1PJBA

L-alanine dehydrogenase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
361
structure length
361
Chain Sequence
MEIGVPKEIKNQEFRVGLSPSSVRTLVEAGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRVGLTAIAYETVELPNRSLPLLTPMSIIAGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVPNMPGAVPWTATQALNNSTLPYVVKLANQGLKALETDDALAKGLNVQAHRLVHPAVQQVFPDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structure and substrate binding of Phormidium lapideum alanine dehydrogenase.
pubmed doi rcsb
source organism Phormidium lapideum
molecule tags Oxidoreductase
molecule keywords L-ALANINE DEHYDROGENASE
total genus 112
structure length 361
sequence length 361
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA02
1UXHA 1Q1NA 1ADFA 3TDKA 4JJGA 1TI7A 4Q9NA 1O5IA 1H9BA 2C5EA 1NWHA 1ZZEA 2B4QA 1HDYA 5ITWA 1GADO 2OO5A 4D79A 4FCCA 4XR9A 4AVYA 1ZIDA 1E7SA 1UDBA 5G0WA 5G2OA 1P77A 5TX7A 3COSA 4IDBA 1I8TA 5JCJA 3MZ0A 2NU7A 3Q1LA 3VPFA 1FJHA 2HDHA 1DJNA 2PA3A 3I23A 3UVEA 1NQAO 3DZJA 2POQX 3ROKA 3LC1O 3FRJA 1M6HA 2HRBA 4CLEA 4GX0A 4R16A 4BL5A 1ADGA 1LSJA 3ASUA 2QW8A 4BKOA 5JC8A 3IJRA 3K9QO 1T2FA 1LRLA 4FC6A 1WAMA 3RFXA 4GPD1 3FD8A 2QX7A 3JYQA 7ADHA 3ADPA 1BXZA 3WQRA 3GEGA 5DBFA 1B8PA 1HXHA 1PTJA 2VHYA 4MKZA 3AOEC 4JIGA 3ANLA 2WE7A 3NT2A 4R5MA 3JQ6A 4I5EA 4LSWA 1QYWA 3D0OA 3NAQA 2OBNA 3FSRA 4BNLA 2ZTUA 3F47A 3U9LA 1R66A 4R3NA 3Q2IA 4W9NC 2WD7B 1JKIA 1PS9A 2YFHA 4F6CA 5ILOA 1YXMA 1J5PA 4E2YA 1DIBA 1KVRA 2VT2A 1LNQA 3WTBA 1PL8A 1YQGA 1RYEA 2NSDA 4OQYA 1PIWA 3GA0A 2PGDA 3SJUA 3NTRA 4NU6A 3EVNA 1K6XA 4EITA 3MJ4A 3RUCA 1UP4A 1B0AA 4RPHA 2ZB3A 4M1QA 3ZHBA 5C7OO 4LRTB 3I3OA 1ONOA 4PG4A 1ZMOA 1A71A 3E5MA 4DREA 2OBYA 5DDIP 2OFPA 4CMGA 1A4IA 3O8QB 1F8GA 4BKQA 1UZLA 1DHRA 2FHSA 3GMSA 3CZMA 4MDHA 3PQFA 2PTGA 1X0XA 2VOEA 1MGOA 1WZEA 3I52A 3BMCB 4LRSB 3TN7A 4E4YA 4JN6B 1XU9A 3RUDA 1WXDA 3IJPA 4NJOA 4KTTE 1J4AA 3AI2A 1GY8A 4E32A 3VH2A 2X86A 4ZGWA 2R2GA 3DBLB 4IMRA 4MPDA 2DAPA 3ZWWA 5JFOA 4CQMD 3BA1A 1W0CA 1E7QA 1DB3A 3DAGA 3AU8A 3WYCA 4W7IA 4GWKA 1AGNA 4WNCA 4WEOA 1WZIA 5A06A 4RVDA 5H83A 3VKUA 4L74A 1MX3A 4K28A 4J91A 4UVEA 4YCAA 5IZCA 3HQ4O 2CVZA 4WKGA 1DPGA 1SZJG 3I6QA 3FWNA 1ZXBA 3TL3A 2C2XA 2QYTA 2DKNA 6LDHA 4MVJI 1JW9B 1Q7GA 4RLHA 4YVFA 4NNJA 2GN9A 4FFNA 3WG9A 1QP8A 3K2EA 3WWYA 3GY0A 3B6ZA 4U7WA 4IDDA 5BNIA 4DRYA 1I2ZA 3B1JA 2X4GA 1MXFA 3NV9A 4F45A 1WW8A 3L4BA 2ZJ0A 3V8BA 3ZV4A 1O0SA 2C82A 3NX4A 2W2KA 3PDJA 3STHA 1PWZA 3H3FA 1EUDA 2VQ3A 2Y1EA 1F8FA 4CR6A 3TZKA 3VKVA 5G0UA 2HK8A 1GV1A 3WMXA 1VM6A 5FI3A 1DEHA 3IC5A 2B4RO 3EUWA 4CLHA 1HDCA 1NWCA 1YL7A 4J43A 4WCFC 1Z6ZA 4LGVA 3BMQA 5T57A 1RPNA 3GEDA 4RPGA 1LEHA 5L51A 2GSDA 3AOGA 1JDJA 1YO6A 5JNLA 3AY3A 1G0NA 3QY9A 4IMPA 1RM4A 1DC4A 5KJCA 2PZKA 2CSUA 1X1TA 1B26A 1KEUA 4KUHA 1AHIA 3PYLA 3MJTA 3U4DA 2V65A 3SX2A 3WB9A 4YT8A 3O26A 4MKXA 3RC9A 3UHAA 3KBOA 4R9RA 3RIHA 1RJWA 1WWKA 1BMDA 4TVOA 2WEKA 1KBZA 2PV7A 3WGZA 1LXCA 2V6GA 3PRJA 1IHXA 1T1RA 4IJWA 3ROPA 4BV8A 3ZNOA 1K6JA 3KOUA 4IDCA 7MDHA 1E3LA 3T7EA 1XIVA 2H1SA 4TRJA 4UULA 1FMCA 3KLMX 3ZHYA 1BGVA 2DTXA 3ZDFA 3P2OA 4WECA 1VL0A 4PLGA 1WDMA 1XQ1A 3WX0A 4XKJA 2JCXA 2OL4A 2RBEA 2YHUA 1H6AA 4WCDA 3TPCA 3KVOA 3QVWA 3L4BC 3RUFA 5BR7A 3NDJA 4GL4A 1ENZA 3FHLA 2OOSA 4RORA 3GUCA 3ZN2A 3TRIA 4FIZA 1C3VA 1C0LA 4A7PA 1NAIA 3OIFA 2CUKA 2VYNA 2DBRA 4IGEA 3U49A 3GRKA 5L40A 8ADHA 3Q6IA 4A2CA 3DZHA 1QORA 1PEDA 3JYLA 3ETEA 4JROA 3WOHA 3RBVA 5LDHA 1GR0A 1PQUA 2PD6A 3LT4A 4A5OA 2TMGA 3H5NA 4W7HA 2EJWA 2ZYGA 3KYDA 1LSSA 4RLSA 3LC2O 1NYTA 1BDMA 3WJ7A 3LLVA 1UZMA 3JQCA 1LX6A 3K5PA 4RGBA 4N18A 3WIEA 2DBZA 4FPXA 1GQ2A 1U8XX 2XXBA 2B83A 2EERA 4CMEC 1E3SA 1ZJYA 1KVUA 3WBFA 3WMWA 4Z9FA 4E5PA 1Y8RA 4W99A 4BNKA 2GPTA 1T26A 2J5RA 4CM8A 2J3KA 5JYDA 5TT1A 4BNMA 5CHEA 3GR6A 3PQDA 3PI7A 5JDCA 2IDZA 2Q1TA 2QHXA 3HN7A 4CV0A 4MKRA 4ZQBA 4DYVA 3GUYA 3OQBA 1HE4A 1UXJA 2GASA 3LZ6A 1YL6A 4OXYA 1HLDA 1QYVA 3PVZA 3LK7A 4CM6A 3HDQA 4XA8A 1VSVA 2F1KA 1GCUA 1EK6A 2BHLA 4P4GA 3TL2A 2E37A 5COQA 1O8CA 2HUNA 4RPKA 5TNXA 4ALKA 4MVJA 2WDZA 1BW9A 4OO3A 1EQUA 4WK6A 1K2WA 1ADCA 4CMIB 5IZ4A 1NX6A 2D0IA 3ROMA 2D5CA 2PK3A 4CMAA 3A1NA 1DFHA 4UUNA 4EDFA 1YS4A 1PSDA 3DHEA 3V2UA 2CMDA 2I67A 3FPCA 4CM8B 3RUAA 1WDKA 3AU9A 4CMCA 1I24A 4PG5A 5KKCA 4R5HA 4Z0TA 3ZHXA 5IFLA 1P0FA 5GMOA 4E2XA 3CPSA 3E5RA 4B3IA 3ZWXA 5JMPA 2UUOA 1R37A 2VHWA 4BNXA 4S3MA 1JN0A 4ILKA 5ICSA 4PVDA 3RCBA 1D4FA 1XU7A 5F1OA 4K6FA 4FFLA 2CVOA 1NPTO 1PR9A 3GH3A 1CQJA 5L4SA 3WGTA 3DAPA 2LDBA 5A3JA 1NQ5A 4ZQGA 2HAEA 1E6WA 4HFMA 3TJRA 4CLRA 5F1PA 1CJCA 2FPIA 4J2HA 2UDPA 2OXIA 3AJRA 3DO5A 1MLDA 3FCOA 4KDFA 5GY7A 2OHXA 3ZV6A 3I9LA 5JMWA 1SC6A 2O2YA 2PKQO 3C8MA 1Y9EA 2F00A 3PK0A 4NFHA 5K9ZA 4IZIA 5A9SA 4XYGA 3DOJA 3KSUA 1H2BA 3I9NA 4Q3NA 3GDOA 5L3ZA 3TF5A 4DVJA 5I7SA 4PCVA 3IQDB 3OA0A 5JXWA 9LDBA 5JSFA 1OI7A 4XGNA 4Z3KA 1LDNA 4PLYA 5B37A 1ARZA 2JD0A 3WBBA 3DEYX 2DTDA 5A1TA 1VLLA 1PJSA 3HB4X 2B5VA 2GLXA 3IDSA 1YQDA 4GGPA 3WLFA 4R4JA 1HTBA 3ZGYA 2IEDA 1R0KA 1IB6A 4L9RA 1TT5A 2O7SA 5IXYA 4Z0PA 4NK5A 4Z9XA 2VZ8A 4BKRA 5A03A 3KYCA 5JAQA 2X0JA 2GUGA 2VWPA 3ZNQA 1HDZA 1BTOA 4YR9A 3F3SA 5MGBA 1HT0A 4EJ6A 1OC2A 1P9LA 3RJ5A 3LSYA 1XKQA 5BT9A 3U4IA 4TVBA 3DMTA 3L9XA 4YACA 4CV2A 3A14A 1E1MA 4EGFA 1HYGA 4EI2A 2VYND 3R3JA 2DPGA 1QV7A 1KERA 1OFGA 1JWAB 4XRGA 3RD5A 3CIFA 5L45A 1MXHA 1WP4A 4L76A 4XD2A 1Y8QA 3H5AA 4XDYA 2VT3A 5L7WA 3BTVA 5ES3A 3QP9A 3DFUA 2EIHA 2Q1WA 1N7GA 5A9TA 5KJFA 5IDQA 1GZ3A 2X9NA 3TSCA 2Y05A 5COBA 1BRMA 3GNSA 4IBOA 3UAGA 5BSEA 3RQSA 5JS6A 4R9SA 5JDIA 3V1UA 2OMEA 4ND5A 1RKXA 1H94A 2FMUA 4RCVA 2CD9A 5G0VA 5MDHA 4RPLA 1DIGA 2X8LA 5FF9A 2LDXA 4XYEA 2FSSA 2ZTVA 5BQFA 3E03A 3ENKA 4F3YA 5EIOA 4XIJA 1ISFA 3ST7A 3A28A 4K26A 1UXGA 1ID1A 3PEFA 4OXNA 4AICA 4Y6PA 4M89A 1G0OA 3SLGA 2AQKA 1BWSA 1UP6A 3O9ZA 1ZXLA 2GYYA 3QIVA 4KUGA 3Q0EA 3ZWVA 2PY6A 2C2YA 1SPXA 3GHHA 4BNJA 1V9LA 4OJNA 3WSVA 2P4QA 4YYZA 1ZK4A 3OJFA 3SJ7A 1E1LA 4BVAA 1X7HA 4BO6A 5I9LA 4D46A 1N1EA 2WD7A 2NQTA 2JAHA 2P68A 4IIUA 4M86A 5GZ6A 3ZWBA 2Q46A 3LF1A 2O2SA 4EEXA 3PHLA 2QQ5A 5JLAA 5KCZA 2EG9A 2BGLA 4KWIA 4RVHA 3HG7A 4TRRA 3ZI0A 3PYMA 1A72A 3VZPA 4BO4A 1ADBA 1EDZA 3JQDA 4L73A 4R69A 3GOHA 2DLDA 2V6BA 1KC1A 2BFPA 2BKAA 3ON5A 5HTOA 1N5DA 1WLYA 2P9GA 3INGA 3FR8A 1DJQA 1K89A 3RBZA 4K1LA 3C1TA 1O9BA 1DIHA 2NVBA 3G0OA 5IDWA 3PQEA 1DAPA 4FQ8A 2YYYA 1YL5A 2PH3A 4A10A 2H9IA 3H65A 3TZQA 3MCVA 4H7PA 2FOIA 1HF3A 3OBBA 4NMHA 4BNVA 4ZJUA 2YZ7A 1EE9A 4NJMA 4R3WA 2JHGA 1YJQA 2Y0CA 4OHUA 4B8ZA 3E9NA 1I3KA 4FFMA 1U7TA 1I5RA 3JQ7B 3WGYA 2RH4A 2ZTLA 3BHMA 1EE2A 4IXTA 4UEKA 2EKQA 1DIAA 1GUZA 5IDYA 3H4VA 3HZZA 3HADA 3MOIA 3O03A 1UDAA 1XG5A 4U8GA 3VTFA 4OXKA 5DCWA 4NBVA 1ML3A 2HLPA 4J3FA 1LTHR 1AXGA 3DONA 4KZPA 3JQEA 2Q45A 4PLWA 3QVTA 3ETGA 2DVMA 3NRCA 1PJ3A 3RJ9A 3VPHA 3KYCB 2ZCUA 4N5NA 4YXFA 2Y1OA 5CEJA 1KETA 2IE0A 2V7PA 1NPYA 1SOVA 3JV7A 2VYVD 4O0LA 4RF4A 5T5QA 4ALIA 5HM8A 4E6PA 4R1UA 4DBZA 4F46A 4P22A 2YY7A 3HDHA 3PJEA 2P9CA 1AN9A 1NFRA 2Q4BA 3LT1A 1HEUA 3PHGA 1E6UA 4OGWA 1YKFA 3DBHB 4DLAA 1DRUA 2DFDA 4QSMA 5DT9A 2X0NA 2NTNA 1A5ZA 2FN7A 4OMUA 2VTEA 4GI2A 4WJZA 3PIIA 4KUEA 2D5AA 4ND3A 3VH3A 3AUAA 5BNTA 2Y1GA 3MJVA 2CF5A 2WE8A 4TZTA 4UEOA 3FNHA 1JAYA 3H9JA 3WTCA 4WPGA 1N1GA 1DC6A 3FBGA 3T4EA 3GPDG 1U9JA 4ZICA 1I01A 3NJ4A 1JWBB 3QRWA 4MVJM 1S6YA 4BO0A 4LMRA 3P2YA 5T8KC 4EJMA 4BO9A 5JCXA 5GZ1A 4KTVE 1QYXA 4HFNA 4XZ3A 3UGKA 4YAEA 4FFOA 4IDAA 3RI3A 3QW2A 1V35A 4BNGA 5L53A 1CQIA 4GSKA 4BGEA 3B1FA 2GN4A 4YDRA 5DZSA 5A9SB 1S7CA 2BD0A 5I9NA 4XR4A 2HJSA 1HE3A 5KVVA 4YAJA 4BKPA 1U3TA 1P1IA 3LU1A 5ENDA 1ULUA 3HDYA 4IQ0A 4LK3A 1GUYA 4B8WA 1B2LA 1QKIA 3G49A 1IPFA 1H6BA 1NASA 3IUSA 4INAA 4N7RA 4CLRB 1R15A 2YHIB 5CDYA 4R54A 4E0BA 1HDOA 1P0CA 5TRTA 5ITVA 4XYMA 1Q0LA 1MV8A 1I2BA 3JYNA 5EN4A 1DC5A 1B14A 2EJVA 3DZFA 3OH8A 2XXJA 1GDHA 4DGSA 4NBRA 1LRKA 1Y6JA 1GPDG 2NU9A 3CUKA 1I30A 1Y8RB 3ICPA 3GLQA 2D2IA 1KIFA 1L7EA 2NACA 3ITKA 3E48A 4I1IA 2GO1A 4JK3A 4ALMA 3ETDA 4C4OA 1U8FO 5A5EA 1TXGA 3WXBA 3WICA 2WD8A 1PGOA 2IYPA 3I9MA 1NR7A 4OQZA 3LT0A 1HE5A 4BQPA 5IN5A 2UVDA 3FI9A 2JAPA 4JBGA 1D1TA 4TROA 5EL0A 2PZMA 4IS2A 3DDNA 4U6QA 5IF3A 1I2CA 4HFRA 5CG1A 3L6DA 5TIIA 1X15A 3X2FA 1OAAA 4NFYA 2VNAA 3H9QA 2HU2A 4JX8A 3S2EA 1RM5A 3TQHA 3GNQA 5L9AA 5EQDA 1VL8A 2YDXA 2DUWA 3I6IA 3UOGA 1ZUD1 2ZB7A 1SB8A 1PU2A 2C07A 1YBAA 4YJGB 5KJEA 4CM7A 4D45A 3MJSA 3N7UA 4ONEA 3EZYA 5FWNA 2Y93A 3AUSA 2WJPA 4JBHA 4DC0A 2BI8A 2CDBA 2AE2A 4WLEA 4YAKA 1LDGA 4CM1A 1EZ4A 1PZHA 1KY5A 4NZ9A 5I7EA 1PGJA 2E49A 1V3UA 4TKMA 5TQVA 1PX0A 3GGPA 4I5FA 2QRJA 1HKUA 4NBWA 4NU5A 4P8RA 1DFGA 3BMCA 1Q7BA 4QTZA 1UUFA 3TZHA 3ENNA 2C0CA 1ZK0A 2Q4EA 2A94A 4QQRA 1TB4A 2RAFA 3MWDB 4OL9A 2VYVA 1NQTA 1YB4A 1E3JA 4CUKA 4NH4A 3CZRA 5DN9A 5B4UA 1DDOA 4RDIA 1Z73A 4CM5A 2Y67A 3D4OA 4E12A 2JD2A 3HJAA 1EVYA 5TC4A 4TQGA 2H6EA 1D7OA 3P5SA 2RIRA 3QWIA 5EERA 1ORRA 4BNUA 3QQPA 1CRWG 3DFZA 4OM8A 5C7IO 1T1SA 1U2GA 5L4NA 3PDUA 1KYQA 1O6ZA 3MWEB 4EUFA 3EW7A 1CYDA 4GX2A 3NJ8A 4RO0A 3ZZNA 1EVIA 3ZU4A 4CLXA 4XQCA 4CR7A 2B36A 1IL0A 4HADA 3P19A 1L1FA 3JD0A 1RM3A 3Q3CA 4ND4A 1Y5MA 4QO8A 3W4IA 3W8DA 2P4HX 2E4AA 3K31A 1WMBA 2AXQA 3BTUA 4E5NA 4ESOA 2R6JA 2AA3A 2I76A 3UCXA 2CF6A 4RVSA 1O89A 5JO0A 3VDRA 3JQFC 3BAZA 4AFNA 3FNFA 2EHDA 3ORFA 5L4LA 1YDEA 2OP0A 3JQ8A 4U6SA 3RC2A 3BHIA 3JQ7A 2W90A 3HHPA 3VAZA 2ZKLA 3ONDA 3ZHZA 2WYWA 4E3ZA 2Q3EA 4FJ0A 5L7YA 1N7HA 3V1YA 3FNGA 1VJTA 3G1UA 3VZQA 4QFCA 5K6AA 2GZ1A 4LSMA 4FFRA 1CWUA 4WCFB 5EMHA 3ZCXA 5IAAA 1B8UA 2DTEA 1KOLA 4IXWA 5I8ZA 3VPXA 4YB8A 5DP1A 2W98A 3G17A 1SAYA 3JD1A 3PGJA 1BDBA 1IZ9A 4RL6A 3BMNB 3KXDA 4OIMA 3WWZA 4EUHA 4YPOA 3WSWA 4FB5A 1EK5A 2H63A 4DIOA 3PJGA 1R16A 2IEBA 1DO8A 1MC4A 1YRLA 3AM4A 3BTOA 4A26A 1PZGA 1XHLA 4YJFA 4MVJH 1LDYA 3O4RA 2WSBA 4M54A 1O95A 3ICCA 5T67A 5KNLA 1UZNA 2CDCA 3E8XA 4GH5A 4BGVA 2QIOA 2V6MA 2ZJ1A 4J6FA 3PLRA 4QX6A 1HLPA 4HP8A 3TWOA 1K6IA 3AM5A 4IJKA 4Q39A 4A03A 4DL9A 1OMOA 4CV3A 4I9HA 2X6TA 3I4FA 5C5IA 4U0KA 4W4TA 2DM6A 3GPIA 1GZ4A 4Q3BA 3NEPX 4BO5A 4ZVVA 1XQ6A 1IULA 4KP7A 1PQWA 4AJOA 2NU8A 4XDZA 4DUPA 2NUAA 4CM4B 2FY8A 2V6FA 3DBLA 1C1DA 4Z0HO 1LBEA 2GD1O 2PFGA 1MB4A 1R6DA 5JPIA 5KJ6A 3PP8A 3VDQA 4FC7A 3WYEA 3DTTA 2B37A 5EINA 3DZGA 3C85A 3DZBA 5CEEA 5K6AC 4DTIA 3PFWO 1T2DA 4YAGA 5HRUA 5BSFA 2D59A 5HS4A 1LC3A 4J1SA 1FDUA 4M8SA 5DOZA 4AJLA 4ZHSA 5K0ZA 3CKYA 3NTOA 4J2OA 5A4DA 1VKOA 1PJBA 1VJ0A 1XCBA 1P1FA 3WFJA 1PZEA 1P44A 3WQQA 2CVQA 3H2SA 4Y6RA 4YJHA 3KEQA 4FN4A 3PPIA 4RVGA 3GG2A 1NQOA 1ZMTA 3PTZA 2O23A 3OA2A 2CY0A 4IJUA 4LW8A 3OECA 1DOHA 4GGOA 4PLTA 2G76A 3GT0A 1IOLA 1DRWA 1U5CA 1PL6A 2AQIA 4YA6A 5TSDA 1ZKMA 2NV6A 2PKRA 3L07A 3BMOB 3PZRA 4YEDA 3O38A 4XRRA 2AHRA 3WNQA 1XELA 3OIDA 5IJZA 3Q2KA 4GX5A 2EKLA 3B70A 5AYVA 1ZK3A 3VVBA 4ND2A 1R0SA 4IGFA 4WE3A 1ZH8A 1MG5A 3K30A 3NUGA 3VPSA 4A73A 3ZW8A 1A9ZA 5JAZA 3M6IA 1Z7EA 4CUZA 2VUUA 3GVCA 4GKVA 1T24A 1HZZA 3JD4A 3QVSA 2AG5A 4OKIA 1U3WA 3E9QA 5CG2A 3SC4A 1SOWA 4MVJG 1NHWA 4RZIA 4IS3A 4RJTA 4D0RA 4BO2A 2D3TA 2FZEA 3UCEA 2HKIA 4E2ZA 1VE9A 4FOOA 3RC7A 3D1LA 2NU6A 5EJ2A 3GC6A 1E77A 3OMLA 5DNAA 3ZWNA 2JJYA 5A04A 1D3AA 2GCGA 2IXAA 2OP1A 4Z3DA 5FYDA 4QT0A 4L8VA 4JJIA 2P2SA 1NTOA 4QXMA 4GBJA 4XEHA 3F1KA 4GLLA 3CE6A 1OBFO 2VOJA 3F5QA 3KM0A 4R1NA 4R1TA 1LDMA 3D7LA 1B3RA 2VHZA 4ZQHA 2ZQZA 5HWSA 3JQ8B 3H9UA 5F5LA 5T64A 3OIGA 3WGOA 3LC7O 5KKAA 4J9VA 3WGIA 1T2EA 2D1YA 1ZEJA 1EFLA 4A0SA 4W82A 4CL8A 4MIYA 4P38A 2RCYA 5FEUA 2J3JA 4JQCA 1ENPA 3DBRA 4DPMA 1TT7A 1NR1A 2O3UA 2UUPA 3B20A 2YQ4A 2YDYA 3IP3A 3OJEA 4DLLA 5A02A 4M87A 2QRKA 5G0TA 3D5QA 1V6AA 3DBHA 2FR8A 4RDHA 2EXXA 4B4OA 1M2WA 3MTJA 4B7UA 4BO3A 5TLSA 4U5QA 4XX0A 5CEFA 3D5TA 4PLFA 5JAIA 1WVGA 2O3TA 4DLBA 2VNSA 2IZ0A 2C5AA 1YBMA 4FOSA 1PL7A 4NG5A 3IKTA 2X1HA 5B4VA 4WGGA 3EAGA 3MEQA 2RHRA 3OEWA 1YGYA 3DZIA 3M2TA 5TJHA 1Q2XA 2BFOA 2GGSA 1QLHA 3GMDA 3HSKA 3Q11A 3PIDA 4CM9A 3VHRA 1PQPA 3RSHA 1LDEA 3GZ4A 1BHSA 4CLOA 1Z7BA 3SBOA 2C7VA 1HDXA 2Q2VA 3W8EA 1J49A 2PD4A 4HY3A 3ZWYA 1KVQA 2BFMA 3E6AA 1NVMB 2ET6A 4I5DA 3C24A 3OSUA 1E7WA 1ZSNA 3FPLA 4RQTA 2A9FA 1PWXA 1M6WA 3F1LA 4YJHB 1KVSA 4KOAA 4FDAA 3OICA 2BF7A 1WMAA 2CFCA 2GR9A 1UP7A 4CMKA 3HUDA 3JYOA 2EV9A 4KQXA 3HB5X 1X14A 1V0JA 1IHYA 3KLPX 4NFSA 3RC1A 4E13A 1MFZA 1E3IA 4CJXA 4GQAA 4CMIA 4UREA 4W6ZA 5FFFA 5DCYA 5AQ1A 3S1LA 4E21A 2J8ZA 4S1VA 3WFIA 2NTVA 2HK7A 4Z6KA 3HWRA 1YJ8A 1P33A 4IUYA 4L0QA 4TZKA 1UR5A 1EEHA 3U4HA 5JBIA 5B1YA 5JCJD 1NVGA 1IZ0A 1ZW1A 3QWHA 1I3MA 4CQMA 5F1KA 2B4TO 1U7HA 1HSOA 3BZUA 4FJ2A 2BI7A 1E5QA 3EDMA 3QV1A 1XGKA 4JP3A 4O59O 1GEEA 5JE8A 3QLJA 3ZWMA 2JKVA 3OP4A 4CUJA 3GF4A 4J4HA 4JLWA 1VKNA 2C54A 2QZZA 1B8VA 1NVTA 1GYRA 2O3RA 4RZHA 4PZEA 1E1KA 3DMTC 3IAHA 4DA9A 4J7UA 4OSPA 2VWQA 2AG8A 4OOEA 1KEVA 4WUVA 2E82A 2FRDA 4R01A 3S55A 4J0EA 3KUXA 1YVEI 1RM0A 1P1HA 5DBIA 4JJFA 1Z45A 1CF2O 4EJ0A 1DSSG 2W2LA 5JY6A 5DCUA 3EYWA 1I3NA 5DF1A 2HQ1A 2Z1NA 4OH1A 4BKUA 2DU8A 3H8VA 1HDRA 2EEZA 4N5MA 1FF9A 3JQ9C 3NYWA 1UH5A 4LCJA 1MG0A 1P74A 4CR8A 1WPQA 4H16A 5A9RA 3AW9A 2UYYA 3EK2A 4J9UE 2D4AA 1YH3A 5JYEA 1D8AA 1XLTA 4DPLA 5C3MA 3JQGA 1BG6A 4GWGA 4YQZA 3JTMA 3D3EA 1N9GB 4BOYA 4J1QA 3I5MA 1RWBA 1A7AA 2GNAA 3KHUA 3EVTA 2FP4A 3OEYA 3HFSA 3E1KA 4ID9A 3F5SA 3RUIA 1SCUA 2HMVA 3H7AA 1GQYA 1NM5A 3QJ5A 5CPFA 2O4CA 3AI1A 3QVXA 1VSUA 3NKLA 4L4SA 4CMEA 1IYZA 2AMFA 2G82A 3GZNB 4UVDA 1YWGO 2BGKA 2P5UA 3ZU2A 3LDHA 1N92A 3TOZA 1E7MA 4E5MA 2ILTA 4HV4A 5CPBA 2Q1UA 3SEFA 1QMGA 3DTYA 1JU9A 4JBIA 4Q3CA 1V3TA 4WOJA 1RYDA 1VJ1A 2P9EA 2GZ2A 3C1AA 4AG3A 1ZO8A 3JQAA 5LCXA 3D3WA 3OFSA 1GYPA 4KDEA 4RV9A 4EYEA 2J3HA 3RASA 1B15A 2B69A 3DOOA 4WCFA 4WNIA 5EPOA 4CMHA 1OZAA 4FSHA 3DOCA 1ISGA 4GX1A 2IXBA 4FD3A 1KC3A 4P4NA 1LC0A 5JAMA 4G65A 4GSLA 5JW6A 2VUTA 1DLIA 1EUZA 3VH4A 1YQXA 3BMOA 1C0IA 3U0BA 3GQVA 4HNHA 1F0YA 2Q50A 2HMSA 9LDTA 4PG6A 2I65A 1Q0QA 2ZATA 3GAZA 4XGIA 1PJLA 2YUTA 2PZJA 3EHEA 2DBVO 4PVCA 2PLAA 1XEAA 4HBGA 1Y81A 5L7TA 5ICMA 3ANMA 2R00C 1EFKA 2BH9A 5ENVA 4D0SA 3EGOA 1A7KA 4CMBA 1FXSA 4Y6SA 5AXAA 1ENOA 3RVDA 3GVPA 1E7RA 3CTMA 4BB6A 4ZU3A 2X22A 3ZV3A 3JQBC 1QYDA 1CEQA 1GCOA 3FBTA 4HX5A 2QRLA 1U4OA 2EGHA 3GGGA 4HFJA 4BMSA 2FR1A 3K96A 1X1EA 1I3LA 1BXKA 1U2DA 2BMAA 2PKQP 1BXGB 4WLFA 3JCZA 3B1KA 3FNEA 4X54A 3R6DA 3KRTA 4AJ2A 1R4MA 1EBFA 1TT5B 2UV8A 3E18A 4NQZA 5G4KA 4YBZA 1GL3A 3H6KA 4K9DA 4O5OA 2VN8A 4RQUA 2DT5A 3RAJA 1UAGA 2B5WA 4J1TA 5AVOA 4AL4A 4JGBA 1LSOA 4II2A 1GQQA 4XYBA 1ZJZA 3U09A 4EZBA 4HKTA 1T2CA 2I3AA 2X0IA 5CDGA 3ASVA 4BNFA 1U3VA 3CMMA 3I4CA 3C7AA 4UAGA 1KEPA 1X13A 3KETA 4O6VA 1EMDA 4GKBA 3WIDA 2J6IA 3OJLA 2ZYAA 1ZFNA 3GN1A 4CLOB 4D7AA 1NHGA 3H5RA 4E5KA 2P91A 1Y8QB 1HSZA 4GVXA 3PJFA 4ZRNA 4LISA 4NBTA 3WDSA 1DXYA 3JYPA 2HSDA 5CP8A 2EW2A 2NVWA 4RF3A 4JNKA 2PH5A 4DPKA 2EKPA 1HWYA 5KIAA 4L75A 1M66A 1PZFA 4BB5A 3M2PA 5FI5A 2OUIA 1W8DA 5B12A 1YONA 4AJ1A 3JSAA 3OJOA 4PLZA 1U3UA 3GEMA 3ADOA 3DAFA 5A5FA 3OJ0A 2EF1A 4ITUA 3BMQB 1PS8A 1GTMA 1L7DA 4RPJA 1TVEA 4CQLB 4BO7A 1P1JA 2JFHA 3HFGA 3VOSA 1CDOA 2OGUA 4BO8A 1A4UA 1XA0A 4XGKA 4AJPA 2EP7A 3WR5A 5IG2A 1VPDA 4GMFA 2HCTA 2DBQA 2IODA 4BNTA 2GN8A 1E6EA 3OQ6A 2CNBA 3PHJA 1LQUA 1FDSA 3UCFA 2VHVA 3C7DB 1NBOA 3NDRA 5F3RA 3TFOA 4MIOA 3Q9UA 2X23A 5HA5A 3NGXA 2C7GA 3QE3A 1B7GO 4RVFA 4CODB 1QLJA 1LUAA 4D43A 4WLNA 1JAXA 4G81A 4PGFA 3C3XA 3OQ1A 3R1IA 4QO7A 2VWHA 3GVXA 3QVOA 4MINA 1PJ2A 5F5NA 1QYCA 5C37A 2G5CA 3GK3A 3S2IA 1I0ZA 2B35A 2JL1A 1FDVA 4TRNA 1JTVA 1SB9A 4ALJA 3BHJA 3K8ZA 3A06A 1C14A 4PLHA 4DBVO 3W4KA 3KEOA 3GGOA 2HO5A 5AXBA 3G1TA 4IZHA 3K6JA 4AJKA 2IZ1A 4FW8A 3HDJA 4TWRA 4DQVA 3AOEA 3IS3A 1P45A 2X9VA 3EC7A 4MVJP 2O4UX 3IP1A 4YT2A 3DBRB 4AJJA 2J5KA 3R3SA 1W73A 4HWKA 2VZ9A 2C20A 4ZQFA 3RU7A 1Z75A 3NGLA 1LI4A 5CFZA 4FS3A 1ZK1A 1Y9AA 1UAYA 3OM9A 3UUWA 2G17A 4XCVA 3WLEA 4YRAA 4R68A 4B4WA 1LDBA 2GERA 5H81A 4BIIA 4J4TA 3ZWAA 4TKLA 1V8BA 4C7JA 4O1MA 4ZD6A 5HBRA 4RF2A 5BSHA 3DMYA 4UUMA 3JQBA 4NPCA 3O8QA 5LDGA 2FSVA 3KSDO 4E2WA 1GYQA 1ISMA 1R12A 5DOVA 1FDWA 1G6KA 1ONPA 1VL6A 3TOXA 4UVIA 2Y1FA 1SNYA 4JCOA 3FTPA 3ZWPA 4R51A 2W4QA 2JCVA 3E9MA 3PLNA 5COAA 2J5QA 2ZCVA 3ANNA 4MP8A 2VUSA 4IPTA 1UXIA 3BXXA 3I1JA 5G4LA 3L0DA 4H15A 4AJIA 3GDFA 4MO2A 5JO9A 1C0PA 1GAEO 2NVUA 4YTEA 3D3WB 5GZ3A 4OKNA 4OYRA 1VI2A 3H3JA 4BNWA 4ALNA 3GG9A 2BGMA 1DAOA 5J23A 2G0TA 2A35A 1MA0A 1LLUA 5TGDA 5G0SA 4AJHA 5L95A 2Z95A 4G5HA 4NBUA 3VZSA 4MVJE 4DQUA 2HJRA 1H6DA 5JY1A 3GZNA 2YHIA 3RFTA 3LLSA 1Y7TA 3DL2A 4MJLA 1I10A 5LC1A 5I8WA 1H0KA 1OOEA 2VZ0A 4PZCA 1NNUA 3W6ZA 2GF2A 5ER9A 1C1XA 2CZCA 4PRLA 3V5NA 1GD1O 4J49A 2DPHA 5U9CA 1M67A 3W4JA 3L6EA 4D3SA 4AJEA 1ZEMA 4DWVA 3KO8A 1U5AA 3NTQA 3QWFA 2PZLA 3AI3A 3GAFA 3ITDA 4NHEA 3M1LA 1BVRA 1GEGA 5IDXA 2JD1A 3HNPA 3U4CA 3AWDA 1ZK2A 1H6CA 2C29D 3D4NA 3DHYA 4GVLA 4BNYA 4YRDA 2AEMA 1QG6A 1M75A 1JLLA 2HK9A 3A4VA 1KS9A 1ISIA 1EVZA 1LSUA 2GRAA 3PHIA 5JDIC 4DMLA 1N9GA 1N2SA 4XQEA 1E0DA 3DC2A 4LN1A 1JVSA 1XSEA 4Y8VA 3KB6A 3EMKA 3S8MA 3INTA 1E7YA 1GFSA 1MC5A 3FR7A 1I32A 4PN3A 3WS7A 1ULSA 5ER6A 4A27A 4E31A 4IQGA 4BS9A 3ZU3A 3GFBA 3MOGA 1WNTA 3SVTA 2NNLD 1Q7CA 1LLQA 3F6YA 2J3IA 2BFAA 3ONEA 3MTGA 1F14A 1H9AA 3I9KA 1N8KA 3DHNA 4B7XA 4FR5A 4Y9DA 2X5KO 2IYOA 3ZWCA 2JFFA 1QSGA 4Y67A 4CM3A 1IUKA 3JQ9A 3K92A 3VVCA 3DZKA 4L4RA 2PGLA 4WLOA 4CMJA 3PWKA 1U28A 2WWRA 4KWHA 2TMDA 4RF5A 3IOYA 4UVHA 4MOWA 2X9GA 2I3GA 1DRVA 4UEJA 4Q3DA 2EWMA 4YJFB 1JVBA 3RFVA 2Q2QA 1MFPA 4IINA 2W2KB 3C7CB 3L6OO 1C1DB 2GN6A 5EQFA 2FZWA 4J90A 5KVQA 1EUCA 1Z74A 4FFPA 5KWEA 3ROQA 1P31A 2C59A 1DC3A 3AUUA 4B4UA 4PIVA 4AJ4A 3SC6A 2Y1CA 3CINA 2NM0A 2DFVA 3VTZA 2PGJA 5IXSA 3GFGA 4KQWA 2PNFA 5F21A 4IY1A 1GU7A 1AXEA 5ADHA 1EQ2A 3FWZA 5U1PA 2Y0EA 4BHTA 3U5TA 3GN2A 5A05A 5KVSA 1DFIA 3GVHA 2YJZA 1QXSA 3PYXA 4TRMA 3DR3A 3OF2A 1TEHA 1ENYA 1T4DA 2Z5LA 2O3JA 4MVJF 1I36A 2I9PA 5KJ1A 1UXKA 4WLVA 3LVFO 4I9UA 4HNGA 3RUHA 1JKJA 2RHCA 1PJTA 2YV2A 2YQ5A 1LLDA 1C1XB 3IUPA 3UH1A 3RBXA 4BMVA 4LVUA 4WEQA 3T7CA 4YAIA 1E3EA 5TF4A 4PZDA 4I9NA 3P7MA 1EVJA 3UF0A 4MVJD 4IQ8A 4C7KA 1R4MB 5G4KB 1VC2A 4NI5A 3S2FA 4BGUA 2A92A 4MP6A 1K5HA 3L9WA 3TZCA 1JA9A 3I9OA 1E3WA 1B3BA 4ZA2A 3ZV5A 3SXPA 4LCEA 2WYVA 3OETA 4CV1A 2NLOA 2EGGA 4I8XA 5DP2A 2AQHA 2Q1SA 2GZ3A 6ADHA 4GLOA 4PRKA 5JC1A 4YRBA 2SCUA 2VCYA 3D4PA 4U0JA 1R4NA 1KEWA 1GV0A 1X7DA 2Q49A 1P3DA 2YW9A 2HMTA 2W2LD 3L77A 4M49A 4NDNE 3RKRA 5U4QA 1F17A 2JHFA 1H5QA 5JDCC 1W6UA 2QG4A 1AHHA 4BGIA 3ZH2A 2E6UX 1QV6A 4BNNA 4IJVA 4IIVA 1J6UA 1R0LA 3PFFA 1ONNA 2DUUA 3ZWOA 4XIYA 3AY6A 1PJCA 1IPEA 2JCYA 3GDGA 3HE3A 3VZRA 1ISHA 3RROA 4BO1A 3K2BA 3QA9A 1NAHA 1OC4A 1DBVO 3KTDA 1V3VA 4XQ9A 2ZYDA 1T4BA 4W9NA 4CM9D 5TJ9A 4B3JA 2O7QA 1Y5RA 4XYLA 2I5PO 3W1VA 3WNVA 3IL2A 3ONFA 2QZ9A 5CDUA 1QRRA 4FGWA 5DULA 3RKUA 5HS6A 4P4LA 1VRWA 1SEVA 3PWZA 4II3A 4QEDA 4E33A 3NT5A 3RWBA 1XYGA 4YWJA 3VPGA 1ISJA 1HYEA 4OSOA 2WM3A 4E30A 1IE3A 3VC7A 4B79A 1XR3A 1EBUA 3F9IA 2XOXA 5TS3A 4E5YA 4QECA 4XQGA 4WASA 4B3HA 1XDWA 4L4XA 1XWFA 3LQFA 1HYHA 4R1SA 1X7GA 2NWQA 3AK4A 2O3SA 3WQSB 1HRDA 2NVUB 4DIFA 3PWSA 4CQLA 3Q9NA 1HL3A 4QUKA 3JQAD 4AJNA 1ZSVA 2FPGA 3FN4A 1IY8A 1CIVA 4FGSA 3WYBA 4YJDA 4BQRA 2DC1A 2G1UA 1MUUA 5C7LO 1P1KA 3W6UA 4N5LA 1PR3A 1ZCJA 3I9JA 3HN2A 4PG7A 4ZQEA 3UKOA 3WGHA 2I6TA 2Y0DA 2JFGA 1B16A 3CEAA 4XB1A 1BVUA 3JQGB 3PXXA 3AFNA 1E5LA 2UAGA 1DIRA 2I66A 2Z1MA 4HUJA 3F4LA 2VRCA 2HRZA 4IDGA 4M55A 4UUPA 2Y68A 3C1OA 2Y66A 4DYDA 4D42A 2GDZA 2D8AA 1SMKA 4J7XA 3U62A 4DC1A 3A9WA 3DB2A 1AUPA 5TT0A 3SLKA 1T25A 5KTKA 4Z9YA 1HDGO 4J4BA 1QR6A 2PWZA 2OZPA 5IN4A 1NPDA 1ZVMA 2AEFA 1Y1PA 4D3DA 3NT4A 4LMPA 1TA4A 2O3QA 4GMGA 3VH1A 3X2EA 5DBGA 8LDHA 4UUOA 3I83A 3TFQA 4YT4A 4G2NA 4R41A 2X7HA 3V2HA 3AY7A 4F6LA 2A4KA 3UFXA 1E92A 3ZW9A 3GRPA 3KYBA 1NXQA 2H5LA 5CDSA 5I7FA 3EZLA 4OOFA 3S2GA 1Z82A 4BMNA 1K0UA 1LJ8A 2ZB8A 3ZNNA 3QHAA 3QSGA 3CMCO 3LF2A 5T6BA 1YOVB 2HMUA 4ND1A 1C0KA 3N58A 2BRUA 3JQFA 2VTDA 2X5OA 3BTSA 2AEJA 3JQAB 3UICA 4Y98A 5BNFA 2FWMX 2NTJA 1PJQA 4H3VA 1E3WB 3DWFA 1U4SA 4CQMB 1I33A 5I9MA 4CM4A 2XAAA 3E82A 1F12A 4ZN6A 3AM3A 3K73O 3JD3A 1UDCA 1A9YA 4FJ1A 4PG8A 1P1RA 4BNZA 1GUFA 1TLTA 3KSZO 4ZRMA 1JQBA 3G79A 5AOVA 3W8FA 1D1SA 4DXHA 4XB2A 2DQ4A 4PLCA 4GAEA 3PZBA 4EBFA 2CDAA 2XPCA 4NK4A 4XWYA 2O48X 1H2HA 2AW5A 5AXCA 1T2AA 4CPDA 2RH8A 4JXKA 4MIEA 1K3TA 2P5YA 4NJMB 1J0XO 4J16A 3JD2A 4BUCA 3L4SO 4K6CA 1KY4A 1W4ZA 1SBYA 2EP5A 5CDTA 3AUTA 1A27A 1YB1A 1LRJA 2VHXA 1GZ6A 2IZZA 1YE3A 2X5JO 3UW3A 2VRBA 1JKFA 4WLUA 1YB5A 1ZSYA 3RUEA 1LLCA 2BLLA 1PGPA 4RVUA 4WOKA 3UXYA 2YV3A 3DQPA 3EY4A 2NADA 1EDOA 3QWBA 1NP3A 3FF4A 4CLDA 2AQ8A 5BSGA 3V1TC 3ABIA 4IDFA 3AFMA 3NDIA 3H9GA 2AE1A 4YJGA 2Y1DA 3H9EO 2YFQA 1FDTA 1LU9A 4LVCA 3ZU5A 5CAEA 5I7VA 5IZCC 2FR0A 4I5GA 2WTBA 4CL3A 3R0IA 2BELA 5THKA 1KVTA 4OAQA 3WGQA 1H93A 2ZK7A 3M1AA 5THQA 3DBVO 3DXFA 4D44A 2W8ZA 4B7CA 4D41A 3UN1A 1PGNA 4IDEA 4NIMA 2R00A 4JP2A 4Q3EA 3N74A 4BNIA 4QFDA 1PJ4A 3F46A 3CXRA 4YT5A 4PLVA 2X0RA 1DLJA 2E48A 4URFA 3TZ6A 1HZJA 4EW6A 3MJEA 1GPJA 2ZQYA 4J0FA 4YQYA 1Q0HA 3ZNPA 1E1NA 2ZIZA 2YV1A 1R4NB 4KMSA 3KZVA 4FBGA 4XJTA 2B0JA 1BSVA 4BNHA 3GHYA 4XJSA 3BIOA 1O94A 3KV3O 1CERA 2ZTMA 2PR2A 2WMDA 1AE1A 3G3EA 4DQXA 3ULKA 2VRCD 1F06A 2IRWA 1YBVA 3RU9A 3PGXA 2ZB4A 3IKVA 1SEPA 4D3FA 1HE2A 4TSKA 1ZNQO 1NFQA 2NQ8A 1X0VA 2FPPA 5B4TA 1G1AA 1PGQA 1U1IA 4N54A 2EW8A 3LYLA 2O50A 3BYZA 2Q2WA 1YDWA 3F4BA 3QWAA 3FTNA 3LT2A 1WDLA 3V2GA 1HETA 4J1NA 4J7CA 3BMNA 5ILGA 4DIBA 3GNTA 4B4VA 1DHTA 2Y99A 4PFJA 4TMFA 1BXGA 2PD3A 3D64A 2QYSA 1YOVA 3INRA 4MP3A 2X58A 3IIEA 5AXDA 4EUEA 5KOIA 2I99A 1FK8A 4I08A 3CSDA 3WGGA 5KVCA 4UVGA 4IM7A 1NFFA 1ZBQA 3IMFA 4ALLA 2HMWA 4EEZA 4ROSA 3KYDB 3OHSX 5H82A 4O63O 3TNLA 3WJAA 5T8KA 4DMMA 4NR0A 2VWGA 2XF8A 1LQTA 3CH6A 2WYUA 4Q3AA 4PLPA 2OORA 2Q99A 5EESA 3T4XA 1M76A 5A3VA 1CETA 3GVIA 1LA2A 3PJDA 1SO8A 1PS0A 1BW9B 3H2ZA 4HXYA 4BV9A 3MJCA 1UJMA 1MP0A 3U3XA 3PHHA
chains in the Genus database with same CATH superfamily
1UXHA 4JJGA 4UMVA 4HZIA 1ECPA 3GAMA 3UZUA 2A84A 5D3MB 5JOQA 2QX6A 2CLKB 3THWA 3BH0A 1QRUA 1KE2A 3RSLA 5E8RA 2K7FA 2QUIA 1QZUA 2JIZD 2EVWX 3GD5A 2I6QA 3GIDA 3TZEA 2PT7A 4C04A 4AVYA 2AR0A 2P9FA 2EJCA 5F78A 2XNCA 3SK0A 1L8AA 3EUEA 3L6UA 3EGXB 1DQZA 1XFDA 8MHTA 3QVLA 3CH4B 2NU7A 3EDQA 3VPFA 5ELLA 3H42B 4ZZ0A 2B6HA 4JJ4A 4N0DA 1CRQA 1PUXA 2Y71A 4F5DA 1NLZA 4IKOA 5K8UA 1NQAO 4WKPA 3ROKA 4Z4GA 2L19A 3MWEA 1VIYA 3UB3A 3LC1O 4Y9UA 1P5FA 2VDRB 3SYTA 1RPAA 3HVRA 3CTPA 3TW8A 2HRBA 4CDNA 4AZWA 3E2MA 3P0IA 1ND6A 4D9JA 2P77A 2QSUA 5D5PA 1JSRA 2XSZD 2QW8A 4N0MA 5CMLA 4C3ZA 5A3QA 4TOIA 5HIKA 5JC8A 3S2SA 1AF7A 1T2FA 3NNDA 3FPJA 4NCHA 4IHKA 1X70A 1RJGA 2ALJA 3FDIA 1SC4A 2GCNA 3RFXA 4GPD1 4MWOA 4QU0A 2HLDA 5M3BA 3D6UA 5K3FA 3EGDB 1GG8A 4Q1EA 3ADPA 5T4BA 3SE7A 7ADHA 3WQRA 5FNVF 3GEGA 3IXMA 3NBMA 5CU7A 1DG1G 2IKQA 3NAGA 2BEUA 4YDSA 3O0DA 5DBFA 1EI9A 4PQEA 3WK9A 2A8YA 2PLWA 3FETA 2HF9A 4JEUA 4L51A 2WD9A 3FIJA 3TQCA 2HT6A 2P3SA 2VZEA 2OHFA 3ANLA 1XDBA 2ZTHA 4RK7A 3H99A 4N3GA 3R40A 4FX5A 4QJ5A 4UQOA 4LF5B 1H22A 2WVGA 2PM8A 5IASA 4A36A 1XD2A 3AINA 3JATB 3NAQA 4QL3A 2OBNA 4RMIA 1GDTA 4BNLA 1JV2B 3TINA 4DAEA 2PN1A 1Z35A 1FJ2A 1NOJA 3EXFA 4J6EA 1OY1A 2CCKA 1NLYA 3LDAA 1JKIA 4R3NA 5E6UB 2GFHA 4INOA 3F3KA 1UC4B 1YXMA 3DT6A 5ILOA 1KVRA 1F3LA 3BK1A 1LNQA 2VBIA 3FMFA 1DAHA 1S3SA 3IPRA 2UYCA 5GJVC 1QP7A 4OQYA 2WFLB 2RC5A 1S2GA 4K03A 4XWWA 1AS3A 4HB4A 3SJUA 1Q15A 2XCOA 2XCQA 3ZDCA 3W9BA 3EX7C 1RI3A 3B51X 4HF7A 2FFAA 5CDFE 1B0AA 1NATA 4DBLC 4WH0A 3PQ6A 3ZHBA 1F1JA 1AQIA 2D0OB 1QK3A 3O8OB 4LRTB 4BEVA 3D4LA 1R64A 1ZMOA 4YN3A 4DREA 1W93A 1Y3BE 2OBYA 2C2MA 2Q2OA 4QUDA 3UK6A 1L4MA 3O93A 2QMZA 4BKQA 4DLVA 1QGOA 3CZMA 1WMEA 4DUGA 1QDLB 3G5TA 4BQEA 1YIDA 1WZEA 3QOXA 5CVVA 1E18A 3H3XA 4JBNA 1RZVA 4LV5B 5CURA 1H4QA 3PX3A 4PGMA 3JWPA 4DOMA 1PYDA 4E32A 1GY8A 3H1AA 1PFUA 2BZSA 4KKVA 3NASA 4M0MA 3DBLB 3KALA 3BD6A 2QPAA 3TTTA 4LY6A 3DXXA 1VLHA 3GWGA 1TMOA 2GFQA 3BUSA 3KVVA 4XD7A 4ZEWA 1TYEB 2PVCA 1E4EB 2QTZA 3JARA 2WNIA 1LWOA 5K3BA 4WEOA 2I1WA 1D2RA 5C5CA 3BL5A 4HI0E 3SC2B 1G6HA 2FW0A 3MTQA 2W2OA 3O82A 2AKEA 4LJ7A 3EJ6A 4J91A 2I3DA 4FNOA 2A59A 3HQ4O 1FUUA 4Y2YA 2D3WA 4RX1A 3P9SA 4Q03A 2Q7XA 3FWNA 2C88A 4RH3A 1P9WA 1J2TA 2HREA 1Q3TA 4HTFB 4RLHA 1GQOA 4YJKA 3SLRA 1ADJA 1EVQA 2ICAA 1W9MA 1QP8A 2H06A 4IAOA 3UMJA 3B6ZA 5A6SA 2GHRA 3IUJA 4DARA 3RYCA 2QT1A 3ZIAA 1TU4A 4P3PA 3M49A 1O0BA 4D98A 2OCKA 1V1MB 2X8BA 3ZV4A 2D2VA 3H9CA 3UFXB 3NX4A 5FAXA 3HBFA 2W2KA 3ZGNA 4AZVA 4I50B 2OKGA 5GP1A 2ATIA 3V7YA 3LFUA 3VKVA 4RTRA 5F7OA 2YW2A 3D6MA 2C7QA 1VM6A 1R8YA 3DTNA 2CHQA 1W35A 5FI3A 3BSWA 2A3RA 2B4RO 3WL7A 1VZ2A 1SHKA 2Q3HA 1JZTA 2E87A 1ISPA 1M2JA 4J43A 2GM3A 2W11A 1AUVA 3NBUA 4RHXA 2OAEA 5T57A 4O33A 1T0PA 5F4BA 1VPVA 2HSEA 3U60B 3H1EA 2M98A 3O2JA 5C53B 1ZQ9A 3CFYA 1MIOB 4U2CA 3DAHA 4P2GA 1YBFA 1YO6A 1XZNA 2II6A 2PL5A 2VXOA 4L8YA 1RM4A 1SCUB 3PNLA 5B3AA 3BD8A 4Z2AA 4EI7A 1Z4PX 5BN3B 2OSBA 4X3PA 2J1LA 3EFHA 3LECA 2H1CA 1KEUA 1U94A 1JA0A 1W4BA 2B5OA 3PKZA 3PYLA 4HSEA 3CH5A 4KUHA 4MYTA 4YAOA 4YDHB 4BBZA 4F21A 1Z8FA 3WB9A 2WFZA 1GGFA 4HSGA 4KO1S 4OHVA 4CI9A 5LYJB 1EGHA 1O2DA 4TL9A 1IHDA 4YMLA 2HB6A 4L57A 5HCUA 1ZM3A 2ZYUX 8ATCA 1CP2A 1W4RA 1WWKA 5B1DA 4GU5A 4HLQB 4TVOA 2WEKA 4DMRA 4XLTA 1AV7A 1T9GS 2H3EA 1GXSB 1OLSA 2PV7A 1Q92A 1SBIA 2WJJA 1T91A 4LDPA 5LZ8A 3ROPA 3WGZA 5KBYA 1TGVA 1IVSA 1F51E 2P40A 3KOUA 3UJAA 7MDHA 1E3LA 5HF6A 1AD2A 2Z2KA 4M8LA 4IH4A 4EHAA 4OGGA 4TRJA 4B6GA 4FONA 4Q5IA 1BGVA 5H9VA 1FDRA 2DTXA 3LSTA 4OFZA 4WRRA 3ZDFA 2KBEA 1DG9A 1ML4A 3WQHA 4NU0A 1IB0A 1XQ1A 2HK6A 3EBLA 3K7EA 3WX0A 1P2BA 2ZUVA 2YHUA 3DEHA 4A8HA 4D0NA 4QATA 1QIEA 4NOKA 1Z2CA 4DV3B 4RTNA 2V7TA 3SNKA 3ZN2A 1L6RA 3LBHA 4QUIA 1WUKS 5ULLA 4TYMA 3PB3A 4A7PA 1NAIA 4V0OA 4DR1B 4BUJA 2CUKA 2VYNA 3NGMA 1CQIB 4PU0A 5K3AA 4EHLA 4F7DA 3SQWA 1X1RA 4F5EA 4RS3A 4P5EA 2V1XA 4V0NA 3EOAI 1JL3A 3OT5A 1NU8A 2DHEA 3AVQA 1QORA 2BL4A 4IQFA 3QELA 4RZSA 4YJ2A 2F6RA 3ETEA 3TIXB 1L1QA 3RH0A 1MA3A 3ZJ5A 1AHNA 1TYZA 3GV0A 4DJ5X 5H4GA 3G8DA 2PD6A 1REQA 3LNTA 4BC1A 1RQXA 4A92A 3V9AA 4BJHB 3NDBB 3PL1A 1YQUA 1X7ZA 1RYYA 2BCGY 3I05A 1A69A 2Z2XA 1KH2A 1ZNWA 4MYHA 1G8YA 4IHJB 4RLSA 4YRNA 1FUYB 3FTDA 1S89A 2B8NA 2Q5CA 3LLVA 3IEVA 1LX6A 4XDGA 2FJUA 1KYVA 2EZTA 3K5PA 3OPQA 3VR6A 3QEBZ 3IE0A 2DBZA 4ER3A 1GQ2A 2EERA 2XQKA 3PNBA 1ZJYA 5CD1A 3WMWA 3A58B 4YJ3F 1RKQA 5AK4A 4DT1B 4Y0NA 2F4VB 2O2ZA 2UVQA 4BNKA 2P30A 3EGXA 2GPTA 1T26A 3W79A 4CM8A 2A0WA 2FUKA 5K2OA 2J3KA 5JYDA 4BNMA 2QX8A 1NLUA 3PI7A 4C3OB 4DLBA 1BJRE 2A1TS 2IDZA 3HN7A 3QOYA 4S1WA 2XTNA 4DYVA 3OQBA 4IR7A 1UXJA 4FYHA 4OXYA 4DSUA 1O6FA 3AUJB 4BNDB 5A3SA 3HO1A 1QU2A 1DRKA 1M3SA 3HDQA 1OU0A 1Z0KA 4R3UC 3ASYA 4GZ3A 3C14C 4MUNA 4JJKA 3RTCA 2BHLA 3H4IA 2X0EA 4P4GA 5A6VA 1IUNA 3DP7A 5K05A 5TNXA 4QDZA 2WDZA 4OO3A 5JIBA 2GXQA 2P3LA 1K2WA 2DHCA 2V5UA 4CMIB 4HH1A 5IZ4A 2NYAA 2YVKA 2H7CA 2D5CA 2JJ1D 4RSRA 3L8HA 2WVAA 5ADUS 2KI5A 3PR1A 1CEEA 1WXHA 4UU1A 1DFHA 3E9CA 4EDFA 1PSDA 1XZQA 3I5UA 1DXOA 3DJFA 1U7PA 2EJBA 4CXMA 3FPCA 2IHJA 1KY2A 4MV6A 1I24A 4BP1A 1OFHA 1V16A 2RAUA 4R5HA 4Z0TA 4ES6A 3BB3A 2H16A 3OZDA 4U8HA 5GMOA 5EMMA 3ZHXA 4E2XA 1CFJA 3NCHA 5IFLA 1IFXA 3ZWXA 2QAGB 2UUOA 4R05A 4EG5A 4RTMA 1WIWA 4HQNA 4S3MA 1OGJA 1XRRA 4FOLA 4JOSA 3WV5A 2F55A 1CRPA 2P5TB 1H2FA 3R3ZA 1N5JA 2FW7A 3RCBA 3RRBA 5F1OA 3R5KA 3DE5X 2C4WA 4IUBS 4MQUA 3QA3E 5C51B 1PR9A 1G5IA 1XDDA 2NV0A 1NI3A 3WGTA 3CF0A 5A3JA 1QTIA 3JZMA 4IUCS 5NULA 2OLEA 3CF4A 3E0XA 4K6KA 3TJRA 2DLNA 2WUDA 4A0RA 1JECA 1JQKA 1LPNA 2FPIA 2XZDA 4J2HA 3CISA 4U02A 3IV7A 1QO0D 4KAFA 2PO5A 4NONA 1SC6A 1YAHA 4Q4JB 2PKQO 3SR3A 1Y9EA 5FTWA 1XXLA 1GTVA 4BZWA 2JLUA 1DO2A 5L3ZA 2PT5A 1H2BA 3BXOA 3GDOA 4INZA 1JXQA 2BPOA 4NP6A 4QRHA 4DVJA 4AI6A 3VC2A 3MB8A 3IQDB 2REOA 2VDPB 4KEAA 2WB2A 9LDBA 5CLQA 1WVMA 1XU4A 3K0AA 4OQNA 1C50A 4RD6A 4Z3KA 4ZCRA 3ZHSA 2GSWA 2GM5A 2BM0A 4H0CA 4DR4B 2LKCA 2DTDA 1NU6A 1STOA 2CFRA 3FYCA 3FPFA 4NV3A 3TLZA 1VLLA 3KQQA 3ZW7A 1PJSA 5HZGA 4ZV7A 2CW5A 4OHFA 5HQJA 4DDVA 1YQDA 3ND8A 4CKEA 2HV9A 5H3LA 2J4FA 4YJ3A 1H8EA 1ZMXA 3QYPA 1OXVA 3P5BA 4U7GA 5ALOA 2MTBA 2QWXA 1OFVA 5JY1A 1M1NA 2E1RA 1RHMA 3DFKA 1C3JA 4NK5A 5A03A 2EZ9A 3PFNA 3SHVA 5AW6A 3KYCA 3LBNA 2CKDA 4BVGA 3SBXA 3F7OA 2ZJ7A 4P92A 4CTJA 2C1XA 1BTOA 3F3SA 2GARA 5ELMA 1HT0A 4EJ6A 1VIVA 3FUVA 4CKBB 3WAKA 1TUGA 1XKQA 3I1FA 3KKQA 3QUTA 2HC9A 4MS3B 3TTXA 2XNDD 4CEJA 3EXHA 2F90A 1BU5A 3L9XA 4CV2A 1FFXA 1IBKB 1A4RA 3AT1A 1XV5A 5C81A 2XEXA 4J2TA 5KNCA 2DT8A 4L95C 1IHOA 3ECCA 1SUIA 1KO8A 3T12A 4MW7A 3GRZA 4PQRA 1MXHA 1V1MA 2PGXA 4L76A 4XDYA 1CZUA 3H5AA 5FR2A 1PKEA 5CYFA 3NANA 1GHTA 3D1JA 1GKUB 2IUFA 1XDUA 3KPUA 3QP9A 4R2KA 2GXSA 4UPVA 4ASUA 4UD2A 3O8NA 1XEXA 2DY1A 3KJQA 4L28A 1FBTA 3ZGVA 1BRMA 3B53X 3EZGA 4AY3A 3ETHA 3RIYA 4DB4A 3JAKB 4G4JA 3UAGA 4I6EA 2OK8A 5HJEA 5FR1A 1RCFA 3DA8A 3V1UA 2CNKA 5KVAA 2OILA 1RTTA 3D4IA 3EY9A 1T4GA 1H94A 2FMUA 3PLAE 3FMVA 4E4RA 2FPRA 3BILA 3WI7A 3H18A 4RPLA 4D9IA 2X8LA 3IT2A 3EARA 4P34A 2WYIA 5FOSA 1NVVQ 1USVA 3RVOA 3TGWA 2K7ZA 1G5HA 1TCAA 4HMQA 1UBLS 2ATCA 4C7XA 3BQ9A 4N1AA 3PITA 4WBXC 2R4QA 3EGDA 1W1WA 4OXNA 4AICA 3TUZC 4DKJA 4XUCA 1E1QD 4I4NA 1NXOA 3EF3A 5IH3A 3VSEA 3HR8A 4KPEC 1DMSA 1KWGA 4C0XA 5AESA 4KUGA 3S68A 3CRW1 2GKOA 3L82B 1IHPA 4GRAA 2VI5A 1CDZA 3G8CA 4KE8A 1ZK4A 2IQIA 5FJIA 2YOHA 4FEEA 1R0CA 2GOYA 4RFSA 5JPCA 3VU9A 2CNWA 3HL0A 2HADA 1W44A 4HAWA 2P68A 1GZSA 2IJGX 3L8EA 4LGCA 5GZ6A 4CIDA 3CRVA 2C2GA 3MXTA 2O2SA 2BJWA 3PHLA 2C9YA 3NHYA 4V38A 1Y33E 4JL5A 2DY0A 2RG7A 5DLYA 2BGLA 3GW8A 3K4QA 2OE2A 2Q6KA 3KQNA 3RFFA 3HG7A 2WFMA 3ZI0A 1KO5A 4AN1A 1AQNA 4QUBA 1KJJA 4Q4JA 3UMVA 4L1KA 3PYMA 4M1EA 1YHYA 2QAGC 3FI0A 3GPCA 4NL4H 1QHSA 1ZGJA 3BZWA 4O2BB 4P82A 5AHWA 4AKIA 1EDZA 3K6SA 4JI4B 2J6HA 5ALFA 3A6GA 4V03A 1T9HA 3SYRA 1K86A 2FLVA 4HQRA 4WKBA 3A6JA 3DEZA 3LHSA 2BKAA 3ON5A 4JB2A 2OA0A 1MH9A 2A9VA 1TZCA 2GEFA 2X41A 3COPA 1N5DA 1WLYA 3INGA 1L8XA 2CXQA 2QRGA 1KK3A 2QUKA 4BBPA 1O9BA 2JBAB 2NVBA 2WIGA 3NYQA 3E9RA 1ZGCA 4WK2B 3OEHA 1AGRA 5IDWA 3PQEA 2QRVA 4NCXA 1RLJA 5JH7F 2YYYA 1MOSA 5IM4F 3UV7A 1QFMA 2GD6A 2PH3A 4NF2A 4P6VF 4A10A 2H9IA 2E5LB 3LXUX 4H7PA 4OYYA 2VSNA 1HF3A 3OBBA 4NMHA 4KR9A 4A3SA 1Z6XA 4Q0MA 2R4UA 2ZZKA 4NJMA 2NPIA 3ZQJA 2JI4A 2ZYSA 3Q3EA 1GM5A 4OHUA 4CU5A 4ER6A 2R66A 3JQ7B 4B3MB 2ZTLA 2V9CA 4Y7DA 5K0CA 2VHJA 4L6CA 1XQXA 3G88A 1C8VB 1FEZA 4AF8A 2WJ4A 4RKWA 1DIAA 3FFWA 5IDYA 4J0KA 3HADA 5KC9A 4MUHA 4QGBA 4D9GA 2PYIA 5BRAA 4LQ4A 3EEOA 3HJFA 4L7VA 5DGIA 3TZLA 4HR7A 4U8GA 3VTFA 5JSQA 2JIPA 2V6IA 5DCWA 2AR9A 2FGJA 2VJKA 4ZQIA 3LP5A 4J3FA 4Q1BA 4W5QA 4M1TA 1LTHR 2JCGA 1K97A 5AVZA 2WJGA 1RDFA 3PXAA 5BR8B 3ETGA 2X2FA 4B83A 1MIOA 3KYCB 3BL6A 5EUBA 3I04M 1ULAA 3TB4A 1EBBA 1JP7A 3QOFA 3ZDXB 4N39A 4JJ6A 3OQJA 4M0DA 5DH9A 5JCOC 3GPLA 1NXPA 3K0HA 1PZMA 5T5QA 5HM8A 1KJWA 3E1SA 3K0SA 2YY7A 1OAOA 3HA5A 3HVHA 1DDIA 4TLDA 4B09A 2NZ2A 2H00A 5I7UA 4FVTA 3LZCA 2BIFA 2X3FA 2Z04A 3LT1A 4FK8A 3IDFA 1U6IA 2VNIA 2ZU6A 1YKFA 3DBHB 4PSUA 1DRUA 5ALYA 1QWOA 4DLAA 3VKGA 2AN4A 1SFRA 3FTQA 4TWJA 2NTNA 4DGQA 3PUYA 3QNUA 1EK1A 4GI2A 1M54A 5JHGB 1BKSB 2D5AA 2GNOA 3STXA 3AUAA 5LNK1 3MD9A 3SFVA 4IVPA 2ZBFA 1CFZA 1FYVA 1NMZA 2A9KA 4G0QA 4MLZA 1WXXA 3IAEA 3RVLA 4TZTA 2P62A 1UBFA 2X9LA 3SEQA 1EM6A 3OMXA 1DC6A 4PSAA 4G0XA 3T4EA 2AK2A 3RQIA 1S0UA 2HBZA 2P6MA 5KYNA 5CCBA 4DIUA 2FETA 3PD7A 4EVRA 1S9HA 2ENUA 3HU2A 3MWLA 2XGJA 1FSPA 1S6YA 3RREA 4LMRA 2IV2X 3RG8A 1RC8A 1TW3A 1RYMA 4XZ3A 2FKAA 3WRYA 5ES4B 2CNNA 4AT1A 4YAEA 1VKRA 2VR1A 5HDBB 4FFOA 4IDAA 3RI3A 2QTTA 3K5HA 3BXFA 2LZ0A 5HTKA 2XY4A 4MW4A 4RM3A 1R2QA 1MOPA 4QG3A 4I50F 4E07A 3R2JA 1HY3A 1KI1A 1O87A 3KDAA 2ZRDA 4QGSA 1JU4A 1S7CA 2D5LA 2H08A 4OLJA 1QLWA 1EXDA 5ED4A 2C0PA 1HE3A 1PG5A 1ZRMA 3ILHA 1SD1A 4BKPA 2G40A 4NATA 5EJFA 1SKUA 2PA0A 3VHQA 1OV6A 4QHSA 1GUYA 4B8WA 3CPHA 5K9ZA 4TMVA 1J2RA 1JIUA 1AKVA 1Z6YA 2ZWOA 3HSSA 2FCRA 2RHBA 3FGZA 2QTVB 3PX2A 3ESAA 1TUBB 4FHFA 4JODA 4U7DA 2BFCB 3UKJA 3NFYA 2P35A 1KY3A 1K9SA 4E0BA 3FKSA 5E4JA 1VBFA 2F3PA 1I2BA 2PQ0A 3DBOB 1GUDA 3MTAA 3DKIA 3JYNA 3SJCA 1TJPB 4KVAA 4ZZIA 2EJVA 3LCJA 4D96A 3OQOA 2BGJA 4FIDA 2OFOA 1HNNA 2SBTA 3E7FA 3EAFA 2RGEA 3QXCA 4UM9B 3KJIA 4E03A 4MUEA 1L1FA 1I4WA 3DLIA 5FNVB 1I30A 1Y8RB 3JR3A 3GLQA 1KIFA 3CKLA 3FF1A 1CY8A 1V5FA 2AFIB 1KDOA 3HSYA 3K20A 2WK1A 3LA6A 3PXDA 4RJIA 1UL1X 2Q5QA 4KITB 3IV9A 4ICIA 4BLVA 3GLFE 2AXEA 4FI3F 5ALSA 3ETDA 3IO5A 5A5EA 1AOXA 4CFYA 4UTNA 2HA2A 4TLMB 2C92A 1RYBA 2IYPA 1U1FA 4LOLA 2EFDB 3IIMA 3VJRA 2CXTA 2P69A 3LT0A 4HL6A 1UC5B 4KSYA 3ADCA 4IF4A 3AHDA 4ATNA 2UVDA 3E1GA 4TMWA 4A8JC 2NNWB 4JBGA 1TQ8A 4TROA 4LZAA 2LCQA 5EL0A 1YZQA 2PZMA 4PPNA 2I80A 2GM9A 1I2CA 2QTAA 2WIFA 3IB6A 1T3HA 2B4KA 2I8CA 5CG1A 1WCIB 5KB3A 5TIIA 4NZPA 3SZUA 3WYNA 1Q0UA 1WHTB 3FMPB 4B76A 2HU2A 1IIRA 3HKEA 4JX8A 4X8MA 5EKUA 5IBQA 4B3GA 3V4OA 1VMDA 3PNQA 3PFHA 5MHTA 2C9CA 2X0FA 3UO8B 1QFYA 2ZIUB 4C20A 2J85A 2O8NA 1Y5IA 1VL8A 1YACA 1X94A 3U7JA 1KYIA 2YDXA 3TDMA 3LTEA 5KSOA 1SB8A 1PU2A 3OZXA 4D45A 3PDWA 5EI5A 1SCNE 2JAWA 3N7UA 2HV8A 3EZYA 1LVGA 1RQLA 2PZEA 5EMKA 5CBKA 3AUSA 2QP4A 3NH6A 1LPPA 2MJLA 3EODA 4DC0A 1TE2A 3R0QA 4KR0A 3GEPA 421PA 1LDGA 2BBTA 4PAQA 5FHRA 5I7EA 4NZ9A 2OAGA 3AONB 4E1AA 4YI3A 3NS7A 1D0IA 1QS0B 2YYAA 2E49A 4JVNA 5F33A 4YLYA 4G1MB 1PX0A 5IEJA 1EQAA 3QGMA 1SUFA 2IZ5A 2JVKA 3EVCA 1UPXA 5C31A 4HNSA 4NU5A 4D5EA 1QH9A 1WUIS 3CO5A 3AB7A 1UUFA 1HRKA 4I36A 1ZUNA 1OXUA 3M8KA 3LUDA 5HKBA 2V7EA 4XWGA 4DA6A 1I9GA 2C9BA 2RAFA 3D2LA 4QWWA 1FTWA 5BW6B 2C57A 3DULA 4HGYA 1E3JA 1KHHA 4TMXA 3VR4D 3PC8C 3E3AA 5K0LA 3HCCA 3LVQE 4F85A 4MIKA 1USIA 1XLVA 4RSHA 4BAGA 4D9BA 3AEYA 3L18A 4BAZA 5JSZA 3OJWA 3D4OA 4RENA 2JD2A 1F4PA 2LNDA 2Q8PA 2BT4A 5HCIA 1FBNA 1D7OA 3L2OB 2WTNA 3P5SA 3ZEIA 2CL7X 3UPDA 1T5LA 1CRWG 5C7IO 3EPKA 1L7MA 2ZE7A 1KYQA 2P7IA 1JR3E 3N5CA 1TMKA 3UJ9A 2X2EA 4HYEA 1L7QA 4XIFA 1EVIA 2FW8A 1TM3E 1NVAA 3DXZA 5KQPA 2B36A 1ULBA 4IP0A 1NF9A 3MINA 4HADA 4RY8A 4AP5A 3OTWA 5EIEA 4KBYA 3P19A 4UHFA 1G7RA 3JD0A 4GP6A 3LGXA 4W8HA 2C78A 4WXRA 4JEIA 4OKSA 3FROA 3W8DA 4EX7A 1I7SB 2ZITA 5CLGA 4LFAB 1ES9A 2AXQA 3BTUA 5CNKA 3CVUA 1OI2A 2J9RA 4KQ6A 2BKLA 4LRYA 4TTQA 3QPWA 1KPHA 1RWWA 2CF6A 2H4HA 3T35A 4BLWA 1P62B 1UCFA 2FWJA 3N39C 1IAVA 1WU7A 2QVLA 3A6PC 2GYWA 5DNVA 3U37A 4AFNA 3FNFA 3ORFA 4G4SP 1QONA 4C21A 3C8UA 3JQ7A 5DHFA 2A30A 2HGSA 3K6RA 3WA7A 2JLRA 4QNNA 1ECBA 4V2IA 1UMDA 1Y1TA 4E3ZA 1ZIYA 2R60A 4DIMA 3F8TA 1UBOS 2H2AA 2Q3EA 2OC4A 4FJ0A 3UYLA 5JS8A 4CEHA 4LYDA 4PNPA 2P6UA 4WCFB 1CWUA 3VR6H 5IAAA 1B8UA 4H7IA 5K51A 5I8ZA 1NP7A 3VPXA 4C3UA 1XK6A 4YB8A 4DR5B 2FV8A 3G17A 4NENB 5LBUA 2VDMB 1BDBA 1IZ9A 4WK0B 3BMNB 3ZBTA 4OIMA 2DUJA 4EUHA 1RLTA 2WSMA 4FFSA 4L5JA 4BUZA 5B6JA 4LJAA 1N25A 2JLSA 3F9RA 5I6DA 5CT9A 5JAPA 1YAJA 2C95A 4FB5A 1EK5A 2UXBB 4ABTA 4KIGA 3KD2A 1YV9A 3MFQA 1X7XB 3CNOA 2HDWA 2PX4A 2XUPA 3M9LA 4MVJH 5TQJA 3D8SA 2XUJA 1YRWA 3ICCA 5A2QA 4E3WA 1IXRC 1WBJB 3M6VA 1USWA 2FMXA 1YI1A 4REOA 2FFJA 2PLFA 4KWTA 3SM3A 2ZJ1A 4L08A 4E15A 3KFVA 4QX6A 1HLPA 1PVDA 3TWOA 5F52A 5K5EA 1XEXB 1K5GA 1RLOA 2HJGA 3AM5A 4PWZA 3HACA 4RLQA 4DL9A 5AM2A 5AVSA 4FMDF 1OMOA 2ZANA 1Z22A 3S2FA 2HPHA 3FGOA 5HOQA 1NUSA 4Q34A 1FVHA 2W4IA 3HY6A 4U0KA 4Y2QA 5JNVA 2DM6A 1I6KA 2C2OA 3FJYA 3GPIA 4G86A 4HWRA 2VTBB 1PKXA 1RVV1 1FMLA 1TZKA 2JAQA 2WUEA 4ZVVA 1XQ6A 3R7WA 4M22A 3W05A 4BO5A 2PL9A 1XZJA 4BATA 3FDJA 4Q82A 1UAAA 2EDAA 4DUPA 2NUAA 3EQZA 3I42A 2HSGA 1Y6QA 4Z0HO 4P3YA 2GD1O 4KK4A 4MWZA 2VJAA 2Y2VA 3ZQ6A 7REQA 2Z5FA 5KREA 2B99A 3FIUA 3SI7A 5DHAA 1SCBA 3KQUA 3FDZB 4GXQA 2XCRB 3P4YA 5EINA 4PZLA 4Z7OB 3LZDA 3ZWKA 3AR6A 1U8ZA 1XF9A 2GD0A 3EULA 3PFWO 3BERA 4DTIA 4EYOA 1TKBA 2BEWB 4YAGA 2D59A 3FCUB 4RTJA 1NVBA 2GAOA 5FTJA 3R7BA 3LY9A 4NXNB 2BZ1A 2REBA 1DTWB 1SXJD 1CUYA 1ZGBA 2B7LA 3NTOA 4EB0A 3T5BA 1KZ9A 4OMFG 3DV0B 4W9MC 3CRRA 4J2OA 3H5TA 4OBEA 3UC5A 1GLNA 1VKOA 1XCBA 3O0TA 1XJ5A 2KPOA 3F49S 2QUJA 3WIUA 5JAHA 5FBLB 4QM7A 3FCSB 2OC9A 4JDPA 5H80A 1U9ZA 1G20A 3H2SA 1N2JA 2IIQA 2UZ3A 4BQFA 1Y8AA 2DR2A 1KZGB 2HIMA 3OA2A 2ZOSA 1Z5NA 4OH7A 3PBKA 1GPUA 1MRSA 3EXAA 4GGOA 1YR3A 2O1XA 4R2XA 4YUAA 4M0PA 2G76A 5LN1A 1TYBE 2SKCA 1DRWA 2AQIA 2KBFA 1SQGA 1G98A 3CUVA 3EVAA 4FP9A 2OPHA 4WN9A 3UQYS 2MMGA 1ZKMA 2NV6A 2PKRA 3OUZA 1H2YA 2IYYA 2CFIA 1UBNA 3PUVA 3VTKA 2O14A 2O2JA 4H35A 1XVTA 4XRRA 5E9AA 1T29A 3E23A 4GRIA 2ZDGA 2I8AA 1RAFA 1D03A 1NVDA 2EKLA 3QUAA 1W1IA 1FP4A 2MSCB 2O0KA 3NATA 4JB8A 1XL1A 2LR0A 3B6MA 3K30A 4FTWA 1RHRA 2WKPA 4L72A 1TLFA 2PX2A 2X1MA 4WY5A 5JEEA 3NALA 3BG5A 2AW3A 4QOEA 2G70A 3O4GA 1VYUA 4KWCA 4BLPA 4CKXA 2NVOA 221PA 4BX9A 1VKZA 4FFBB 1T24A 4JYPA 1NT4A 3ZVLA 3E9QA 1XAJA 3SC4A 2HW8A 1SOWA 3WNCA 4GM0A 5ESRA 1E0KA 2HQOA 1F2TB 1JB1A 5CCXA 1BKYA 5DNUA 3GC6A 5CA1B 2XMSA 5DNAA 3WLLA 5KNBD 4RMHA 1BS2A 1M8KA 2GCGA 4IJ6A 1N7JA 4XSGA 1VCMA 2ZI9A 4W9RA 3MS4A 4QT0A 5FYDA 3Q7EA 5LZ5A 4JJIA 5LSAA 2PUVA 5C8VA 4QXMA 1AKNA 4XEHA 5JNTA 1IONA 1UKCA 1OI4A 3Q12A 4GLLA 3K8OE 4FZJA 4IQ4A 4AUMA 3FWKA 3LC0A 4D26A 3SS9X 1NN3A 4P3KA 4R1NA 1KJZA 4DV0B 3F6SA 1B3RA 1CHNA 2IYNA 2W6QA 1G8SA 3ELUA 1CQXA 4ZYTA 5B57C 3JQ8B 3H9UA 3OIGA 3Q4GA 4KAAA 5H16A 2C97A 4DA8A 3EUFA 2QMHA 2D1YA 4U7PB 3S7TA 3WGIA 5AOBA 2JFBA 5BYBA 3X44A 4C4AA 4IO1A 3AB3A 1CUUA 3FSGA 5IKOA 2X5XA 3O3CA 2EWWA 4ZYVA 2RHJA 1O96B 5TVKA 1M10A 2ZLBA 5FEUA 3EJWA 4OHRA 4A8TA 4QRDA 3B20A 1VP3A 2UUPA 3IP3A 3QNMA 3BWMA 1JDBC 3IFSA 1GILA 3GARA 4RGQA 4M87A 3WLSA 4DLLA 2R6R1 2RGCA 3FCYA 5G0TA 4IV0A 4C6HA 1MHTA 3QXHA 1C7IA 2I7VA 2WINI 3DBHA 1NMXA 4FE7A 3JARB 5BVGB 2YRWA 2EXXA 4B4OA 1M2WA 1SR8A 3M0EA 4BO3A 1ZJJA 3B2NA 3LWNA 1M74A 1Y89A 1G38A 1WF6A 3MRSA 3N6XA 3H16A 2QYOA 1WVGA 2O3TA 2O20A 3HO6A 3MIIA 1GPAA 1FNDA 3PPYA 4KQHA 1YBMA 2F59A 5M2QA 1NDQA 2I7DA 3BIFA 3K70C 4GW3A 5FNZA 1M7HA 3EAGA 3KQWA 3MEQA 5AKJA 3OEWA 3I01M 3ODGA 4DNQA 3DZIA 1BD4A 2JATA 3M2TA 1Q2XA 3HSKA 2ZBEA 1QLHA 2CYBA 3GMDA 5HX7A 3LPCA 2CL0X 3FDXA 1I4TD 3IB3A 3PIDA 1E9DA 4EBBA 1ZD2P 2JI9A 4PO8A 3GZ4A 4DCMA 2P78A 4E1VA 3T52A 3ZE8A 1NA5A 1QIHA 1PFGA 4OK5A 2G88A 2JI8A 2ZR9A 1HOTA 1GTG1 2R6GA 3DW3X 3E6AA 4I5DA 3D7NA 4JB3A 1XAGA 3F5DA 4AWXA 1N2ZA 1THZA 2GX6A 1HR0B 2HWXA 2WUGA 1YHNA 3L1KA 3QLVA 4FNGA 3QZUA 3F1LA 4Y2VA 4YJHB 4KOAA 4FDAA 3OICA 3I0NA 3UV3A 3WLNA 2GNPA 1FXWF 4D8WA 1HEIA 5MN4A 3O90A 3W04A 1ODIA 4BECA 1F0NA 2GR9A 1VECA 3HUDA 3JYOA 2EV9A 1T3SA 1RKUA 5A7HA 4L9WA 4JLVA 1FFGA 1Z18A 3RC1A 3KLPX 4AMVA 3THXA 4TKVB 4YRZA 1TAUA 4CJXA 1B8NA 1DKQA 2VTVA 4W6ZA 1O97C 3WFZA 4C01A 2FUG1 4AXBA 1F3OA 1DEOA 1WG8A 1FQJA 3S1LA 2WLTA 4DZTA 1HL7A 3TM4A 4RD3A 3WFIA 4UKDA 4PR0A 1EP2B 2KSQA 3HZOA 4OIFA 1VSBA 4X1YA 4B2IA 1V1RA 3C15C 2XCTB 3BIXA 1JHOA 2HJ9A 2MT9A 2FPLA 4BRWA 4BX0A 1G9XA 1P33A 4DA7A 3RIEA 1OWPA 2A0KA 3R76A 2C7OA 2WA1A 2XZPA 1UADA 3N5KA 4DCGA 4TM7A 3WP0A 4E11A 4WN3A 1XNRB 1W88A 2QNRA 4WOPA 3VYWA 2C1ZA 5DWDA 5AVKA 1FSGA 2W6CX 2PMEA 4IYRA 1H2RS 1IZ0A 4Y2UA 3V8PA 3WLOA 3QWHA 5EJ4A 3ZXYA 2Y76A 2O8CB 4ZYYA 1P2GA 2M32A 2PIAA 2AG0A 2WIAA 3BZUA 4FJ2A 1DV1A 3N0VA 1E5QA 3PUIA 4BWVA 4WBNB 3TJMA 1CT9A 1XGKA 4JP3A 1QPBA 1GEEA 2XYGA 1XA3A 4XM1A 5E9WA 1K4KA 3ZWMA 3UEOA 1TLLA 5KAMA 1E0SA 2PMWB 1V11A 2WWTA 4PZEA 2G4CA 3IAHA 3HRIA 3DLCA 4OUKX 2AF4C 4QVKA 4Z99A 2D2FA 2YMQA 1JMVA 1GNSA 1X1BA 4YMIA 3ZZ0A 3PV0A 2FRDA 4KX5A 4DC9A 1NXSA 5LOVB 4J0HA 3OU7A 1RM0A 4UHBA 3CX6A 2PXAA 4KO2S 4JJFA 5LQAA 3ZD6A 1CF2O 2AN9A 4X1IA 4EJ0A 2W2LA 4I7EA 4IDPA 1I3NA 5DF1A 1JDVA 2HQ1A 4C87A 3X0DA 4OCZA 4OH1A 3KOMA 4JUIA 4XVRA 3AIOA 4JYMA 3IIIA 1IJKA 2Q3BA 3ACDA 5CXQA 3IX7A 1MG0A 1P74A 2XYPA 1WPQA 4IJ5A 3P0EA 4WZAE 2PXCA 1I1QB 1WABA 3FDFA 1L4HA 3R20A 2J32A 1IWPB 4GC5A 3RKSA 3U9SA 5KDOA 1P17A 3JASA 3N7TA 4TYPA 1OFTA 2D4AA 1KQFA 5FL3A 5BN1A 2FK7A 1XLTA 5JYEA 2IZOA 2CNLA 1FQOA 4J3NA 3NVKI 2YFKA 4BLRA 4BEWA 3SEZA 1N9GB 1FRFS 2ZI3A 4J1QA 4OPMA 4R81A 4B7ZA 1OBOA 1IXZA 3CNQS 3HRHA 1KQPA 2FFRA 3DMRA 3BCUA 3E1KA 5IKMA 3NHSA 2ZFUA 1U0GA 1SCUA 3C3AA 2Z0MA 2NMVA 2QV0A 3QJ5A 4RA6A 5CPFA 3HR4A 1GGEA 3AF6A 2O4CA 3Q5GA 3BCSA 4LXQA 3R7SA 1VSUA 3LPMA 3A9CA 3NKLA 5HOEA 4OHBA 1IYZA 2AMFA 1LPBB 3FDZA 3GZNB 4WI1A 1YVRA 1YWGO 2BGKA 3IQIX 5B6IA 1J8QA 3ZU2A 1C29B 3LQQA 3TOZA 3DLAA 4NOLA 2VF2A 2YX1A 5EYPA 2OXTA 3RLFA 1GGJA 1OXKB 2VTBA 3ANYB 3N9IA 5G02A 1WB9A 3ZXXA 5JWHA 1MZPA 1YZGA 1WU8A 2Q1UA 2Q6TA 3SEFA 3T3MB 4CKCA 2HCRA 2IUYA 2Y2UA 5KMGB 3CSUA 1EPUA 1Q7RA 5CR9A 2BRUC 1QMGA 3ZDZB 1JU9A 5JU6A 2BGUA 4MEAA 3RJZA 2CLFB 3ER6A 4HLUA 1YB6A 2XMCA 4BVFA 1AA9A 4F2WA 3CN7A 2P9EA 3B5JA 3JQAA 5K0JA 3OQHA 3N70A 2ZBPA 3O1LA 1B15A 4WCFA 4YK7A 4WNIA 3OOEA 4REMA 2IYQA 2OENG 4P4NA 2GBFA 3GEBA 3LX6A 4HC4A 1LS6A 4MV1A 4ZYLA 1LC0A 2NGRA 4KRGA 1SZCA 4LC1A 4X63A 1S3FA 4DMKA 4EB3A 1Z0JA 5JAMA 1FP1D 1IU9A 1A4XA 3HUTA 5DN6D 3GQVA 4ZDIA 1GNPA 2MMCA 1XN1A 3KE9A 2I65A 4BXOB 1AIPA 2WICA 1IZ8A 4HDMB 4Q3LA 2CV2A 3KQMA 5DI3A 5J58A 1Y5LA 4W6QA 4PGAA 4FHDA 3GI1A 5LL6P 1ZS9A 2EYQA 2E3JA 4FS8A 3TJZA 3TXYA 1KZ6A 2A7XA 1MTOA 1YGPA 2ZIAA 4HQFA 5FV4A 3DS8A 1EEXB 3TOSA 3PC3A 3IEPA 4HBGA 1Y81A 3E84A 3FYSA 3MGAA 4EVSA 4HO1X 3LP6A 3CSSA 4M9UA 4DSOA 2UUAB 2GBPA 3L02A 1A7KA 4IGKA 3Q0IA 4OMDA 4R6XA 3ZLUA 3B1VA 5DSXA 1LBQA 1ENOA 1J00A 2ZETA 3FPEA 1H23A 2ZWVA 1PR2A 3HB0A 3OCZA 4WKOA 3JQBC 2ZRMA 3ROXA 1CXZA 3V9PA 4HX5A 5GGXA 5FCDA 4EQZA 2XUIA 5CT6A 3UMSA 3ZHOA 4BMSA 4D6PA 1DAMA 2V6JA 1DVRA 3M4YA 5KZMB 4DJEC 3UT0A 1I3LA 2BMAA 1Z4IA 4N12A 4WBNA 5KTPA 4DV7B 1AX9A 3JCZA 3B1KA 1IDN1 2O5CA 3MWFA 4H7EA 3ECAA 4UFPA 1II8B 4N4AA