KA 4M1QA 4HFMA 4Q3EA 5AQ1A 1V8BA 3ZU3A 1RKXA 1EE2A 1YH3A 3VZQA 1JLLA 3PGXA 3U49A 1QLHA 3LC7O 3I4CA 2ZYAA 5A3VA 3NTRA 3ON5A 3WLEA 1ZSYA 3ICPA 2EP5A 5F5LA 1E3JA 1Q1NA 1DRVA 4NBTA 4BMNA 1UP7A 1QG6A 4AICA 3DZGA 1A5ZA 1PL6A 3R0IA 5BR7A 2X5JO 2RCYA 1HZJA 4GX2A 4J4HA 4CMJA 4NBUA 4I5DA 4TRRA 3TWOA 1ZW1A 2PKRA 4L73A 3IIEA 5KNLA 4OL9A 4FQ8A 4XJSA 5TQVA 4YJGA 3E1KA 4Z3KA 2Y93A 4OQYA 2HKIA 4N5NA 5CDYA 1PL8A 5A02A 3HWRA 5I7SA 4WLNA 1UUFA 1N2SA 2WE7A 4I9UA 1G0OA 3GF4A 2VWPA 2YFQA 3ZI0A 4NJOA 1R16A 4E2WA 3C1OA 1HYEA 4PFJA 2GZ2A 3KOUA 4JBHA 3INTA 4M55A 2Q46A 5G0WA 3UGKA 4PLCA 1EMDA 1WP4A 1Y5RA 1G0NA 2DC1A 2HCTA 5CDSA 5ENDA 2Y1FA 1UR5A 1R37A 1Y9AA 3RCBA 3FWZA 3JYPA 5GZ3A 4YRDA 1LBEA 4YJGB 3V2UA 3BMQA 4B7XA 3C24A 4D41A 2DUWA 3NYWA 2PGLA 4W4TA 5IN5A 3SLKA 4AVYA 5KJ1A 2VNSA 1NWHA 1MG5A 4XIYA 1HE3A 5HA5A 3DZBA 1AXGA 4Q3NA 4EJ0A 4DVJA 2B83A 3JD2A 2NV6A 1XGKA 3WG9A 4ALLA 1LRLA 3H9GA 3W8DA 4BNGA 3QVOA 1DIAA 1IHYA 2C7GA 3EAGA 1SO8A 5COBA 2VYNA 1JWAB 4HKTA 3WBFA 2GN6A 3QWIA 4DUPA 4A5OA 2O3SA 2NSDA 4QSMA 1B15A 3TZ6A 5F1PA 3WDSA 5G0TA 1BGVA 1AN9A 1ISHA
chains in the Genus database with same CATH superfamily
2WU0A 1V1RA 2B8NA 1GOTA 3UC9A 1WY5A 2DWQA 4CIYA 4DLAA 5IG2A 2BKEA 4JJFA 2YIVX 3H1PA 5D3KA 1O6ZA 2Z56A 4R9VA 5E0KB 2JZCA 4FX2A 5DCWA 3RBAA 3KBBA 2B4RO 3F78A 5C7OO 4G4JA 1USUA 1Z28A 2WF7A 1PFWA 3IAHA 4B3RB 1WU8A 2MYTA 1IBCA 3DCIA 3I83A 4KBFA 4UCQA 3TQCA 4JI6B 4QUIA 4OMCA 2ZI3A 3HH8A 4FYKA 1HM5A 4LYGA 1VBKA 1JL3A 5JSKA 3OICA 5BYAA 1QP0A 3DO6A 1ZYUA 2JFNA 4PV7A 1PUJA 2WG2A 4C0KA 3X2FA 3QVXA 4JLSA 3FFWA 1QIDA 4ZAVA 4ARZA 4DZRA 2QHXA 3VR3D 1A9PA 4C2BA 3AM3A 1K9SA 2W2LA 4JZYA 3KB1A 1T3ZA 1NR7A 2KM1A 3BTSA 3GMTA 1GDHA 1HV8A 3QG5A 3CY6A 3JCZA 5C5CA 1U0HC 3LH5A 3W3AA 4N0DA 1U6IA 2C5HA 5ECDA 3QZUA 3W9SA 1LK0A 1TLTA 4XOIA 4GIBA 5AK4A 5M29A 1E3SA 3CZ4A 1RWXA 3ZR4B 4O8CA 2A3RA 3TOCA 1FSGA 2FE4A 4D5GA 2GTIA 1TLFA 1NVUQ 2IX9A 2PMWB 2JD1A 3KO8A 4K9NA 3KPYA 1PR1A 3THXA 4RS3A 4XGRA 5J4KA 2HNKA 1KFEB 3ITNA 2QVGA 3B60A 2GZMA 2ZYVX 4FFBB 3JVUA 4BHTA 3U7RA 2OCXA 5HBRA 2JKVA 3R0ZA 5G3YA 2XUZA 3IUEA 2DY1A 2XA1A 5AXDA 4ERNA 1NZDA 3DB1A 3ROZA 1L7XA 3RV3A 5JY6A 4CL0A 1RHQA 1EBUA 3OE1A 1X7WB 3IQDB 4HRVA 4ZYWA 4LJSA 2PSFA 1IBKB 5LLDA 4Q02A 3IT3A 4N7BA 1MRNA 5ICSA 1P4RA 2NTNA 1PYDA 3ED1A 1B14A 1QHIA 4TM7A 3LIIA 2QRGA 4UCFA 3UJCA 3EVNA 4DWOA 1MIOA 4RXTA 4QWMA 1JG4A 2WMNB 5EMHA 1YHZA 2I1LA 3L8GA 3OF2A 5CT6A 1I1HA 2Y1CA 1Z73A 4WDQA 2QPTA 3JAKA 3O47A 4EX7A 1ZSVA 3NM6B 2FR0A 1SXJB 1HFEL 3BD8A 5CDGA 3FIUA 3ZWBA 4ZODA 3FDXA 4PZZA 4O2LA 3VDMA 1HTTA 3VPBA 2EL9A 4OHZA 3ZHUA 4TYNA 2VPTA 2JVJA 2V54A 1YI1A 2FB9A 2XECA 2GN0A 2NNWB 4P31A 4LWOA 1X0VA 4HQ6A 1T6NA 5EWJB 1DCTA 1GRRA 4R9NA 4ASUA 1SUEA 2PVSA 3VOAA 1CR0A 2OV8A 4OH1A 5K6AA 2ZCVA 5HKAA 5FEUA 1GNVA 3IVXA 5ANRB 2AKAB 1D9ZA 2QY6A 4Z2YA 5U1PA 3NKVA 2PVCA 3SX4A 2WU3A 2ZAMA 4M7RA 1TF7A 4KDEA 2HHJA 2VJDA 3PKZA 8ATCA 5JMWA 4GMXA 4W5TA 3FPSA 3OMXA 4RX1A 2RHGB 5LZ5A 4B5KA 4LOAA 2PLNA 2VNJA 3F8WA 5KJFA 4I55A 5D8DA 4OJMX 5CB4A 4QWWA 3L01A 2WHYA 2XTAA 3KB6A 4GXNA 2PZGA 4JNCA 4EFDA 2K87A 4EM6A 2IUEA 3RS5A 3WL3A 1JQ5A 2ONKA 4P81A 4U2EA 1V16A 2O6HA 2P67A 4AB1A 1FXUA 2ZFUA 5J2UF 3H9QA 3V2GA 4HNGA 3A27A 3DO8A 3HO8A 4TT3A 1I2CA 1YE5A 1TRHA 2IXTA 2XF8A 4F86A 5LMUB 4B87A 1XD2B 3ZNOA 2OHVA 5EKTA 2A35A 2WWVD 3UV3A 1PNTA 3C3WA 4GWKA 4H16A 4C3ZA 3MJSA 3R5TA 1VPDA 3L1UA 4CQNA 2DQYA 3L0BA 4QQRA 1DX4A 3T0FA 4LJ9A 4EQ6B 1G2PA 2PH1A 4QVKA 3IQEA 1QV9A 5DN6D 1CVLA 1SKBA 3FMFA 3UJAA 2C84A 3PEUA 1T2AA 2JLSA 3EULA 2GBFA 4LVUA 2JGRA 2QMYA 4WFJA 4ZVRA 4G0OA 3WFZA 2YZKA 4MR7B 1GQFA 1HI9A 4ANFA 3GJYA 4DW8A 4KQEA 1ESDA 4CV2A 4FKZA 1KQGA 4NCAA 4NABA 4ER5A 4HEJA 1IRXA 2RSLA 2FEPA 3FAKA 2RHCA 2QLJA 1X1CA 2VZ0A 1RM4A 4OI1A 1UMBB 4MX8A 1K2VN 1BVHA 1E1LA 3M81A 4LBWA 5EE0A 4GFDA 1IOVA 4Y2VA 1S0UA 2WJZB 4MRAA 4YP0A 4BBJA 1ENPA 2BEUA 3A31A 3JQAB 3MMXA 3KQMA 3MB8A 2IVFA 4N01A 1X7YB 1E77A 2ZIWB 1NI4A 1TMGE 3STUA 2GARA 3H4MA 5H9WA 2V0NA 1XMVA 3VC3A 2B1RA 2D1YA 2HK6A 4N8DA 2AYXA 1EAMA 1PK8A 3F46A 3GOQA 4JJ6A 2C92A 2JEOA 3F7MA 4KYIB 4MLPA 4INAA 1CF2O 3FYTA 2IU6A 5BUQA 2GFHA 3QU4A 2F1OA 3DQZA 3QBVA 4M0EA 4MVWA 1AHHA 4Y1GA 4Y9TA 3NOVA 5ALRA 5THKA 4BLVA 1EGAA 4P4GA 1VLQA 4MW0A 2ZIAA 2C9BA 4Q6WA 5D85A 2FN8A 1DDIA 3J7TA 3OLXA 4TKZA 1RYDA 4H7PA 5K8VA 1QF6A 3L7KA 1RBQA 1KSHA 3IVAA 5CXUA 2NU9B 3UJ6A 2O0JA 3UQYS 2PZFA 3UXMA 1OTYA 3SNHA 3JQ9A 4P4SB 4IGKA 2N75A 1MOPA 2B3TA 2JFYA 4C07A 3DKKA 2AF4C 3ZBUA 1WZNA 2OLJA 7MHTA 1E7MA 3IVCA 4I66A 3SR0A 3USCS 5KQRA 3MYRA 3TM4A 2WSSD 1DPGA 1LNQA 1ORRA 1ZHFA 4LBZA 4OGLA 1HNXB 3CRQA 1XG5A 1REQA 3C6KA 3K9QO 3R5XA 3E05A 4L16A 3HWSA 1ENOA 3GVXA 1XRQA 2I4NA 3B1VA 1AKEA 1SPXA 1SHKA 1UZMA 3IPLA 3PNSA 1PGNA 2NAFA 4GSLA 4YV7A 3KQVA 2AK3A 3FCSB 4BVKA 3K9WA 1CDZA 4QUGA 4CMEA 4Q9KA 2FHPA 2X22A 4K1LA 3LUKA 4XSGA 3FJOA 3VNBA 2IZ0A 3EQ7A 2H63A 4WY2A 3RBVA 4CU5A 3MINA 1N77A 4HT3B 1NASA 1V1MB 2FVYA 2F64A 3HYTA 3LDHA 1T15A 3OZRA 1L7VC 2YJNA 4C0JA 4FZJA 4EFMA 3QF4A 1NMZA 1DNPA 2D13A 2CZCA 2IKSA 2CK3A 5HCNA 4EAQA 1T9HA 3DLBA 1XTJA 4WXMA 3WV5A 3ER6A 3R76A 1E98A 3ESRA 3TNDA 4D3YA 3LCUA 5JROA 2W43A 3IYLW 4RA6A 2XGJA 2F3TA 5EEGA 1T9CA 4HY3A 1QG2A 3M4YA 1TGVA 1GADO 1MVLA 2OO7A 2W2QA 5GP1A 4LOIA 1ZOLA 1BRTA 3QOFA 1IOWA 4JLNA 4DNFA 1MD9A 3PUYA 2B34A 2IYOA 2QPAA 2O5RA 4X95A 3FHOA 2OQVA 4AWAA 1YU9A 4CM3A 4HC4A 4L95C 2IBSA 2G17A 2BMWA 1MX1A 5F2KA 4R01A 4FHEA 3N70A 4MINA 1S4QA 2HEGA 8GPBA 3E9DA 2JAUA 1JEQB 3AL3A 5ARCA 4N7JA 4M9SA 5JSQA 1NXVA 2I1VB 3TM5A 1YAHA 2YHSA 3GARA 2J7PD 1QP7A 2CF5A 3VDXA 2C2ZA 1Z4MA 3LECA 1YU6A 2Q62A 3QKUA 4M1WA 5DKFA 5LZ2A 4HXEB 1QSGA 4D6YA 4ZO6A 4EG7A 4PSDA 5J1TB 3R8CA 4RGVA 5ICEA 5LMNB 4UHFA 2VUSA 3AHCA 2AUNA 4HUQA 5DBFA 2OCLA 4RPJA 3KKEA 2Q2VA 5BW5A 2ODQA 2G40A 1N6NA 2ID9A 1RXWA 3LW8A 3V7FA 2ZUBA 3DB2A 4P5DA 5GOZA 4UTNA 1XKTA 3M1LA 5B2EA 3LGSA 2YJ6A 3H42B 5JFTA 4F3CA 1P9RA 4CLDA 1NT4A 3ENZA 2XUIA 3HB4X 4AJHA 1YZFA 2Z08A 2OGZA 4TL9A 1AURA 1VSVA 3VZDA 3L5KA 4W1PA 1K3TA 3R4VA 1GT6A 2CYBA 3QGMA 4XFKA 5ILQA 3TH5A 3TTVA 1LX7A 1EVQA 2ISSD 5ALIA 1Z0DA 3RC9A 3TCKA 5BURA 3NHPA 1UQTA 2O2JA 1P1CA 1NZFA 1HT3A 1XYVA 3GAZA 1C3LA 4CT5A 4BCDA 1G18A 4GGMX 1X7ZB 4KLZA 4V0RA 3BDAA 1NXOA 1X1EA 3AGPA 1P29A 2RCNA 2WIDA 4JBLA 4B82A 3NOOA 2PA0A 4I1UA 1GUDA 3BB4A 4QQ8A 1CIJA 1UZUA 4HYEA 4U0JA 5IZCA 4NMLA 6LDHA 3R75A 3P2YA 1II8B 1A3CA 1TYZA 1U98A 2M6RA 3H9UA 4TZKA 5K51A 4C5CA 3H0KA 4NV3A 1NVKA 4CU2A 2P6RA 5AUNB 1PG5A 1YFKA 3HZHA 2XD4A 1ID1A 5DN6A 4JMPA 4ZANA 2Y0EA 3TJZA 1RQPA 1PNRA 3WMGA 3EPKA 1B2RA 2IT1A 3V1YA 4EPTA 5DNUA 4K2HA 5FX2A 2Z3WA 4BZWA 1RMTA 4D7AA 4Y67A 4JLJA 3QMVA 2JVIA 3AI2A 5AOBA 3LY5A 2PJRA 3R5KA 1BX0A 5KIAA 4DKJA 1E5XA 4BO8A 1Y6JA 2I3GA 1NVVQ 2UUPA 4DC0A 1RM0A 3KWMA 1J0CA 1QFXA 3OT1B 3QVTA 4PU0A 5BV1A 3G8YA 3ZDZB 3G8AA 3TW0A 3AETA 5AHRA 1XTUA 1V43A 4RF3A 4JH0A 2XMSA 2JI7A 5NULA 3F5QA 1KVUA 4AN1A 1NM5A 1BCRA 2NTJA 3G0BA 4PWZA 2N9UA 1BS1A 4MKFA 2JLZA 1QE5A 1WDMA 5LBUA 2JW5A 4ZO4A 4OSOA 4AKEA 5J2TA 3HI4A 4AN4A 5L45A 1KGDA 2LDXA 3DF9A 1JIVA 4MZXA 5G1NA 3N2GA 2HGSA 1GQ2A 2ZBQA 1YRQA 2ZVDA 1GR0A 1B00A 2BMFA 2DHQA 4LCBA 2ONZA 3L4EA 3SXUB 4U7DA 1ODJA 2QT0A 5LPNA 1KZ6A 5AXCA 1SXJA 3FDIA 1N2JA 2NV0A 2BM8A 2J45A 2P2NA 5CIYA 3EASA 1NLYA 1UQUA 4PYOA 4ZU1X 1F51E 3DVAB 4JYPA 1C4XA 4MUMA 4ZQFA 2Q28A 3BIOA 3JYQA 3RAJA 1WRBA 3E9RA 2NM0A 2WFLA 3DW3X 4II3A 4RA9A 4U63A 3TEFA 1BFDA 2C5BA 5JRDS 4ZPJA 3KWJA 3KEOA 4RHTA 4BO5A 2YWEA 4LQ4A 3LUGA 3VJKA 1UEIA 1IONA 1V11B 2ACVA 1FRZA 3A1VA 3VSCA 4D8VA 1VG8A 3PZBA 4J1QA 2GCEA 5CVVA 1E3EA 3WGJA 2OO3A 2IZ5A 4AY5A 3CCFA 4OHCA 2JLUA 1QZXA 3P4XA 3COPA 4LZLA 4EI9A 4NMWA 2NX2A 2VP4A 4CKCA 2C31A 1G66A 5H16A 4JX9A 4EJSC 1JZSA 1G21E 1KY4A 5EIWA 1K7FB 3LOUA 1UEXC 3V6MA 3ZDBA 5ESDA 3E23A 4G0NA 2QTMA 3NYIA 1PW7A 3NFRA 1QIHA 3MJTA 3A3PA 1SUAA 3UUFA 5AVWA 4E94A 3DOIA 1SQ6A 3UK2A 3WLRA 1VCIA 2I6TA 1XF1A 2ZREA 1T2DA 3N76A 1ZVMA 4PCLA 2XDYA 5JXIA 1UT6A 4CQMA 1SHTX 5A6VA 5B3JA 2ZGVA 4C7VA 2FPLA 3MUOA 4W8OA 5KI6A 5IJWA 1E1NA 3BL6A 2WFZA 1K92A 1OGIA 5F5NA 3Q5DA 1ZMOA 4K6CA 1WZIA 4P22A 4D5EA 2BH2A 4ZYUA 3W7BA 2ZJ1A 4QQNA 3M6MD 3RI3A 5DOVA 4KIFA 4A10A 1YBAA 2FR8C 2PEZA 2I65A 2VWQA 4MRMB 4RLHA 3AV3A 3LQ4A 4AUMA 3A1NA 5BT9A 1NBWB 3KZ1E 3QKRB 4CN9A 4QBGB 4BAUA 3M5CA 1Y0BA 5EIAA 4ZIRB 1VDMA 2XBLA 4EB3A 2KSQA 3IDAA 5AI6A 5G4LA 3MA0A 3CWCA 4RV5A 3ETHA 3AKYA 2JGDA 3AR5A 1K1EA 2QRJA 1Q50A 3AFMA 3HCCA 2OHFA 3VYTB 4YMVA 4HX5A 2PMDA 2DKFA 1IN7A 1P2FA 2YV5A 3BWCA 4YR9A 3EEYA 4B83A 1J22A 1F7VA 1ECCA 1ZSNA 2AC4A 3C5EA 1K06A 2CNBA 5HCUA 1THZA 1H05A 1RLTA 1VIVA 2ADMA 3ICVA 3O9VA 1SZPA 1Z83A 2OHJA 5JNWA 5MGBA 4PANA 3TLZA 5A1TA 1S2NA 4JODA 1T2VA 2XPCA 1Y3DE 2XIJA 1UWKA 3Q1KA 5AJWA 3V1LA 5FOQA 1BW9A 1DBRA 2DPLA 3OZDA 5ABPA 3N8HA 4BX2A 2J31A 4DY4A 3UUGA 3IC5A 2HW8A 2QTFA 1FP7A 3Q7PA 2FQ1A 1CY0A 4D0SA 1J1ZA 2PM8A 1KAEA 3WYFA 5FI3A 4DXAA 1K8XB 2VS1A 2O2DA 2W2KB 4MR7A 2PVPA 5IAGA 2AN5A 1MQ8B 4ZVQA 4PLPA 3SYNA 3RJ9A 4IO0A 1GZUA 1N1GA 3M6UA 1MGOA 2V1UA 3H0CA 3SJZA 1BQ4A 1N8TA 1SVOA 2Y76A 2DHCA 5DXFA 3O4IA 3WNDA 2A0WA 3WK7A 1X39A 2ZE7A 4LXIA 2OY0A 1N2IA 4LF6B 4I0WB 3A11A 5LB4A 4AY3A 4F4CA 4MVJF 2Z6UA 1IHUA 1KS9A 5EZSA 2EZ4A 1VRVA 3GIWA 4H1WA 1GZDA 1ZI8A 1MTOA 1JN0A 2PGIA 1M67A 4JR2A 4P7BA 3TTUA 2WIJA 1I01A 1E62A 1U3WA 3A1WA 3CEJA 3IBFA 3PQ6A 1ELOA 3KYBA 3RVJA 1OCEA 2QZZA 5C3UA 7REQA 4MI1A 4N3GA 2JLBA 4Q7EA 2Y0CA 4K1XA 4EA9A 3EIXA 1WV1A 3P19A 4KQ2A 2YWHA 3V1UA 3UT0A 3B53X 4WBNF 2J3HA 3GZNA 1D2NA 3P5SA 4YRMA 4HXGA 1AXEA 5KYUA 1WS6A 5K01A 3RD5A 4BQFA 4DNQA 1XHFA 5IF3A 1JJVA 4U6NA 2HNAA 2Q6OA 3MTBA 4RV9A 1EWYA 3OKPA 3ZPXA 1XDDA 2FQWA 4Z1MA 4F3RA 1KZ7B 1RHJA 1TD1A 4IJQA 4LF4B 3AUFA 1E1QA 2HN9A 1L1RA 4AKTA 4DLVA 5J2UA 5KMGB 3BSWA 3N3AC 1GLNA 2IHZA 2I2WA 3BS4A 4U3JA 4DIMA 4G1VA 4XIIA 2AEEA 4Q3BA 1QDLB 3E58A 5LP6A 3MM4A 1TUIA 4B6SA 2WD7A 4I7EA 1TW3A 4YMWA 3CF6R 3HS3A 2Q9AA 1BXKA 2VIIA 4UVIA 1I5OA 4OQEA 4AM8A 2DBQA 1YR1A 1BMTA 3LNCA 3ZWVA 1ULZA 4KBGA 4CF3A 1BMFD 1O9GA 1OZFA 4QYSA 2UUAB 1ZMBA 4JKYA 2HR1A 5D86A 1LDNA 4TLCA 2G6BA 3NJRA 3RJZA 4GLLA 4MPJA 4NESA 4YGXB 5C8YA 1SXGA 3LUCA 4UBKA 3MRTA 4K81B 3C7KA 3GFRA 4HS9A 1J07A 4RFVA 4TLEA 2DTXA 3U4CA 1G2OA 3ECCA 1APBA 2FZWA 5C1IA 3BXGA 3ZUPA 4CMKA 3OZVA 4DEVA 2GAOA 3BDIA 4P82A 1FP4A 1JR3A 3WIOA 3LRXA 1RPJA 4PIVA 4F7WA 4F1KA 4TRNA 4B46A 1KJYA 4WCFC 5B3LA 1RRVA 1HLGA 1SUDA 2XT6A 3AEYA 2IBTA 4NPHA 5LQSA 1ZD5A 1QYWA 4ZCPA 2BFFB 2DFVA 3NX4A 3T9BA 1HEYA 1E96A 4WL0A 3O2SB 5DLDA 521PA 1HF3A 5JAZA 3S1AB 1YZHA 1Q7CA 3SC2B 3AR6A 3DHYA 5ES3A 4LE1A 3DV0A 1HRDA 2WC1A 3IJEB 3L4BC 4ZVUA 3K0KA 2AW3A 2I0FA 2XUQA 2QRQA 2PRZA 3MGCA 5EPOA 5TVKA 4OQLA 3HU5A 4CTOA 4KXNA 5KSWB 3GUVA 2ZJOA 4WSOA 5CBPB 4IWNA 4LQLA 1IG3A 5DT9A 2V3WA 3RYFA 2R8YA 1AMOA 2AUTA 2PE5A 5DHFA 3QPVA 3CW9A 4CM9A 2G1PA 4PSKA 3R6WA 2GF9A 1P75A 4IMIB 4Q1AA 4V24A 2NWQA 3H1TA 5KCZA 1P4GA 2FMKA 1Z8FA 3Q2IA 5LQDA 3NKLA 5EJ2A 3IELA 2I4IA 1DXHA 1TA0A 1PYGA 2UV8A 4YJ3B 3ELYA 3IXLA 4YEDA 5B58T 3EBPA 3VKUA 2YN2A 4RKQA 1QXSA 2QZSA 2ZCJA 1ULBA 4QUKA 3UG7A 1RC1A 4FZRA 5IJXA 2WTAA 1PRYA 5DW0A 4B8ZA 3RVLA 3UJPA 4AKIA 1L1EA 4U2KA 1Q0QA 1RVDA 4MGKR 5F1KA 1MDBA 4OF4A 1JG1A 3K8OE 2HBZA 1U04A 1XROA 2YQ4A 1NG1A 5IJ0B 1KY3A 3N6VA 4DNOA 1H4TA 5FUMA 2WJ4A 1DZIA 3GO4A 3QTLA 4OI2A 4XYBA 4JI5B 3EF0A 4WCFA 1H6CA 1PFYA 3COSA 1U81A 2A30A 2AD5A 4P7KA 1B26A 2WHRA 3K92A 4M0CA 4X44A 1W9MA 3I42A 4TXJA 3P94A 4BLQA 2HU8A 2BE7A 1NN1A 4PGMA 4QOJA 4J0DA 3IR7A 1EXWA 1C4WA 1EA5A 4PZAA 3IB3A 3GLFE 3OM9A 4URZR 1RYHA 2PR2A 4XYLA 1TEXA 3D0KA 4GZMA 1FJXA 2DE0X 1H1LA 3WRWA 4HV4A 3FMOB 3LQRA 3V33A 5KTRA 5FBRB 2QVBA 3LP6A 3TL2A 3ZXXA 4IH4A 4BIIA 4AJEA 1Z8HA 5BQFA 1RR6A 5GZ1A 5A0TA 3GRCA 1U0LA 2Q5EA 3ANXA 3D2BA 1KYYA 2PSJA 5HUQA 2BBWA 2ORVA 3DEIA 1MU0A 2IODA 3DG9A 2PQ0A 2RIPA 3FKSD 4U8HA 1QTNA 4DBLC 2O0KA 4HQOA 1FYWA 2QM8A 5LDHA 3DBLA 4OV6B 3LT1A 4HDNA 2ZRFA 4JI0B 1XLVA 4JELA 2O1WA 1ANKA 1E6KA 1X1AA 1Q0TA 3T1VA 3E9QA 1WA5A 2A14A 4Q3KA 4X71A 1S96A 2IOFK 4TZ0A 4C2UA 4PZUA 1E1QD 1R15A 2IELA 3K9LA 1JKJB 2W5UA 3PDUA 5D51S 1MAWA 4XAQA 1QQ7A 3VDQA 4CR6A 3FOAA 2X15A 3WDMA 1KWKA 2BR5A 5F77A 3D3WB 3JXEA 5YASA 4IDHA 4KNYA 1OLUA 3FTPA 4YDQA 3QE9Y 2GZHA 4Z5XA 2E4ZA 1FU8A 3BRQA 4QRDA 1GG2A 4XYGA 4F6LA 5IRCD 4MKXA 4G89A 1V3TA 2VR1A 3MINB 1L5RA 4PN3A 4XD7A 3WIBA 2HDHA 5E95A 5IKPA 4GI5A 4MKRA 3TKYA 1YR8A 3VZRA 5KKNB 4LK3A 2ZUVA 4AROA 3B9BA 5K4HA 3ICQB 3FD8A 4RK0A 4R2MA 5JZSA 4D9FA 1DV2A 2E82A 4KDCA 4YALA 5H70A 2PL1A 1V1JA 2Q0XA 1D1TA 1YDFA 1SQFA 3I23A 3SQDA 3ZWOA 2G36A 2I78A 1PFUA 2IXEA 5NLLA 2GERA 4WDRA 4IXDA 3LCRA 5B30A 2JFVA 1G4UR 2V4MA 4X6YA 4KAFA 1WIWA 3RTDA 1YIDA 3VPFA 3MF4A 1AQIA 2V9ZA 1F8XA 3IBGA 4GOOD 1PZGA 5ALQA 2P75A 4V0SA 2VHXA 1CY8A 2J59A 2VQSA 1RXYA 3PEEA 2WJJA 1XKLA 4NPAA 2NAPA 4BFXA 5JZ9A 4PX3A 1HOTA 3RSCA 4X8LA 1TIKA 1H9AA 3H2KA 4V0NA 2G5TA 1IJKA 1IG0A 3O1LA 4KOAA 2LIVA 3RB8A 1YB6A 3T52A 5JCPA 1VI5A 3GL9A 1Z38A 4YNBA 3JSAA 3N2GB 1WAMA 4IHKA 2ZPTX 1Z34A 1U3DA 2WAAA 3I5AA 4ZMRA 1OB5A 1E1MA 4NRDA 2J67A 1QVZA 4ETIA 3TECE 2D00A 2AB0A 2H4WA 2QMEA 3TNJA 2QJRA 2C8VA 3IQZA 1XWFA 4WFKA 4BQPA 3I9JA 1U94A 4DNXA 4DHWA 2VYFA 3O03A 3DQQA 3Q3CA 3DMPA 4FHGA 4LHSA 3FF1A 3KEGA 4R2KA 5EKXA 5TMEA 3TI9A 4AF8A 5ALWA 4RVFA 2Z2XA 3LRTA 3MD9A 4W1SA 3PB3A 1VMIA 3HSSA 3PQ8A 4ZCMA 2HZ7A 3SDBA 3IEPA 1Z22A 3ZIAD 2XA2A 1DV1A 1I1OA 3M1IA 3O73A 4HWRA 4EW1A 5JEEA 3AVPA 1SVSA 1K8QA 1KDZA 5C1PA 3EQ6A 1UWCA 3C4VA 5AVQA 5I48A 2DSTA 4I50B 2QP4A 3KL4A 2GJ4A 1MH1A 3SSMA 5A3QA 1K5DA 3K8YA 3T9CA 3GLSA 3MELA 1E2GA 2W2KA 3U9TA 3TDNA 4EL0A 1AS0A 3PHBE 2NSYA 4DR4B 1VMEA 3PGMA 3IUMA 3E3NA 4FFLA 3F5SA 2C2KA 2ZVPX 3WO1A 1C30A 5K3FA 5SY6A 3RIYA 5IT0A 1C0IA 4RZUA 4JLUA 2IXBA 1LDYA 5EJ9A 1SUBA 2A5JA 2FPMA 3JZIA 2CVZA 4O0LA 3SR4A 3WGVA 2BMAA 2BDTA 2OFFA 4M9UA 4P08A 4ALKA 2BRUA 4C7KA 1FW6A 4GBMA 1XDWA 2H85A 1PWXA 4Z0PA 1IMJA 1ISMA 4CETA 4FR2A 5KJ6A 1ES9A 3E3OA 4O08A 2MINB 5KWEA 5FNVA 3T3MB 3LBAA 3CR7A 3IUPA 3KQYA 4PFKA 5ILOA 3TG8A 4IDDA 5M04A 3NPAA 4AG5A 2XBMA 4HWGA 4J03A 3BCSA 3C1UA 4G86A 4QU0A 2VNAA 1JWLA 1WABA 1N6IA 1ZUNB 3I6BA 3QHQA 2C4HA 3LCCA 4TS9A 2VYCA 4L5YA 2Z2KA 5TQ0A 2IDZA 3W06A 5HXAA 3R5SA 4UXHA 4INPA 2VKQA 3MRSA 4G5GA 4JQZA 4ESVA 5KNDH 3TBHA 2CLIB 3ABIA 4D0NA 3PNBA 4TS4A 4UPDA 1PJ3A 1MF7A 2EIXA 4L5JA 2B5WA 3RASA 3U62A 4C89A 2JFGA 2ZPAA 1F2TA 1AA6A 1K75A 5HKKA 3RYHB 1ZGAA 4KH0A 3HBFA 1IXRC 2PKWA 4JFAA 2WV9A 3K1YA 4F4JA 1ZP6A 2IXDA 1Z39A 3BDVA 4WKNA 5K20A 5HFJA 3LOPA 2QP3A 1U8FO 1QHHB 1IPEA 1JLMA 1ONNA 4FI3F 5A4KA 1QRSA 2E87A 2OFWA 4UATA 1J2UA 1TYCA 4EYGA 2CJFA 3P0IA 3WHLA 1AQUA 5CLHA 3OZIA 3UAWA 3E3AA 4NFLA 2CDNA 4K9PA 1R3DA 3OX1A 3M6AA 5KQGA 5LVAA 4HNSA 3BCUA 4HNAB 1B93A 2XNHA 2COEA 3JAKB 3PC3A 5DP2A 2V4ZA 2NZ2A 5J47A 5LZ4A 3USZA 3U61B 1E9SA 1GPAA 1EX9A 2YZMA 2FTKE 4OHYA 4G1BA 4EG8A 1KSFX 5IVPA 1RTTA 5EWMB 1G16A 2Z6AA 3FYDA 2A0YA 3QU5A 2F1RA 1ZIXA 2B4YA 3GJ7A 4KOEC 3PE3A 3O84A 2QMQA 5TJHA 4FJ1A 4ZU6X 3F90A 4Q37A 3NASA 1JTVA 5I7RA 5F2EA 3R3ZA 5KBYA 1F6WA 3OCYA 4AG3A 4ZDIA 3V3TA 4H9GA 1IUNA 5HQJA 1IVYA 2HMAA 4UNSA 5ESWA 3BIFA 2O2IA 4MGZR 1TM7E 3QF7A 1SBZA 4G5FA 1ZIPA 5JIBA 3DDWA 5JDIA 4QD3A 3DNPA 1Z2CA 3EMKA 1AQLA 2Q3LA 2Q99A 2QQ0A 1KXJA 5DNWA 5JHHB 1EUYA 4RPGA 1SB8A 5AJZA 2PWPA 5AOVA 2EJCA 4GKKB 4GHWA 1DRKA 1ISPA 2F3QA 2EGHA 4AJLA 1Y1RA 4TWBA 2DFDA 5JW6A 1Y3HA 1CUSA 3DZJA 3FUTA 3I2JA 2QTRA 1KH3A 4BMDA 1YB7A 3T06B 4G5RA 4K6GA 3B9PA 3V8VA 3SYKA 4DLYA 2V96A 4F6CA 1N34B 2P11A 1JIUA 3OCCA 4A23A 4RJIA 5CEJA 3PXGA 2ZIXB 4DQKA 5BN4A 2XDAA 2XUHA 2VDJA 3B1YA 1Q20A 2VH1A 4AWXA 3QSGA 4NV0A 3RADC 1JHRA 3EC7A 3QMPA 1QOZA 1NVGA 4K7JA 4UDYX 3DLIA 1DOZA 1QV6A 3GROA 3PIDA 4NBNA 3S2UA 1DAOA 3SIPA 2O52A 4ZCRA 1OASA 4LXXA 4DIFA 4ED9A 1IAVA 5IU6A 3CF4G 1SULA 1I13A 1CE8A 2J0EA 2MSKA 3N86A 1YQXA 4MR9A 4PICA 4QTUB 3DZKA 3WLTA 4ZVSA 2RI1A 1V1RB 5AVUA 1UK6A 3HJRA 4ZVVA 4PRZA 4L3OA 4HDSB 1ZUNA 2B94A 3VO1A 3HBNA 2V7WA 4OJYA 1GPBA 1RYNA 1XJCA 1A8SA 2R4TA 3DULA 4O59O 2JGMA 5K0FA 4WZBB 3VSBA 1OFVA 5AHKA 3O8BA 1SBTA 1M2VA 1BWRA 3H19A 4QFMA 3OO1A 1JSXA 1XCLA 5EZYA 3CUVA 3B9QA 3HP1A 3VR2A 2AUMA 4B7AA 3HU2A 3UOGA 1QGOA 5IDWA 2I3BA 5T3YA 2EG9A 1O5OA 1GTSA 3B7GA 3EXEB 4PG6A 5A5VA 3QLTA 1DAMA 1ZQ9A 5KYKA 2Y77A 3D59A 3EZ6A 4PXSA 1Q12A 4ZJYA 4A6EA 4ROTA 4FYHA 4DCUA 4KWEA 4N1AA 2GEKA 4CGYA 3IUJA 4IVNA 4MGYR 4D97A 3RUAA 1S8NA 3EW7A 1YI0A 5EMMA 4D96A 5B6PA 2JHAA 4RBNA 1CF4A 3X0DA 4TUYB 2AJ8A 1H2RS 3HUEA 3GJ4A 3T7JA 3T1QA 4RZIA 3HE3A 4MI6A 3X1YA 5KOIA 2W6JA 3U9LA 4C0HA 2OHOA 4BNIA 1NUTA 4AS2A 3F6YA 3FNBA 3K9BA 4O2AF 1L7EA 2GGSA 2WOJA 3HUDA 1JMVA 1TZKA 4I9FA 3OQ6A 1QMPA 3WGOA 4JQSA 1VQ1A 3DEAA 1SC1A 1SCJA 3DPSA 4B3DA 3Q0IA 4HVLA 3LA8A 4BNJA 2VK8A 4XH9B 1ZINA 3IT0A 2I2XB 3N58A 3FPLA 4RVNA 3L8FA 3W5JA 2ASEA 2FI1A 2JJQA 5EERA 3BEOA 1GKIA 3DJFA 3I9KA 4FGLA 1UBFA 4P2BA 1YE8A 1ETUA 3EJWA 4R8RA 4E31A 1PLKA 1YTUA 4FYYA 2E1RA 4UC0A 4D9KA 5L4NA 3C6QA 2ZR7A 3ZGVA 4V1CI 1I4OA 5C5DA 1YVPA 3KB2A 4QG7A 3GEEA 3KJXA 2ZSEA 3D8UA 4P0QB 1KK0A 5BN5B 3OG9A 2VYVD 3PDWA 5JAIA 4IMRA 5ES4B 1EFCA 4UU0A 2DEUA 2O2EA 5CLIA 3HGTA 2J1LA 3C1TA 2QD3A 4DAOA 5IAOA 4MLCA 2C0CA 1YDHA 2VTEA 3FTEA 4WNCA 4KLCA 3I64A 1VJGA 3UF0A 4EW3A 5ADVA 5LP6B 2QXYA 5A0VA 2UZAA 5AW1A 4J49A 2D0IA 5LQRA 3QY9A 4EHLA 1LI7A 2ZATA 3IUBA 3OJCA 4TZ6A 2PUFA 2V1XA 3ONNA 1GGVA 1RRMA 2H57A 3QEJA 2VT7A 3L8CA 3TIGA 5CAEA 3DWGA 2F3PA 2K5UA 4GR4A 2BGWA 4F4IA 3EEFA 3QU2A 2JKZA 3RDPA 1Y7IA 4GVXA 2C3YA 2WR8A 1S89A 2W7TA 3UNXA 1YRWA 3HFJA 1Y4UA 1O4WA 1NP3A 3KE8A 5CDFA 1ZXBA 3FPBA 4MW1A 4L7QA 1PJQA 4TKUA 4WBSA 4PC1A 3H2ZA 5CLGA 1UMKA 2WKRA 1MOSA 1RC8A 3FSJX 1OV6A 1PFGA 1SNYA 4FD3A 4WGGA 1PR4A 5E7JA 4NX2A 2O9JA 3OTQA 4O1HA 4XFDA 4NJMB 4F2HA 5K45A 2IV7A 4GYWA 3JR7A 4IRXA 4K9OA 3GDWA 3QK7A 2Y1DA 2JLRA 4J1NA 5AHOA 5IAJA 5I7OA 2P9GA 1K5HA 5FWXA 2HRCA 3PRHA 3NVDA 4RKWA 1J8YF 2AG0A 1YZGA 4M7WA 1WG8A 5I7VA 4EBBA 4QDTA 4Y1EA 1I9CA 3O1IC 5CHYA 4ENRA 5BUCA 4M1EA 2XOKD 4QOFA 3WWZA 1JKJA 2GRUA 3O3NB 4JR0A 4OQQA 3NTQA 2EJBA 2L19A 3M5PA 1TM4E 2W00A 1P91A 2X0KA 4AY6A 2ZI7A 1NFQA 3IP5A 4GMDA 1GCOA 5F2OA 1L7QA 3RFVA 1IZ0A 3L6BA 5FTLA 1KZHA 4NDZA 1KC1A 1JV2B 1EDEA 1JZTA 1T2UA 2SKEA 4CM6A 4Z4IA 5IJ9B 3HCWA 5TPWB 5IKXA 3ILYA 1NMSA 1GITA 1ODIA 4KPUB 5SZHB 1WPRA 3FPAA 2ZUDA 3UBMA 4E5MA 4IOLA 4XXHA 4MW9A 2O07A 3T0GA 2ZRNA 4TQAA 4BJHB 3BFXA 3GK3A 3QV2A 1I2MA 1LLDA 3KKQA 1Y8QB 2CUKA 2ZBRA 3VRHA 3QLUA 4B6QA 1NI4B 3BK7A 4XPIA 1M75A 4RF5A 4AG6A 1UBKS 1A9XB 4PWYA 4ZRMA 3OESA 2IE0A 4GQIA 4BB0A 5E6UB 3HJAA 4DM7A 4MAAA 1C3XA 1IXKA 1J7JA 3P26A 1HL3A 3LFUA 1RZRA 1BMQA 1J56A 3R5JA 3GJ5A 2B2CA 3T9EA 4D44A 4JYZA 1NVEA 2ZYSA 2DPHA 5JVDA 4R1QA 2AR9A 1IBLB 4IP0A 1ZPDA 2A9PA 4HWTA 3HU3A 3DMDA 3RAEC 3R8XA 1KY2A 2QYOA 2J9ZB 2ZSBA 1RXIA 5F9HA 4JIGA 2XDWA 4GLBA 2BF7A 4ZKEA 5HM8A 3IE1A 2B1QA 3J81A 4FDAA 1FP2A 4F85A 5J43A 1KEKA 1YBHA 2A1UA 3H2GA 1QZUA 2EHJA 5FPHA 5BR1A 1FX1A 4P7GA 5IJAA 5BWNA 4LTMA 3GJTA 4EPWA 3GNLA 1CRZA 1UOQA 1R4MB 2CVHA 1Y4AE 2Y1LA 3ZDFA 1T0UA 5AVRA 1I2BA 2Z2JA 3DWFA 4FDUA 4CYMA 4A03A 1EINA 5DI3B 1O08A 2XDQA 3GVCA 1JIJA 3BMQB 2YASA 3HEMA 3SBXA 1J39A 2HRDA 2UZIR 3LL7A 4G0UA 1NUQA 1W87A 1FFBA 2E0IA 3DMTA 3MQFA 4J94A 4NNJA 5TDHA 5JNLA 2F8MA 4ZXFA 3N5KA 3AIIA 3PQFA 4OA8A 1H6BA 4WASA 4YFYA 4ARVA 2QM3A 2L0XA 3IPYA 2IQIA 2C8KA 5KAMA 2X4LA 4LDQA 1RQLA 4QJ3A 1COWD 1UFVA 3CNNA 2XZDA 3D0QA 3OLVA 3QX7A 2FLKA 2Q4RA 4Q18A 2FZCA 4CL8A 4X3CA 2AEFA 4AZSA 4L9WA 3K35A 5CH8A 5BSGA 3FNHA 5C2JB 1FNSA 5T6MA 3CZ5A 2XA9A 7YASA 3STXA 2FZKA 1XMXA 4Q01A 1ENZA 4QODA 5G1PA 1USKA 2FCRA 1KP2A 3GEDA 3MWDA 3BWXA 4I50F 1V9CA 1WVMA 4EPVA 3I4LA 4NF2A 4QLAA 4UZEA 4FPXA 4RY2A 3OEHD 4DLBA 1YR3A 4GPEA 2BSQA 1QGUB 4YDSA 3HY3A 1Z16A 2OCGA 4K0KB 2BT4A 4AMVA 1PDWA 2I3DA 1DSSG 1JEOA 1NURA 2VDPB 2G6TA 2ZB4A 4N3AA 4WCDA 2X2EA 3LSTA 1USVA 3A4MA 1V8ZA 3GJXC 3MAGA 4EARA 2CDRA 3D4IA 2BONA 4K03A 2L17A 2RGWA 4JSRA 3QEMB 3KU4A 4N41A 1I4EB 4RH3A 2ETXA 3LUDA 4YAUA 4B0PA 4HB0A 4YRFA 2FGKA 4BGVA 4CG2A 2EBHX 1WXEA 3KRTA 3NBQA 4HH4A 1YRLA 4G8DA 4I5GA 1U2QA 2IKQA 4OP2A 1NAHA 4FLFA 4FKMA 3N0RA 3RNLA 1W34A 3NWPA 3W79A 4DMHA 1RP1A 2C61A 2Y2VA 4RKYA 3BJEA 1CUXA 1DPFA 5M5BA 2C97A 2RGRA 3OZEA 3CZMA 4OGGA 1M2NA 4YMHA 3W7VA 4Z49A 3P52A 1DQPA 1U9IA 1X15A 1VIAA 3GLRA 4AKSA 1P8AA 3PD1A 2XMBA 1T5TA 3DE6X 3AG6A 1BA3A 3CZQA 2FP3A 3MJEA 1LY1A 3NFYA 4R98A 5C7IO 3KELA 4H0CA 2ID7A 4BVFA 4CF7A 1SVLA 3V6LA 1JDSA 1RAAA 2Q2WA 4ZU3A 4PRLA 4Y2TA 3LUHA 3ULKA 2X1HA 4J6EA 1MIHA 4Q48A 5FD8A 4KPYA 2QLTA 3ROMA 4KNVA 4NCBA 5BQXA 1QIGA 4IGFA 1AGNA 1OPXA 1J24A 2PT7A 2P78A 2PTGA 2RHOA 2VDRB 3IRVA 5KINB 1KDYA 3P9NA 1CB0A 5F33A 3DHEA 3AF4A 5DT2A 3U48A 3RC8A 4UAJA 3OEED