1PJBA

L-alanine dehydrogenase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
361
structure length
361
Chain Sequence
MEIGVPKEIKNQEFRVGLSPSSVRTLVEAGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRVGLTAIAYETVELPNRSLPLLTPMSIIAGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVPNMPGAVPWTATQALNNSTLPYVVKLANQGLKALETDDALAKGLNVQAHRLVHPAVQQVFPDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ALANINE DEHYDROGENASE
publication title Analysis of the structure and substrate binding of Phormidium lapideum alanine dehydrogenase.
pubmed doi rcsb
source organism Phormidium lapideum
molecule tags Oxidoreductase
total genus 112
structure length 361
sequence length 361
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA02
4YAEA 2J3IA 2POQX 3FTNA 1BXGB 3I4CA 3FBTA 3CKYA 2HRZA 4KUEA 2R00A 1HE3A 3INTA 4KQXA 4ZRMA 4BNLA 2O3TA 2EIHA 1LDYA 4CR8A 4D45A 2GERA 1ZJYA 1PZHA 1AHHA 2BKAA 2NACA 3M6IA 4FOOA 2FWMX 1HT0A 2EJVA 3GY0A 3VZQA 4GX0A 5DOZA 1N5DA 3FPLA 4IDFA 1B8VA 1GADO 3H9GA 1KYQA 4CLRA 3AFNA 4YYZA 5FYDA 3GGPA 1PL7A 4E5NA 1MGOA 2BLLA 2PKQO 2VHXA 5I7FA 1CWUA 1W4ZA 4FR5A 4YJGB 5DDIP 2O3UA 2HMWA 1DFGA 5BNTA 5CG2A 3GG2A 2ZB7A 4BGVA 1BXGA 3QSGA 4PFJA 4R54A 3TZ6A 1YB5A 4KTVE 3HWRA 6LDHA 5K0ZA 1K0UA 4HP8A 3ZWCA 3AI2A 3PQDA 1ENYA 1T4BA 1DIRA 5CEEA 5JMWA 1QSGA 3PWZA 4BNHA 4TVOA 4XX0A 3PTZA 1XGKA 3PK0A 1HYGA 1KEVA 4IQ8A 3X2EA 1IPEA 1UXKA 4CUZA 1BDMA 1D1TA 4K26A 2VWGA 1EUCA 4BS9A 2Y1GA 1WDKA 5JW6A 1I2CA 4WOJA 5KNLA 4J2HA 1HE2A 2JL1A 1HE4A 2J8ZA 2AXQA 4XYLA 1P31A 5TIIA 4PZCA 2AE1A 3KHUA 5DNAA 4ZGWA 4CM3A 5TNXA 1XQ1A 3I9NA 3ON5A 1HE5A 3U49A 3ZI0A 2OORA 3VPHA 1PEDA 3GN1A 2Y1OA 1U3WA 1PS9A 3TF5A 3OIDA 1LLCA 4HXYA 4EYEA 1B3RA 3OJOA 2VTDA 2GZ2A 2E37A 4ZQGA 3ORFA 4YJDA 3ICPA 3PJFA 5DBGA 1IYZA 3H9QA 3R0IA 3UN1A 4Z0PA 2DBRA 3BYZA 1ID1A 3WLFA 3O8QA 1DJNA 2A94A 1V6AA 5I9NA 3I1JA 4AFNA 3DBRB 2BELA 5ILOA 3PQFA 3PGJA 2EHDA 2V6GA 3TOXA 2FPPA 1ADFA 4JK3A 1Q0QA 4G81A 4KUGA 3UH1A 4B4WA 3ITKA 4AJOA 4ZICA 4Z3KA 4PLHA 2CY0A 1PTJA 4Z9FA 4R3WA 2CUKA 1PWZA 3IS3A 5L7WA 2CDAA 2DTXA 4RCVA 4ROSA 4ALNA 1V3TA 2BF7A 3AY6A 1BDBA 3AI3A 2NUAA 1F17A 2EP5A 4JROA 3RU9A 1PX0A 2YV1A 3VOSA 1HL3A 3GHYA 1Z74A 2AEMA 3KSZO 3IKVA 3U4DA 4Q3AA 2JCYA 4E4YA 5C7LO 3AOEC 3SC6A 2ET6A 4XRRA 2GR9A 5IG2A 1B26A 3ONFA 1LDNA 2DUUA 3HDQA 2W2KA 1V8BA 2ZYAA 1VL6A 1LRKA 1YDWA 3D1LA 1ZCJA 2DLDA 1Q0HA 2JKVA 1A9ZA 2PKQP 2VOJA 3RD5A 2I9PA 3O4RA 3DHNA 2UDPA 3PHIA 1I33A 1PJ4A 3V2GA 1NPYA 4BNWA 3KZVA 4E3ZA 3GVHA 1VL0A 1C3VA 4K6CA 1CDOA 3LDHA 5IDXA 3VH4A 4WGGA 2HK8A 2O2SA 3K2EA 3NUGA 5A3VA 7ADHA 2BFPA 4HKTA 3CZMA 4IS3A 3UCFA 1LSJA 1X1TA 1GCUA 3JQ9C 4DUPA 4ZVVA 1WP4A 2RBEA 4CLXA 5JDCC 4OMUA 3K2BA 1DIGA 1KEWA 1FF9A 4E5MA 4ZU3A 3C85A 3PYMA 4XGIA 3S2GA 2HAEA 4EJ0A 2HRBA 1DAPA 3S2FA 4ZHSA 3GPDG 4YJHA 3BTVA 1PSDA 4CM8B 2FOIA 2DAPA 4ID9A 3KTDA 2Y66A 4E32A 1VKOA 5KKCA 1G1AA 3QVWA 4L74A 3L6DA 2ZYDA 1UP6A 4RGBA 4BNNA 2WMDA 4XQEA 9LDBA 1I01A 2AMFA 2HDHA 2XF8A 2XPCA 3VH3A 4YR9A 3JD4A 3WSVA 4XRGA 3DOJA 3JD1A 4M1QA 1DXYA 4A7PA 3I4FA 3M2TA 1HF3A 2Q99A 1JVBA 1LQUA 1KEUA 1KVTA 1MA0A 1PJTA 4ALIA 1P9LA 5JY6A 1I8TA 5JE8A 1ARZA 1ULUA 2HJRA 3ZWXA 4EUFA 4L4RA 4IXTA 3TPCA 4J1NA 4DGSA 4NH4A 5IF3A 3RUEA 2D5AA 1CYDA 1DB3A 1WNTA 4QTZA 2BGMA 2GLXA 3P5SA 1Q7CA 2XXBA 1AXEA 3FRJA 1MLDA 2X5KO 3F1KA 3TFOA 1ZVMA 4J91A 4CR7A 3PHGA 5IDYA 1E7WA 2NQTA 3DBHB 1KVSA 1UDAA 2GZ1A 2ZQZA 3ZWOA 4D3FA 1WZEA 3MJCA 3F5SA 1XG5A 3ZW9A 1Q2XA 4YAIA 4BNJA 1PQPA 5DT9A 3L07A 4S1VA 1DHRA 5EERA 1H93A 3R3SA 4DQUA 4RLSA 1P1HA 1DFIA 2BI7A 3UCEA 1GUYA 1E3IA 4MOWA 1OC2A 3GHHA 3UUWA 3ZNPA 3WQRA 1UUFA 1ZH8A 2C54A 3HN7A 4WLNA 4WLEA 1F12A 3KYDB 4PGFA 5GY7A 3GA0A 3WSWA 2VYVA 2GZ3A 3DBHA 4FD3A 4OOFA 4L73A 3UXYA 1PWXA 1AE1A 3KEOA 4NFHA 2BH9A 4GVLA 3SJUA 2X58A 2PH5A 4B7XA 1E77A 1NQ5A 1TI7A 4PG5A 3D4OA 1XDWA 3SX2A 1J0XO 2ZB3A 4J16A 4E2XA 2OXIA 2Q49A 4UVIA 1IULA 2NQ8A 2NSDA 3H8VA 2BGLA 1E1KA 1PJ2A 1Z75A 5JDIA 2RHRA 1K89A 1R4NB 4R1TA 4CM5A 3TSCA 1LX6A 1X0VA 2VNSA 3H3FA 2VHWA 2ZIZA 3F47A 4P38A 1EUDA 4R01A 1XIVA 3VZRA 5L4LA 4CV3A 3LF2A 4F45A 3DXFA 4PN3A 2HMSA 3KYDA 1N9GA 3K9QO 3SXPA 3IIEA 1ISGA 2PLAA 3OA2A 1U3VA 3RAJA 3RC9A 2GO1A 1N1EA 4ND3A 2VN8A 2H5LA 3ASVA 3Q11A 2Q2WA 2O3QA 4NZ9A 4YTEA 2BFMA 3VPGA 1NFRA 4B7UA 4E5YA 2G17A 4DL9A 5JLAA 3HDJA 1AUPA 2H1SA 2VT2A 3BHJA 3GLQA 3WGHA 1H6BA 3R1IA 1AGNA 3AUTA 2AEFA 4B4OA 4B3IA 5EESA 4PG4A 4TKLA 2QIOA 5CP8A 1YQDA 1A9YA 3JYQA 1A4IA 1R4NA 4EJ6A 4BO6A 1YJ8A 3E9NA 5J23A 4CQMA 4P22A 3ZHZA 3KXDA 1IHYA 1YH3A 3JQAA 2ZK7A 3KBOA 1HDCA 2X8LA 2BD0A 1ZK2A 4DC0A 3K96A 2V6BA 2VRCD 5KVCA 2JFFA 4A10A 2AE2A 2HJSA 2RIRA 4FJ0A 2G5CA 2X0IA 3SJ7A 2IDZA 4A5OA 1P1KA 3COSA 3OMLA 4MVJM 4GH5A 2CSUA 3L4BC 5FFFA 2DBQA 1LSUA 1M6WA 4NBRA 4NFSA 2HMUA 4GAEA 4YVFA 3QVOA 4PG7A 3DFZA 3RVDA 2QZZA 4OAQA 4MKZA 2WE7A 5JC1A 1QYDA 3AY3A 2PR2A 2LDXA 1TT5A 4U5QA 3D3WA 3VVCA 1LNQA 4NIMA 2CF6A 3NX4A 4LW8A 3TWOA 3AWDA 5BSHA 5JYEA 3ETDA 4Y8VA 1LBEA 2GF2A 5TF4A 1JAYA 3CSDA 1F8GA 4NQZA 4AJIA 5T6BA 1MXFA 3VZPA 3DR3A 3GNQA 1A7KA 1Y8QA 4FC6A 4BNTA 1SOWA 3GG9A 3GAFA 3QWFA 2TMGA 2CNBA 1L7DA 3TOZA 4EJMA 1J49A 1CRWG 1P0FA 1L7EA 3F6YA 3KLPX 3VPSA 1B16A 3DAPA 4QFCA 1K5HA 3WNVA 1UH5A 3E1KA 1YOVA 1NR1A 3KYBA 4R1SA 4JCOA 1BW9B 3V1TC 1R0KA 3NDIA 3FNFA 5BNFA 1GTMA 4P4GA 2O50A 1UXIA 1LLDA 4XCVA 2NWQA 4IZHA 1WPQA 5JCJA 3WR5A 4GSLA 4KDEA 1PJLA 1WMAA 4BKRA 5JC8A 3N7UA 2HMTA 1BG6A 1LEHA 1P33A 1LC3A 1KETA 3N74A 1YL7A 3VTFA 1LLUA 3CZRA 3ST7A 1WDMA 4W7HA 4RPGA 2IE0A 3CPSA 1XA0A 2YFHA 4NFYA 4YPOA 3HB5X 1PQWA 3ETEA 5THQA 3ROPA 3WTBA 4CM7A 3ZU2A 1E3EA 1GEGA 2Q2QA 2GD1O 1VRWA 2XOXA 3PZBA 4EZBA 3U62A 5KJFA 4DIFA 4W82A 1EVJA 3H5AA 3V2HA 2Q3EA 3HQ4O 4NJOA 3EK2A 1BW9A 1T24A 3RFTA 3I6QA 1UXJA 4AJHA 4CLEA 3JQ6A 1ISMA 1W6UA 5THKA 2W8ZA 2B5WA 4DLLA 2O3JA 1OOEA 4XIYA 1ZMOA 1ZK3A 1ZSVA 3BA1A 3NEPX 4PLYA 4TSKA 2IEBA 1L1FA 4A73A 1PL6A 2EWMA 2Q50A 3JD3A 4HFJA 4R16A 4RF2A 4CMEA 2EKLA 1O95A 1QYWA 3WIEA 1HSZA 2BFAA 1DIHA 1W8DA 2P5UA 2YYYA 4UUNA 5H81A 1YL5A 2D0IA 1DOHA 4WCFB 4IY1A 4NMHA 4BB5A 4DIOA 4RZHA 1YRLA 2X4GA 4TKMA 5GZ1A 1OZAA 3C8MA 4GX2A 1QYXA 4IJVA 1M67A 4JN6B 3H9JA 3RFXA 2DM6A 1P1JA 2P9GA 4WUVA 1T2CA 4ZD6A 1B8UA 3ZDFA 1ADBA 1KIFA 3BZUA 3G79A 2Q4BA 1UZNA 5GZ6A 2VTEA 1GYPA 1CF2O 2X1HA 3DMTA 4D43A 3NDRA 3WGIA 4IDGA 1QV7A 1P1RA 1SAYA 3L6EA 1T2DA 4RF4A 5C7IO 4LSWA 1DIBA 4P8RA 3H5RA 2Y1DA 2GN9A 4BV9A 1E6EA 4L4SA 5B1YA 4WCFA 1ZW1A 1FMCA 1VJ1A 3IUSA 3UHAA 3EMKA 4CUKA 2NLOA 4M86A 4TRNA 2WD7A 3NT2A 2JCXA 5FEUA 5HTOA 3WFIA 1P74A 2YJZA 1U2GA 4PRKA 2J5KA 4A26A 3OETA 1GEEA 2J5QA 4DBVO 4DVJA 4IM7A 1LI4A 1I3KA 5JXWA 1XKQA 5U1PA 3BMOA 1KBZA 4O0LA 5COAA 3FNEA 4MP8A 1PJCA 4I9NA 3M1LA 4W9NC 5TJHA 4D79A 5IZCA 5EJ2A 2VZ9A 2NU6A 1Q7BA 3QWAA 2PZMA 4U6QA 2QRKA 5I7SA 4UVDA 4CMGA 5AXCA 3BHIA 1WWKA 3F5QA 4U6SA 1KY5A 1YB1A 3RSHA 1JN0A 5L95A 3EVTA 1ZK4A 3JQ7A 4IDBA 3ZWPA 4MVJF 4LISA 5G4LA 3K73O 3EUWA 3Q2KA 4TRRA 3GVPA 5I8ZA 4I5FA 1E1NA 4Y67A 1SCUA 1MFZA 1OC4A 2D4AA 4ND1A 1JVSA 3P2OA 4AJ4A 3RIHA 3ZWBA 2B4TO 1BHSA 4MINA 1NHGA 2QRJA 1DRVA 4YAGA 3OIGA 2Q2VA 4OQZA 3S8MA 4BO2A 1LA2A 4KDFA 2VUTA 3ZWYA 1NTOA 4M89A 1XELA 2EKQA 4RPJA 4PIVA 2AHRA 1OAAA 4YT8A 4BO3A 1D4FA 2CDCA 2O2YA 5CPBA 4Z0TA 4EDFA 1JU9A 2YUTA 1O94A 5CEFA 3G1UA 3GPIA 1HDYA 3LC7O 1NASA 4UREA 3K31A 4X54A 2H9IA 2R2GA 4J0FA 1Z45A 1WVGA 2RHCA 5U4QA 3RUCA 1FDVA 2YHIA 1BRMA 2VYND 4I9HA 5CDTA 4Y6SA 5CDGA 4MP6A 2VRBA 4AL4A 3CMCO 3LLVA 4RJTA 1IL0A 1AXGA 2RAFA 3H7AA 5TRTA 1DRUA 4I08A 1NVGA 2PY6A 4BHTA 4PG6A 2WYUA 5ER9A 2I6TA 1I2BA 3KSDO 3ZU5A 4CMHA 3RWBA 4DA9A 3RBZA 2Z5LA 2V6MA 4AJKA 4J7UA 4KUHA 3HDYA 3OP4A 2IXAA 2GNAA 4LRSB 1XSEA 1WDLA 3LYLA 4YAJA 3AM4A 4ND4A 1PGJA 2NM0A 4XB1A 4J7XA 3WJAA 5BR7A 4CMJA 2GPTA 1C14A 2C2XA 2Y05A 1H6DA 4IQGA 4XJTA 1NXQA 3NTQA 1LSOA 3O26A 5B4UA 3IJRA 3U4IA 4DPMA 1B3BA 1XU7A 3ZV5A 1KVQA 2X86A 5A05A 1J6UA 4ZQEA 3OJEA 5I7EA 4ND5A 4B3JA 1C1DA 1EMDA 3AUUA 3QWBA 1HDGO 2D1YA 4OYRA 5A06A 1JAXA 1HDZA 4YJFA 3VZSA 1D1SA 3PHLA 1EVYA 2H63A 3HN2A 1TXGA 1NR7A 1YBVA 2WE8A 4CL8A 5A04A 2DBVO 3H5NA 4XZ3A 1PJSA 3OQ6A 3GFBA 3RQSA 1E1LA 5IDWA 2FN7A 4ITUA 1OI7A 3EDMA 3HNPA 4K6FA 2A35A 4UEKA 4YT4A 4ZQHA 1ISJA 3O8QB 3BTSA 4CMKA 1R6DA 1V3UA 4NDNE 2DFVA 3LT0A 1NP3A 1DRWA 4AJEA 3D7LA 2OUIA 4FDAA 2FHSA 2ZQYA 2HKIA 3NGLA 3DB2A 3TJRA 5G0TA 3TZHA 5JAMA 2ZYGA 3WWYA 2YQ5A 5DN9A 1M6HA 3VKVA 1B8PA 3GEMA 4UEJA 4IPTA 4QXMA 1R16A 1LSSA 3JYLA 5AQ1A 1JWAB 4GX5A 1V9LA 2IODA 4DC1A 1V35A 4CLOB 1PR9A 3W8FA 2D5CA 1KS9A 1O89A 4FPXA 3JCZA 3KEQA 3VKUA 4RVUA 2G1UA 1ML3A 4O6VA 1U2DA 4F6LA 4Y6PA 1DC4A 4MDHA 4G65A 1IPFA 2AEJA 4AG3A 3D64A 3FTPA 2W2KB 5BQFA 2A92A 2NV6A 4BNYA 5A3JA 1I3MA 5C3MA 1GU7A 4N54A 1A7AA 4LSMA 1NAIA 3T7CA 1H9BA 3MTJA 3NYWA 4N5NA 2EF1A 2OBYA 3MWEB 4RPHA 1O0SA 3E5RA 3PPIA 4P4NA 4ALLA 3A28A 1A4UA 2VHZA 4JIGA 3DMYA 3PJDA 5KJ6A 4QECA 3SVTA 3GR6A 4Z0HO 4CM4B 4WK6A 1AN9A 1HKUA 3ZWVA 3AOGA 2QYSA 2AQKA 2B36A 3BIOA 3FN4A 5A9TA 1HDXA 3LK7A 1GR0A 3KO8A 4QSMA 3ANLA 4B8WA 4CLOA 2XXJA 1NFFA 1EEHA 1GD1O 5EN4A 5KVSA 4Q3BA 5CFZA 1EK5A 3LT2A 2CF5A 3ZNQA 5HBRA 2NTNA 3ROQA 3DZGA 1IZ0A 4EITA 3VH1A 1YKFA 5DCUA 5IXSA 4KWIA 4TROA 1VPDA 4HFMA 2WWRA 3ANMA 3LC1O 4EEXA 1C0LA 4RQUA 2YY7A 4CMCA 1M75A 5ADHA 1WAMA 1HXHA 4YJHB 4D46A 4J1TA 4OQYA 2D2IA 3JQFC 1QG6A 4BNGA 3OM9A 3H2SA 2G76A 1HWYA 4LN1A 1MC4A 4ILKA 4WEOA 4IGFA 2HUNA 4CM4A 3OEYA 1I30A 3T4XA 3TNLA 3WYCA 4JP2A 2C07A 1EVZA 3Q0EA 2X7HA 2EGHA 3V2UA 3H65A 3HUDA 4QQRA 4BO7A 2AQ8A 3GOHA 4BB6A 5COQA 3L9WA 2EERA 4CR6A 5TLSA 1N8KA 2P91A 4B3HA 1RM5A 1BTOA 2NVBA 3D0OA 3RBVA 3CE6A 4WLOA 5TC4A 3ZV4A 1ONOA 3WBBA 1VJ0A 2O3RA 4YT2A 3GDFA 3KUXA 2R6JA 5AOVA 3ZHXA 1NVTA 4RVDA 5K9ZA 1Z82A 2DC1A 5ENDA 2WEKA 5MDHA 1HLPA 3F46A 3Q9UA 1I32A 1T26A 3VC7A 4H15A 3PHHA 4FFMA 3VPXA 1QV6A 1HDRA 4AJPA 1U3TA 2WSBA 4OXYA 1FDUA 4GGPA 4M8SA 4WNIA 3GQVA 3D4PA 1E7RA 3UFXA 4PZDA 4XQCA 3DL2A 4R5MA 4XQ9A 2PH3A 4BNMA 4D3SA 1ISFA 1M66A 1EE2A 3FNHA 4XB2A 5HM8A 1FDWA 1PGQA 1E6UA 1VJTA 3ADPA 3W4JA 4CMIB 1P1FA 3FCOA 1GZ3A 3JQEA 5KWEA 3AOEA 1C0KA 4CV1A 1XHLA 3EW7A 1RPNA 1Y7TA 1HSOA 3PEFA 1BMDA 5JY1A 5L40A 2JAPA 4AJ1A 3JD2A 1P1IA 4E33A 4IJUA 3V1UA 3R6DA 2AG5A 2I5PO 4D41A 5T67A 4DPKA 4GL4A 2C5AA 3E82A 4G5HA 1I10A 3VHRA 4BO5A 3D5QA 4JQCA 4J4HA 4UVHA 1D8AA 4UVGA 2IXBA 1N1GA 2QHXA 4C7JA 1R12A 1P45A 1YONA 5IZ4A 2J6IA 3ROMA 2Z1MA 3Q1LA 2O3SA 3KYCA 5KOIA 3MOIA 2O7SA 1U1IA 2ZJ1A 3E03A 3JQ9A 4KOAA 4AJNA 4GWKA 1U9JA 2J5RA 5KVVA 3KETA 3JSAA 2WTBA 4Z3DA 1PS8A 4CMIA 2HO5A 5JDCA 1NWCA 2ZCVA 3ENKA 3L4SO 3PHJA 3C1OA 2JJYA 5T57A 2VNAA 2WYWA 4DTIA 4NPCA 1FJHA 3BMCB 1E7SA 2E49A 1U5CA 2RH4A 2PGDA 2ZKLA 3H9EO 1M2WA 1ULSA 3PLNA 1VLLA 2IYOA 3G17A 3JQGA 4IIUA 3K92A 1H2BA 1UZLA 3RASA 5L4NA 1DFHA 1ZK0A 2VZ0A 3DONA 1UR5A 4J1QA 4ZN6A 2PFGA 4FB5A 1TLTA 3AUSA 5T5QA 4FGSA 1YE3A 3C1TA 3S1LA 5CEJA 2GDZA 3EAGA 2FRDA 3GDOA 5HA5A 5KKAA 2D3TA 1N9GB 4LRTB 5TX7A 5L4SA 2WD8A 2OOSA 3A1NA 3MEQA 3ONEA 4IDAA 3I9LA 5ICSA 4LMPA 1N7GA 3JQ8A 3L77A 4CV2A 3U5TA 2YFQA 3HG7A 3ZNOA 4A03A 2FSSA 3BMCA 3I3OA 4QT0A 4IDCA 1ZKMA 3DZIA 5FI3A 1FDSA 1EDOA 1DJQA 4YBZA 3HADA 3LSYA 4PZEA 4RO0A 4GKBA 1EUZA 2NU7A 1YS4A 2Y1EA 4YT5A 1DAOA 4GI2A 1U4OA 2VRCA 1PR3A 1TB4A 2ZATA 4RORA 4HY3A 4J9UE 4CQMB 3PFWO 4KMSA 3SBOA 2P2SA 1ZMTA 4J49A 3S55A 3JQAB 2VHYA 3BTOA 4RQTA 1V0JA 1HZJA 4MVJA 2RCYA 4CUJA 4L8VA 4UVEA 1MX3A 2P9CA 1YXMA 3QVSA 3OFSA 2C29D 4FS3A 1B2LA 3Q2IA 1BWSA 2DPHA 1LQTA 2HQ1A 3JD0A 3H2ZA 4BKUA 1YBAA 2Q1UA 3CIFA 3LQFA 4B79A 1X13A 3QP9A 1FXSA 4R41A 2B69A 1PL8A 1PGOA 5DP1A 2DU8A 2I66A 3JQDA 4D7AA 2X9NA 1TT5B 1Y81A 3C7AA 3D3WB 4ALMA 1VI2A 4CM9A 3QLJA 2GASA 4ZQBA 4Z9YA 3LZ6A 2W2LD 1I2ZA 3OECA 3GDGA 2PZKA 5EPOA 3DOOA 1LRLA 1Y8QB 2G0TA 3G3EA 3GUCA 4H7PA 6ADHA 1PZEA 1BSVA 1F06A 4JJGA 4YEDA 1ADGA 3IQDB 2EV9A 3LF1A 1AHIA 1IHXA 4JGBA 5JSFA 3F4LA 4N18A 4DLBA 1YOVB 2IZZA 4GKVA 1GUZA 1S6YA 3H4VA 4BOYA 2P4HX 4EUHA 3NT5A 3D4NA 3EC7A 3WQSB 1TEHA 4JLWA 3ZWAA 2D8AA 3PDJA 5G0SA 3RU7A 4MIEA 2O4CA 3WMXA 3OJLA 2B35A 3H9UA 3LU1A 4OXNA 5CDUA 2E48A 1MFPA 4EUEA 3QRWA 2PD4A 3I6IA 1GQ2A 3IMFA 2LDBA 3FD8A 4PVCA 1YBMA 1EQ2A 1UXHA 4MP3A 3GC6A 1SPXA 2DVMA 2ZB8A 3INRA 2WYVA 3HE3A 1LRJA 1XR3A 2A4KA 2QZ9A 4EBFA 3W6UA 3ZU3A 2WJPA 5IN4A 4D0RA 3GN2A 3I9KA 2G82A 3TRIA 3E6AA 1B0AA 1XYGA 3FNGA 3GMDA 4H16A 4UUPA 3NJ4A 5ENVA 4HWKA 5F21A 3UKOA 4I5EA 1X15A 1XEAA 3I52A 1NPDA 2V6FA 4HNHA 4CLDA 1GDHA 4DREA 3HSKA 4Y9DA 5IXYA 1CJCA 3PGXA 5T8KC 3T7EA 2CMDA 3GNTA 3GVXA 3RCBA 1ZBQA 1GQYA 2DTDA 3P7MA 3H6KA 3QY9A 4NK4A 5DBFA 3F9IA 3JQAD 3MJVA 1WMBA 1YVEI 4RL6A 4AJLA 1ENZA 1OMOA 1Z73A 4GMGA 4W7IA 3BXXA 4R69A 5T64A 5IJZA 4YB8A 1A71A 2PWZA 1R0SA 4PCVA 1T2FA 4E13A 3EVNA 3CTMA 4I1IA 3L4BA 1K6IA 3GF4A 4FFPA 2NU9A 3IC5A 4PG8A 2Z1NA 5L51A 3FR7A 4D0SA 4XYEA 4CM1A 5CAEA 2NVUB 3BMNB 4PLZA 4ZJUA 3IP3A 3ZHBA 1WW8A 2VOEA 4RVGA 4HUJA 4BNVA 1HRDA 5JNLA 4BL5A 4BO0A 4NBWA 4N7RA 4IJKA 3ZNNA 2CFCA 2Q1TA 4MKRA 2CVZA 4AJJA 3NKLA 1ZZEA 1UZMA 4BMNA 3AU9A 4AVYA 2JCVA 3FWNA 2IZ0A 5KJCA 1NQTA 2B37A 2YW9A 4LGVA 4Q9NA 3B20A 2ZTMA 3MZ0A 2AG8A 3I83A 3QVXA 1SB8A 4Y6RA 1MXHA 3INGA 2NVUA 4IUYA 4K9DA 5I7VA 2WD7B 1DO8A 2AA3A 5A4DA 3BMNA 4PLTA 4DLAA 2GN8A 2CDBA 5C7OO 1YO6A 3NT4A 1ORRA 1KVUA 5CHEA 2GGSA 4BMVA 5ES3A 2GRAA 1HDOA 3KVOA 4XYMA 5JCJD 5JYDA 2YZ7A 3LT1A 3V5NA 1DIAA 1RJWA 3BMOB 3ENNA 3MOGA 3NDJA 4EW6A 2HLPA 4Q3EA 1U4SA 4HFNA 3F3SA 1G0NA 4FC7A 5CDSA 5CDYA 4LK3A 4R9RA 2C59A 2OO5A 1A72A 3PYXA 1NYTA 1ZXLA 3JQBC 3MJSA 2FR1A 2IEDA 2QYTA 3DZFA 3M1AA 3WGGA 4BNZA 2YDXA 1T2EA 3K6JA 4QO7A 4XR4A 8ADHA 5JO9A 1G0OA 4BKQA 2P4QA 3MTGA 1E3WB 3JQ7B 3PWKA 4LVCA 3PDUA 1HEUA 3ETGA 3IDSA 1UP4A 1VKNA 2PGJA 2QW8A 4IQ0A 5DCWA 2Y68A 4BO4A 3PJGA 3QWIA 4DYVA 3DZBA 3ONDA 4TQGA 1MG0A 3ZWNA 3IAHA 5F1KA 4E2ZA 3UVEA 4JBIA 4OO3A 5IN5A 3DHEA 4Y98A 5LDGA 4G2NA 1R66A 2BRUA 4RVHA 4HX5A 4GWGA 4FN4A 5FWNA 3FWZA 2X6TA 4NI5A 2HU2A 1FK8A 1E0DA 3GH3A 1CQJA 1ISIA 2VQ3A 2VHVA 2NADA 4N5MA 1I5RA 5ITWA 3ZH2A 1O6ZA 4NNJA 3C1AA 1MV8A 2OMEA 1X1EA 2BHLA 1H94A 3DOCA 2EG9A 2P5YA 4A2CA 3RUFA 4MKXA 1QLJA 3KLMX 4OXKA 4JNKA 1E6WA 1Y5RA 1E3WA 2R00C 2YHIB 2B83A 3AJRA 3TQHA 4DPLA 1Y8RB 1PJ3A 4O59O 2PA3A 1U28A 4WJZA 5DZSA 4IMPA 5F3RA 4BQPA 3I23A 3EHEA 3BAZA 1DPGA 1VL8A 1GV0A 1XU9A 2DTEA 4MJLA 5G0VA 1KERA 1LXCA 3KM0A 1E7MA 5F1OA 1C0IA 2FR0A 3DAGA 4WASA 5ER6A 4DWVA 4A0SA 2UYYA 1U7HA 3GK3A 3A4VA 3A14A 4U8GA 5KJEA 3SLKA 2OGUA 4BMSA 1P0CA 3ZWMA 3LC2O 1NQAO 4NK5A 2W98A 5CPFA 2QRLA 3PP8A 2NVWA 2VZ8A 1RWBA 4Q3CA 3TN7A 4NU5A 3MJTA 5A1TA 4B8ZA 1QLHA 1GL3A 2J3JA 2X23A 1VC2A 4O5OA 1VE9A 4J43A 4NJMA 1ZK1A 2PD3A 4F46A 1NWHA 4JJFA 1I24A 1Y8RA 2FP4A 3DZHA 4Z6KA 1C1DB 1SO8A 4EGFA 1P77A 5EQFA 4RLHA 3TDKA 4YJFB 1NPTO 3CXRA 2JD2A 4FOSA 2TMDA 2D59A 1Y6JA 3RUHA 3GT0A 3GGGA 1T4DA 3SC4A 2FPGA 1UP7A 4RPLA 3OIFA 3HHPA 1F8FA 1R4MB 3LT4A 5G0UA 4DXHA 4PRLA 5DULA 3PJEA 4B4UA 4W9NA 4D44A 4GVXA 1H5QA 3GVIA 1NNUA 1BVRA 1SEPA 2B5VA 3PLRA 3VDRA 3ZW8A 1E5LA 1OBFO 3QV1A 4PLCA 1QR6A 4MVJP 2YQ4A 4OM8A 1JKIA 1KVRA 2A9FA 3E5MA 3TZCA 4AJ2A 3BMQA 3TL3A 4F6CA 4BKPA 4XEHA 1SOVA 2HK7A 4TRMA 1NQOA 5KTKA 1EZ4A 1LDMA 3FR8A 4XA8A 3P2YA 1ZNQO 1Z7BA 4CM6A 4OHUA 5DOVA 2Y93A 2ZTLA 2NU8A 4CODB 1R4MA 4PLPA 1PQUA 1IB6A 3E9MA 3STHA 3WFJA 1E5QA 4WKGA 3NGXA 1DDOA 3X2FA 3GZNB 5U9CA 3O38A 4E0BA 2BMAA 1GCOA 2PZJA 3HZZA 3IP1A 3L0DA 3QQPA 2V7PA 4PVDA 4R9SA 5KVQA 1Q0LA 1QYCA 3BTUA 1CQIA 4TVBA 3OBBA 3WGQA 3E18A 2B4RO 4GLOA 5TGDA 3U4HA 1H6AA 3MWDB 4IJWA 3W8DA 2O4UX 3V8BA 4CL3A 1PIWA 1JQBA 5KJ1A 2V65A 1G6KA 1TVEA 3NV9A 5JPIA 5L45A 2FR8A 4J3FA 3CH6A 4WEQA 5TSDA 1NFQA 4GBJA 4NHEA 3B1KA 1Z7EA 1N2SA 1P3DA 3B70A 3VAZA 4E30A 1SEVA 1JKJA 4OSOA 4BO9A 4E31A 4ALKA 3E9QA 3AU8A 1KOLA 1QKIA 3CUKA 4IXWA 1ZO8A 2Y0CA 3UAGA 1NVMB 2Q45A 2VCYA 1ENOA 3GZNA 3OSUA 5KCZA 3WBFA 3C3XA 1PJBA 1GZ4A 2BFOA 2I3GA 4YJGA 1U5AA 4NBUA 4BV8A 4CQLB 3DAFA 2X9VA 3S2EA 3GEGA 1PZGA 1KC3A 1H2HA 1UDCA 2HMVA 1W73A 4JP3A 2PZLA 5EMHA 3WQQA 3I9MA 4KZPA 5F1PA 2Y1CA 1GPJA 3RI3A 5JMPA 5L53A 1YDEA 2AW5A 5G4KB 4RVSA 1J5PA 1PZFA 2CVOA 3K5PA 4E2YA 1XLTA 5LC1A 4IDDA 2C5EA 5JO0A 3GRKA 3ZU4A 2DUWA 5TT1A 5L7TA 5F5LA 1RM4A 3MJ4A 3GNSA 3ROKA 1K3TA 3SEFA 4Q39A 4URFA 3QVTA 4R4JA 5BT9A 4ZA2A 3V1YA 3FF4A 3U09A 1MB4A 4GPD1 3IUPA 1ADCA 1I3NA 1ZSNA 3JYPA 4CQLA 4PLVA 1JW9B 1NBOA 1WZIA 2I76A 4XYGA 1ZUD1 1LTHR 1ZSYA 7MDHA 1DLJA 1RM3A 4BNFA 5JFOA 3E48A 1Q1NA 1LJ8A 2UV8A 1QXSA 3WS7A 2FZEA 1ZEJA 2DPGA 3DHYA 2B0JA 5G4KA 1C0PA 1JWBB 3QHAA 3GAZA 1N7HA 4AICA 1U7TA 3WICA 4RV9A 5H82A 3TZQA 3WNQA 4YACA 3QE3A 2W4QA 1O9BA 4K28A 1WXDA 2YDYA 3FI9A 3A06A 3RUAA 3WMWA 4L76A 1SNYA 4MVJI 4BO1A 1E3JA 3DBRA 3OHSX 4DQXA 4RZIA 1YJQA 4ESOA 2O23A 4OSPA 4JJIA 4WECA 3WX0A 3WGOA 3VVBA 5EQDA 4BGEA 3HB4X 1LDEA 3TZKA 3PYLA 1FDTA 2X5JO 3PI7A 1UXGA 4M87A 1J4AA 4YRDA 1QMGA 3QJ5A 3WDSA 4HFRA 1ZXBA 3UOGA 3ZV6A 4OH1A 5BNIA 5I9LA 1E3LA 3NJ8A 4R1UA 4DQVA 4EI2A 3QA9A 4JXKA 4FJ1A 2YV2A 4XD2A 2ZTUA 3I9JA 3NTOA 1ONNA 3WYEA 3C7CB 4RVFA 4OL9A 3OJ0A 4TZTA 1X7GA 1LC0A 2C2YA 4CLHA 3PVZA 4O63O 4IMRA 2HSDA 3Q9NA 3KYCB 3IOYA 1SZJG 4E5PA 1EQUA 5A5EA 4WCDA 5CG1A 4XKJA 5GZ3A 4XDYA 1GV1A 1HETA 1K2WA 3RC7A 1YWGO 1EBFA 1SMKA 5B4VA 4IGEA 1GZ6A 1I36A 2I99A 4JBHA 4JX8A 5LCXA 3RROA 2WM3A 1ZFNA 3MCVA 3NAQA 4CMBA 3M2PA 3ZWWA 4INAA 4YWJA 3P19A 2Y1FA 1DC3A 3VPFA 3JQFA 2OFPA 3OQ1A 4J9VA 3JQGB 2QX7A 1JA9A 4WLVA 4F3YA 3GVCA 5IAAA 4HADA 5A03A 1SB9A 4I8XA 4J4TA 4YQYA 3U0BA 4LCEA 2XAAA 3WTCA 3IJPA 1GQQA 4FCCA 2O48X 1IUKA 1NM5A 4XQGA 5GMOA 2OP0A 4CM8A 3OEWA 2X0JA 3JQ8B 4RF5A 4CV0A 4TRJA 4LVUA 5JDIC 3I9OA 2AQIA 3WYBA 2Q1SA 3U4CA 2X5OA 5EIOA 3JV7A 1ONPA 5JAIA 3IL2A 2P9EA 4QFDA 2OL4A 2AQHA 2JD1A 1DC6A 1MG5A 1DBVO 3NTRA 1JLLA 4YAKA 1NHWA 2DFDA 2JAHA 3UGKA 3B1FA 5B37A 1E1MA 1E7YA 2QQ5A 4QUKA 1DEHA 5L7YA 1ZEMA 4YRBA 2FSVA 2UAGA 2BGKA 2PGLA 1YQGA 4DRYA 4MVJE 2VWPA 3WLEA 1GAEO 2YHUA 3AK4A 1PJQA 3EYWA 1F0YA 1BVUA 1UDBA 4LMRA 3RKRA 3VH2A 4L9RA 1LDBA 3W1VA 3Q3CA 5C37A 1V3VA 3LVFO 5LDHA 5BSFA 1CERA 3AI1A 3K30A 3OH8A 3UW3A 1JKFA 2X0NA 4IINA 4MVJG 3UCXA 2Y67A 3CEAA 4OJNA 5AVOA 4FSHA 2X22A 3KRTA 5JBIA 3ZHYA 3WJ7A 4M49A 4TMFA 2Y0DA 1VSVA 3FSRA 4OKNA 4P4LA 4I9UA 3ITDA 1EK6A 3DFUA 4MIOA 2W2LA 1RYEA 4DMMA 1S7CA 3GMSA 3AUAA 2UVDA 2I67A 5AXDA 1PU2A 1ENPA 4U7WA 1Y5MA 1UAGA 2C82A 4BUCA 1YB4A 3D3EA 3W8EA 1QP8A 4XGKA 3O03A 4UUMA 3T4EA 3RC2A 3WGTA 5K6AC 1NX6A 4FFOA 5JAQA 1W0CA 2C0CA 2PV7A 1LDGA 5AXBA 2ILTA 1Y1PA 5ILGA 5B12A 1HZZA 2I65A 1A5ZA 3B6ZA 2VUUA 3OJFA 2OBNA 3GZ4A 3RBXA 1PGNA 2OP1A 5DBIA 3ZV3A 1I0ZA 3KOUA 4R1NA 2BI8A 1HTBA 2GSDA 3K8ZA 3PQEA 4KQWA 4KWHA 4QX6A 4B7CA 4L0QA 3WGZA 5A9SB 4W4TA 3DZKA 1EFLA 2DBZA 2O7QA 4KP7A 5H83A 1GY8A 3KB6A 1IZ9A 5FF9A 5ICMA 2VYVD 2EW2A 5JS6A 3WXBA 4W99A 3WGYA 3WB9A 5IDQA 4R68A 1KC1A 2GN6A 3ICCA 4J4BA 4RPKA 5MGBA 1B7GO 2EP7A 3QW2A 3G0OA 3FHLA 3AFMA 3A9WA 1M76A 4FBGA 4ND2A 1SBYA 3H3JA 2ZTVA 2Z95A 4QO8A 3RUDA 5C5IA 1GFSA 3TFQA 5TQVA 1T1RA 1CIVA 2PK3A 4GSKA 1DLIA 2C20A 5EINA 1GYRA 3D5TA 4J0EA 3RJ9A 4BNUA 1IE3A 5ITVA 2PD6A 5AXAA 3GRPA 2Y99A 2B4QA 1XQ6A 1ZIDA 3IKTA 4WLUA 3OA0A 3ABIA 4N5LA 4BNIA 1B15A 3ZN2A 4E5KA 5A9SA 2Q4EA 1KEPA 4J6FA 1Q7GA 4BIIA 2GN4A 3GGOA 1R0LA 4MVJD 4U0KA 3EY4A 2FZWA 1OFGA 2EEZA 3VDQA 3AY7A 1KY4A 4PLFA 4R3NA 1RM0A 5G2OA 4D42A 5G0WA 2SCUA 3PRJA 4J2OA 3WOHA 4B4VA 1XWFA 4HBGA 4NG5A 1PS0A 4HNGA 4FW8A 1E3SA 5K6AA 1C1XB 4GMFA 4RF3A 4FFNA 3RJ5A 4ZRNA 3NRCA 4BNXA 5JAZA 1EBUA 3U3XA 4KTTE 1CEQA 1VM6A 1XCBA 3QIVA 2C7GA 4I5DA 3L6OO 4CMEC 1O5IA 1GUFA 3WWZA 1Y9AA 1N92A 4CQMD 4XJSA 3DBLB 1MC5A 2FY8A 3HDHA 3RKUA 1X14A 4CM9D 4E21A 3ZGYA 4C4OA 4E6PA 4M55A 3KV3O 4JBGA 3DBVO 2VWQA 2I3AA 4Q3NA 3UF0A 1DHTA 3JTMA 4MPDA 9LDTA 4DYDA 4IIVA 4IZIA 4J1SA 3W6ZA 2ZCUA 3DQPA 5DCYA 3W4KA 4K1LA 3EZLA 4BGUA 2F00A 4E12A 2WDZA 2IZ1A 2UUPA 1X7HA 3JYOA 1K6JA 4FIZA 1T2AA 1C1XA 3DC2A 4XGNA 3WIDA 4EEZA 1LLQA 3G1TA 4OIMA 4II3A 4FFRA 3AM5A 1DSSG 1T1SA 3ASUA 3DMTC 4OKIA 4WOKA 2X0RA 2E82A 1SC6A 4MO2A 5A9RA 2EKPA 3SLGA 1UJMA 3C7DB 4XYBA 5HS6A 5L3ZA 1BGVA 1RYDA 3DBLA 4ALJA 3PXXA 2VT3A 4GLLA 3TL2A 4R51A 4C7KA 2Y0EA 3R3JA 4WCFC 3WG9A 4BVAA 1JDJA 5B4TA 1NAHA 2IYPA 3ANNA 4LCJA 4IDEA 5I9MA 4UAGA 3ZZNA 4UULA 5COBA 4YXFA 5BSEA 2CZCA 1EE9A 1YL6A 2JFHA 4XIJA 2GYYA 1WLYA 2W90A 3DTTA 5IFLA 2DT5A 3BHMA 1B14A 1E92A 2PKRA 2JFGA 1VSUA 4XDZA 4CPDA 4U0JA 4XWYA 2EJWA 3HJAA 1BXZA 3RUIA 2E6UX 4RDHA 2Q1WA 4BGIA 1A27A 4YDRA 5IZCC 5HRUA 1QYVA 4M54A 5T8KA 5F5NA 4DIBA 1YQXA 4I5GA 2GUGA 1PGPA 1X0XA 3KSUA 2GCGA 1I3LA 3E8XA 3OF2A 4YCAA 4YQZA 1UAYA 3UICA 4RDIA 4BQRA 2C7VA 1EFKA 3EZYA 2VWHA 4PLWA 5HWSA 4IS2A 4ONEA 2NTJA 2FPIA 3DDNA 4BNKA 1Y9EA 1QRRA 4WE3A 3GEDA 1R15A 2J3KA 4FJ2A 4BKOA 3JQCA 3OICA 4J90A 4YA6A 3AW9A 4UUOA 1ZJZA 2H6EA 3HFSA 4MVJH 4NBTA 1F14A 2CVQA 2DQ4A 3PIDA 4CJXA 3ADOA 3GUYA 3MJEA 1H9AA 3CINA 5JCXA 1YGYA 1U8FO 5DF1A 3OQBA 2HK9A 1CETA 1EVIA 3GFGA 4GQAA 1TT7A 5L9AA 3FBGA 4R5HA 3L9XA 2NTVA 5FI5A 4WNCA 4FQ8A 2QG4A 4MIYA 4L75A 1GYQA 4A27A 3S2IA 2ZB4A 3VTZA 4E2WA 4CMAA 1R37A 4J7CA 3W4IA 3RFVA 2J3HA 1MUUA 3RC1A 1JTVA 2VYNA 5I8WA 2OZPA 4Z9XA 2YV3A 4BO8A 2EW8A 1LUAA 1DC5A 3O9ZA 8LDHA 4Q3DA 5HS4A 3N58A 3F4BA 4NJMB 2EGGA 2PTGA 5TJ9A 5EL0A 2P68A 3PFFA 1IOLA 4DMLA 4O1MA 5A5FA 5TS3A 2Q46A 4FFLA 3ZCXA 1H6CA 4II2A 3Q6IA 2DKNA 4YRAA 3G49A 3PIIA 5AYVA 4UEOA 3HFGA 3QWHA 3PWSA 4D3DA 1P44A 4TWRA 5BSGA 3C24A 1U8XX 4IBOA 5KIAA 2ZJ0A 4OOEA 2JHFA 2UUOA 4XR9A 2FMUA 1X7DA 1TA4A 4WPGA 1HYHA 3FPCA 3CMMA 3B1JA 2VUSA 2JD0A 4DBZA 3JYNA 4W6ZA 3JQBA 1BXKA 1T25A 2JHGA 3DWFA 4H3VA 4HV4A 4WLFA 1LU9A 4NBVA 1O8CA 5TT0A 4OGWA 3DEYX 2CD9A 4S3MA 4FGWA 1ISHA 2IRWA 3EGOA 1Z6ZA 3BMQB 1HLDA 3ULKA 4NR0A 1D7OA 1H0KA 3DZJA 2RH8A 4NU6A 1IY8A 5A02A 1QORA 1RKXA 3LLSA 1EDZA 5DP2A 2PNFA 4GX1A 3U9LA 4GGOA 4QEDA 2OHXA 2EXXA 3I5MA 4CLRB 1K6XA 3AM3A 4ZQFA 4TZKA 1GPDG 1HYEA 2NNLD 3DO5A 2HCTA 3F1LA 3PZRA 3DTYA 1D3AA 2E4AA 4L4XA 4PLGA 1MP0A 2F1KA 1U3UA 1E7QA 2X9GA
chains in the Genus database with same CATH superfamily
4PX2A 3OM0A 4ZARA 4Q7EA 5E4JA 4KGDA 3RLIA 3ZLTA 2X19A 4OHWA 5JHGB 5ETJA 2QL9A 3CJQA 3EFOA 2DEUA 5BUQA 4HN4B 1HE3A 2I1LA 2QVGA 3W78A 4DR4B 3DNMA 2JDIA 2EIHA 3KR1A 4DRZA 1JYSA 3ASZA 4HLQB 3RIXA 4CR8A 1RVDA 1GQOA 1ZJYA 1LPBB 2DOKA 2NACA 3DE4X 4GRIA 4OH7A 5EMMA 3RREA 4OVKA 3O8OA 3GY0A 2CWWA 2Q1YA 3OY7A 5FLKA 1BD4A 1PUIA 3SOPA 1LPPA 3EZ7A 5DOZA 4A82A 5B7PA 4HLUA 3FPLA 5TMPA 3L0SA 3MLAA 5JATA 5JJBA 2ZS7A 2YMMA 3H1TA 3H9GA 1FOEB 4LYYA 4PQEA 1AQJA 3EJ6A 4CLRA 5F33A 4EPXA 5FIUA 1LY1A 2OLEA 3DKPA 5LNK6 1YRAA 5HUJA 4IXNA 1BVYF 1L7RA 2PKQO 2WSSA 5I7FA 1CWUA 3LP8A 1W4ZA 4FR5A 2CBXA 4II7A 5DDIP 2XA9A 1DE0A 2BBTA 1YS7A 3GG2A 1OYOA 3W9UA 4DB2A 3Q7RA 4BGVA 1EFDN 1MIOB 4R54A 3TZ6A 3VR5A 1I6MA 4MV7A 4ZVRA 3HWRA 3H1FA 1AMUA 4LE1A 4C0QC 1K0UA 2WUVA 4HP8A 4PQRA 3A2MA 2C3UA 4ZVMA 3VYVA 3ZQ6A 4DM4A 4C0SA 2BGUA 1ENYA 2DWPA 3GT4A 1Q14A 2X3UA 3AUJB 3M3PA 4NV0A 5JMWA 3PWZA 4EBBA 1KPIA 1XZFA 5DXAA 1AMOA 2CV1A 4O0MA 2AFVA 3L6BA 1XGKA 1CF4A 1MRZA 4JHXA 3HLYA 2QM3A 3QLVA 2QGNA 3TQCA 1BMFA 1BDMA 1ZJ6A 3GH1A 4NH0A 521PA 3LDUA 2VNKA 4BS9A 3LOQA 3L79A 1BE0A 1NYLA 4NTZA 4HNUA 1FFDA 1UBNA 2R47A 4C3ZA 1LBQA 1LQ2A 1R5OA 2J8ZA 2PJZA 2QMEA 1GN8A 1HT3A 4XYLA 2ZBUA 1P31A 4WBXC 2FPPB 1HT2E 1L7PA 1GTZA 3NFYA 4Y1FA 5DNAA 5TMEA 4NDZA 5JZBA 3NDBB 5FWAA 3WV4A 1E18A 3R5JA 4HQLA 1XU4A 2QTVB 3TI7A 5BN5A 1MIOA 2P2LA 2OYRA 2D0DA 5DVZA 3U5ZB 4LDAA 1RYYA 2OQ2A 3U49A 1HE5A 1VGRA 2OORA 3SBEA 1J8MF 2XKKA 1WY7A 2AUMA 2RB4A 4ZK6A 1WEHA 2V7QA 1B3RA 3GRRA 2JH9A 3OJOA 4AO6A 2GZ2A 2VSOA 7REQB 1FIUA 1SD5A 1G2PA 2CL5A 1NQVA 3CBQA 4WMLA 4HZIA 1USUA 3AJ8A 1ESCA 3H9QA 3R0IA 4RS4A 1IATA 5SV2A 3UFBA 3W1EA 4DDKA 3K0CA 1J24A 1U8UA 5SZIA 3WLAA 4ZREA 1G9TA 1V6AA 2F9FA 2PQ6A 2YWXA 3D6NB 2ILVA 3IBYA 4XUCA 3I92A 3KQTA 3ROFA 2D2EA 2EHDA 1AO0A 3B6IA 2FPPA 3KPYA 3GUVA 2YX1A 4KUGA 4G81A 1AXRA 4ZICA 4AJOA 4Z3KA 1B1AA 5CHYA 5E6UB 1R6VA 2CY0A 2FW6A 3T9FA 1Y4SA 4EJSB 3BD8A 2XMSA 3NRBA 3OTHA 1PTJA 4G3XA 3VR1A 2QTVA 4JJKA 4R3WA 1RRVA 3W5BA 4NBKA 2VP9A 1S1MA 2I4TA 3ZZ0A 4ROSA 2YVAA 1US8B 5L7WA 4AZ3B 3L7NA 2I6SA 1QVVA 5K3FB 4E2YA 1P7WA 2OV6A 2JC3A 1F17A 1ZY2A 1V71A 5AWFC 3TLXA 4BX0A 4CDRA 2QJFA 4FGZA 3RU9A 1U5BB 2IBMA 2YV1A 4OB7A 1KU6A 1SXJB 2O8CB 1GNVA 4FLFA 3RVQA 3D0KA 1Z6QA 7REQA 2RJOA 5I3ZA 2WJGA 3IKVA 1EWRA 4N3NA 4WJKB 1JTFA 2V74B 1UC5B 3T7SA 1NG1A 2ET6A 2OB2A 2GR9A 3ZDCA 1SCQA 4X1YB 2OZKA 1WXQA 4RC9A 4UAUA 1VL6A 2RGWA 3WE7A 2XIJA 1YDWA 4YASA 1ZCJA 3HO1A 2P62A 3IE0A 3MVEA 1E2BA 2HIGA 4WFJA 1Q0HA 2NNWB 1COWD 2JKVA 3LQ2A 1D2EA 5ALPA 3GLFB 4AN1A 3RD5A 1VFPA 2I4MA 3A27A 3L2OB 3O4RA 3SLRA 2UDPA 5A62A 1I33A 5GADl 1Y98A 2AJCA 4WOBA 2Q41A 1RYMA 3GVHA 3PUHA 4YRPA 1US8A 2QTNA 4AZ3A 5K3FA 3VH4A 2V4UA 2ADFA 3JX9A 4WGGA 2FN9A 1FTQA 3NUGA 4WOCA 5A3VA 1C1HA 1Z07A 3VHLB 6PFKA 1Z56C 3CZMA 4IS3A 1U5BA 1X1TA 3F78A 1GCUA 3JQ9C 3GDWA 3JRNA 5K0GA 4MULA 1U9CA 1WP4A 4GM1A 3MW8A 3WO1A 2EFGA 1NX9A 1M7HA 3LCUA 3M8KA 3O1HB 4S04A 2NTEA 1V1MB 1N75A 1WF6A 5AI0A 1LJLA 1C8BA 5MGNA 1S2IA 4X1YA 5F52A 5M34A 2OHJA 3JU3A 3T4PA 2PNJA 1T6ZA 3C6ZA 5AK3A 3ESZA 3NHLA 5ALMA 2HRBA 1WMDA 4A8HA 5DTQA 1MJ5A 3N0TA 4YJHA 5JQGB 3QLUA 5A6SB 2FSFA 4ID9A 3GW8A 3O74A 4B3SB 4FNMA 3FCCA 4MRSA 3PEYA 2ONZA 5KKCA 1G1AA 1KWGA 5FUWA 2QORA 3QVWA 2G0AA 4L74A 3TKYA 2ZM6B 3JQRA 4BNNA 1J2EA 3K9CA 2VF4X 5FI0B 5ICFA 3ZC3A 4YUZA 9LDBA 1I01A 5AT1A 1AC5A 2PX4A 3M4JA 4MAMA 4MROA 4MWEA 4QDZA 4DZRA 2ZP1A 4XWGA 2XPCA 3VH3A 3CLUD 4EABA 1MVNA 4EDFA 1RBQA 4PR3A 1S2OA 1TYZA 4G01B 4OY3A 4U4AA 1LPAB 3TIXB 3PFIA 2AN5A 4JT4A 1V1MA 1EYZA 1BS1A 3P26A 2Q0XA 1KEUA 1Q1EA 4DQLA 4E46A 2Q3CA 1PE0A 4JKOA 1H69A 3GIWA 1AGXA 1PJTA 2B9EA 1ITZA 1EFVA 3H8SA 3O4HA 2C77A 1CZRA 3LBIA 4L0DA 3UWMA 5DRTA 2O7VA 4MW5A 1MV5A 3GJ7A 4N39A 1AHPA 1I8TA 1IEVA 1R8QA 3L46A 1K7XB 5A4JA 4XEUA 2VKTA 4IMIB 4EGSA 4EIWA 3TPCA 2HYIC 2OXFA 3VR4H 4BVJA 1NF9A 2WUWE 4QODA 4UCWA 1A8HA 4TMWA 3JTEA 3K16A 3R20A 1YZNA 1CYDA 4LDQA 5EQJB 2KBFA 5K3AA 1S7GA 1W5TA 5K6TA 2WVAA 4KK3A 1Q7CA 1W0JA 1SUSA 1EFUA 2RI0A 1GRNA 2X42A 3WLNA 3BILA 3PHGA 5BWLA 2GZ1A 3ZWOA 2XKAA 1V8DA 4EYKA 5K5EA 1ISPA 4DAOA 3A9RA 4MKIA 1JT9A 2B4KA 1Q5PA 4C3VA 1XG5A 4F4IA 1Q2XA 3M6VA 1N1MA 4BVLA 1C8KA 1AB6A 1H8ED 4KRYA 3TMYA 5EGSA 2WINI 1OYYA 4JJ6A 5LJIA 1HOTA 4Q1CA 1AUOA 2GVDC 1QGAA 2FWIA 2Q8PA 3DWGA 4FYKA 4MWTA 1JHUA 4HDRA 2BBOA 4DQUA 4IRMA 3GGSA 3NOXA 4KO1S 2QD3A 4NS4A 2XMDA 3A05A 4IIBA 4QPPA 1XRNA 2G88A 3HCCA 2W22A 2ZJ5A 3OCUA 3OIVA 5IH3A 3ZKWB 2BI7A 3L93A 3UCEA 3W06A 1WETA 1DKQA 1GUYA 5BV7A 4D4KA 2H4JA 3M9LA 3KR9A 1OC2A 3GHHA 4G23A 1L4EA 1SA0A 5AOBA 4MX8A 1UUFA 2XUJA 4FFBA 3STYA 1KJWA 3IVAA 3V46A 1OFUA 3WLPA 4WLNA 4I1UA 1RRFA 3MB5A 4HR7A 4U1RA 5TGTA 3WSWA 2OESA 1JKXA 2GZHA 2FMIA 2GZ3A 2VYVA 3A9SA 4IKPA 4Q37A 4YP1A 5JJKA 2AI2A 2RK4A 3DBIA 4L73A 3R41A 1PWXA 1AE1A 1Y34E 3KEOA 4LJ4A 3WYNA 3E2IA 3HKBB 3SM9A 4UQOA 1IHOA 4F5EA 3IERA 4X45A 1GAXA 5JASA 1E77A 4HDCA 1N0WA 1P7VA 5LZ5A 3KSMA 3D4OA 5HF5A 1Q83A 3QH4A 1EAMA 3SX2A 4J16A 5MFPA 4F72A 3QFSA 3NNDA 4ENQA 2B3DA 2WF9A 3CA8A 1DXOA 1ESMA 4X3PA 1ACMA 5ALUA 3WBJA 4DZTA 1G16A 1WQ1R 1HNWB 3ODGA 3ESQA 3O4FA 5ALGA 1K27A 4ENWA 1E1KA 5CDFE 5JCZA 2I1WA 2XRYA 4UPDA 2GQ0A 4R1TA 1ZG3A 5LLDA 3AVYA 2YWBA 7GPBA 1LX6A 3VUFA 3VKWA 1X0VA 2BSXA 2VHWA 1MA3A 1G9SA 1XIVA 2OV4A 1JPUA 2GXQA 4CV3A 1KH1A 5ADVA 4PN3A 1GNRA 1U6JA 2ODQA 4H1HA 4GG1A 1CUEA 3K9QO 5A71A 4AUNA 3OA2A 2PLAA 3A4TA 3NH9A 4PPNA 3ZHUA 2GO1A 2W6OA 3AZQA 3G9TA 3L0CA 5IBQA 1IIBA 2BOVA 3K6SB 1FX1A 1RBZA 3HKBA 2R97A 4B47A 3QU5A 1Z0UA 2VPZA 3A1UA 2CLIB 3C5HA 3PE6A 5I9SA 4E5YA 4KHPB 3NP9A 5NULA 1GSOA 2GUWA 2J7PA 2RSLA 1QRUA 1Z28A 3I5UA 3GLQA 2P3QA 3EB9A 5E2AA 3ZTWA 2EARA 1AGNA 3AUTA 2AEFA 4JYCA 1T9KA 3D6HA 4P34A 1AK2A 1J1ZA 1NMEA 2C0QA 2PZFA 1TFRA 1QK4A 2B20A 3HKCB 4YAOA 2X7XA 5HIAA 1IHUA 1PVVA 4TUYA 2X0KA 5K51A 3TR6A 5HTKA 1U31A 2ODPA 2XZLA 4EG3A 3UK0A 1UKBA 3SZMA 3SR3A 5LU9A 4EY3A 4C5CA 4GBED 3M9WA 3K96A 1NI5A 5KNBH 3FUCA 2I7TA 2RKBA 1G20B 1CE8B 2GEJA 1DAMA 1X1DA 1RQ7A 3WHLA 4BWVA 2F3QA 5HK9A 1Z35A 1O5OA 4KBGA 3ZLVA 1J8DA 2IDZA 3HWX1 4MVJM 3OMLA 3NW9A 2CSUA 3TTTA 3QE4A 1PR6A 3IDZA 1LSUA 3K72B 2JHCA 4NAVA 1SURA 2X6QA 4GAEA 4EA9A 1KAMA 4ZKDA 5BYAA 4JC8A 1IG0A 2BVNA 5LU8A 4E5SA 2SKDA 3BGDA 1QAQA 2WE7A 4ON9A 1R6UA 3HKCA 4X8LA 3K6RA 2LDXA 4CQJA 3RU3A 3D3WA 3J81k 3VVCA 1LNQA 5JYEA 2FPKA 2QRNA 2AD5A 3KJNA 3DNPA 3ETDA 1A1VA 1FFCA 2QRHA 4YRLA 3ZCPA 2AK2A 1WCV1 3LG2A 5D3KA 3Q98A 1G18A 5EIWA 2IKSA 3AR3A 4NY1A 1G20A 3DR3A 1CE8A 1LF5A 1T9ZA 5BN4B 4MRAA 3NOOA 3OCVA 3ENWA 2ZJ7A 3NPMA 3CVYA 3L7MA 2NO9A 4E03A 3PFNA 3NALA 2CNBA 2FPOA 4WNYA 3T06B 4X24A 1J70A 4KYUA 2VJYA 1KR5A 5LFAA 3ICEA 1J49A 2RI6A 4TLMB 5IPFA 1P0FA 3R75A 4FFWA 2H31A 1L7EA 4O8ZA 5E4YA 1ZD8A 1B16A 3A8TA 2D2VA 2JAWA 4GOND 1UH5A 1YDHA 3WNVA 1DEKA 2RIPA 1NR1A 2QMYA 4Y2RA 1O0CA 1N5RA 4JI7B 2MT9A 1FPMA 1UXIA 1LLDA 1OFVA 2O50A 4IZHA 2WKQA 5BPHA 4HG2A 4QYIB 1XFDA 2JGDA 3RS7A 3PGVA 5E3IA 1EGHA 4E6EA 3MUEA 5JC8A 5FBLB 3EA0A 1V2GA 2IC5A 3F3KA 3N7UA 3UMVA 3EWSA 4P3YA 5JSQA 1FS5A 3KU1A 4U2BA 1KETA 1AS3A 5AKHA 3MAGA 2VDPB 1YL7A 2WK1A 3A1TA 4KRGA 1RCFA 2RK6A 3V8VA 1LLUA 3C15C 2Z43A 1AZWA 3FOBA 1LVGA 2B1QA 5TB5A 2FEOA 4U39A 4RPGA 4W7HA 5CX1A 2OXTA 2VATA 2IE0A 4F86A 2YFHA 2HF9A 4NFYA 3I2HA 4HLNA 3VTKA 2C4NA 5KO2A 1PKEA 3GLGE 5ALWA 3J7TA 2QTHA 3THWA 4KR6A 3F6BX 2O54A 1IFXA 1CNMA 1C41A 3CKMA 4EZBA 2BKLA 1AQNA 2RGBA 3FJ1A 3Q9SA 3F7OA 3LQ1A 2ZRHA 4W82A 5EXSA 4DIFA 3H5AA 1UM9B 1NZJA 2DB3A 4KVZA 4DDUA 3CNOA 1WTAA 4NJOA 2QN8A 3TSOA 1E62A 1NLMA 2R86A 1RRGA 4BLPA 1OFUX 2LW7A 5IM4A 5LIRA 1NMYA 3I6QA 1ZM2A 4CLEA 3JQ6A 4QYIA 4YRJA 1DBPA 1FRNA 5THKA 1JLHA 1USVA 3ZXSA 4EVIA 1QKKA 2R6DA 4JBXA 4JIMA 4XIYA 2O8BB 1M8PA 16PKA 5FKJA 5CXQA 2CEKA 1ZSVA 2ZJ3A 3L84A 3OZFA 4KWCA 4YDQA 1Z2EA 1ZL0A 2EWMA 1QIIA 4HFJA 4R16A 4B43A 2NO0A 2Q4RA 3R5KA 4HSEA 4PZUA 2DWCA 2ZYTX 5BNZA 4FD2A 3BMXA 4GQBA 4NYIQ 4DDMA 4QU8A 3KKEA 2X77A 3OOSA 4EZEA 2C7OA 3BQNB 3ITNA 3WP0A 2QX6A 1ODKA 4YQFA 1JIVA 3GLGB 2R1ZA 3ZJTA 4ENTA 4YNBA 1YU9A 1YL5A 1QLWA 1DOHA 1O9HA 1PVDA 3CSSA 2WT8A 3C74A 3EXHC 4WCFB 4Y6LA 4C04A 4JOBA 1UJBA 1YRLA 2X4GA 4Z51A 4V0KA 4KLAA 1KQGA 5ALSA 3VR6D 3IR7A 5C4MA 4QOSA 1GFIA 1UM9A 4FLEA 1GIAA 3P9QA 3QOXA 3H9JA 2JIZD 2QE7A 2YNMA 1DBQA 2HNBA 2P9GA 3OLWA 2HFKA 5KYGA 2B7CA 1KIFA 3BZUA 1I7SB 2Q4BA 4M0LA 4PYOA 1GA1A 2Q3HA 1REQB 4MW1A 3L05A 4DT1B 1FFXA 1E1RA 2X1HA 3ILHA 2QAJA 1SRQA 2IEYA 4GYKA 3KT3A 1QV7A 1Z06A 1SAYA 4M7RA 3R7BA 3AFIA 4M1KA 3I8SA 5I9TA 4K0RA 4RF4A 4G8BA 4EY8A 1L7VC 3WLJA 2IQIA 4EHBA 3UATA 5B1YA 4NAUA 4EUNA 4RKEA 2P8JA 3GJZA 4WCFA 1RHJA 2BKUA 3VU0A 4Y2YA 1HFJA 4LV6A 3GJ0A 3HBAA 2YXLA 2R2AA 1IDN1 4OMFG 5KI6A 4E51A 5HTOA 1JILA 1P74A 2MCFA 1A77A 3UAYA 1YHNA 3OMXA 3QPBA 5JECA 4X61A 1C7EA 2J5QA 2QG9A 2R68A 4OEHA 4R98A 4ZVLA 3WOVA 4DBVO 3FG9A 1LI4A 1I3KA 4KFTA 4LJAA 1X7XA 2VDNB 4CKCB 3RTAA 3LDGA 4C4YA 5ADWA 3TCKA 3GJ4A 3FNEA 3ZY6A 1FFGA 1REQA 1E4EB 1F2TB 2BGRA 3LXXA 4FP9A 4I9NA 2R79A 2ZIVB 4BCBA 5DNCA 1TYEB 2CVPA 4TS3A 3GRCA 4W9NC 1U99A 5K4AA 1SKQA 1Q0RA 1EHCA 1U0BB 4XDGA 4QTUB 1GDDA 1U7XA 2W8BA 1J33A 1OU0A 1U0EA 4UDXX 3ZCQA 4WQMA 1J9GA 1XF1A 5CYOA 2YJTD 5FWYB 4YJ3B 5LQCA 5AK5A 5AXCA 4D9GA 3F5QA 3HSSA 4U6SA 3N6RA 3FTDA 4EI8A 4DE5A 3BJIC 2YYZA 4D96A 5L95A 3EVTA 3JQ7A 4LJYA 1FRZA 1Q12A 4EKEA 5UKDA 5JRZA 2OB1A 3EUWA 2C0PA 4BCDA 2EFJA 2QTCA 2W00A 3W3AA 3GVPA 4OLHA 3VC2A 1ZCZA 1OH6A 3R44A 2ZWOA 2JLBA 4OK6A 5F4BA 4ND1A 2NZUG 4Z4CA 4AJ4A 5K3EA 4NP6A 1BHSA 1CZLA 1I1QB 1NHGA 2C31A 2UZAA 5CYFA 3ZI7A 2CJXA 2IIBA 1DRVA 2C4WA 2QDXA 4PHHA 4O25A 3G0BA 3QZUA 4CKCA 3TD9A 2HA3A 1G98A 2BL4A 2XNKA 1E4EA 3TTVA 4CIVA 3UQYS 5LKRA 1PFYA 2EWWA 3D6AA 4UDOA 2GBFA 1OAAA 4LK2A 3T3PB 4AECA 3KZ1E 3RVRA 2O2YA 4PZYA 1O58A 2PKCA 3E4DA 4CNBA 1UBUS 2FSPA 3H1AA 1OY1A 2A9PA 3OUUA 2BJVA 2OTCA 1J25A 4G1BA 4UOQA 1L5KA 4DW8A 5FWYA 1F7VA 1HY3A 3GFSA 3R0QA 4AX8A 1HDYA 1VIMA 1DUVG 1TEVA 4UREA 2OG2A 2R2GA 1R0WA 3D3JA 2F3TA 2YHIA 1V4VA 1AKTA 4AZTA 5FNVB 3IR5A 2F4NA 2H3HA 4FYJA 4I9HA 4Y6SA 2BBSA 5CIYA 3HR4A 4MP6A 4E1VA 1YKGA 1KK0A 2E4ZA 1Z22A 2VNIA 3CMCO 3H7AA 4JLPA 4J2TA 5TRTA 4RJTA 4I08A 5LL6P 1NVGA 2PY6A 1E2JA 2Z08A 5DGIA 4N0DA 1KJJA 1DAFA 1Z0FA 2RJNA 4S1TA 3HCAA 1U7WA 3CZCA 2HF7A 3BQMB 3RWBA 4DLUA 1H0SA 3R6WA 4G86A 3T7DA 2ATCA 4DA9A 4PNEA 5J4HA 1QCCA 4LWOA 4X6LA 1QHGA 2H2HA 1U02A 2WIGA 2E55A 3SKYA 3BSWA 1CS0A 3TBFA 3AM4A 3MS4A 1A8IA 3IGFA 4ND7A 3CNLA 3FKSD 4TL6A 5JPCA 2PT6A 4Q82A 2QTZA 4CMJA 1XZAA 2GPTA 4ZQCB 1C14A 3GLSA 3KT0A 1U2DC 3WKDA 4LYHA 1EUCB 1NF2A 2WP0A 1YI1A 1XAHA 4XJTA 5DNVA 1OHHD 2FEKA 3NJRA 5FNZA 3T3IA 3NTQA 4UNIA 3ZE6A 3V42A 1TCVA 1GNPA 3T35A 3A3NA 4BPBA 2D6FA 1PCXA 1JNXX 4KQJA 2OCIA 2X86A 1PYGA 1J6UA 1KO4A 2Q5LA 4HJRA 1CLUA 1Z5VA 4CLOA 2E4VA 5I7EA 5LXTB 3K15A 3OQIB 1I3OA 2O07A 1C1DA 3AT1A 3DV2A 3ND9A 4G9GA 4C6HA 5C1BA 4OYRA 5A06A 3AERB 4UTOA 1RRCA 2UZ3A 4M0MA 4JMPA 3MXOA 4EB6B 1OR8A 4RMIA 1WTCA 2QSZA 3KELA 2GZSA 2KJQA 3NASA 1U2PA 2VHCA 3ND5A 4DV0B 1TXGA 4MRMB 4ZPJA 2G80A 2WE8A 4AYWA 1YZ3A 4CL8A 3EGCA 1KYYA 3FUUA 3UJBA 3OLZA 3OHMA 4IIFA 3DQQA 4I8DA 4S24A 4RTQA 3R76A 2XGGA 3OMWA 5IDWA 2I3ZA 5I9BA 4KI7A 2REQB 4M0DA 1VDMA 3L1KA 4MR7B 5DX8A 2OZLB 3EDMA 3HNPA 3VI3B 1JE0A 3H75A 3V8EA 4F92B 4F9FA 4Q7LA 1Y6ZA 4JYAB 3JAKB 4ZQHA 1AKYA 1ISJA 4Q01A 3G23A 1C2TA 3BTSA 4CMKA 3ORRA 4NPAA 2ZRCA 1A8SA 3EGEA 1BMTA 2DFVA 2VT7A 3N2NA 4X1KB 2DBYA 3IR6A 4FMDF 4KBYA 4X44A 5KYTA 1VTKA 3H11B 4US0R 2ZSDA 3TJRA 1EFCA 3AERA 4PSUA 4UFOA 4Y7CA 2UZIR 2YQ5A 3WWYA 2ZSHA 1T5TA 4D4IA 3AKCA 2IDJA 3G68A 3I4LA 4IPTA 1QS0B 2VBCA 4EB6A 1I51A 3CLKA 3NETA 3SZRA 3WRVA 4KO3S 3JYLA 4FYMA 3U4QB 2JJ1A 3CVJA 3KKNA 1DAHA 1YZUA 5JSZB 1HTTA 4B17A 4HB4A 3CJRA 4P86A 4DC1A 4AXXA 2AEEA 3QPUA 2FYTA 5AHKA 4QNMA 2FEMA 1JKMA 4Q9IA 4A1OA 3HC7A 3V4OA 1KS9A 1O89A 1ZS9A 1LLFA 1WO8A 1PQ4A 2OZLA 3FYUB 3KEQA 2G1UA 4KMMA 4MR7A 3GBSA 2IOQA 2AZMA 4TMTA 2J9GA 5EFOA 3ZR4B 3I2FA 4F6LA 2VF7A 1GGJA 1P75A 3IVXA 1DQNA 4G65A 4TV9F 5HCIA 3K0HA 5ICCA 2AEJA 3N7TA 2XHZA 2YJ6A 2W2KB 2A92A 5EE9A 2NV6A 5C8DA 1Y3CE 4Y30A 3SQLA 2WSSD 5C3MA 4N54A 2IPNA 2QWXA 1W4LA 2XWQA 3H11A 4N5DA 1OH5A 4N5NA 4MUJA 2OBYA 2WU3A 2XV1A 3DUWA 4Y2XA 3RS9A 1MOPA 1O0SA 4ALLA 3A28A 4IJ6A 4N3GA 4A0GA 2QVXX 1JJBA 5A2GA 4QECA 4NCBA 2P30A 4WV3A 1AN9A 4HHEA 1H4QA 1PR1A 1G21B 1JAHA 1VPLA 3MTDA 1GR0A 5KPDA 4KQKA 5JISA 4B8WA 4IHAA 2XXJA 2ZS9A 3NTXA 1F3LA 1GD1O 4O8CA 4PTZA 3IOMA 4L07A 5EN4A 1VCOA 3RKSA 1Y1RA 4TQ9A 3TJZA 3B9QA 4EHHA 3PE4A 4G09A 1BMFD 2CF5A 1WG8A 1IEQA 2PMDA 3CLSC 4F8EA 2NTNA 2QLLA 1B8NA 1NNEA 3VH1A 1R27A 4JBLA 3TIVA 3HEMA 5CTAA 2BFDB 1D4ZA 4UNNA 3LC1O 2O2GA 1BH6A 4LYJA 1P2GA 4OQEA 1G6Q1 3UWPA 4F60A 1W9HA 2L69A 4FOTA 4HO1X 2W6JA 4D8TA 2AXEA 4A8PA 1GCAA 2GEDA 4D46A 4J1TA 2VPYA 4OQYA 3JQFC 4BNGA 1GNSA 2VHUA 3H2SA 4G85A 4MKGA 1RJ9B 3OPYI 1OPXA 2H1CA 4LN1A 2ECFA 4RACA 2HBQA 3Q9LA 1TPYA 2AMJA 4WEOA 1MOQA 2P1DA 5EJIA 2AH5A 5KUTA 3OEYA 1I30A 5BOSB 1SU4A 1G21A 1XVTA 4R1OA 4BYGA 3V2UA 4ESEA 2C8JA 1JI3A 3PPYA 2AQ8A 3GOHA 1RI3A 2H00A 2QPLA 5HNKA 2ANBA 2HHLA 3BD7A 4WY8A 3R09A 1V48A 1USWA 1EGQA 1WOYA 2BHRA 2CL6X 5AVSA 4IG4A 1Y1SA 4B3HA 3QNWA 1BTOA 1UDRA 1A5BB 3CE6A 1JDTA 2IOFK 1QZZA 4JVOA 2FQWA 1TIPA 1Q57A 2A1TR 2HSZA 2N1MA 4NCHA 2VP2A 4UHHA 4FWBA 5E1BA 4X71A 3WRWA 1CULC 1JBEA 2BFDA 5KNBA 2R1VB 2HGZA 3HV0A 3Q5GA 1HE1C 4JBNA 1JSLA 5BWNA 4RVDA 1ZR2A 2TMYA 3GMIA 1TF2A 1PSZA 2DC1A 5ENDA 5MDHA 3T0GA 1VJDA 4GUDA 5EXPA 3E61A 3F46A 3GJ5A 1I32A 2QLBA 1WSAA 2EHJA 2OHVA 5EE3A 5EE5B 2V7TA 4F4CA 1A88A 4HNRA 1C9DB 3RODA 1OB2A 4QDKA 1Q3HA 5G02A 3DKRA 4GPEA 4R1LA 2OSVA 2JLXA 2JAUA 4AJPA 4QUGA 4OXYA 4MWGA 4UBNA 2V96A 4P7JA 4TTTS 3O92A 2E1PA 3GQVA 3GRZA 3D4PA 1RWKA 2CGEA 1Z88A 3LYAA 3U40A 4DLYA 3LS2A 4OV6B 4BFUA 4XQ9A 3S29A 4D3SA 2YJ3A 1ISFA 1M66A 1T0JB 1EI9A 3FNHA 4OP1A 2VUHB 5B1DA 3RIGA 2WTUA 3UT5B 2WNSA 2XOKA 3X1XA 3FCOA 5FYQA 3AOEA 3IAM1 3BF7A 4FE7A 2Y2VA 4U7GA 3EW7A 3PEFA 1Y9JA 3OOHA 3UA4A 2JAPA 3EVCA 5CB6A 5IANA 4RTJA 1XZDA 4E33A 1SOUA 3V1UA 1T0UA 1FFSA 2I6UA 3WYFA 2AG5A 2AZTA 3OD5A 5BUSA 3EDRA 4JP1A 3WWDA 3RRZA 2FW9A 4DPKA 3OPMA 4GL4A 2C5AA 4G5HA 2WWTA 1KA9H 2JFYA 5KU1A 2COKA 3KOXA 4Q19A 5HJ2A 2V0CA 5IAJA 1KPGA 2ACVA 4EJ2A 5CA0A 5L4LA 4DNOA 1UPBA 3FUVA 1COZA 2I7XA 4B6SA 5JADA 2FPWA 1JZQA 3ZPXA 1CLEA 4INOA 3UT0A 2CWDA 4HEA1 1P45A 2WFZA 4IF4A 1NY6A 4PGHA 1WIWA 1CUCA 2YOGA 5TQ0B 5KSZA 1A9OA 5IBRA 1Y42X 2Z1MA 1NJ6A 1UQTA 5KOIA 2IPLA 2ERCA 1FSGA 2ZR0A 1U1IA 2ZJ1A 3E03A 4O4HA 1O3YA 1SXJD 1V9SA 3TZBA 5KVVA 1U9JA 2FPLA 1VSQA 4Y2SA 3AG5A 4B0OA 4UU7A 4YP0A 3UT5A 2IDMA 2WTBA 5JDCA 2JFUA 3BDVA 3NNNA 1MB2A 1YKSA 3ZHSA 3L4SO 1E2IA 2XY4A 3PHJA 4OLJA 3AF6A 3H42B 5AVYA 3ENQA 3KWLA 3K5IA 4NPCA 1FJHA 2OGWA 4KJZA 1B6RA 4LI3X 1JA0A 4MMXB 5FAKA 3N5KA 3JWEA 4IDPA 4KREA 2XDAA 1M1UA 4GKAA 1XZHA 2BCJQ 3VBEA 3ZIUA 1OH8A 1XRLA 3PLNA 2NP6A 3LHIA 3LRTA 3L0ZA 3PICA 3JQGA 4IIUA 3K92A 5DWVA 3PLAE 1ZK0A 3UH0A 2HPVA 4ZI7F 1E2MA 1VHTA 4LGCA 3TSAA 1Z6YA 1JWLA 1G291 4ENSA 1NIPA 1NJGA 2IH4A 4ODIA 1C9NA 2C9MA 4W9RA 3G2NA 3S1LA 1S0UA 2GDZA 3EAGA 1II0A 4LXYA 4L0MA 4TS1A 4V24A 2FRDA 3TSWA 3GDOA 4B85A 1N9GB 5CM9C 4LRTB 5G3ZA 5E6SB 5TX7A 2IU0A 3AHCA 4RDCA 4CIWA 5L4SA 3VPDA 3C43A 3INYA 3MEQA 3SOZA 1WUTA 2DQSA 1PNVA 1ZLYA 5ICSA 3Q10A 3OTOB 1K8QA 3BHNA 5SZHB 4EY6A 3L77A 2QTWB 1WU8A 2ZR8A 4DY4A 5BYKA 4PGMA 4TWAA 5FV4A 2PFSA 1NI4A 4RD6A 5ISMA 3OKAA 2FWAA 1ADYA 2MSLA 3C3EA 2CXNA 4S2EA 5HEKA 3WGJA 1DC7A 1RE0A 4F0JA 2B2XA 3BCHA 2VRNA 1EDOA 3DZIA 5FI3A 5JS2A 4PZEA 4RO0A 4B3DA 4AX4A 4A15A 2YJGA 5DN6D 4YIKA 2VJNA 2JFPA 3R5XA 4YT5A 2VRCA 2ZATA 3IP9A 3ZD7A 4RJKA 2H48A 1ZUHA 1T35A 3RRMA 1W4RA 2FW1A 3V4FA 2WJ6A 2A0WA 1DX6A 1K1EA 4W1SA 4CGYA 2X8WA 3SBOA 2P2SA 1ZMTA 4J49A 4R31A 3JQAB 4DV2B 3LY8A 3HY4A 4AW9A 5JVDA 2GBPA 4US2R 2BUBA 2QT1A 2WICA 1W0JD 3BTOA 4RQTA 4X95A 5E6SA 4D3XA 4EHNA 5KQMA 1Q0UA 3N2ZB 4OQNA 3DT6A 1FYDA 3GXBA 1MX3A 4V3CA 2VJMB 4BEVA 1PJRA 3U4MA 3WLOA 2X4LA 4GWLA 1UPAA 2C29D 4CVNA 3LHFA 3SXJA 3B53X 1UKYA 2L0XA 5PGMA 4MLPA 2DUMA 1Z68A 2LD4A 5IAEA 5BSMA 3TOCA 3H2ZA 3M1IA 4LQ4A 3SVTA 4HGOA 3RR2A 3CIFA 2TYSB 1ACLA 2OD9A 3T15A 2CNKA 3Q85A 1GZUA 1X6VA 2R62A 4GS5A 1UCFA 1XD2B 2BFWA 4Z7QB 3C7AA 4BXOB 3OLVA 4LHZA 4Y9TA 1G7TA 4KPGA 2VA9A 1A9RA 1VI2A 4F4HA 5AO9A 3NFRA 2GASA 3F7MA 3S27A 8GPBA 1HDEA 1YZLA 1ZIOA 3L18A 2Q29A 1N25A 3S70A 3ZLBA 2AT1A 2B92A 1OT3A 2YXBA 5K3DA 1RLOA 2A33A 4Q4JB 4W5WA 4Z9YA 5KSOA 2Q6IA 2NUPB 1W5AA 1I2ZA 1ZH0A 2W2LD 2WJJA 2XB4A 2PZKA 2Y76A 1GZ7A 2DJIA 2VJMA 2ZTHA 5EPOA 4ADSG 2H1HA 3PX2A 3WA6A 2W58A 2V7UA 4H7PA 1KXZA 4MQ5A 1XQWA 4DWWA 1KH2A 1Y80A 2HWYA 3CUTA 4RA6B 6ADHA 1IN6A 4IKEA 1AGPA 1V2HE 4X84A 2QN2A 1IHXA 5ICGA 1HMPA 2VH1A 3FPFA 3QOFA 3B6MA 3CR8A 3KKOA 3IO3A 5JSFA 3L1VA 3B78A 4FVTA 5C8XA 3T8YA 2BKVA 3VM6A 5JI3E 3PFGA 2IZZA 1FFBA 3A36A 1GUZA 1XD2A 2JI8A 4W8HA 2QF7A 5G40A 3UTCA 4BOYA 1C3OA 2P4HX 4B2YA 4L9SA 4DV1B 4BXOA 1S8FA 1JHRA 3D4NA 2HU5A 3RVBA 3IB3A 5C34B 3TRDA 3B3FA 5JEEA 4JLWA 5E1OA 4WKPA 1KO1A 1HUQA 1Z5ZA 5G0SA 3RU7A 2Z56A 2O4CA 5DJ5A 2J07A 3BJZA 1RHRA 2B35A 3LU1A 2FFBA 2OXRA 3CTPA 3LOUA 4FXPA 3WGQA 4Q4JA 4IIJF 2PD4A 2ZUFA 4ETMA 3A6LA 1GQ2A 4FMDB 1QHHB 1MN6A 2LDBA 2NUPA 3AR2A 4RM3A 3NVDA 3SI7A 5HIKA 1AQLA 2H4ZA 2DF8A 4MP3A 5FHQA 4QWWA 4NONA 1H3NA 2DVMA 2ZB8A 5ADUS 2BDTA 2PPLA 3D7SA 3M89A 4JJ7A 2A4KA 3R5SA 4RGYA 4ZYUA 2J7PD 4KW7A 2B9VA 1P8AA 1T10A 1Z5WA 5KC8A 3HBLA 1VXOA 2VQSA 1LVHA 3BCSA 4JI6B 5MN5A 3I9KA 2PANA 3AKEA 3K0FB 2ZR7A 4P32A 1OLSB 2ECPA 2ZGVA 1TU4A 4IV0A 3TDNA 4UUPA 3NJ4A 4HWKA 4BAZA 1G66A 3JQQA 1XTZA 4XD7D 1LZLA 1X15A 1XEAA 2R6R1 4U2CA 1NPDA 4NXNB 2BGJA 1X9GA 2C9OA 2Q6KA 3T7EA 5EVJA 4TV9B 5KYWB 3O4IA 1V6CA 1ZJ5A 1ZIPA 3H1GA 4ZRDA 4NK4A 2XNJA 5DBFA 2IJGX 3F9IA 1P3JA 4W5TA 3MJVA 3QU4A 1TJPB 1WMBA 3EOBI 4MIKA 4QRDA 2FU5C 1H42A 2EX4A 5B1HA 1QHHA 1ENZA 1D2AA 1M2FA 4GMGA 4W7IA 1NVXQ 2BE7A 1A71A 4C43A 4QTYA 4E13A 1Y8ZA 4MUXA 5K05A 1SBTA 3UJ8A 4F8JA 1DJMA 4C21A 2ZJ6A 4N5IX 4FFPA 3T5CA 1THMA 1CEXA 4ARZB 5KWVA 2Z1NA 1SH7A 2NVUB 2WKPA 1L1EA 4FHEA 3K0FA 3RW9A 1OLSA 4MPJA 1GDTA 5EP3A 4L8YA 3I58A 4PLZA 2YZ2A 3LY7A 4JOSA 2TSYB 2IXGA 4KXLA 2VOEA 4OYLA 3U80A 2O2JA 1HRDA 1J21A 2Z8YA 5JNLA 1TVKB 2D5BA 3PPXA 5ERYA 4TV9A 5KYWA 2PUCA 2CFCA 4PFSA 2ABWA 2WFMA 3A9VA 3IA2A 4G6ZA 1CJBA 3UWKA 4MQ4A 2WV9A 3I3SR 5AVUA 4MUBA 3ZHOA 1VI5A 4EVQA 1YZTA 5CLGA 3X1KA 4MNTA 2QY9A 3V00A 2PEYA 1YTUA 4YMSA 1EB9A 3ZCSA 3F49S 4KQIA 3HRHA 4C2TA 4LGVA 1QHEA 3MQFA 4JVMA 3B20A 4W5OA 3BSSA 3MTQA 3R8CA 2CT8A 4DLZA 4HZUB 1PJAA 1YD7A 4YDHB 4ZO8A 1WD7A 3INGA 3SZOA 1Z33A 1Z15A 4E2FA 4D3YA 3I61A 2NVUA 4DJAA 3BFKA 4K9DA 4B48A 2WD7B 1DO8A 1BU5A 1F1BA 2XHEA 2CDBA 3FVRA 4IH4A 5C7OO 2C04A 4BMVA 2GGSA 2K2WA 5ES3A 4GD3Q 3UIEA 3KQKA 2ZJ8A 1NN1A 4MHSA 4NNOA 5AOCA 1JLSA 3D0QA 2LIPA 3IBTA 1X19A 1Z2NX 3V5NA 1LTQA 2DY1A 3NYIA 3OJWA 3MOGA 4EW6A 3CXUA 5K2MA 1J0CA 3QQ5A 1KI4A 3IHTA 5BQXA 1JHMA 4HFNA 4FC7A 2REBA 2VSQA 3R0XA 4XIFA 4U7JA 3X1JA 5GIPE 2G36A 2WIFA 4WH0A 2IX9A 3QEJA 1YJXA 2Z6VA 4UDNA 5AM4A 4DSUA 1RBMA 1BX1A 3RIMA 1Q74A 2JLAA 3G13A 1JYFA 4FZ3A 3NBYC 4QO7A 5JO9A 4LXQA 3LFTA 5K8TA 3VC3A 4HZUA 5IKOA 5KZMB 1CY6A 1ZGBA 3MTGA 3K71B 3HJTA 1HEUA 3SX4A 1KMQA 1J99A 1C7QA 2GD0A 1UP4A 2PGJA 2H11A 2QW8A 2YBEA 3LRXA 2Y68A 5EIBC 2HX1A 4GXRA 4DYVA 4IR7A 4DAEA 1BHQ1 4RHCA 4H7HA 3DHEA 1OGIA 1XCJA 3DZ8A 4XIGS 5LP6F 1K2VN 5LDGA 2W2VA 2VO1A 2OFOA 2QD1A 4TYWA 2BRUA 1A04A 3E7DA 5BV8A 4GWGA 3ZBUA 1SFRA 2N46A 3FWZA 1XTTA 3TE7A 2G8LA 2HU2A 1FK8A 1E0DA 5GJBA 1ISIA 3B82A