1PJBA

L-alanine dehydrogenase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
361
structure length
361
Chain Sequence
MEIGVPKEIKNQEFRVGLSPSSVRTLVEAGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRVGLTAIAYETVELPNRSLPLLTPMSIIAGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVPNMPGAVPWTATQALNNSTLPYVVKLANQGLKALETDDALAKGLNVQAHRLVHPAVQQVFPDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ALANINE DEHYDROGENASE
publication title Analysis of the structure and substrate binding of Phormidium lapideum alanine dehydrogenase.
pubmed doi rcsb
source organism Phormidium lapideum
molecule tags Oxidoreductase
total genus 112
structure length 361
sequence length 361
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA02
5JSFA 4GSLA 3VTZA 1KIFA 1O5IA 2FMUA 4EEZA 4CLDA 4RPKA 3PQFA 4ZD6A 5T6BA 3ZW9A 1YO6A 1DC3A 4PGFA 4CV0A 1WVGA 2Y0CA 4RVFA 1OI7A 2VHXA 1CERA 4U0JA 3QP9A 1Y9AA 4MVJP 4XR4A 5IN5A 5BNIA 5KOIA 3E5MA 3CH6A 2E4AA 1VJ1A 1LLQA 2X7HA 4CQMB 4II3A 1X1TA 5DDIP 2PZLA 3PXXA 4BO4A 1VJ0A 4HFMA 1XKQA 1Y8QA 1MXHA 3NJ4A 3INRA 1CJCA 1EQ2A 1ADBA 4NIMA 3COSA 4KUEA 3M2TA 3MWEB 5C3MA 2ZB8A 3WWYA 4QUKA 2ZYDA 4UUPA 2R00A 4B4WA 3C24A 1SEVA 1OMOA 1DIBA 3B20A 1E1MA 4JGBA 4LRSB 4RZHA 5T64A 3UW3A 1UDCA 5JCXA 3OSUA 1E6WA 3V1YA 4LW8A 5BNFA 3AY3A 1OC4A 5A9SA 1X0VA 5TC4A 2FWMX 2PKQP 5I8ZA 4DRYA 4J91A 1VE9A 4EUFA 4JXKA 2GERA 1KY5A 2AEMA 3UCXA 4LGVA 3IS3A 4H16A 1PS8A 4YEDA 2V7PA 3OJLA 1P0CA 2SCUA 4DPLA 4OSPA 3I9LA 4BNJA 1QG6A 3FN4A 5COBA 4IMRA 1BG6A 1LDGA 3HN7A 1E7SA 2ZB7A 5L40A 4FFOA 3Q0EA 2QQ5A 4NJMB 1WZIA 4JP3A 1NR1A 4JJFA 4N5LA 1HE4A 3NGXA 1VC2A 4ITUA 4ALMA 3V2HA 3NT2A 1U3WA 1LJ8A 2B5VA 2HRBA 4XQGA 4AFNA 5L7TA 1GCUA 1A71A 1ZK0A 1PGQA 3S2EA 1ZZEA 4A03A 2IYPA 3HDHA 2W98A 4LVUA 1XGKA 5IDYA 1F8FA 3PK0A 3ICPA 1EEHA 1PQPA 4NNJA 5AXDA 4MO2A 5KIAA 1FDWA 1E7QA 3D3WB 2PY6A 4FFLA 4BKOA 4M86A 4E31A 4Y6RA 3RROA 4XJTA 1A4UA 4XYBA 4R9SA 3P7MA 1DC6A 3I23A 4CL8A 2NU8A 3AI2A 2NVUB 4CUKA 4J7XA 2G0TA 3S55A 4Q9NA 1ISJA 5CG1A 4OL9A 1NTOA 2EV9A 3IMFA 1BW9B 1UXJA 3UUWA 4XDZA 4YAGA 4RDHA 3C7CB 5U4QA 1H93A 4IS3A 3LVFO 1LTHR 1DB3A 4RGBA 1NM5A 3TZKA 3JQAA 3GVPA 1C14A 4L8VA 1HDOA 1D1SA 3E9MA 3C7DB 5AXCA 2PV7A 4E2ZA 2FRDA 4OMUA 4O63O 3S2GA 1E0DA 2DBQA 1Q0HA 1PTJA 1ONNA 2EJWA 2GLXA 3GHYA 1NNUA 4AJOA 1Y8RA 2BHLA 4GKVA 3FNEA 1O95A 3NKLA 4LSMA 3KV3O 4BQPA 5G2OA 3WX0A 2YHIA 3NDRA 4DGSA 1HDGO 5JE8A 4LN1A 2GYYA 3ZCXA 3BA1A 4E5MA 2AQHA 2P4HX 3PLRA 4WLVA 3L9XA 5JCJD 1EDZA 2C2XA 2PGDA 4WLOA 1P3DA 2DFDA 3K31A 4NBRA 4Y6SA 4JP2A 1GY8A 1R4NB 3WNQA 5IZCA 1LSJA 2H1SA 1HYHA 2C2YA 1AXGA 2CZCA 4DUPA 1T25A 1Q7GA 2Y1OA 4G5HA 3TNLA 1NPDA 2FPPA 1HYGA 2GN6A 2WDZA 3KSZO 5H82A 4YWJA 4DPKA 3JV7A 3PJFA 2HAEA 1G6KA 2VHWA 1Y5MA 3AUAA 3BMCB 4ID9A 1GD1O 2IRWA 5JYDA 4E32A 5L9AA 3JYLA 4BMVA 3PI7A 4OYRA 1KETA 1SEPA 1C0IA 1YQXA 4K1LA 3GVXA 3HNPA 5IXSA 1XDWA 3DBLB 2NUAA 4L9RA 4PG4A 4YB8A 4B4VA 1K89A 4BNIA 5KJCA 3KVOA 4E21A 1YJQA 2V6MA 4FW8A 1DIRA 4HV4A 3RC9A 5AQ1A 3H4VA 3D4NA 3NAQA 3QSGA 2HMUA 3AM5A 3G17A 4OHUA 4Z3KA 3LT1A 3ANLA 4NK5A 4XRGA 4AJPA 5DBIA 5G0TA 3FTPA 3WBBA 3H2SA 3TSCA 3JQ8A 3EYWA 5JAZA 4DBZA 1FDTA 4Q39A 4YQZA 4E0BA 1WDKA 2JCXA 3D4PA 4CM4A 3OA0A 2R6JA 3ONFA 2WMDA 4D42A 3K30A 4PLGA 3WQQA 2HKIA 2OBNA 2X5OA 4WLNA 4W9NC 1HDCA 1N2SA 2WD7B 3TRIA 2BFMA 3G79A 1DO8A 1XEAA 3FD8A 1QKIA 2PLAA 5BR7A 2Y67A 1LNQA 1TLTA 3DAGA 1HSZA 3PFWO 3I6IA 4I5GA 4IXTA 3RU7A 1UXHA 2HSDA 2ZIZA 3PYXA 3QVTA 1EK5A 5JDCC 5EJ2A 3AW9A 2C82A 1H5QA 3PGXA 2QIOA 1HE5A 1GU7A 4I9HA 4RPLA 4EEXA 1ISMA 5BSFA 1P33A 4N18A 1NAHA 4YA6A 3ZWAA 2UAGA 1UXIA 4CLRB 1QR6A 5DN9A 5A05A 1IL0A 1CDOA 4LCEA 4XA8A 4CM8A 3ZNOA 1DBVO 3HB5X 2DKNA 2GF2A 4C4OA 3AM3A 1R0LA 3SVTA 4YAIA 3BMNA 2VTEA 3GH3A 3HFSA 5KKCA 4ZQFA 1Y9EA 1HDXA 4AJIA 5KJ1A 1JKIA 3RD5A 5JMWA 2DT5A 4MP8A 2NADA 3BHIA 2XF8A 4GQAA 4IPTA 1NAIA 3GGOA 1EZ4A 4CMHA 3JQFA 3AU9A 3O8QA 3NEPX 2HMTA 2D3TA 1PGNA 4O0LA 3Q1LA 4G65A 4GSKA 1NWCA 1B8PA 3IOYA 4RQUA 5ICSA 1T1RA 4WNIA 1BHSA 2V6GA 4PLHA 3S2FA 1H6CA 1TXGA 3JD4A 1OC2A 4DC1A 3AWDA 2GR9A 4OJNA 2X0RA 3JQ9C 3AOEC 3KUXA 4XQ9A 1Y1PA 2F1KA 1V3UA 1GZ3A 3LT4A 1U7TA 1CETA 2EWMA 2OP1A 4J49A 1ZSVA 2AHRA 2IZZA 4CJXA 1JN0A 3GZNA 4U6QA 4CLOB 4Q3BA 1LC3A 1Z74A 4Y6PA 3IQDB 1I5RA 4WECA 3PJGA 3KOUA 3WOHA 1JWAB 1UDBA 4NPCA 5I9LA 1F14A 3E82A 4J90A 4FJ0A 4PZCA 1QYDA 2I67A 4NHEA 1E3IA 3WIDA 3UFXA 4UULA 3VPFA 1P44A 3JYNA 1PQUA 4XCVA 2B37A 3A4VA 2DBZA 4PZEA 3WDSA 4GWGA 2RH4A 3JYOA 4WKGA 1HT0A 1W4ZA 5G0VA 1U3UA 3CZRA 3ETGA 5IJZA 3VZPA 3WGTA 1OFGA 5DOVA 5DNAA 3KETA 2A92A 4KWHA 1FDUA 2YYYA 4MIYA 5IDWA 1BMDA 5HS4A 2JAHA 3SJ7A 3DFUA 1HLPA 4RLSA 3EC7A 4WLFA 4DL9A 5C7OO 4RF5A 4ZU3A 1F17A 1MX3A 1UXKA 2P4QA 3AFNA 2D59A 3DZKA 3FRJA 5AOVA 1T26A 3ROKA 3C3XA 1BSVA 4PG6A 4XYGA 1ZBQA 5CEEA 3ZWOA 3ZU5A 4AJ4A 1IOLA 1XR3A 4II2A 3WB9A 3VZRA 1O0SA 2A4KA 2EHDA 2CMDA 4YDRA 5DF1A 4YT2A 4GGPA 3PRJA 5K6AA 4Y67A 3OIGA 3R3SA 3PHJA 4CPDA 3OJFA 1PL6A 1SOWA 3U49A 4HXYA 3UHAA 2GCGA 2AMFA 3RBZA 2H5LA 2QHXA 2P91A 1BXKA 3DBVO 1A27A 5L3ZA 1WAMA 4KZPA 5CDTA 3F47A 1PL8A 5B37A 3ETEA 5EL0A 4E4YA 4PVDA 1DJQA 1F8GA 3ZWYA 3W4IA 2VTDA 1NPYA 4Z9YA 2I99A 2C7VA 1PZGA 2TMDA 4D44A 4E2XA 5FYDA 2DFVA 2DM6A 4NU6A 3RCBA 1J0XO 2YDXA 4F6CA 1VSVA 4R68A 2IZ1A 4WCFA 3CZMA 3OEYA 5ADHA 4FDAA 2A94A 3QV1A 4IDBA 3D3EA 2O7SA 2ZCUA 4DWVA 3A14A 3G1TA 4O5OA 1ONPA 2PZMA 3E9NA 4Q3AA 1MXFA 3UN1A 1QV6A 3LSYA 3QVSA 1UZNA 3ZV3A 2WE7A 2B69A 3H5NA 5A04A 9LDBA 5DT9A 3F46A 4D46A 1CQIA 3ZN2A 2WYVA 1LLDA 1ML3A 1ENYA 3AJRA 1CF2O 3DB2A 1U8FO 1DAOA 1W6UA 5B4UA 3OHSX 1HDYA 3LYLA 1PGOA 4WLEA 1RKXA 3RIHA 2IZ0A 3B1JA 4FOOA 5BSHA 1E92A 3L4BA 1JDJA 3RUFA 1C1XA 1NHGA 2HMVA 1CRWG 1KEUA 2Q99A 4YVFA 4FN4A 3JQCA 4DLLA 5C7LO 3HHPA 4XQCA 3VHRA 4J2OA 3RVDA 1AN9A 1PQWA 1IZ0A 3NT5A 4GL4A 3CXRA 1MG0A 1YBAA 3BMQA 8LDHA 1JKJA 2W2KB 3W8EA 2O3SA 5J23A 1RPNA 2BKAA 3EVTA 2JL1A 3B70A 4JN6B 4CQLB 1BVRA 3ZW8A 5EQDA 3IL2A 2CVQA 1IHYA 2D2IA 1SPXA 4YCAA 3UF0A 1HE3A 2PTGA 1GUYA 1H9AA 1SO8A 1FJHA 3GGGA 2Q45A 5L45A 4BGVA 2FY8A 1PGPA 3BMOB 1T2AA 1UAGA 4MPDA 1A9YA 1Y6JA 1U9JA 2QW8A 2X23A 4R9RA 3ULKA 1EE2A 1L7EA 1PZEA 4H15A 2AG8A 5HA5A 1P9LA 3GVHA 3FSRA 1KEVA 2Q2WA 1JAYA 4BNYA 1UZMA 2X9VA 4MVJM 5JDIA 4BB5A 1BVUA 3PIDA 5H83A 1YBMA 5F1OA 2VYNA 3HUDA 3OECA 2X0IA 3WJAA 4Q3CA 4XIYA 4Q3NA 5B4VA 5ICMA 3H9EO 4UUNA 4NK4A 4B7XA 3MJVA 3LLVA 4NBTA 3PZRA 2BF7A 4XD2A 1XU7A 1ONOA 1RWBA 4Z3DA 3UAGA 1T2CA 3NYWA 3WLEA 3PFFA 5IG2A 2VZ8A 2CDBA 2O3QA 4OSOA 1AHHA 2OMEA 5F21A 3UCEA 1D1TA 4TKLA 5BSEA 2HK8A 2J5QA 1IHXA 5KVSA 3OIDA 1R4MB 2OFPA 3KHUA 4YT8A 1V8BA 4GVLA 1NVMB 5KCZA 1ADGA 3JSAA 2Z95A 3RJ9A 3L6DA 4W4TA 2VWHA 1M75A 3GFBA 1LSUA 3GGPA 4Z6KA 5KKAA 1KEPA 3D5TA 4BKUA 2P2SA 3LU1A 4GI2A 5JO0A 4N5NA 3GR6A 4HFJA 4DTIA 2VN8A 3LQFA 3NGLA 4KDEA 4LMRA 4YPOA 4QEDA 4RPHA 3WQRA 4XWYA 1VRWA 1G0OA 3C1AA 3I9JA 1RYDA 2FR0A 5TF4A 2WM3A 5I7FA 3CE6A 3E18A 3VPXA 2Q4EA 2X0JA 3U3XA 4PRLA 2J3KA 3QRWA 3VZQA 3TZCA 1G1AA 4RORA 3ZI0A 4ALNA 2PD3A 2NNLD 4D3DA 4D45A 2X1HA 2IEBA 4E2YA 1LX6A 4D79A 3RFVA 4OKNA 3JQAB 4J9VA 3KYDA 2Y1CA 4XGIA 4KQWA 2OZPA 2ZKLA 5KJFA 4J6FA 5F3RA 3M1LA 3KO8A 3C1OA 3JYQA 3DWFA 3LC7O 4E3ZA 4D0RA 1QV7A 4J4BA 4JJGA 5JLAA 1V0JA 4IIVA 3ZU2A 3X2FA 5EPOA 3ZWMA 1YXMA 5CEJA 4ZA2A 5A9TA 3U9LA 2AEJA 3AUSA 3NTQA 1YS4A 3SC6A 3ZV4A 1M67A 4YACA 1ID1A 3V8BA 2VNSA 5HTOA 3ZWXA 2YFQA 2WEKA 3GDGA 1B15A 3UOGA 3WYCA 5CFZA 1LSOA 2X5KO 2Y1GA 2JFHA 1YDWA 4A10A 4CMIB 4ZQHA 4QFDA 4ALIA 3DZFA 4M87A 3DZHA 1NQTA 1U2GA 1RM0A 2NV6A 1UR5A 1GZ6A 4WASA 2VCYA 4WPGA 3AUTA 1PJ2A 5L51A 1K5HA 2OOSA 4HWKA 1P45A 1GEEA 2JJYA 4HNHA 1ISIA 3V2UA 1DJNA 3FCOA 3ONEA 5ITVA 2W2LD 2C59A 2YFHA 4GMFA 3WMWA 3D64A 5L4LA 1PJTA 4FFMA 1I3LA 6ADHA 1IY8A 1V3TA 1E5LA 1DXYA 1E3LA 4GVXA 2RH8A 3LC2O 1H9BA 4GAEA 4AICA 1TT5B 4BNWA 4A5OA 2HK7A 2VZ9A 4INAA 3GPDG 2EW8A 5T8KC 4MP6A 1QYCA 4CM7A 3NDJA 1AXEA 1NQ5A 2O3UA 5I7SA 1DRWA 4GLOA 3UICA 3VH2A 1QLHA 1MA0A 1R15A 4W99A 5TJHA 3W4JA 4U5QA 4N54A 4YJGA 2C5AA 4CL3A 3JQ8B 4D7AA 4WK6A 1GQQA 5CHEA 3WXBA 2BGMA 3L07A 2VHZA 3PHIA 3PWKA 4K9DA 1HKUA 1F0YA 1YL6A 3VAZA 2J6IA 1PGJA 2Y99A 4XKJA 1KC3A 1BDMA 3HB4X 3OICA 3RUHA 1T24A 5MDHA 3K2BA 4OOFA 2WSBA 3WSVA 4FR5A 4TRJA 4RVGA 5FI5A 4FFNA 2BELA 2RIRA 3IKTA 2EP5A 2RHCA 3T4EA 3ZH2A 5TRTA 3U62A 1O8CA 4B4OA 1W8DA 3GY0A 3JQBA 4ZVVA 4BNTA 1GCOA 2B35A 1U4SA 4AJNA 4EI2A 3HFGA 3I83A 4A26A 2PKQO 2D5CA 1PEDA 4YJFB 2O50A 1NFRA 1IE3A 4R41A 3K6JA 4FJ2A 3MOIA 1HDRA 2GRAA 3UCFA 3JD1A 1T4BA 3Q9NA 3IIEA 3GDOA 2HMWA 4CMKA 3H9QA 5DBFA 4ALJA 1UH5A 4AG3A 3KZVA 2Y66A 4MVJI 1VKOA 4P38A 3VOSA 1ZIDA 4R4JA 4BUCA 3WGQA 3MJSA 4GKBA 4I9NA 4QECA 1QORA 3CINA 4CMBA 4AJHA 1PJ3A 3WNVA 1HDZA 3MTJA 1MLDA 4AJJA 1ULSA 1E1LA 1PU2A 1GV0A 1B3RA 3O8QB 4Z9FA 3BHJA 3JQGB 1M6WA 3INTA 4B3IA 4CM9D 3QE3A 3NTRA 4HFRA 1EVIA 3TFQA 4ESOA 1MB4A 4FGWA 5BQFA 2EGGA 5TNXA 3WICA 1LDYA 1FMCA 3DDNA 4TRRA 4I5FA 2WWRA 1XHLA 4KWIA 2X9NA 3TL3A 5I8WA 5TSDA 3FWZA 5CDUA 3PPIA 4QO7A 3KLPX 1CWUA 1HZJA 2JHGA 4KDFA 3EK2A 3WG9A 1DOHA 1ZKMA 4H7PA 3ITDA 3L4SO 1E3WA 5K6AC 5TLSA 4JQCA 3PLNA 1KVSA 5I7EA 3GDFA 3M1AA 4E33A 2NSDA 2DBRA 2PFGA 2VUTA 3DMTA 4PLFA 1SZJG 1N9GA 2J3HA 3HN2A 1IYZA 1UXGA 3EZYA 4B8WA 1X7GA 5LCXA 1VL6A 4OXYA 2V6FA 4U0KA 1IPEA 5DBGA 2AEFA 2QYSA 2I9PA 3QWHA 3EVNA 2VRCD 4M49A 4Z0HO 3WLFA 4BB6A 4XB2A 2OBYA 1MC5A 2Q2VA 1PJCA 1T2EA 5JYEA 5KJ6A 5JNLA 2HLPA 4WCFC 1L1FA 1UJMA 1DFHA 4D0SA 2EW2A 3GT0A 3IAHA 3EDMA 5ES3A 1LUAA 3WGOA 1M66A 3DBRA 3HDQA 1EMDA 2A35A 4LK3A 1OBFO 2O4CA 3ZWCA 3F5SA 1GUZA 2ZTVA 1RYEA 2Z1NA 1NQOA 4XRRA 4BO1A 4BO2A 4ALLA 4M54A 2OHXA 3C85A 3ZU4A 1EVZA 4F6LA 3DO5A 4BGUA 3ZWWA 4OQYA 1JAXA 1AE1A 1H6BA 1LLUA 1XWFA 4YAEA 4BNGA 4R54A 4BIIA 1A4IA 2FSVA 4CMGA 3GHHA 2ZB4A 1LQUA 2G1UA 1YL7A 2RAFA 1BDBA 4EUHA 1ZXLA 5CPBA 2QG4A 1I2ZA 4YRDA 3W6ZA 5HM8A 1EFKA 1E3SA 4F45A 5T57A 3I9OA 2P5YA 2Q1UA 4UEJA 2BFPA 1HF3A 1E7YA 3GK3A 3H9JA 4LISA 4RVHA 2HUNA 4WOJA 3RJ5A 3V2GA 4CQMA 5K0ZA 1R37A 3O26A 4ND4A 4D41A 2OXIA 5U1PA 4BO9A 1QLJA 2DUWA 4XX0A 4D43A 1JTVA 3X2EA 5C7IO 1NX6A 5FEUA 3VH4A 1MP0A 3HE3A 3LF1A 1UDAA 4J1QA 1P1RA 4BV8A 4XJSA 3WSWA 3JQAD 4TVBA 1ZO8A 5TX7A 3VZSA 3FWNA 1XYGA 3LDHA 1U28A 2NQ8A 5FF9A 2EJVA 4CR6A 5BSGA 3JQDA 1TT7A 4JROA 5CDGA 1H2BA 3I9NA 4QO8A 4PZDA 4RVSA 4W7IA 1E1KA 1ZMOA 2Y1FA 3RASA 2BMAA 2FR8A 2ZB3A 1NHWA 3AI1A 1GQYA 4CM3A 3KSDO 3PZBA 3M2PA 4M89A 1C1DB 1T4DA 3GRPA 1E7WA 2H9IA 1IUKA 2GNAA 3DOJA 3KEQA 3GRKA 4IINA 5K9ZA 3QVWA 4E6PA 1NP3A 1X13A 2CSUA 1TB4A 3Q3CA 4P8RA 4TVOA 2OO5A 3WR5A 1YB1A 1XLTA 4XYMA 3AY6A 1KVRA 4JCOA 1CQJA 4MKZA 4MVJE 5HS6A 3WMXA 8ADHA 2HU2A 3Q11A 2YV2A 4WEOA 1MV8A 3WTCA 1ENZA 2YV3A 2IEDA 3TN7A 3F1LA 1PX0A 3VC7A 2PWZA 2BFAA 3F4LA 5GZ3A 4XIJA 5IN4A 3HJAA 2XXJA 4RCVA 3H5RA 3RQSA 3DZGA 1PS9A 4R5HA 5G4KB 1LRJA 2NU6A 4UVGA 1HXHA 1KY4A 3FPCA 3INGA 4GX0A 2I6TA 3D3WA 4WGGA 5JC8A 1PJBA 4BMNA 3B1KA 4ONEA 1B26A 4M1QA 1I0ZA 4XGKA 1HYEA 3DZIA 1I36A 2NVUA 4CR7A 3FNFA 2ZCVA 1YONA 4F3YA 2YQ4A 1Q2XA 3A06A 2CF5A 4Y8VA 5KJEA 4UEOA 2VOEA 5TT1A 2RBEA 3VVCA 5A02A 1BW9A 1T1SA 4XQEA 3WS7A 2G76A 5F1KA 3LZ6A 4OGWA 2H6EA 4IJWA 4TQGA 1YQGA 5GMOA 5L7WA 3EHEA 2Y1EA 1B16A 3H6KA 4QQRA 1DEHA 2GD1O 5I9MA 1LDNA 1EDOA 2O7QA 1NFQA 4R1SA 4FFRA 5EERA 3S1LA 3RBVA 1BXZA 2G5CA 3V5NA 4ZHSA 3FPLA 3KBOA 4XR9A 2J5KA 3C7AA 3KRTA 1NBOA 2QZZA 4IDFA 4FS3A 4GBJA 4R01A 3AY7A 3ORFA 3QY9A 1PZFA 4IJVA 3UGKA 4ND3A 3KLMX 3WYEA 4BO7A 7MDHA 2IXBA 3PDJA 1J4AA 4GGOA 4YQYA 1E77A 1LDMA 3ZWVA 5AXAA 1R0KA 3IUSA 2VT2A 3PQDA 4NFYA 4Z9XA 2Z5LA 5KWEA 1Y7TA 1C0PA 4C7JA 1VLLA 5AVOA 1Z75A 3CMCO 2OL4A 3U4IA 2PZJA 2UUPA 3MJTA 3DC2A 1I10A 2YUTA 4MOWA 1U5CA 2PK3A 2VYVA 4RV9A 3RC2A 3Q2KA 1H0KA 2O3JA 2Q3EA 1R4NA 3KXDA 1YRLA 2X86A 1WWKA 5GZ6A 1TEHA 4OXNA 3RKUA 2YJZA 2AA3A 3QVOA 1OAAA 3B6ZA 3WGZA 4S3MA 3IP1A 4J1SA 3IDSA 3VKVA 3TFOA 2VOJA 4L4SA 4BO5A 2C29D 1CEQA 4YJHA 2R2GA 1GAEO 5JBIA 1Q1NA 3BMCA 4OH1A 4IM7A 4OAQA 4FB5A 3Q9UA 4TZKA 3JD2A 5ENVA 1YWGO 2BI7A 4QTZA 2C20A 1Q0LA 1SOVA 1UUFA 4NR0A 5DOZA 1ADFA 4NBVA 3EY4A 3DBLA 4W6ZA 3GN2A 3IP3A 3OBBA 1ENPA 4W82A 1TA4A 4NDNE 1H6AA 3HDYA 4PCVA 1BGVA 4WUVA 4MIEA 3ZHBA 4IQGA 4WLUA 1H6DA 4BV9A 4TMFA 1ZFNA 3ICCA 4GH5A 3E03A 2GSDA 4DIOA 1E1NA 4BO8A 4MINA 1TVEA 1P1IA 5FI3A 1I3MA 1QXSA 1YOVB 3H8VA 1SMKA 2JCYA 4FFPA 4K6FA 3RAJA 5CDSA 2ILTA 1E5QA 1VJTA 1JWBB 3PYMA 4NH4A 4IGFA 2GDZA 4H3VA 2X6TA 3E48A 1LRLA 2IODA 1PWZA 2WD7A 3T7CA 3R3JA 1GYRA 5EN4A 2RCYA 5TGDA 4A73A 1BXGA 3ANMA 4DREA 2R00C 1Q0QA 4IQ0A 4NFHA 2JHFA 3HADA 3LK7A 1SCUA 3P2YA 1XELA 4S1VA 1M6HA 1A5ZA 2B4RO 2E48A 1MFPA 3MCVA 5JAIA 4UVEA 4E30A 2JD1A 1N5DA 5DULA 1LRKA 5B12A 4QSMA 3JYPA 2YDYA 2Q50A 1C3VA 2JFGA 4RQTA 2BRUA 2Q1SA 1EUDA 1GDHA 4YAKA 2VZ0A 4CLRA 3KYCA 1P74A 3O9ZA 4RL6A 1U4OA 4RDIA 4TRNA 3D0OA 4EYEA 5EQFA 3ZV6A 3JQBC 4IDAA 1JW9B 3H5AA 4XYEA 2I5PO 3G0OA 4RZIA 5TT0A 4GWKA 3GEDA 1PZHA 3WQSB 4IDGA 2NM0A 5IDXA 3CEAA 1ZH8A 2GGSA 2GN9A 2WJPA 2ZYAA 4IQ8A 4L0QA 1V6AA 1QSGA 1HSOA 4RVDA 5JY6A 2GASA 3QWFA 3ZGYA 2AQKA 5A06A 2IYOA 4LMPA 2CF6A 3BAZA 1FXSA 2BI8A 4L4XA 3QIVA 4D3FA 1WLYA 3OQ6A 1ZSYA 4DLAA 3IJRA 3L0DA 4E5YA 3OQBA 3SC4A 2PH3A 1R16A 1IZ9A 1GYPA 2QRJA 4DPMA 2VRBA 4I1IA 1EUCA 1Y8QB 4QXMA 4MVJA 2AW5A 4DC0A 2JKVA 2DQ4A 4BKQA 1UP6A 4W9NA 2I65A 2VHVA 4A7PA 4AJ1A 1DHRA 3VH1A 1YB4A 5IAAA 1QMGA 4RLHA 4FPXA 3ZNQA 2OP0A 2JAPA 1U2DA 5TJ9A 4ALKA 2BH9A 2AXQA 5JDCA 2NTVA 3GAFA 3TDKA 5A9SB 1YQDA 4L76A 1G0NA 1N1EA 3MTGA 3TZQA 4CLOA 4QFCA 4YRAA 4J3FA 1WW8A 4AJKA 3DOOA 3GVIA 1PJLA 5IDQA 2O3TA 4IY1A 4MJLA 4WE3A 5DP1A 1YE3A 2HO5A 2BLLA 1UP7A 1U8XX 2Q4BA 3DHEA 1LDEA 1EUZA 2EGHA 2V6BA 2ZJ1A 3RU9A 3VVBA 2B83A 3WWZA 1DIAA 2NU9A 4XGNA 3VPGA 6LDHA 3TF5A 4PLWA 3OMLA 1LU9A 2EP7A 2GN4A 2NWQA 4M8SA 2NTJA 5H81A 4ZICA 3DQPA 3MWDB 1HWYA 1ZK2A 4OXKA 1ZJZA 1LEHA 4KQXA 4I9UA 4IJKA 3AOGA 4W7HA 1MGOA 2B36A 1AUPA 3GLQA 3LC1O 1ZXBA 3CSDA 3BIOA 3K8ZA 5G4LA 4DYVA 9LDTA 2X22A 1DLJA 4BO6A 1NFFA 2QX7A 1P1HA 1YBVA 2E82A 2W2LA 1Y81A 5IZCC 3QVXA 5A4DA 3KEOA 3A1NA 1NPTO 5JFOA 1DC4A 2UVDA 4TSKA 4PLVA 1HETA 1HL3A 2YV1A 3PTZA 2B5WA 2JFFA 4O59O 4R69A 2NACA 2J3IA 4DIFA 4J1TA 4NI5A 1EBFA 3RI3A 3KTDA 3GUYA 3AI3A 3AOEA 3I4FA 3JQ9A 4ND5A 1P1JA 2Q46A 4URFA 3RBXA 1BTOA 1ZJYA 1DRUA 2CDCA 1E6EA 2Y0EA 4IBOA 3C8MA 4R5MA 3L6EA 4Y9DA 1OZAA 2IDZA 4EW6A 2AE1A 2QYTA 2ZQZA 2PGJA 1X14A 4BS9A 1UZLA 1EQUA 1I32A 2JD2A 1I2BA 4ZQEA 4B79A 2RHRA 2J8ZA 1HLDA 4PN3A 1SC6A 2GN8A 3U5TA 5LDGA 5IF3A 1PR3A 5ILOA 3ZV5A 4WJZA 1D7OA 1JKFA 1Y8RB 4NBWA 5DCWA 3PJDA 1I3KA 3OETA 4IZIA 4NFSA 2J5RA 4MP3A 2YHIB 5F5LA 1YGYA 3DXFA 2DTEA 1J5PA 2P9CA 1PWXA 3AFMA 4LSWA 4CUZA 2EEZA 4EGFA 3AK4A 1NR7A 3I52A 4A0SA 4DQXA 3LLSA 3PIIA 4EITA 2VYND 2X8LA 1Q7CA 2GPTA 1GQ2A 1UP4A 4PRKA 4K26A 4BNXA 3VTFA 3GC6A 4JBIA 5AXBA 1WDLA 2X9GA 4FQ8A 3DMYA 4OIMA 4CV3A 3QJ5A 2OORA 2JCVA 5T5QA 3ZWPA 3CKYA 1KC1A 4TZTA 2O23A 2O2YA 3MJ4A 3NT4A 5I9NA 2P5UA 3RUIA 2XOXA 3LT2A 1HEUA 1WXDA 3K2EA 3E6AA 1B8VA 2EKPA 1ENOA 4K6CA 5LDHA 3HZZA 2GZ3A 2P9GA 4EUEA 1X7DA 4DMMA 1LBEA 2CUKA 3KB6A 2PH5A 1U5AA 4CMCA 2BD0A 4Q3EA 2O4UX 4E5NA 4E12A 3E8XA 1VM6A 4EDFA 1GTMA 2W90A 1NWHA 1P31A 1VKNA 2W2KA 1I33A 4IJUA 1ZNQO 4CM9A 1I24A 3DAFA 4CQLA 5THQA 2VUUA 3FHLA 4UAGA 4I5EA 2VT3A 2BGKA 4J0FA 2VWPA 4BO3A 4R51A 1O94A 3KYBA 1LA2A 3JQFC 3OIFA 3DBHA 4ZRNA 4HX5A 2DBVO 3BMOA 3JQEA 5ER6A 1P1KA 2PKRA 1U3VA 3GQVA 4PLCA 5A9RA 2J3JA 4CM4B 4R1UA 4GX5A 1ZK3A 2HK9A 1KERA 1KVQA 4N5MA 1PL7A 1WZEA 3DAPA 3ETDA 3AM4A 3DOCA 4CLXA 4BKRA 4JBHA 1WNTA 4YTEA 2I66A 4GPD1 3QWIA 3DFZA 5G0WA 2E49A 4IDEA 2VQ3A 1IPFA 3VDQA 5JCJA 1RM5A 2C7GA 1QYXA 2I3AA 3E9QA 3M6IA 3DZBA 1QP8A 5B4TA 1PS0A 4WCDA 2BFOA 2VRCA 3ASUA 3S2IA 2ZTUA 4GLLA 3WIEA 4BNNA 4B3HA 1N7GA 2AG5A 4FOSA 4NMHA 3I6QA 2FN7A 1JVSA 1XU9A 2GUGA 4KP7A 4EZBA 3F9IA 3QA9A 1GADO 1XA0A 3RUAA 4CM8B 4B4UA 5C5IA 2QRKA 1Z6ZA 3RFXA 4YT4A 1BRMA 3F6YA 1R4MA 3BMNB 4CM5A 3WGYA 2D8AA 5A3VA 2VWQA 4BMSA 1YJ8A 3UXYA 3C1TA 4R1NA 5G0SA 2F00A 4NJOA 1Z82A 4KOAA 2GO1A 1SNYA 3BXXA 5GY7A 3ROQA 2YY7A 5BNTA 2NVBA 4BNKA 1WMBA 3GG2A 3ZNNA 1FDSA 4P4GA 1PR9A 4MDHA 4MVJF 2EF1A 4PFJA 5JY1A 3UKOA 4FC7A 3W1VA 5CG2A 4BNHA 3TPCA 2ZK7A 4Q3DA 3FNGA 4CMAA 4ZGWA 3QWAA 3ABIA 4JJIA 5A1TA 4MKRA 1RM3A 3DR3A 1ISFA 2DTDA 3GG9A 5L7YA 2HJSA 3D1LA 2ZYGA 2YW9A 3K5PA 4BNZA 4J7CA 3JQ7A 1GV1A 1I30A 3WJ7A 5JC1A 3GNTA 4G81A 4I5DA 3OEWA 3K96A 2HDHA 4AJEA 1V35A 4RF3A 2EKLA 2P68A 3FNHA 5T67A 1WMAA 2DU8A 2DAPA 1D8AA 3Q2IA 4PLZA 3TL2A 3GZNB 3K92A 3G1UA 4BQRA 5L4SA 1KEWA 4J4HA 4ZQBA 5A3JA 4BNFA 4IS2A 1X0XA 1ZK4A 3RUCA 2CDAA 3BZUA 4ROSA 3VPSA 2NVWA 4XZ3A 4UVHA 2LDBA 3E5RA 1YH3A 1ZCJA 3JCZA 1P0FA 4Y98A 2E6UX 3FI9A 4ND2A 5A5EA 3UVEA 4FC6A 4OM8A 4UREA 4J4TA 1AGNA 3CUKA 3T4XA 1DIGA 2Q1TA 3EUWA 4ILKA 2D1YA 4AJ2A 5B1YA 1KS9A 3OJEA 3NDIA 2IE0A 4FCCA 1R0SA 1N92A 3F3SA 1B8UA 4EBFA 1E6UA 4EJ0A 1PIWA 4L73A 2ZATA 2YZ7A 3O38A 1LXCA 1Z7EA 4NG5A 4HP8A 3L9WA 2EG9A 4CMIA 5EIOA 4CMEA 4YXFA 1K6XA 3H9GA 3WGHA 1E7RA 3SJUA 3ZU3A 4O1MA 2G17A 3SBOA 3ZWNA 4JNKA 1B0AA 4J9UE 4CV1A 2CY0A 3ASVA 4QX6A 4CM6A 1DFGA 3H2ZA 4E13A 3NRCA 3JTMA 3L4BC 4DIBA 4PVCA 4YJHB 1KBZA 1X1EA 3GAZA 3AUUA 3GOHA 3GPIA 4BO0A 2Q1WA 2FOIA 3OF2A 5AYVA 3ON5A 1B7GO 2WTBA 1N7HA 5A03A 3SX2A 3P2OA 2XXBA 4DYDA 3RKRA 4UEKA 1LLCA 5C37A 1TT5A 4HKTA 1HRDA 3FBGA 3GF4A 4B3JA 4BNLA 3N7UA 3ROPA 2P9EA 4WEQA 3OH8A 3QW2A 1ZUD1 4TKMA 1JVBA 3AU8A 3Q6IA 4HADA 1NVGA 4BVAA 1X7HA 2B4TO 3W6UA 5JPIA 3WBFA 1QRRA 2X4GA 3DHYA 5COAA 4A27A 2WD8A 4J16A 1FDVA 5CPFA 1MG5A 3I1JA 1B14A 1EFLA 2NLOA 5MGBA 4WCFB 4BKPA 4A2CA 3RSHA 3PJEA 5FFFA 3U4CA 1PJSA 2VNAA 1D3AA 4EJ6A 4OOEA 5JO9A 5I7VA 1ZK1A 2XAAA 3O4RA 1C0LA 3GEMA 5JW6A 1EK6A 4CV2A 5KVCA 1EE9A 1BXGB 2PR2A 5KTKA 4Z0PA 5JDIC 4JLWA 3TQHA 3DHNA 3BTSA 3HG7A 2G82A 2FSSA 3WTBA 1NXQA 3BTVA 4CLHA 4XEHA 3WFIA 4CM1A 1RJWA 4J0EA 4KTTE 1GEGA 1R66A 4YJFA 3B1FA 3PHHA 1B2LA 2HMSA 4NJMA 3R1IA 1C1XB 1D4FA 3GN1A 4J7UA 3BYZA 3GA0A 3PDUA 2POQX 4J1NA 4Z0TA 3KYCB 3PEFA 3ZDFA 4JX8A 4RJTA 3PQEA 3RUEA 1P77A 1DSSG 3RFTA 3BMQB 2IXAA 3F1KA 3FR7A 3A28A 2I3GA 3MJEA 4GX2A 1H2HA 3U0BA 2PNFA 1QYVA 4DBVO 3QLJA 1E3EA 3SEFA 3DZJA 5T8KA 1W0CA 4OKIA 2WE8A 4TRMA 4U8GA 3VPHA 2HQ1A 1F12A 4G2NA 4C7KA 4PLTA 2OGUA 3SXPA 1HTBA 4NBUA 2CVOA 1N1GA 1NYTA 1VL0A 2UDPA 2CNBA 1H94A 1OOEA 3R6DA 4N7RA 1XQ6A 5GZ1A 2NU7A 3H65A 5ENDA 3TZHA 4TWRA 3JQGA 1VSUA 2Q49A 3PYLA 5TS3A 3QQPA 1ZMTA 3FF4A 4FSHA 1ISGA 1TI7A 4L4RA 5CDYA 3H3JA 1GFSA 1XIVA 1CIVA 4J43A 3HQ4O 2UV8A 1GYQA 4IUYA 1W73A 3NUGA 1A7AA 3H9UA 2X5JO 4IIUA 2Y05A 3KSUA 4IMPA 1A7KA 4NQZA 1K2WA 5ITWA 2A9FA 1FF9A 3SLKA 4CQMD 4R1TA 5FWNA 2ZTMA 4LCJA 2AE2A 4IGEA 3V1TC 4PG5A 1DRVA 3GNQA 1I2CA 5U9CA 3HSKA 2FP4A 3OFSA 2Y0DA 3F5QA 3TZ6A 2CVZA 1SAYA 3CPSA 4DQVA 4DXHA 4J2HA 1O6ZA 1Z73A 2O2SA 5JXWA 1T2FA 4ND1A 1DIHA 3I9KA 5DCUA 5ILGA 2CD9A 4B8ZA 3CTMA 5L53A 1ISHA 4CLEA 2OUIA 1YKFA 4E5PA 4QT0A 4RO0A 3ZHYA 1LSSA 1E7MA 1ORRA 4YBZA 4JK3A 3CIFA 1ADCA 1KYQA 1YVEI 3W8FA 3W4KA 1C0KA 5A5FA 1CYDA 4KTVE 3PHLA 4R3WA 5ER9A 5JAQA 4L75A 3RC1A 2D4AA 2X0NA 1HE2A 5KVVA 3U4DA 3EGOA 1B3BA 1DPGA 1K0UA 1Y5RA 1KVUA 3I5MA 4BNUA 3ADPA 1O89A 3QHAA 4B7UA 4KUHA 3CMMA 1NVTA 5KNLA 2ZQYA 1ZSNA 1ARZA 1K6IA 2TMGA 2DUUA 3O03A 1GL3A 1M2WA 2FR1A 3FTNA 3S8MA 4DQUA 1P1FA 2C07A 5EINA 5G0UA 4FD3A 2FZEA 3PGJA 5EESA 4ZQGA 2EKQA 1PSDA 2WYWA 2NTNA 5EMHA 4XDYA 3ITKA 3DL2A 2GZ2A 5HBRA 4CUJA 4AVYA 4UVDA 3G3EA 1F06A 3PWZA 7ADHA 2FZWA 2PZKA 1AHIA 1I8TA 2HRZA 3H3FA 1WP4A 4RF4A 3ADOA 2ET6A 2VHYA 4DMLA 4YT5A 2DPHA 4ZJUA 3KYDB 1ZEMA 3EAGA 3EZLA 3ENNA 2PD4A 2B0JA 5BT9A 3OM9A 1PJ4A 3HDJA 1Q7BA 1YB5A 5F5NA 1BWSA 3ZHXA 2B4QA 2EIHA 3ONDA 1DLIA 2GZ1A 3ANNA 4P4LA 4IDDA 1KVTA 3TWOA 3FR8A 1MC4A 2DC1A 4DVJA 3WGIA 4YRBA 1V3VA 1YDEA 4XYLA 5JMPA 5TIIA 3GZ4A 1E3JA 3H7AA 3L6OO 4U6SA 4BOYA 3OJ0A 3T7EA 1A72A 3E1KA 2Y1DA 1S7CA 4FIZA 4U7WA 1PJQA 1JU9A 2H63A 2UUOA 2BGLA 4AJLA 3WYBA 1JLLA 4BHTA 1ZEJA 1DAPA 4EJMA 1C1DA 4BNMA 5COQA 4D3SA 3WFJA 4HY3A 3PVZA 2VUSA 3TOXA 3PP8A 4P4NA 2NQTA 1EVJA 3PWSA 2VYVD 4GMGA 1N8KA 4I08A 3EW7A 1GPJA 1L7DA 1J6UA 3RC7A 3P19A 4PG7A 3IJPA 2VWGA 3ZZNA 5CEFA 1HZZA 4RVUA 5L4NA 1LQTA 1LC0A 1T2DA 4B7CA 4PLPA 1R6DA 1S6YA 4I8XA 3K9QO 4WNCA 2AQ8A 1IB6A 5G4KA 1FK8A 4ZRMA 2PA3A 3OP4A 4OO3A 2C54A 2W8ZA 3D4OA 3F4BA 3OJOA 4X54A 4CODB 4R16A 3LT0A 3OQ1A 4F46A 2UYYA 1K3TA 4YJGB 3STHA 3DBHB 1U7HA 1LDBA 1VI2A 2HJRA 3ST7A 4LVCA 2C5EA 2E37A 3ZNPA 5CP8A 3ZHZA 5KVQA 3R0IA 2YHUA 4HNGA 4FGSA 3GUCA 2O48X 3IUPA 1K6JA 5HRUA 1GZ4A 2V65A 2CFCA 2Q2QA 4MVJG 3SLGA 1IULA 3MEQA 3NTOA 3VDRA 2X58A 4BGIA 3JD3A 4OQZA 4E2WA 4RPJA 1I3NA 1MFZA 4IDCA 3BTOA 1X15A 1WPQA 1EBUA 2AQIA 3KM0A 5DCYA 2QZ9A 1QYWA 3ROMA 2W4QA 2DTXA 1Z45A 4LRTB 3NV9A 4PLYA 3DMTC 4RF2A 2ZTLA 3A9WA 5TQVA 1YL5A 3G49A 1LI4A 4K28A 5IZ4A 3BHMA 1SBYA 4YJDA 3K73O 1DFIA 4PIVA 3JQ6A 4WOKA 5DP2A 4YYZA 5CAEA 5JS6A 1DC5A 2Y68A 1NASA 3MJCA 4UVIA 4DLBA 1VPDA 3V1UA 3VH3A 2XPCA 2JD0A 1GPDG 3FBTA 4M55A 2D0IA 1SB9A 3I4CA 5LC1A 3VKUA 3HWRA 1DDOA 3IKVA 4PG8A 1I01A 4FJ1A 2HCTA 3GMDA 2DLDA 4BL5A 3D7LA 1M76A 1UAYA 4RPGA 3ZWBA 4MIOA 2Y93A 4CMEC 3I3OA 2D5AA 1DHTA 3GEGA 1VL8A 4XB1A 4IZHA 1EVYA 1WDMA 3I9MA 1XG5A 4UUOA 3DTTA 4CMJA 1XQ1A 4KUGA 2ZJ0A 3OA2A 1V9LA 3JQ7B 1JA9A 2LDXA 1J49A 2Z1MA 3IC5A 1U1IA 2O3RA 1R12A 2WYUA 2DPGA 3JD0A 3GNSA 1E3WB 1Z7BA 4MVJD 4FBGA 4R3NA 4TROA 1O9BA 2QRLA 4NZ9A 2PGLA 1XSEA 3UH1A 4CR8A 4HUJA 1YOVA 3MOGA 4BGEA 2FHSA 3N58A 3N74A 4BNVA 4P22A 5THKA 3DTYA 2I76A 4HFNA 3RWBA 3U4HA 4AL4A 3U09A 1N9GB 5DZSA 3P5SA 2C0CA 2FPGA 3NJ8A 1XCBA 3GMSA 4L74A 4HBGA 3DEYX 4JIGA 1A9ZA 3LF2A 1SB8A 3L77A 1JQBA 2PD6A 2FPIA 3RUDA 1KOLA 3WGGA 5HWSA 3EMKA 5IFLA 2EERA 4NU5A 1ZVMA 4IXWA 5F1PA 4DA9A 5IXYA 1ULUA 3PHGA 3DONA 3D5QA 4E5KA 2YQ5A 3NX4A 5JAMA 4MKXA 3GFGA 4O6VA 4UUMA 4YAJA 1U3TA 1NQAO 4GX1A 4YR9A 3W8DA 3MZ0A 1GR0A 4KMSA 5L95A 3DBRB 4JBGA 3ENKA 1RM4A 3QWBA 4ZN6A 3GVCA 1ZW1A 2DVMA 2EXXA 3BTUA 1MUUA 3TJRA 1GUFA 3TOZA 4MVJH
chains in the Genus database with same CATH superfamily
4YP6A 2OXFA 3FETA 1S2MA 1Y4UA 5KX5B 4GSLA 4DCJA 2FMUA 4NY1A 3FHTA 1C1HA 1U1EA 4HNQA 4RPKA 2OWDA 1LI5A 3K72B 3OBIA 3IELA 1RSZA 1CRLA 1Y6QA 3MGGA 4Y1RA 5IJ9A 5T6BA 3GDHA 1TCVA 4PGFA 1NW9B 1WVGA 2G0AA 3PUWA 3ERCA 2ZZKA 5IM4F 2R6DA 2W6PA 3AVVA 1OI7A 2FH5B 1Z8HA 1II8A 4Z54A 1Y9AA 3K1ZA 4LZWA 4M2LA 3TKYA 2HBRA 4BBZA 1KKUA 4GDFA 1JHVA 2C57A 3GFFA 5AESA 3KQTA 1P72A 3B1WA 5ECDA 3HVKA 1IY0A 1LLQA 1YDHA 2X7HA 3BFXA 2VH2A 4MB2A 4YONB 5IHXA 5DDIP 1H9CA 3OEHA 2PZLA 4CU5A 4HFMA 4DSNA 1L7BA 1P18A 1XKQA 3ZY6A 1JAZA 4DA8A 5LM3A 1YCDA 3AUJB 1CJCA 4EA9A 2J9YB 4Z4HA 1K08A 5C3MA 1SM4A 2ZB8A 3JATA 4IJ5A 2XRZA 3WWYA 3JVIA 2IVZA 2QQEA 1DEXA 3PFBA 2QLBA 2ZYDA 4DV5B 2R00A 3PC6A 1YU6A 1YRWA 4GR9A 4MWCA 1T15A 3L7IA 4TLDA 4BKMA 1CZUA 2FPMA 1SXJE 2ZPAA 3EAFA 1OMOA 1Z5WA 3B20A 3BK2A 5FNVF 2BL4A 4LRSB 4TTPA 5T64A 1XQWA 3V8MA 2YHSA 5AVWA 4FBMA 1E6WA 1OFUA 2FLWA 2IZ7A 4LW8A 5BNFA 5F7OA 2VJQA 1Z0DA 2GARA 1R0XA 2GF9A 4XB6B 5EVCA 2PUFA 5LOVB 4DRYA 4IAOA 2XXAA 5HKKA 2X8JB 4EB3A 1W36C 2C2WA 4P3NA 4AXXA 1VE9A 2Q2NA 2ZJ6A 2ZVQX 1KY5A 3D7RA 5CMLA 2NYRA 3KLOA 3IS3A 4WACA 5D00A 5F78A 1NOJA 1CJKC 1GSAA 1YFLA 2CL5A 3KZKA 2O59A 2V7PA 1Q5PA 2MR6A 3N39C 2VPTA 2PSFA 4Q4LA 3ZE0B 5K0LA 3T5BA 4PYJA 3HM9A 4PS0A 4F0JA 3FN4A 1J42A 4M0CA 5CBPA 5COBA 3ZXSA 2WVAA 3BKWA 5LBTA 4TMYA 2FE1A 2B61A 3L92A 5KHAA 1THZA 1E7SA 4ZO6A 3WK5A 1H5NA 2VKQA 4M9QA 3R5KA 5L40A 5F33A 1ULTA 5KYUA 1CQJB 2BOVA 3EUEA 3EXG1 3BSWA 1IN6A 2JZNA 2JANA 3OI7A 2HEIA 4KYIB 3MMNA 1PCXA 3JWJA 4GPEA 3V2HA 5CITA 2C5FA 2YVUA 2UUCB 1U3WA 4K87A 3RK1A 4ED9A 1UKBA 4YUXA 4WFKA 2JBAB 1A71A 4MUYA 4R3UC 3S2EA 3BZBA 3KT8A 1E5DA 1QR2A 3SU8A 1VECA 3ICPA 1NLYA 4PQRA 1VCNA 3F49S 4IOKA 3AEYA 2PY6A 3EJ6A 1T8UA 5F7ZA 1XF9A 3BQMB 3AERA 3LFHA 3UT5A 4PWZA 2YZ2A 4BLOA 3KZCA 3GLHA 3HCCA 2ZJ5A 2TS1A 3P7MA 4LYFA 1OYOA 1Y4DE 4PPYA 4CL8A 2NU8A 3Q0TA 4QUIA 5IVPA 2IBMA 4RXMA 4CUKA 2FFHA 1PKXA 3CKLA 4BP9A 4UW9A 3S55A 2DERA 1SD1A 3QITA 4ZV7A 5EJ5A 1FYWA 1FUIA 3AEUA 4OMDA 4RJIA 2JFQA 3JU3A 3EFEA 4CEJA 1ILWA 1JI3A 4XDZA 3UUWA 1P3JA 1FP2A 1S2OA 3CNEA 4D3YA 3VOTA 2YWHA 2GWHA 3THYA 4K05A 3LVFO 4MRNA 2GDJA 4XPZA 3CF4G 2IP1A 4A8JC 4UPVA 5K8VA 2GEJA 4L8VA 1C14A 3D59A 4OAOA 4WKOA 1W36B 2IEIA 3T9CA 1BFUA 1K06A 1PR6A 2XVMA 2ACVA 4LAFA 4LHZA 1IM8A 1OI2A 1TVKB 3IAS1 2EJWA 3FYTA 2V6IA 3UKJA 2P7IA 1O4WA 2SKDA 4U6NA 2DWPA 3LYUA 2IT1A 4AJOA 4Z4IA 1B76A 3QIAA 2G6TA 4NAHA 3D8NA 2HREA 4W7SA 1N9ZA 4QYTA 4DGSA 1YA8A 3VJRA 4LN1A 2GYYA 1MJGM 1SCJA 2EW1A 2O7VA 3B12A 2AQHA 1FMJA 3HPRA 3IDZA 3CRZA 1WXFA 3PLRA 4WXYB 4YAWA 5GOZA 3L9XA 3ORHA 5JCJD 4N0QA 4GP7A 1Y6GA 2C2XA 3EIQA 2AFVA 1GXSB 2PGDA 2YWBA 3LCUA 1H5UA 2DFDA 3K31A 3LD9A 4H3SA 4ZAXA 4B44A 4Y6SA 3DNMA 1GY8A 2OCBA 3OKPA 3K5IA 2YNMC 3U7JA 3WNQA 1H4SA 3HVUA 3JASB 1NBEA 2Q28A 4ZYUA 3K6SA 2G7ZA 4FHEA 2F1IA 4HAOA 1PR1A 1L5QA 1P5RA 4Q12A 2A33A 1XEXA 3MJDA 4HWGA 1CZNA 1T25A 3IVCA 1U0EA 1PW7A 2JBWA 4LZZA 2Y1OA 3S2UA 4YMLA 3LECA 2II6A 2FPPA 5E1OA 4YJ3B 5I4IA 4K9OA 5H82A 4YWJA 3FM9A 5BURA 2MDTA 2WQZA 2HAEA 1R27A 1Y5MA 3AUAA 4ID9A 2IRWA 2PPVA 3TTTA 1SBIA 4GEGA 2DF8A 1Q7EA 5L9AA 1VG1A 1CY0A 2UZ1A 5ECGC 2IPLA 1KETA 1C0IA 2XRYA 3HNRA 3GVXA 3A6FA 3L0PA 4HGPA 4RHCA 2O8CA 4YROA 1TYAE 3CLKA 2WHPA 3DZDA 2IXEA 1E1RD 4IRMA 4NABA 3UMGA 4KLRA 4EYGA 3E7XA 3KVOA 1XPUA 2BEJA 2V6MA 4FW8A 4OLHA 1DIRA 4ZT2A 4PO3X 5KWSA 3H2YA 3FGZA 3TXYA 1Q1GA 1QAOA 2W43A 3FCAA 4L51A 4MGHA 4TLLB 2HMUA 1Z5GA 3ANLA 1E2DA 1YUNA 3OLCX 5LA6A 5EGNA 1NXTA 4BU1A 5DBIA 4XRGA 1BN7A 2JGLA 3FTPA 3HR8A 5A3RA 3HR7A 3TSCA 3JQ8A 1USKA 4AUNA 1QANA 1VI5A 4YX9A 5J3JA 2RGCA 3QMWA 2IV3A 4ZCPA 3HZOA 4CHGA 1AK1A 1QO7A 2NYUA 4B3SB 2A5DA 5PGMA 1C30A 2OYRA 3K0CC 1J25A 4JJ6A 4R6WA 3IMEA 2WMDA 4PLGA 3WQQA 4PTZA 1YI0A 2QGZA 4MLZA 4WLNA 2J6HA 3OWXA 2B30A 1HDCA 2VPYA 1XTPA 2WD7B 3CSUA 3ZYCA 4B0OA 5E6UB 3G79A 3P0HA 2ZRDA 4QYMA 3K3PA 2Q6VA 3KVVA 2Q6OA 2FEOA 2W48A 3VMMA 4DILA 2BW0A 1TLTA 3DAGA 3AR6A 3K9LA 4I5GA 3I6IA 4JLPA 4QD3A 4QEKA 1I0LA 1UXHA 4FP9A 1DX9A 4QGAA 3OCUA 4D6PA 2IUYA 2FFRA 1VLZA 1W4BA 3QVTA 4ZO7A 1EK5A 5AKLA 4FUQA 5DNWA 3BE8A 2DXIA 1CIPA 1HE5A 4FT2A 5C8DA 5C8YB 3X1MA 3WXMA 3EZ9A 5AI6A 4RKFA 3HJFA 3V8QA 4BV2A 3ZWAA 1LKZA 4DADA 3OU2A 1GWNA 2HNBA 2H1FA 4LCEA 2X1LA 1BQEA 2YWFA 4D8XA 3HB5X 1WMFA 5HRCA 4HK4A 3AM3A 2YN4A 5IJAA 1QP4A 3O4GA 3BMNA 1A8QA 1U8CB 2H06A 4ZQFA 1SXHA 1Y9EA 1B23P 4QUBA 1NF3A 3CBGA 5HQ3A 5C80A 2IYLD 5JMWA 1U0GA 2PUBA 3BHIA 5HPYB 3R9XB 1U6IA 2XF8A 3NORA 4K0RA 4IPTA 4W1SA 3QVGA 5KS2A 3I62A 2C94A 4CMHA 1TX4B 3KXIA 4Y3UA 1EIWA 3RABA 1RI5A 2PX0A 2NUTA 2PRJA 1PGNA 3IJEB 3ICEA 4R0MA 2Q1XA 4O0LA 3ZLUA 1WUHS 2Q7XA 4ZCQA 5FUMA 4JUIA 1J2UA 1N6PA 1TOAA 4WK2B 2NOAA 4ER3A 1B8PA 1GGNA 3GQBB 4MEJA 5AKEA 5JJCA 2QGNA 3VKFA 1C0EA 3OZ7A 5EMJA 1YRAA 3CH7A 3JD4A 4X1YB 3OZWA 2J3EA 1OC2A 2A0XA 3WHKA 1ST3A 3FSJX 1PT7A 3JWIA 4I1OA 4ZVOA 5KEIA 3ZGZA 2O0LA 5HF9A 2WF8A 1CG6A 2X0RA 1VLQA 3JQ9C 2BTQA 3KUXA 1TK2A 1Y1PA 2F1KA 1V3UA 2MTBA 1MRZA 3EFBA 2OG2A 1PT6A 2EWMA 1DQZA 3BGIA 3WKBA 5IFKA 1SC9A 2C61A 3TQRA 3CM0A 3E15A 4CJXA 1T36B 1N0UA 1YBHA 2YMMA 1RU3A 2CVFA 3CBQA 5CNKA 5IAJA 3A58B 3TK1A 2J5BA 1UBJS 3WFZA 3TGLA 3U3JA 4EL5A 3KYIB 3KOUA 4CZ2A 4AY6A 1JWAB 1UDBA 4HDRA 1BEUB 4LQ4A 4NPCA 1V2HE 1VKHA 1E9EA 4FJ0A 4JU8A 4MVYA 3NHZA 1QYDA 1ZQ1A 2WVGA 3I6YA 4UULA 2W2OA 3EGDB 2PUJA 3PXGA 4J75A 2YWRA 3V7YA 1GQSA 1OIXA 3L02A 2V97A 2QPAA 2RH4A 4LJYA 3WGLA 2C3YA 2W8BB 4PTLA 2H2DA 5FADA 5AK6A 2OXCA 1ECCA 3OFND 1UBLS 4MDEA 4D8VA 1UC5B 1NVWQ 4MTCA 1SGWA 4DA4A 2BT4A 3VZPA 4TMKA 3WGTA 1OFGA 4ZYWA 3KETA 4G0UA 1VRVA 4UNSA 1DTEA 2FXVA 3AHFA 3MTIA 3ZIAD 4MIYA 3IXMA 5K0JA 3BD9A 2IUFA 4MXDA 1BKYA 1VG8A 2IY9A 3HS3A 2JAHA 3NBFA 3F8WA 3DFUA 3QU7A 5DTEA 2UYOA 3EC7A 3LHFA 1TYDE 4RHFA 1W5TA 2FK7A 2FMHA 2WI8A 4G8DA 3BS4A 2P1RA 4KYTA 2RGEA 3ORYA 3Q3VA 4RF5A 1OSNA 1UXKA 3FCCA 3DZKA 1PAUA 3C3XA 1C9NA 1ZBQA 5CEEA 4L2IA 3VO9A 4II2A 2JARA 3CUEF 1E3DA 2EHDA 2P8SA 3TQSA 3AHCA 3HUFA 4BEWA 4PX2A 3X1YA 4YDRA 2R6FA 1X9GA 1JIJA 5DBHX 1VCHA 4YT2A 2IY8A 3BC1A 1XQ9A 1IPHA 4AIRA 2VF8A 3KOZA 1JV2B 1RAFA 3OJFA 5G02A 1SOWA 4QOHA 5CFNA 5CD1A 5A7FA 1NR5A 4ZZIA 2H5LA 3DBVO 3N8NA 3ZHRA 4ZOEA 1UBTS 1FP4A 1QVAA 3N1UA 4TT3A 5CNIA 4D57A 2O5EA 4P7GA 3NC1C 4TTTS 3WLLA 1DJQA 1F8GA 1W5EA 5E3JA 5EZYA 2NNWB 2REBA 1NPYA 4Z9YA 3M3DA 2I99A 2C7VA 1FJGB 1BQ4A 3NUQA 2IS4A 3SMVA 1PYOA 3SDSA 1SUAA 1P2TA 4NU6A 3RCBA 3T9BA 3KAPA 3I5XA 3RARA 3UJPA 3FGOA 3X1XA 2VJLA 3IKMB 2G5TA 3DMNA 3EVZA 1VSVA 4OUKX 4WCFA 1KFBB 3CZMA 1MTOA 1XA3A 2XYPA 4F46A 2A94A 3QV1A 3QW4B 4C4PA 1CY2A 1N0VC 1S2GA 2E7ZA 5DYGA 1JEQB 3L7LA 3G1TA 2PZMA 3UN1A 3F96A 3GLFB 1NURA 4G86A 3BK1A 1JG4A 5A04A 1QK5A 5HR5A 4D46A 1CF9A 2O7NA 1L6RA 3DB2A 3DD1A 2BFDB 4IJ6A 1W6UA 3K2IA 4LBZA 1RMQA 3MTDA 4P7FA 3L7CA 3ESQA 2D0OB 1OWMA 3BWVA 3DLTA 5DI3A 1PGOA 1HQCA 5A7HA 4L16A 3RIHA 1ACLA 5BSHA 1L5RA 1JDJA 1T8SA 3RUFA 4BX2A 2G1PA 4LZJA 5K4GA 3VRHA 3JQCA 3WBKA 5LZ2A 3HHPA 2PX6A 1ISSA 1ITZA 2QNRA 2C8LA 4J2OA 3AF4A 3L8HA 1UK8A 1PT5A 3FAKA 5HRUA 1AKRA 2JGDA 4S1OA 2HD4A 2CL6X 1K3UB 1HI9A 4P34A 1MG0A 3WGMA 4PNEA 4Y2GA 8LDHA 2VLBA 1SH7A 1JKJA 3CQ9A 2XITA 1LVHA 1ELOA 5FT9A 4MS4B 4FYPA 3S1AA 1Q77A 3ZDQA 1RPNA 3B3FA 3UUEA 2JL1A 4CIXA 4CQLB 1YDGA 1Z5VA 5EXSA 4TOIA 5HVNA 5L8VA 4G1UC 5FEMA 5TEWA 3RYHB 5LQSA 5H59A 2HU8A 1PKEA 3P94A 3MS7A 1J9ZA 2IIPA 1YAJA 2PSHA 1EDDA 2QUZA 3LUBA 1FJHA 4M9CA 4LUCA 5C5EA 4JT2A 4QVKA 1UAGA 3DEJA 4MUIA 2WY2D 1Y6JA 3DF7A 4V3CA 1YTUA 1YQWA 3ML1A 5EXEA 2WB4A 5ECYA 4R9RA 3UA3A 1AS0A 1KDPA 1SUCA 2CXRA 4ZOQI 1RYBA 4TSFD 2GN1A 4D9NA 2CNKA 3K4PA 4I46A 5H4HA 1DUSA 4XM0A 1W5BA 5CTJA 4UDNA 1QOZA 2Q2WA 5DX1A 3VO2A 2WG0A 2CYAA 4HAWA 2X9VA 4HQOA 2AC2A 4KRXA 1IAQA 1E6CA 1X1RA 1YGPA 2IYYA 1YBMA 4GP9A 2AR7A 2W4MA 3LXUX 2IUSA 3OECA 4GKKB 2BGIA 3HKDB 3WJAA 4JX9A 4V0NA 4Q3NA 3KXKA 4XIYA 3WMFA 2C4KA 4HXFB 5AK5A 5ICMA 1WTAA 2IZ6A 2HRCA 3LG2A 2E6KA 1CUHA 3LGSA 5TY0A 3T8YA 2GO7A 2JLYA 3OM1A 5E0KB 1KSGA 2AOTA 3NEJA 1SBNE 3I8SA 3SXUA 4I1RA 3P9NA 2VZ8A 4GIBA 5L3VA 2X76A 4AUEA 1UKVY 2EZTA 2OMEA 3OT1B 2W6MA 3QU5A 4TKLA 1RI1A 3VI3B 3G2OA 5ALZA 2XZTA 1XJQA 3A2KA 1MJ5A 1N2IA 5IH7A 4RAQA 2XADA 4JS0A 1F2DA 1D1QA 2W6OA 4KV7A 4MWZA 4NOKA 3PC8A 5F5XA 5HCNA 2WVHA 4URUR 4E1VA 2J59A 5KCZA 3JSAA 3RJ9A 5EP4A 3RRNA 4M8NE 4NMMA 4W4TA 3ZK7A 3CFYA 4QJBA 3GFBA 1LSUA 2EU8A 3Q7QA 1B74A 4UBMA 1HG1A 5FB3A 1V45E 1KEPA 2ORED 2Q3DA 3D5TA 1G21E 4NATA 1RNLA 2OCGA 2R5FA 3UAOA 4N5NA 2D54A 1GGJA 2JH9A 2OESA 4KQIA 3EF0A 3OQNA 1GUDA 3HUUA 3GFSA 3NGLA 4L8WB 3TJMA 1EINA 2YHBA 4X61A 1LK7A 2QP9X 4EY3A 4LMRA 5AP9A 4D1YA 4YPOA 3LOUA 4QEDA 4YP7A 2WZDA 4RPHA 1RXEA 3CLTC 3HKBB 3FZEA 5TGTA 1TD1A 2GTHA 1NMXA 4EF5A 3U6BA 2G40A 1KI3A 3FFTA 4EX6A 5IKEA 4F1WA 1QQTA 2CXHA 4NL4H 1Y4SA 4N8SA 4CTNA 4GQIA 1TUIA 1SVLA 3N0XA 3VPXA 4DZRA 3OUUA 5JPCA 4HHEA 4F5DA 1SVNA 2R62A 4INJA 2B0CA 3IEPA 1P5HA 3NHJA 1WM1A 3QRWA 2JGKA 1UFQA 1KH2A 2O2EA 3F8TA 3GMTA 2QPTA 4RORA 3MAAC 3RTBA 1L6IA 4ALNA 2PD3A 5F4BA 3UJCA 2EFGA 1LX6A 1UL1X 1SKAA 2FMXA 2IIBA 5FRDA 4PQEA 3P20A 1ORVA 3R24A 2V7VA 3WYDA 1XXLA 2F67A 2ZKLA 5AM3A 2VPWA 3KKQA 5KJFA 5F3RA 1WKCA 3KO8A 3ZVRA 1WUIS 1AO3A 1LS6A 3NPAA 3RRBA 1QV7A 4C4SA 4JJGA 5EXTA 5JLAA 1MT3A 1V0JA 1J8MF 2WWTA 4O2AF 3ZU2A 2QTZA 3EBPA 1XPJA 4YRMA 1H3EA 5A0VA 2GS9A 3I0NA 4CG1A 4LNUA 4D8YA 5C8VA 4J16C 3KDAA 2VJKA 3WSTA 4O4HF 3U9LA 2VH1A 2IPAB 1L4GA 2VXYA 1K9VF 4O4IB 4YMUA 1X87A 1M67A 4YACA 4C0XA 2ZS8A 1RYMA 3UXHA 3ZWXA 3RVMA 1WUJS 2BFCB 2OENG 4D82A 2X5KO 1G6Q1 2VA9A 2JFHA 4LE1A 2LIPA 3N07A 4PW0A 3HCPA 5EWJB 4A10A 5ELXA 4ALIA 3FVWA 2XCUA 3IPAA 2L82A 3DZFA 4WQMA 5HF5A 2WB2A 3T35A 2RGNA 3GAAA 1U2GA 3F6SA 4ZZ1A 5TV2A 3H1AA 2VCYA 4WMLA 2ZEJA 1QFXA 3DKIA 3KK0A 2C2ZA 4PFQA 4DEYA 3AVXA 3ANTA 4AJEA 1P45A 1A04A 1UEJA 2SHKA 2CK3D 4U3JB 4DCMA 1Q84A 1G6HA 3U4AA 1E2JA 1AO0A 1ZC4A 3KQVA 2HF8A 1XTTA 1NW7A 1AHNA 2JJ1D 3F74A 3F78A 3LOQA 3NP9A 2GCIA 2BSQA 1XTSA 4EGJA 3BM5A 4GMFA 2G80A 2R8ZA 3PQ5A 4L95C 5GONA 4BFUA 1PJTA 1JZQA 4BN0A 1V3TA 6ADHA 3DYIA 1A50B 1PRYA 1YS7A 1DXYA 4MGKR 1E89A 4JJKA 5CB0A 4JNCA 4BMCA 3J81A 4LI0A 4YCSA 1TCBA 3F5DA 3LC2O 1Y7PA 4M0UA 4WW0A 5K05A 4RK4A 1K0FA 5C1OA 1D9ZA 2GVZC 4I6EA 5JADA 2EAUA 1K4KA 2HK7A 1NYRA 4D9JA 1FFCA 4X6XA 1F8YA 1NVKA 2EW8A 1RBYA 2AJ8A 2VZLA 4LRQA 4CM7A 2AG0A 3ZD6A 1LB1B 2MHCA 3VR3D 1NQ5A 1RWWA 2H7YA 2W6IA 4GLOA 1IUNA 1EM8B 3VH2A 3RHFA 1R15A 1Y7LA 1H3FA 5CVUA 5I5GA 2C5AA 1OX4A 3I8XA 4PIPA 3ZDRA 1E32A 1KY2A 2ZRPA 1FMFA 2E21A 3TCKA 3ZCVA 1NXSA 2HM7A 2ZE7A 3A1VA 1F0YA 1DWUA 3VAZA 1YK1A 1PGJA 4E46A 1ZXXA 2LIVA 3HXKA 3Q0IA 4HGNA 1IOWA 1BE0A 1VHWA 5H9WA 3K2BA 1JFLA 3KFXA 1AD2A 2WSBA 4OOFA 1PHRA 1XWWA 2BM9A 4YPFA 1CLUA 2IIQA 4NP6A 5LMNB 2GZAA 4BEJA 1M2EA 5KYWB 3DVRX 4TXJA 4WINA 1HPLA 1AXRA 4FFNA 5EUBA 2RIRA 1NJ2A 2AMVA 1BE1A 1KAQA 3G0GA 3T4EA 3VNBA 2VP2A 3K05A 4IOMA 2H3HA 3CLUD 5TRTA 3BMXA 5J2TB 2J3MA 4ZVVA 1F7UA 1SXIA 3EA4A 4FGLA 4EI2A 1K88A 4FDVA 4M46A 3G9UA 4P4SA 4PFSA 3VU3A 4PGHA 2HHHB 1NOKA 5ALPA 2F4NA 4MQ5A 4QHTA 3C87A 3FUCA 3LX4A 3D6HA 4NCKA 1KK1A 1T4BA 3B5IA 4MPRA 3EE6A 4WZZA 3IIEA 3GDOA 4QC2A 4DCTA 1CYEA 2F7SA 3H9QA 3PWTA 5DBFA 3EXG2 3T9EA 4B84A 3JPYA 2Z9BA 3KZVA 1ZUIA 1M1ZA 1RQPA 2XR1A 1N2HA 1JDPA 4MVJI 4QPPA 4OHFA 2GM4A 3OJWA 2ONYA 1VKOA 1N2EA 3VOSA 1EHCA 1YZKA 2QUIA 2WTXA 3DOFA 2C4NA 3K1YA 4R4JA 1DTWB 2FEPA 2ZGVA 3MTBA 3OPVA 4C7OB 3WWCA 1D4OA 3AR9A 3MJSA 1PVDA 4WHMA 1UEIA 3UATA 1VE6A 4RDXA 1QUEA 3HEMA 1ZM2A 2H1CA 2JH8A 5KWVA 1OXMA 3A9RA 3ACCA 4TKVB 4CTOA 3MTJA 1ULSA 1E1RA 4NBSA 1PU2A 1OXBB 4Z9FA 1O6GA 2NU7B 3TAHA 2WKPA 3TTYA 2OA0A 3U3ZA 2QLJA 1M6WA 3INTA 4II7A 4B3IA 4CM9D 5K8LA 3DF9A 3PT5A 4REQA 4RE6A 1EVIA 3DDHA 5LJLA 4EFLA 4ZKEA 4L57A 4FGWA 4M7OA 5BQFA 3UMJA 4IXMA 4I8IA 1GPKA 2EGGA 4O4JA 3WICA 2HW8A 1ZLXA 1LDYA 5CT8A 4N0DA 1W2WB 1DQRA 2N75A 2ZJFA 2QQGA 4TXLA 1YNSA 2FF7A 3M4XA 1XHLA 3SDBA 4KWIA 3I5YA 3BWBA 5DASA 5I8WA 4G8CA 1DVRA 2DCMA 4R2WA 5D3KA 1QPGA 2PH7A 4L7VA 4QO7A 4KDFA 4L0MA 1DMRA 5LQAA 1ZKMA 3EQ6A 2V3VA 4FTWA 1ZRNA 4H7PA 4ZAYA 5TLSA 1UIRA 2C2OA 1SOUA 3NBKA 2R8PA 5KQMA 2ONZA 2WWFA 4E33A 2WU4A 4IHQA 5AOCA 4B45A 1AB6A 2Y1LA 4B2LA 3ZJ5A 2FB9A 3LUDA 4AY3A 1SZJG 5DN6A 3PRHA 4ICIA 5BUZA 3L7DA 3BGDA 2Z9CA 1Y6RA 3T7TA 1BYUA 4U9IS 1YJAA 1VJDA 2ODBA 1I7LA 1IFXA 1X7GA 2A59A 3G0CA 5DO9A 1VL6A 5E4YA 4OXYA 2CB9A 4XWWA 1AF4A 2M2IA 1K6MA 1ZC3A 4EHNA 3RFFA 4B6JA 4M49A 1AK9A 2E89A 1YB6A 3ESDA 1U65A 3FOEC 5E7MA 3T54A 5JYEA 1T2EA 2AFRA 1T9BA 5I7UA 1ZICA 3G23A 4LV6A 3CRQA 1QUFA 2AI2A 1ZD2P 5AI4A 2BHRA 2ID7A 4HYTA 3TNYA 3UT0A 5JZSA 3ZDEA 1TECE 3Q8KA 4MLPA 3EDMA 2PLNA 3R5SA 3QLUC 1UEXC 4NAVA 5AJTA 4EA6A 3S68A 1LUAA 1CZHA 1Q12A 1DJPA 1QDLB 1WUKS 1RYYA 5EYPA 1OBFO 4QGSA 4DMFA 2C88A 2ZTVA 2V1UA 2Z1NA 3WLNA 4FX2A 3AUKA 1V7PC 4ALLA 2H7CA 4XLTA 5KSOA 4RIHA 3BXPA 3ZU4A 5AMXA 2O9JA 2OQIA 4F6LA 4LJSA 2IK8A 1E94E 4BGUA 3V7WA 4DJTA 1E1YA 2Y0PA 1AE1A 4OQYA 4YAEA 2M6LA 3ISTA 2J3DA 5FLEX 3S2YA 3SSAA 4B48A 3TLGB 1KKMA 5KAMA 2FSVA 4BWVA 3E9CA 3JS5A 4M6WB 4OFZA 1YL7A 2PRYA 3E9YA 3D8HA 3QE4A 1ZG3A 3W6ZA 1FYFA 1EFKA 4QLOA 3LPNA 2JFVA 3SHQA 4ZI2A 1EGHA 3CNLA 2QN2A 4CF6A 4OK5A 1HF3A 3GK3A 3T9DA 1REQA 2KPOA 3NEAA 5BN5B 3NW9A 4CQMA 2HLDD 2VK2A 4D41A 3FX2A 4WBNB 4BO9A 1AKVA 3MBKA 5U1PA 2HOQA 1X8KA 2GJAA 2WVJA 3C45A 1PR0A 3TMYA 3ADCA 4OQMA 4D43A 3CVVA 3GYGA 4JQZA 3FMGA 1H0SA 3HI4A 4YMSA 4JVNA 2BFNA 3D3KA 3V4LA 1Z68A 1I2DA 1MP0A 3HE3A 4ZEMA 4B9EA 4YRNA 1ZD3A 4GUDA 4AKTA 1X7YA 3RV4A 1Q57A 4MH0R 3WL3A 3JQAD 2IYFA 2QUKA 1ZO8A 1PQYA 1W96A 2P3SA 1OR8A 4CU2A 5HJ7A 3FWNA 5B55A 2D2FA 2NQ8A 4GUAA 1LW7A 4O0MA 4PRYA 3C7KA 3Q5GA 3ICOA 3I0ZA 5FF9A 2ZBUA 3JQDA 1TT7A 4OA8A 4WNYA 2P41A 1H2BA 5CDGA 3ZD8A 1KI1A 2WV9A 3AFOA 5KSYA 2W58A 3QFCA 4TLEA 2NUBA 3C41J 1QHHA 4KIWA 4PZDA 4RVSA 2J0UA 1O95D 3FOAA 4QELA 4WLFA 2Y1FA 1DAMA 2FR8A 5C7OO 3UAWA 1GQYA 5BSMA 4CM3A 4MQUA 1XCOA 2ZBRA 3OFNA 2X6QA 3PZBA 4AD8A 2TYSB 3WGNA 3NIGB 1JZSA 1Z6GA 3G13A 4JGIA 2H9IA 3ETLA 3BH7A 5LWQA 2XTNA 4FQ7A 5EY5B 3T52A 3QVWA 1XQYA 4MVWA 3AV0B 3I6BA 1NP3A 3Q3CA 4H59A 1TB4A 2GK7A 2NZYA 1G59A 5BR1A 2AN5A 5HXAA 4RMJA 4DCPA 3WR5A 2PVSA 1XLTA 3AY6A 8ADHA 5HZHA 1N77A 3F6PA 4D0NA 2QWXA 1MV8A 5E95A 2JIQA 2QVYX 4OHVA 1X9IA 2PSSA 4MR8B 4S35A 4D8TA 4KPGA 5K3CA 3U7RA 4PN7A 2VYQA 3ZQUA 5GZ3A 2BFAA 2G63A 2YXBA 2RB4A 3DZGA 1YSCA 2ZWIA 3G7UA 5CFRA 3V1MA 3M81A 4Z99A 3TVYA 1GGKA 1R74A 3G89A 2XE7A 2VSQA 4LWZA 2IV7A 3CW8X 3FOFC 3THXB 1QFMA 4FEAA 2J0VA 4BMNA 4ONEA 4QM6A 5TVKA 1VHDA 3DZIA 4CR7A 4PQYA 1XN4A 1GRVA 1L7PA 3D3QA 2ZCVA 1YONA 3D7SA 3U7HB 2PLFA 2YQ4A 5ECWA 3F3MA 2QRQA 3VR5A 5KJEA 4UEOA 2XB4A 3VVCA 4C5AA 4D9EA 3R6WA 3OE7A 4KSCA 5AW4A 5F1KA 3GGSA 3LZ6A 3USCS 1CB0A 3FUVA 4IVNA 4K9NA 3NHRA 4TQGA 1GA1A 4AO8A 1V8DA 5L7WA 1HEYA 1X80B 2Y1EA 4MQMA 3RR2A 2XKKA 1G3QA 4QQRA 1GKUB 1Z39A 1XKLA 3R74A 3JZMA 2O7QA 3PKJA 5BWMA 4FFRA 1CUSA 3RBVA 3V5NA 2KSQA 4JJ8A 3KRTA 1ESCA 4IDFA 4L7QA 2J0QA 3MS2A 4FS3A 4GBJA 4JYPA 4R01A 3ORFA 2WKRA 3HP7A 2WIKA 4ZVKA 3QLVA 1RJ9B 1PZFA 3M6UA 4PYOA 4OREX 3BCSA 3UGKA 4ND3A 1CU1A 3OG9A 3QKSA 2XQIA 5T3YA 3WYEA 4EPVA 7MDHA 1OGJA 1TTTA 2DH6A 4R8RA 4R8VA 1J5XA 3PDJA 2IBSA 3ZWVA 5AXAA 1RAGA 1M2JA 1DAFA 3HM2A 4O2BA 3PQDA 4LOHA 5JSQA 5KQRA 4PINA 3W77A 4CF5A 1C0PA 1E9AA 1VLLA 2ST1A 5AVOA 1RHUA 2F3QA 1EVQA 2PZJA 2UUPA 4GBMA 1I10A 4RV9A 3M5DA 2AKYA 5G1NA 3KCQA 3RSOA 4BRUA 1H0KA 2O3JA 1JFFB 2XMQA 4YUVA 2ISSD 1WWKA 4RTLA 2SICE 1R7RA 2HQOA 1ECFA 1I6KA 1RRFA 2YJZA 1DKNA 1RAHA 4K6GA 4GW3A 1OAAA 4X8LA 5AJXA 3PFIA 1A77A 3WGZA 5TMPA 3TFOA 2BEVB 4UNPA 3CWZA 1CNMA 1SXJD 1XYYA 1HG0A 3F3YA 2F1OA 4L4SA 4NEHB 4BO5A 1ZJ5A 3BKXA 1NMEA 1DADA 4YJHA 1JR6A 3RIXA 3BMCA 3TR5A 4S1TA 4TUYA 3NMUF 2VATA 2BHNA 1UPAA 2BKXA 1H1DA 2WR8A 4OAQA 4TZKA 1DO2A 2DZDA 3CF2A 3CX3A 4R2IA 3T5DA 4Q37A 5ENVA 1OLOA 1YWGO 4QTZA 2CXQA 1OHHA 1P61B 2C20A 1Q0LA 2Q4DA 5BMVA 5CB4B 4RE5A 1CFJA 1UUFA 3N5KA 1ESNA 1JP7A 4EJ2A 3GN2A 5HHTA 3MGAA 3OBBA 1EYZA 3HXPA 3OT5A 4JA0A 3S99A 4PGGA 4CVNA 1H6AA 1F0KA 2PX8A 3KUUA 3AVTA 3THSA 1MZPA 5IJ0B 2XEXA 4ETMA 1ACMA 4GH5A 1K6EA 2VUHB 4L6IA 1T9AA 2ZYHA 5IC5A 3UY4A 3QK7A 3WL7A 1N5LA 4TSFA 4DIOA 2WHXA 4AZ3B 5JU6A 1P1IA 4F60A 3GLFE 4JUFA 5FI3A 1XFAA 5LDDC 1SULA 1W7AA 1EK2A 1JQ5A 2BZ0A 4K6FA 2JCYA 1Z37A 2QMEA 3OOWA 4JBNA 4F3CA 3QXJA 3PYMA 4P32A 3P9SA 2VHUA 4UKDA 2YC2C 2L2QA 3I53A 3MXOA 3NCHA 4H35A 4K88A 4NH4A 1K5PA 1CUYA 3UNXA 2GDZA 5JZBA 2DULA 2NXNA 3JAWA 4H3VA 2E5WA 3IXQA 3I92A 1ZAYA 1ZU4A 3GP8A 3AR4A 2IODA 3V4ZA 4B1FA 1PWZA 3DS8A 4TLAA 3T7CA 4AYXA 4EM6A 3I05A 3OLYA 2G9UA 1GYRA 1E0JA 2FPIB 2RCYA 1ZCAA 3H1BA 5EN4A 5IF9A 4X6YA 3FDFA 3M4ZA 1GQOA 2R00C 4WDQA 4DREA 4IQ0A 5IT4A 3A4LA 2EQ5A 1VXOA 2JHFA 2X5NA 1ABBA 1VPLA 3EGXA 3LK7A 3P2YA 3IURA 3KLNA 3WWOA 2OT3B 3QF7A 3IH5A 1E20A 4C6SA 2WUGA 3W2FA 2O2XA 4JOSA 1ORIA 1JUDA 2QMHA 4E30A 2IYXA 4RCYA 2ASVA 3L0BA 4BTEA 4FOTA 1KO1A 5JEDA 3JYPA 1BS2A 3OQIA 4P3XA 4F5EA 3LRTA 1C3VA 3L8MA 2BRUA 3ZCQA 4UBJA 1ODTC 3R7SA 1GDHA 1ESZA 4F21A 3SCZA 3KYCA 1COWD 4CDMA 8MHTA 4C05A 1U4OA 1XRPA 5F23A 1U8UA 3D0OA 1E69A 5EQFA 1KFKB 1NI5A 2FZGA 1ZJ4A 3C5VA 4YMIA 1Z0UA 1NF9A 4BDSA 1YQEA 2OSVA 1CUJA 2QRGA 3H5AA 3EEYA 4MYRA 4XYEA 3CRNA 2JLZA 3T5GA 3SSMA 4Y1RB 4EGQA 5IJ9B 5TT0A 1JX6A 3PXEA 3V4FA 1PZHA 3PPVA 1NC3A 1LPMA 3CEAA 3CR8A 2ZYAA 3OPNA 3UYLA 3WGVA 1QSGA 5CH3A 4B3FX 3R2JA 1ZLYA 4ODIA 4CF7A 1IUPA 1II8B 3QWFA 2AQKA 3A37A 3D81A 4JENA 3ZGYA 1G8SA 2CF6A 3KFLA 3T3PB 5DM60 2BI8A 2O20A 1GA6A 2PX2A 3QIVA 3T1OA 1WLYA 1Z83A 3FFBA 3OQ6A 3USES 4JP8A 4AU1A 4DLAA 1LPBB 4MZDA 1MB9A 4RC9A 1P5JA 4UM9B 3OQBA 2EDAA 2PH3A 5JS8A 3AR2A 4H18A 4XIIA 1YT5A 2Y1WA 4MB6A 3SYLA 4I1IA 3C4VA 1NXWA 1HQDA 2AW5A 1YBFA 2K2WA 3WP0A 1ID8A 1CC1S 1KK0A 3IOBA 2Q0XA 2ZSEA 4W9NA 1T4GA 2FXIA 1E3QA 3TBKA 2VHVA 4OHOA 4QGBA 3JATB 3ZY4A 4NCBA 1QMGA 2C97A 5BPFA 3K71B 2NIPA 3H1EA 4LJAA 3DMPA 5KYNA 3K8YA 3ZNQA 3ZTYA 2ZSJA 2BV3A 1U2DA 2QQ0A 2WQ6A 3D3JA 3LZCA 3FGNA 4HJRA 1L2TA 4P36A 4ALKA 4DDMA 3B9RA 3SQXA 4JSRA 2NTVA 3GAFA 3BK7A 3CB2A 1G0NA 5IVDA 2V74B 2XXAB 4HDAA 5B2ZA 2BF4A 3FCYA 1Z7YA 5F52A 4NZOA 3FGPA 3JQRA 1NI4A 1WDTA 1OW3B 5DNVA 3GVIA 5IDQA 2IV2X 5JD4A 3CUTA 4MJLA 5DP1A 4EW3A 1IY2A 1NDQA 1MC1A 3EZ2A 1C80A 2CNNA 4C4TA 1UP7A 4UDXX 4UTRA 1KMIY 3ILSA 1YS2X 3M6XA 3K0KA 1AQJA 3T3NA 2ZB2A 5CBPB 1IVNA 3EGEA 1N6HA 2FPWA 2P1ZA 3G5AA 4HO1X 5BXYA 3KUKA 1ZIPA 3AHIA 5FUWA 5FDFA 4PLWA 1RWKA 2EP7A 3PNSA 4ZICA 3CU5A 2JHCA 3TXAA 3LA8A 5KYUB 1DBWA 2WF9A 1HWYA 3IT0A 3LXMA 5FOUA 4OXKA 2RGGA 2V7XA 5AKYA 3MCUA 4KQXA 5HUJA 2CK3A 3Q5EA 4IJKA 4PC2A 1MGOA 4B74A 4MWDA 1AUPA 1XQVA 3LC1O 2E0IA 1JR3E 1TF5A 2NO9A 4DJAA 2QVZX 1NIJA 5IKOA 4DYVA 9LDTA 2JJ1A 4AP9A 1DLJA 4BWGA 2NZUG 4GXRA 4FSXA 2QX7A 3UAZA 1YBVA 2E82A 2QG9A 2V5UA 3VR2D 1ATIA 4PO9A 1IRXA 2XJ4A 1X8JA 1XHEA 2OHIA 2BLNA 4C43A 1V5EA 1Q3KA 5JFOA 2UVDA 3NC0C 4OK3A 4PLVA 4FNMA 5E1MA 3EIHA 2V55B 1HETA 2Y8EA 1HL3A 3AERB 3SE7A 1IXYA 4XCQA 3GLHB 2NZJA 3LQ4A 3FZYA 1NF8A 2IYWA 2Z6VA 3ZC3A 3OLWA 2A9PA 3ENZA 2NU8B 3A4MA 1KJIA 1QCZA 4Q4DA 3GNLA 4J1TA 3RI3A 4IWNA 2X4IA 4BASA 3AEUB 2CD7A 5I3CA 3QV2A 4EMBA 2FRVA 4PF1A 5E4TA 3CHYA 4OBXA 4QKQA 1H2ZA 2Q46A 4URFA 4I66A 1B6SA 1PV1A 3ODPA 4KN8A 2V1XA 1V5FA 3RWMB 2INGX 1AKUA 1R0WA 3ZBUA 3C8MA 1HH4A 3THYB 5ICGA 4Z4FA 3TECE 1HX7A 1OZAA 3K15A 4Q01A 3WLRA 1QTNA 4EW6A 1K7SN 2PGJA 1ZD4A 3UWPA 1UZLA 1EQUA 1I32A 2C8KA 3C1UA 3UJNA 4B79A 1JF8A 1VYHA 2RHRA 3H5WA 1YVDA 1GPWB 1HLDA 4C0QC 4PN3A 1HURA 3EXEA 1SC6A 2GN8A 2E87A 3U5TA 1I5EA 3B9QA 1V9SA 4RLQA 2Z30A 4GI3A 2HU5A 5EKTA 3TVDA 1NSTA