1PJBA

L-alanine dehydrogenase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
361
structure length
361
Chain Sequence
MEIGVPKEIKNQEFRVGLSPSSVRTLVEAGHTVFIETQAGIGAGFADQDYVQAGAQVVPSAKDAWSREMVVKVKEPLPAEYDLMQKDQLLFTYLHLAAARELTEQLMRVGLTAIAYETVELPNRSLPLLTPMSIIAGRLSVQFGARFLERQQGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQGGCVETLHPTSHTQPTYEVFGVVHYGVPNMPGAVPWTATQALNNSTLPYVVKLANQGLKALETDDALAKGLNVQAHRLVHPAVQQVFPDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the structure and substrate binding of Phormidium lapideum alanine dehydrogenase.
pubmed doi rcsb
source organism Phormidium lapideum
molecule tags Oxidoreductase
molecule keywords L-ALANINE DEHYDROGENASE
total genus 112
structure length 361
sequence length 361
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjbA02
1XR3A 1O5IA 3GZNA 2E4AA 2SCUA 4AJIA 4ZRNA 1P0CA 4XR9A 1ZUD1 1ONPA 3DHYA 5ITWA 1NFQA 4FIZA 4URFA 2H63A 1X1TA 4Q3BA 2DTDA 4CM8A 2C5EA 3EC7A 4F3YA 3AM4A 2GZ3A 3F46A 3QVXA 2WD8A 4RQUA 4BUCA 2H9IA 1XGKA 2HRZA 4NJMB 4NG5A 1U2GA 3CINA 4N54A 4OSPA 5L4SA 4II3A 1AN9A 4BGEA 4UVEA 3DL2A 4XGKA 3EMKA 3UCFA 2YDXA 2FMUA 4G5HA 2VNSA 1EBFA 3OIGA 1UXJA 3QVOA 4NR0A 1PJ4A 2GSDA 3I23A 4NFYA 1HKUA 3FR8A 4MPDA 3PPIA 1B16A 5DCWA 1DFIA 4CM5A 3F1KA 4IS3A 3KV3O 4OO3A 4CR6A 5JNLA 4KUHA 4Z3DA 1N2SA 3K31A 1H6BA 1EDZA 3EHEA 4PG4A 1NVGA 3VOSA 2JCVA 1HE3A 2JAHA 2Y99A 1C0IA 4L73A 5K6AC 3ITDA 3RBVA 2GZ1A 1T26A 3ZWBA 2EJWA 2PK3A 4XDZA 3KBOA 3LQFA 4QFCA 3WGQA 1YDEA 1KC3A 1B15A 5HS6A 1YJ8A 3ETEA 3PJDA 1K0UA 3DBHB 4QX6A 5BNFA 3BYZA 1F14A 5EQFA 5T5QA 4BS9A 3INTA 4J6FA 2YHIA 3AU9A 3NAQA 4MP3A 2Q1WA 4BNGA 5A02A 3SLKA 4QO7A 3ZNOA 3DAGA 3JYPA 4E3ZA 3F6YA 1U3UA 3KZVA 4RVUA 4LSWA 4OQYA 3DZKA 5DNAA 2NADA 4O6VA 3D3WB 1AE1A 3IS3A 4BKOA 2AW5A 4AG3A 4ZICA 2EV9A 4IDAA 3GK3A 1UP6A 2PNFA 1QKIA 1YE3A 3L4BC 3LZ6A 3W4IA 4A03A 2DQ4A 1J5PA 2XPCA 1EVZA 4BO0A 3KVOA 1U7TA 1JDJA 2HRBA 5K0ZA 1H2BA 3UGKA 3DBVO 3OICA 1R15A 1JKJA 3AUUA 1O0SA 3ETDA 4QT0A 5G0WA 1E6EA 1E6UA 5KIAA 5FYDA 1DC3A 3AW9A 4CMIA 2B35A 3H2ZA 4XQ9A 2ZTUA 3VH3A 1WLYA 5JO9A 3I83A 1N1EA 2Y05A 5CDGA 3ZNNA 3VPHA 2BKAA 3AWDA 5CEFA 2J6IA 2VHYA 1E3JA 1UXIA 1YBMA 3HDHA 4HFRA 3H9GA 3OM9A 4XB1A 1TI7A 5IF3A 3O03A 4J0EA 3AFNA 2FPIA 3WLEA 2GPTA 1HF3A 4WUVA 1ENOA 4DVJA 4GX5A 2X0JA 3RUAA 1KVQA 1N1GA 1ZW1A 3DFZA 4NQZA 4BNYA 4FD3A 2RBEA 3JQGA 1GUYA 4JROA 3GGPA 2Y66A 1LX6A 5F1OA 3U09A 4CR7A 3VDRA 3ANNA 2DAPA 4H15A 5T57A 1PEDA 2C0CA 1LXCA 4GMGA 5DBIA 1WNTA 3D5TA 3SC6A 1BDMA 2DBZA 1LQUA 3PYMA 5JO0A 1CETA 4YB8A 5HBRA 4BB6A 4S1VA 2QRKA 3U0BA 1NFRA 3KLPX 5MGBA 2X0NA 1MB4A 1GAEO 3C7CB 4QXMA 3V1TC 3P2YA 3C24A 3IC5A 3NGLA 3X2EA 2BGMA 3ZW9A 4DREA 1I24A 3UW3A 3LK7A 2X0IA 3ZWPA 2YZ7A 1WDKA 1LRJA 3UF0A 3MCVA 3TNLA 4RPGA 2JD1A 1UUFA 2I76A 3JYLA 5JFOA 3AOGA 1N7HA 1EFLA 1QV7A 5JCJA 4D3DA 3AOEA 1R66A 3ROKA 4TMFA 3GY0A 2DFVA 5ER6A 1FDTA 5F5LA 4DBVO 1R4MB 3VDQA 4DLLA 2PZKA 1R12A 3K5PA 3KSZO 1HLPA 1Z45A 2G0TA 3PGXA 1JVSA 1DLJA 2NUAA 4A7PA 4Y67A 3PEFA 2C07A 2E37A 3ETGA 1CEQA 3TDKA 3TPCA 1ZK0A 1JKFA 2O3RA 2GASA 3QWHA 3M1LA 3ROMA 2GN9A 3QIVA 1F17A 4WCFB 2BFAA 1X7HA 3OQ6A 2EKQA 4CLXA 2FR1A 2QHXA 4B7UA 2AQIA 1GTMA 4CLEA 4HFNA 3KOUA 1G0NA 3FBGA 1UXGA 5EPOA 4N5MA 1A9ZA 4B7CA 5A9SA 1EQUA 4YBZA 4M87A 4JIGA 4P8RA 3O38A 5G0SA 4I5FA 4E4YA 3BMOA 1YVEI 2G17A 3V5NA 2FN7A 3GDFA 4LCJA 4B4VA 3E6AA 4GMFA 3K92A 3E9QA 1HE2A 4OKNA 4Q39A 3RUEA 4RZIA 3EZLA 5B37A 4F6LA 4GKBA 4U0JA 1ONNA 1HT0A 4RPLA 2JCYA 3JQFC 4TRJA 4ZHSA 4KQWA 3GFGA 2HK9A 1B8PA 2HCTA 4H7PA 3HHPA 4IINA 5L9AA 1ZCJA 5JS6A 2HMUA 1RYEA 4GBJA 1QR6A 3PLRA 3RROA 2DU8A 3RUDA 4EDFA 1Q7CA 1SBYA 3NTQA 4Y6SA 3V1YA 3WQQA 1SEVA 1LSJA 3H9QA 4R3WA 1DC4A 2W2LA 1XCBA 3OJEA 3BMQB 3WYCA 5EQDA 4NI5A 3BHMA 4AVYA 3WQRA 1C1XA 1DAOA 2YYYA 1DDOA 2D3TA 2CNBA 5EINA 3H3FA 3D1LA 4CLRB 5AVOA 4B4UA 4EITA 1AUPA 1QP8A 2FR8A 2JCXA 1EUCA 1QXSA 4J7XA 4C7JA 5L4LA 5JC1A 2VWHA 2PZLA 5T8KA 5JCXA 2I6TA 3CSDA 3P5SA 4YQYA 5TGDA 2I3GA 4ALMA 5JAQA 2Z1NA 3O26A 4J9UE 4WJZA 3ROQA 1E3WA 2Q99A 5I8ZA 4WEQA 3IAHA 1JW9B 1LA2A 1ZO8A 2F00A 1KEWA 1WP4A 1LU9A 4WLNA 1VL0A 4H3VA 5KOIA 3GEDA 2W2LD 1K2WA 1BXGB 2VWQA 4ND1A 1J49A 4RVHA 2X6TA 1SPXA 3ENKA 3DWFA 1XQ1A 4ND2A 3ZV3A 1X13A 4JP2A 1V3UA 3QWFA 1UH5A 4ALKA 3OA2A 1YO6A 1D1TA 4DA9A 4PRLA 2H6EA 2R6JA 4CUZA 1JLLA 1KC1A 3W4JA 1H2HA 4FW8A 4M89A 1YOVB 5AYVA 1TLTA 1JN0A 1IUKA 1ZK4A 3AU8A 4QECA 2B69A 1DIAA 2QYTA 3BHIA 3WYEA 1R4NA 1PJQA 3C1OA 3GN1A 4RF3A 1OC4A 2G82A 3U4IA 2QZZA 4CMJA 1BW9A 4GSLA 4RPHA 3RC9A 4MVJM 2RAFA 1NP3A 5B4UA 1R0LA 3O9ZA 1JVBA 4FOSA 2UAGA 1UXKA 2PD4A 1Y9AA 4NHEA 3W8EA 4D79A 3Q11A 2H5LA 1ISIA 1T4BA 1T1RA 2VRBA 4BHTA 4MVJI 4P22A 2NVUA 3OFSA 3VH2A 1NASA 3DZGA 3M6IA 1ZNQO 1XSEA 1FDVA 1CF2O 4JJGA 1I2CA 1QSGA 3FI9A 1E1LA 3DXFA 3A14A 4YRBA 4JLWA 3DBLA 1E7SA 1H6AA 3KYDA 4FFRA 5L7WA 3QLJA 4NU5A 4PG5A 5L3ZA 1MP0A 3GAFA 1GD1O 1VRWA 3HFSA 3A1NA 3NV9A 1T2CA 2O4CA 5ENVA 4ID9A 5C7IO 1Y5MA 1DEHA 2BFOA 2NACA 1K5HA 3F47A 1EUZA 1P74A 4RO0A 3V2UA 3WSVA 1EVJA 4Q3EA 3ENNA 4O59O 3HB4X 1ISGA 1JWAB 4RDHA 2ZB7A 4LMPA 1R37A 3OEYA 1D3AA 4YT8A 2Q3EA 3FHLA 3ZCXA 1YDWA 4BOYA 1PGNA 1EZ4A 5T6BA 2LDXA 2Y0DA 3DFUA 3FSRA 3TZ6A 2OBYA 4E6PA 2DFDA 1OC2A 1ZK1A 5TJ9A 4TSKA 1O89A 2VQ3A 4CM8B 2OORA 4KP7A 4OXNA 3HN2A 5FF9A 1D4FA 4PG8A 1AHHA 4TKMA 1B3BA 4YAKA 2GNAA 5F1PA 1JQBA 4BNFA 2X5JO 1PJ3A 4YJFB 1CRWG 1H0KA 1I36A 1SOWA 3NTOA 4KDEA 3ROPA 4OKIA 4B79A 2UYYA 2RH8A 1BG6A 4C7KA 4YT4A 1DBVO 1Y7TA 3DEYX 1Z74A 3ZWXA 1PTJA 3ZV4A 5K6AA 1ISHA 8ADHA 5G2OA 1X7DA 1P1RA 4I8XA 3ON5A 3W8FA 4JK3A 4PZDA 4CUKA 2WYUA 2Q45A 2BFPA 4YR9A 1U5AA 2VNAA 2CVZA 3TRIA 2YQ5A 2X9NA 4CL3A 3KM0A 4YJDA 1LUAA 1LBEA 2AEFA 3FTNA 3L0DA 1M2WA 4WLUA 2HQ1A 4BQRA 2P9CA 3B1FA 3BZUA 4O5OA 1D7OA 1IB6A 2DUUA 2Y0CA 3VH4A 1V3VA 5C37A 2C20A 3F5SA 2B5WA 2IXBA 4FOOA 1TA4A 2HDHA 3K8ZA 5CDTA 3WBFA 2WWRA 2PKQP 4J0FA 3WFJA 4IY1A 4BNVA 4BVAA 2D8AA 4EJMA 3DBLB 2AXQA 2VT3A 1FMCA 1T2FA 1RWBA 4IMPA 1DB3A 2Y0EA 3PVZA 3R6DA 4WK6A 3K6JA 3L4BA 2X0RA 3OJLA 4EEXA 4PLVA 1ENZA 1MX3A 5I9MA 4W6ZA 1Y8RB 2C59A 3ZNQA 5A03A 2E82A 5A3VA 4CLOA 5I7FA 4QUKA 1C1DA 3UKOA 1CDOA 3GDOA 1PJCA 2JFHA 1LLCA 5IXYA 5FI5A 2EGGA 3VVCA 4OH1A 1JAYA 1E5QA 4EW6A 4NBWA 2PH3A 2IYPA 4CODB 3KXDA 1Y6JA 2YHIB 1I3NA 5JY1A 3KEOA 5IXSA 4BNIA 3UXYA 5JSFA 1JTVA 1U3TA 3DBRB 1P33A 1SZJG 3D5QA 3D3EA 3MZ0A 3KLMX 3B1KA 3TWOA 2UDPA 2VYND 3OBBA 1Y5RA 4YJHA 1T4DA 1NQTA 1NHWA 1V6AA 4KMSA 2ZTLA 4YDRA 4HKTA 2EWMA 4MVJD 4MIEA 4R3NA 2AQHA 4LK3A 3SVTA 1XU9A 3DQPA 4XGIA 3JQ7A 4B4WA 4B8ZA 1IOLA 3K9QO 1PIWA 3QW2A 2OZPA 4NBRA 4WCDA 2PA3A 3JYQA 4TVOA 4DIOA 3ADOA 1LLDA 3S55A 4DUPA 2HJRA 4JBHA 5A04A 1WWKA 2ZYGA 3H9UA 4RLHA 1RPNA 2ZATA 4ND4A 3PJGA 4CM9D 4GX0A 1UDBA 3VZQA 2FZEA 3WYBA 1SB9A 3ZWOA 2PZJA 2D4AA 5A5FA 1X0XA 1E3SA 4NNJA 2NQ8A 3SBOA 3IP1A 4BKRA 3I52A 4WCFA 2ZJ0A 3ORFA 3PLNA 1FXSA 5IDYA 1EE9A 1P9LA 1ZSNA 4XYEA 1H6CA 3IJRA 5G0TA 4E12A 4ESOA 1NFFA 2YV3A 4OL9A 3ZWNA 4IBOA 4WEOA 4UVIA 4JN6B 4ALNA 4XZ3A 2FY8A 4AJJA 4E13A 2GF2A 5DP1A 2PY6A 4KWHA 4CQMD 1MXHA 4O0LA 1ORRA 2O7SA 1HE5A 3FR7A 3WNVA 3PP8A 1KVUA 4RF4A 1PL7A 5KKCA 3LF1A 4Y6PA 1XKQA 3QWIA 3E1KA 1PGQA 5G0UA 4W4TA 2E6UX 3B70A 3LF2A 2JL1A 4XYBA 4ZRMA 2IEBA 3E9NA 2BLLA 4I5EA 3FNEA 5JBIA 1FF9A 3PYLA 2NTJA 5KJ1A 2CVOA 1F06A 4NPCA 5LDGA 1P77A 4J90A 5A5EA 2J5QA 2Z5LA 4BKPA 1U1IA 3GOHA 4LISA 1GFSA 1I3MA 1PGPA 3G1UA 2Q2VA 1DC6A 4LMRA 4XCVA 3BMOB 3ONEA 4EYEA 2IDZA 3OJFA 4BMVA 1V35A 1ADFA 3BTOA 4LCEA 1ZVMA 5TJHA 3KYCB 1DJQA 4CQMA 4WLFA 2XXJA 3R0IA 1A7KA 3FWZA 2CDCA 1HDCA 4YQZA 2PLAA 3CZRA 4B3IA 1OBFO 2HMSA 4L8VA 2BFMA 4IDFA 4RQTA 1I32A 2DBQA 3IUSA 1ZFNA 3U9LA 2HU2A 5FEUA 1PQPA 4WCFC 4EZBA 3ZH2A 4BO4A 1A5ZA 1TEHA 2OP0A 3TF5A 3N74A 1I10A 2DVMA 4M86A 2FP4A 2I5PO 1BVUA 3CH6A 2E48A 5MDHA 2V6FA 3WBBA 5CPBA 4FGWA 1RM5A 3ZHXA 2OMEA 5JDIC 1FJHA 4BNTA 4YJHB 4RL6A 1K89A 3QHAA 2PV7A 5ES3A 1NXQA 5TF4A 2FSVA 2HLPA 4XQEA 4XGNA 1U8FO 5A3JA 1B0AA 3S2IA 1YOVA 1Q7GA 3HADA 1ZKMA 3GLQA 2ZKLA 1SAYA 3B6ZA 1I3KA 1DJNA 3I4FA 4OHUA 1LTHR 3GAZA 4J2OA 4CMEC 5DOZA 1ZXLA 2ZIZA 4JQCA 1V3TA 2WD7B 3NKLA 4GLLA 3HQ4O 4XKJA 3UAGA 3IP3A 3ZDFA 1A7AA 4L76A 4L75A 3F4LA 3BTSA 1HSZA 1GYQA 1TVEA 4KTVE 4INAA 1PSDA 1Y8QA 1C1DB 2PWZA 1N9GA 3ASVA 3G3EA 3E5RA 4RPJA 1PGOA 2PGLA 3JQDA 4CMCA 4BNXA 2G5CA 3WR5A 2YFHA 4BNZA 1NVMB 3GRPA 4R01A 2O3TA 2VWGA 3TN7A 5IZCC 2HUNA 3H9JA 3RBXA 4D46A 1DIBA 1XQ6A 2WYVA 4NJOA 4BNJA 4GAEA 3ZU5A 3W8DA 3BMNB 3GG9A 2POQX 1QYWA 1WVGA 4XYGA 3A4VA 2C5AA 2GGSA 4IGFA 2BD0A 3V1UA 1N8KA 4K6FA 4P4NA 1X0VA 2JAPA 2VOJA 2X58A 1YBVA 4GVLA 2Q1UA 3C1AA 2AMFA 4G65A 3JQEA 4XX0A 3PHJA 2NTVA 3CPSA 4J91A 1PJSA 1C1XB 4Z9XA 3SEFA 4WLEA 3QA9A 3WMXA 2IZ0A 1HLDA 5BNTA 1UR5A 1Q0LA 1I33A 1ZJYA 3FTPA 4I5DA 5DOVA 3A28A 1T2EA 4IQ0A 3LC1O 1E3WB 4BIIA 2EKPA 2A94A 3RIHA 4MKRA 4PLPA 3E9MA 3BMCB 5THKA 4YRAA 1U7HA 5JDIA 2B4RO 3B20A 3WFIA 1IE3A 1DRUA 2WEKA 1BWSA 2W2KB 1F8FA 5TS3A 4TZKA 1OI7A 2W8ZA 2AEJA 5DT9A 1CQIA 1BRMA 2P5UA 2IYOA 3LT2A 3GEGA 3PQDA 1SNYA 1TT5A 2V7PA 5EJ2A 1SOVA 1V8BA 4UUOA 4KDFA 5I9NA 1RJWA 4EGFA 1PS0A 1EFKA 1DIRA 1W73A 4TRNA 4UULA 1SEPA 3DZFA 5L45A 3WGHA 2OBNA 2VHWA 3EAGA 1U28A 4MINA 5IDWA 3KUXA 4U0KA 4WE3A 1NQAO 3KO8A 4PLHA 4ZQGA 1ULUA 4FFLA 1PGJA 1NPDA 2BH9A 3AY6A 1O94A 1PZFA 2HSDA 3GUYA 1PZHA 3HNPA 1ZSVA 3NJ4A 4FS3A 4Q3NA 4CV2A 1PR3A 4M8SA 2O4UX 1HDXA 1QG6A 1NVTA 3PWKA 3RC1A 3WIEA 4BO1A 2GD1O 3VZRA 1C3VA 4XA8A 1VJ1A 3D0OA 2X8LA 3MJTA 3ZNPA 2GN8A 3BAZA 1R6DA 3GPIA 4CM6A 4NU6A 2DBRA 1TT5B 1HZJA 4DRYA 2EXXA 3JCZA 1LSUA 5TNXA 3BIOA 4DPLA 1K3TA 5A9SB 4P4GA 4BKQA 5ITVA 3TL3A 4B3JA 1E7QA 3LDHA 1MUUA 1JAXA 3GRKA 4UUNA 4D43A 3RFTA 3ZWVA 1LQTA 4BNNA 4BNHA 3KYBA 5I9LA 3QSGA 4YTEA 8LDHA 3TFOA 4ZU3A 3ZWYA 2BI7A 4J7UA 1HYEA 3NGXA 4RLSA 1U9JA 3JQ8B 2CDBA 3S2GA 4DYDA 2RCYA 1AHIA 4BB5A 2FPGA 5IZ4A 3SLGA 4Z0PA 2CD9A 5LDHA 2TMDA 4BGIA 1PJBA 1MXFA 3JYNA 3F9IA 1KVSA 5JYDA 4CPDA 1DIHA 4L4XA 2IODA 2C2YA 2EHDA 3FCOA 1PJLA 1D1SA 1KEUA 3HSKA 3WGTA 3BMCA 2DKNA 5GZ3A 3W4KA 3FNFA 4R1UA 2AHRA 1J6UA 5ER9A 5KVQA 3JYOA 4JCOA 3PHGA 2D5AA 1MFZA 2WJPA 3QRWA 3NDJA 4DMMA 5KJCA 1EBUA 4RVGA 3WXBA 4WGGA 5B4VA 4QTZA 4PIVA 4KTTE 1YB5A 3PZBA 5BR7A 2TMGA 1R16A 1JU9A 3JD2A 2V6BA 2UVDA 3NYWA 4J9VA 3RC2A 2V6MA 1FK8A 1GCOA 1W6UA 3NRCA 5HM8A 3PGJA 4R4JA 1F8GA 5DBGA 2DC1A 3RCBA 2HO5A 2G1UA 1HDRA 5ICMA 1Y81A 4J49A 4ZGWA 3GEMA 5F3RA 3JQ9C 4HBGA 3H2SA 2DLDA 4J1QA 2R00C 4CMKA 3FPCA 1YL6A 4W9NC 3QJ5A 3WTCA 4M54A 3QVSA 4OIMA 1Z73A 3GUCA 1YH3A 1DHTA 3BHJA 4CM4B 3FD8A 1HYGA 3VHRA 2NTNA 3ZW8A 4B8WA 4DLBA 4ALLA 2AQ8A 4PG6A 1ZIDA 1QYCA 1UZMA 4II2A 1HRDA 3G79A 4CLRA 4OMUA 1PX0A 3INGA 3JSAA 3EUWA 1QYVA 4EUHA 3L9XA 3TFQA 4BQPA 1B26A 4XYMA 3D7LA 1PWZA 2EW2A 3IL2A 2RHCA 5A9TA 2C54A 4AJLA 4KUGA 2Y1DA 3T4XA 1XHLA 2GCGA 4MP8A 4XYLA 3WGGA 3NUGA 4Q3CA 3WX0A 5JXWA 4JBGA 2YV1A 4BO6A 2ZQZA 5FWNA 3MWEB 2NSDA 1WAMA 1LSSA 2VRCD 1M6WA 3UCEA 2GR9A 4IDDA 1DOHA 2EJVA 3TQHA 4ROSA 1HDZA 3CKYA 3PXXA 5K9ZA 4LN1A 1LLQA 2O3SA 1IYZA 3ZWCA 2DUWA 3HJAA 1ZK2A 5KVSA 3TOZA 1HDGO 4TVBA 2OUIA 3H3JA 4TWRA 4E5KA 3AI2A 2VUSA 2WDZA 4GPD1 3ICPA 4MDHA 2RHRA 1A9YA 3LC2O 1RKXA 5JAMA 2ET6A 3DZBA 1E77A 4IS2A 3KYCA 5T8KC 1ZMTA 2O7QA 1KYQA 3GNSA 2VN8A 1DLIA 5H81A 4JJFA 4R69A 5IG2A 2Q1TA 1BVRA 5G0VA 1UP7A 3DR3A 1GR0A 3C85A 3H5NA 3WLFA 1I0ZA 1T2AA 2GDZA 3BTVA 4FBGA 3RFVA 3GVHA 4RVFA 1NM5A 4D41A 5C3MA 2EP5A 4AJKA 2PH5A 1E1KA 4DIBA 2VRCA 4MOWA 3WQSB 3OEWA 1ZBQA 1Q0QA 5DDIP 5FI3A 4EI2A 5JY6A 3JD0A 1UAYA 4HX5A 2X22A 1YWGO 1KBZA 3F1LA 3RKUA 4WOKA 2CSUA 4XRGA 3JD4A 3DMYA 2D59A 3I5MA 5TC4A 3VH1A 3GZNB 3GC6A 4A73A 5BSGA 3HE3A 3F3SA 4DC0A 2O2YA 4RJTA 1A4IA 1SC6A 4YACA 1UDAA 1OOEA 3HZZA 3GVPA 4E2WA 3LU1A 3CXRA 4CLDA 3EW7A 2EW8A 4RF2A 1QMGA 1UAGA 4WPGA 4HV4A 3GMSA 4ZQHA 3HDYA 4RDIA 5JDCC 3GMDA 1E1NA 1S7CA 2JHFA 3GVIA 1L7DA 1ISFA 4J1TA 4U8GA 5F5NA 3WOHA 4DMLA 4CL8A 4CMHA 1YRLA 4ITUA 1E7WA 4FJ2A 4ZJUA 2YFQA 4R1NA 4DXHA 4WASA 3BMNA 1BXZA 3ZHZA 4XDYA 1FDSA 2C7VA 4UUPA 1ML3A 4BO8A 3QVTA 4CM3A 4E0BA 5CAEA 4P38A 2ZYAA 1TXGA 1Y9EA 3RU9A 2EF1A 5L7YA 1ZZEA 3STHA 3G17A 4IGEA 4W7HA 2CUKA 3I6IA 1KVTA 1E7YA 2DTEA 3AFMA 1I2ZA 1HZZA 1U3WA 3DTYA 3GNQA 3L07A 4J43A 4RZHA 4UEOA 4W7IA 3AY3A 1GUZA 1G1AA 2Y93A 5ADHA 4MKXA 3AUSA 4RVDA 5DCYA 1CQJA 4JGBA 1F0YA 3JQ7B 1YQXA 1KVRA 2D1YA 4CLHA 4ZA2A 1I8TA 2AE1A 3MEQA 4PVCA 3OJOA 5F1KA 4DIFA 4G2NA 3K73O 1ADBA 1E0DA 2VCYA 4IXTA 3ZI0A 3ANMA 2DM6A 1N5DA 1B8UA 5IN5A 4UVDA 2WE7A 3E03A 3H9EO 2YJZA 2VZ9A 3MJEA 5A05A 1BSVA 1G6KA 3KHUA 4TROA 3SJ7A 3Q2IA 4E5NA 2P4HX 3I9NA 1Z7BA 4R68A 4GX2A 2NQTA 1WMAA 3G1TA 3SX2A 5EERA 1A4UA 1VE9A 4XD2A 5I7EA 2G76A 4BNWA 2V6GA 4ZN6A 4D0SA 9LDBA 3I3OA 4CQLA 1GL3A 1NPYA 1BXGA 3L6OO 3DAFA 4M55A 4YAIA 1NPTO 3IDSA 2Y68A 5KJFA 2NU8A 1Z82A 3I9OA 2JD0A 3UVEA 1H9AA 7ADHA 3SC4A 3I9LA 2W4QA 1VM6A 4Y98A 2DTXA 3ZWMA 5ILOA 5IJZA 3NT4A 5AXDA 3AJRA 4GVXA 5BSEA 4CUJA 4MO2A 1E7MA 5GZ6A 3MTGA 2JFFA 3GT0A 3ONFA 1EDOA 3IOYA 1P45A 1P1JA 4FFNA 2Y1OA 3EK2A 4DTIA 1IHYA 5TT0A 3OETA 1GEGA 7MDHA 1N9GB 4TQGA 2CZCA 4RPKA 4R5MA 4YRDA 1LC3A 1GYRA 5DF1A 1MC4A 4YYZA 4HY3A 1XYGA 2NVBA 4B7XA 1E3LA 3GHYA 3NX4A 4J16A 4K28A 4PLGA 3QP9A 2VTEA 4XQCA 2YUTA 4JP3A 4Z9YA 5COAA 5HA5A 1IL0A 1NR7A 4O1MA 4PG7A 1KEVA 2DBVO 4IQGA 4R1TA 3JQAB 4UUMA 4YA6A 4AICA 3UFXA 4G81A 3ZU3A 4ALIA 5C7OO 2EGHA 3JQ6A 1QV6A 2QRJA 3L4SO 5JAIA 5CDSA 5I8WA 4OXKA 1MC5A 3E82A 1K6JA 3WIDA 5GZ1A 3GN2A 1U8XX 3ABIA 1WZIA 1MLDA 3V2HA 1EK5A 4Z3KA 3GQVA 5JPIA 2NU6A 3WJAA 1LEHA 5KJ6A 4KWIA 5KTKA 1Q7BA 2GN6A 3TOXA 3AK4A 1E3IA 1C0LA 3HB5X 1YONA 5B4TA 4U5QA 4K26A 4Q9NA 2J3IA 3OSUA 4JXKA 4IMRA 2CVQA 3P2OA 1KEPA 3U62A 2F1KA 3L6DA 2Q2QA 4N5NA 3F4BA 1XA0A 4WNIA 4RCVA 3PYXA 2NVUB 2J5KA 2I3AA 4J4HA 4A10A 4FC6A 2ZYDA 4BGVA 3CE6A 2YV2A 4NK5A 2OL4A 4JJIA 5F21A 2J3KA 1ZSYA 3OF2A 3PIDA 3WGZA 1HXHA 1LC0A 1PZEA 1V9LA 3JQFA 3PRJA 3ZHYA 2VYVD 5HWSA 3JD3A 1YJQA 2HK7A 4Q3AA 1ID1A 4DLAA 3TZKA 3N7UA 2ZB4A 2PKRA 1ADGA 1E6WA 3LLVA 2Z95A 3K2BA 4F6CA 3UHAA 2X9GA 4J4TA 4AJPA 3H5RA 2GYYA 3TSCA 4TKLA 4R54A 2ZK7A 3QQPA 3RC7A 1DXYA 4R5HA 2BHLA 5C7LO 2B4TO 3IIEA 4LGVA 2GO1A 2VUUA 5THQA 1XEAA 4HP8A 2GERA 2D0IA 3MOGA 2Y1FA 4DC1A 5J23A 3ZU4A 1VSUA 5C5IA 4LVCA 4OXYA 2E49A 3VTZA 5HRUA 4MVJA 4DQUA 1GPJA 3LSYA 1A71A 4BV9A 2QG4A 3NDRA 2X7HA 1BW9B 1YQDA 2P2SA 3RAJA 4EUEA 4FSHA 1PS8A 5AQ1A 5KKAA 1NWCA 2FR0A 2PKQO 3N58A 4IJVA 3RD5A 5JAZA 4GL4A 2UV8A 3QWBA 4OYRA 1X14A 2I9PA 4D44A 5DULA 2AE2A 2P9GA 1GEEA 4BO2A 1NBOA 4W99A 4MP6A 2P5YA 5DZSA 2XAAA 2O3QA 4R16A 3LC7O 1OFGA 4FR5A 1B8VA 2VHZA 3PJEA 5HTOA 1T1SA 2X86A 2BI8A 3OQ1A 3K2EA 1XG5A 4OJNA 4Y8VA 4PLWA 4BGUA 2Q46A 1HETA 4EJ6A 4DQVA 3IJPA 1B2LA 4K9DA 2D2IA 3D4PA 2X5KO 4CM7A 1VPDA 1HWYA 1LDBA 5JYEA 1KY4A 1PWXA 2CY0A 3DO5A 5G4KB 1B7GO 1ENPA 3IQDB 3PZRA 4HWKA 3UN1A 1H93A 1UXHA 4I9UA 4K1LA 4NFSA 1OAAA 1H9BA 3LLSA 2QX7A 5LCXA 3TZCA 2VYNA 2VZ0A 1WXDA 2B5VA 2O3JA 2VT2A 1NR1A 4HFJA 3MJSA 1UZLA 3C7DB 2CMDA 3ZU2A 3INRA 1GY8A 1NWHA 2J5RA 4CV0A 1GPDG 4YWJA 3OHSX 2GRAA 3DBRA 5KCZA 1IHXA 1C14A 5JMWA 3KB6A 5KNLA 1EUDA 4XJSA 4K6CA 5CDYA 1WW8A 4R9RA 3RFXA 2JHGA 2IZ1A 3EVTA 3MOIA 3M2TA 3NT5A 3JQ8A 2GLXA 2GZ2A 1UJMA 1LRLA 1ONOA 2X4GA 3DC2A 1DFHA 2OP1A 4UEKA 1DIGA 3GHHA 1K6IA 3RUCA 4FCCA 1I2BA 5B12A 1AGNA 4ND3A 3TJRA 2VTDA 1YXMA 3FNHA 1B14A 3CEAA 1HDYA 5L4NA 1CIVA 5L95A 4KQXA 3LT4A 2ILTA 2FHSA 4YAJA 1VL6A 1BGVA 3RSHA 4DQXA 3AI1A 4J3FA 1KERA 2B83A 4LW8A 2EG9A 1WDLA 1PS9A 3S8MA 2O2SA 1H6DA 1KY5A 4KOAA 2PFGA 1O9BA 4ZQBA 1OMOA 1HL3A 1DFGA 3CTMA 3GGOA 3I4CA 5HS4A 1Z7EA 4XIJA 1C0PA 1DAPA 4R51A 2FWMX 4OQZA 3D4OA 3S2FA 4E2YA 4NK4A 3KYDB 1IY8A 3U3XA 3M1AA 2HKIA 4FFOA 1BMDA 3TZQA 4GSKA 3BA1A 2IRWA 1P1HA 2OFPA 1NAHA 3CIFA 3I9KA 1GQ2A 3MJ4A 4Z0HO 4GWKA 2VWPA 1NX6A 2OO5A 3UH1A 4CQMB 2IEDA 1WDMA 1W8DA 3OP4A 5CP8A 3BTUA 3HUDA 2PGJA 4FGSA 4U7WA 2A4KA 4IDBA 3UCXA 1TT7A 1E1MA 1DPGA 1QLJA 1FDUA 1RM4A 4NJMA 4PN3A 5I7VA 2YQ4A 4M49A 3ZV5A 3EYWA 1U2DA 1ZK3A 3GNTA 5COBA 5IDQA 1EE2A 1MG0A 1DC5A 4QEDA 5IDXA 4BO9A 4IZHA 4BO5A 3O8QA 3WGYA 1E7RA 2XF8A 3RJ5A 2VHVA 2QIOA 4CMGA 3O8QB 3Q1LA 2JJYA 5JDCA 1VL8A 4CM1A 1R4MA 1WPQA 3LT1A 4IPTA 1A27A 2B4QA 2WM3A 4TZTA 3RVDA 5JCJD 1R4NB 3I6QA 1WZEA 4PFJA 1CJCA 1NTOA 2BGKA 3KEQA 5TSDA 3RUFA 4HNGA 2JFGA 3JQBA 4JX8A 3DMTC 2R2GA 1YS4A 3JQAA 4NFHA 4MJLA 1SO8A 3C8MA 2P9EA 2CF6A 2D5CA 1M66A 4BO7A 1JWBB 1CYDA 2V65A 5LC1A 3CMCO 3PHLA 3K30A 3AM5A 3HDJA 5G4KA 1HSOA 1Y1PA 1BHSA 1GCUA 4ZD6A 3RU7A 2ZB3A 5GY7A 4LVUA 5BSHA 2EIHA 4E5PA 1U5CA 4CV3A 1FDWA 1Z75A 3H7AA 1W4ZA 4HFMA 1VJTA 2X23A 4A26A 3KRTA 3VTFA 1E3EA 1YBAA 3DZJA 4YJGB 1VJ0A 3KETA 4BMNA 1PJTA 5U9CA 1XLTA 4R41A 1UP4A 3PDJA 5CPFA 4PLTA 2PZMA 3PHHA 3A9WA 2VHXA 3SXPA 1SB8A 3FBTA 4IJUA 4YAEA 5DCUA 5ILGA 3JQGB 3UUWA 4OM8A 5TX7A 1LDGA 1VC2A 4E5MA 4FDAA 3GH3A 3Q2KA 1ARZA 1CWUA 3COSA 4ILKA 3PFFA 4GGOA 3FF4A 1ADCA 2DT5A 4AJ2A 1ZJZA 4GGPA 2FOIA 3KSDO 1ZH8A 4QFDA 1NNUA 2ZTMA 4D7AA 3ONDA 3DB2A 1MGOA 3HWRA 3U49A 5BQFA 2P68A 4E32A 3JQCA 3HFGA 4BKUA 4A5OA 3K96A 3RUIA 1ULSA 1P1KA 4CM9A 2QZ9A 2I99A 2JD2A 3CUKA 4F45A 5DN9A 2QYSA 2C2XA 4IUYA 4MVJE 4TRMA 5KVCA 4X54A 1I5RA 4CLOB 3S2EA 4IIVA 1GQQA 4MVJF 6ADHA 1J0XO 1PR9A 3Q9NA 4UVHA 1E5LA 1GADO 3DBHA 1W0CA 4DPKA 4DYVA 3KSUA 1IPEA 3WJ7A 4UREA 4ZVVA 2CDAA 4J1NA 4WECA 4IJKA 4Z0TA 2B0JA 1O6ZA 4O63O 4L4SA 4CMAA 3FNGA 1M75A 2FZWA 4ONEA 2EP7A 4EUFA 4YVFA 3GDGA 3L6EA 5AXBA 3FWNA 3PFWO 1NHGA 2HMTA 1DHRA 4RORA 3E48A 1I3LA 4FPXA 2Q1SA 4MVJH 4AFNA 4UVGA 1LDYA 5L40A 4YEDA 1CERA 5EMHA 2HMWA 1YB1A 4IDCA 1IPFA 1PU2A 4P4LA 3V2GA 5CG2A 1KS9A 2NLOA 3QE3A 3TL2A 3Q3CA 3DZIA 1VLLA 2QW8A 3LT0A 3ZGYA 4I1IA 3DHNA 5TQVA 3PWSA 5U1PA 4L74A 3B1JA 3PJFA 3R3JA 4BV8A 4XR4A 1YB4A 4N5LA 5IN4A 2B37A 2EKLA 3DZHA 4D3SA 3CMMA 3U5TA 4YXFA 4FC7A 4NZ9A 4A2CA 4YJGA 1VKNA 3L9WA 4I9HA 4I5GA 4UEJA 3PWZA 2PTGA 4JNKA 4R9SA 2Y1CA 2P91A 4E33A 3VKVA 4Z6KA 2Y1EA 4PVDA 5DP2A 1EVYA 1M76A 2BGLA 1RM3A 2WTBA 1DRVA 4KUEA 3ZWAA 3ICCA 4DL9A 3GVXA 1ZEMA 1O8CA 1LRKA 3WTBA 3EDMA 3JQ9A 4GQAA 4D0RA 5EN4A 4RV9A 1JA9A 3R3SA 3PQEA 5H82A 2Z1MA 3GA0A 4W9NA 4B4OA 3IKTA 1VKOA 1UZNA 3VKUA 5TLSA 3VZPA 3EGOA 4NMHA 4OOEA 4QSMA 4YJFA 5T64A 2ZB8A 2I66A 4WLOA 1NQ5A 3U4CA 3V8BA 4N7RA 2FRDA 3MTJA 4J1SA 4ZQEA 2ZCUA 2JKVA 1B3RA 4A0SA 4OGWA 5B1YA 1DSSG 4IDEA 4RGBA 4GI2A 5AXAA 3MJCA 4BO3A 2A35A 1YL7A 1ISJA 4E30A 2BF7A 4DGSA 3PDUA 3OIDA 1QRRA 2AEMA 5JLAA 1P3DA 4HXYA 2ZQYA 1K6XA 1UDCA 1DRWA 1LLUA 4AJHA 2ZJ1A 1I01A 4J4BA 1XELA 4LRTB 3PI7A 3VZSA 1EEHA 5ENDA 1X7GA 3WB9A 1GUFA 2VYVA 5IAAA 1EMDA 2J8ZA 5L7TA 3ZWWA 2C29D 3I1JA 4XEHA 2Y1GA 1L7EA 4XJTA 4E2ZA 4MVJP 2VOEA 2I67A 1I30A 3WSWA 3NJ8A 3E18A 4E31A 3WWZA 2J3JA 4XRRA 2OXIA 3ADPA 4HADA 2J3HA 3X2FA 3DHEA 3AI3A 2NV6A 4Z9FA 5H83A 3U4HA 1QORA 4KZPA 4WKGA 3QY9A 3GGGA 1IZ0A 3GG2A 3ZN2A 3ZZNA 4CMEA 4GKVA 3RBZA 5L53A 3FPLA 1HEUA 2X5OA 4FJ1A 3VPXA 1XIVA 4U6SA 3T7EA 4F46A 3VPSA 2Y67A 3S1LA 4PLFA 3EZYA 3F5QA 1ENYA 2WYWA 1HDOA 3GR6A 4HUJA 1ZEJA 4U6QA 1PQUA 5BNIA 5ICSA 2P4QA 1DO8A 1GU7A 1BTOA 1Q2XA 3GZ4A 1P0FA 4LSMA 4XIYA 5AOVA 1N92A 3WDSA 1KIFA 4XQGA 2WE8A 1ISMA 3H5AA 4S3MA 1O95A 1Y8RA 4MKZA 1Z6ZA 4HNHA 3QVWA 1P1IA 4C4OA 4EJ0A 1M6HA 5EL0A 3DOOA 1PL8A 2Q50A 3UICA 4WNCA 2FPPA 3JD1A 1C0KA 1EK6A 4FFPA 4GLOA 5CHEA 3VPFA 3JTMA 2OGUA 4GWGA 5TRTA 1WMBA 4E21A 5IZCA 4L9RA 3E5MA 4AJOA 3DOCA 1KETA 3G49A 1P31A 1YQGA 3DAPA 1YGYA 4Q3DA 5TT1A 9LDTA 4E2XA 1Y8QB 2NNLD 3ULKA 3RJ9A 5JC8A 3W1VA 3LVFO 4FB5A 2CF5A 4GH5A 1MV8A 5BT9A 1S6YA 4PZEA 4CMIB 3WS7A 4M1QA 2DPHA 3PIIA 1XWFA 4W82A 4WLVA 3A06A 3D64A 4DPMA 3H4VA 5FFFA 1MFPA 1QLHA 1AXEA 1VSVA 3PHIA 2I65A 5BSFA 4FQ8A 2VZ8A 3LYLA 3CZMA 4D42A 3BXXA 3DDNA 3C7AA 5DBFA 2Q4BA 3AY7A 1QYXA 3WWYA 1N7GA 3RWBA 1Q0HA 1R0SA 4PCVA 4FFMA 2AA3A 4EBFA 4MIOA 1U4SA 3RUHA 5T67A 2BRUA 3P7MA 3JV7A 3Q0EA 3WGOA 1NAIA 3VAZA 1V0JA 1BXKA 3H6KA 1X15A 3C3XA 3IKVA 3O4RA 2A9FA 4BNLA 5CFZA 4ZQFA 5IFLA 3Q6IA 2GUGA 4YPOA 1T24A 4ND5A 3EVNA 4NBUA 2Q4EA 3ANLA 3AOEC 3PTZA 3R1IA 3VVBA 1J4AA 3QWAA 3L77A 1T25A 3EY4A 1LDNA 4NDNE 1KOLA 1M67A 2DPGA 3NEPX 3GVCA 4FN4A 3Q9UA 1L1FA 2X1HA 4AJNA 1JKIA 1YKFA 3E8XA 4CV1A 5JW6A 4PLZA 2XXBA 1GV1A 1AXGA 2O50A 3QV1A 5KWEA 1PJ2A 4IQ8A 1RYDA 4OAQA 3UOGA 4PRKA 4IDGA 1P44A 1LI4A 2Q49A 2RH4A 2EEZA 3W6ZA 1XDWA 1T2DA 3HG7A 3WGIA 3SJUA 3KTDA 3RASA 1IULA 4D45A 5CG1A 3WICA 3FN4A 1TB4A 2A92A 4Y6RA 3H8VA 2Q2WA 1GZ4A 2W2KA 2GN4A 4AL4A 1ZMOA 4BL5A 5COQA 4IXWA 2QQ5A 1X1EA 2VUTA 3I9MA 4A27A 5L51A 3GF4A 4E5YA 3NT2A 4AJEA 1LSOA 2NVWA 3P19A 4BNUA 5JMPA 3JQBC 3DMTA 3OJ0A 2X9VA 4IZIA 3HN7A 2PR2A 1ZXBA 4ALJA 2YY7A 1VI2A 2O23A 4NBVA 3DONA 3PQFA 2QRLA 1H5QA 1GZ6A 1LJ8A 2UUOA 5KVVA 4JBIA 3TZHA 3JQAD 4UAGA 1NYTA 1H94A 4PZCA 2W90A 2HK8A 2OOSA 1RM0A 3ITKA 3ZHBA 1MG5A 3H65A 1MA0A 2NU7A 1XU7A 4PLCA 5A9RA 3M2PA 1SMKA 4L0QA 4XWYA 5CEEA 5AXCA 4B3HA 4IJWA 2CFCA 1LDMA 2IE0A 4QQRA 5A06A 3D4NA 2NU9A 4FJ0A 1LNQA 4YT5A 3RKRA 1GQYA 3DTTA 4I9NA 4NBTA 2YHUA 6LDHA 3HDQA 2C82A 2YDYA 2R00A 3GPDG 2WD7A 4YCAA 3MWDB 4H16A 5G4LA 4CJXA 2BELA 4L4RA 4BMSA 2XOXA 4GX1A 2IXAA 4AJ4A 2AG5A 4NIMA 1U4OA 3FRJA 4CMBA 2UUPA 2WSBA 1R0KA 2FSSA 3OIFA 1QYDA 5TIIA 2HAEA 3MJVA 2OHXA 3OA0A 3VPGA 1Q1NA 5U4QA 2NM0A 3C1TA 4PLYA 1HE4A 1HYHA 3NTRA 4BNKA 3RI3A 2EERA 2C7GA 3OH8A 4R1SA 4OSOA 4J2HA 3AUAA 2B36A 4PGFA 3PK0A 5EESA 1SCUA 2ZTVA 1BDBA 4CQLB 4MVJG 1OZAA 2ZCVA 2IZZA 1HTBA 1D8AA 2NWQA 2O3UA 4D3FA 3BMQA 1LDEA 1GYPA 2YW9A 4QO8A 3U4DA 2HMVA 4DWVA 5CEJA 1U3VA 2PD6A 3NDIA 4XB2A 4RVSA 2W98A 1IZ9A 4J7CA 3VC7A 4YT2A 5JE8A 3OQBA 3AUTA 3GFBA 2PGDA 4EEZA 1GV0A 1PL6A 3T4EA 3WNQA 4CM4A 5EIOA 4AJ1A 4NH4A 3ZV6A 1F12A 1EQ2A 4LRSB 5GMOA 1PZGA 3IUPA 3D3WA 2PD3A 4OOFA 5I7SA 5KJEA 4Y9DA 4CR8A 2AG8A 3WG9A 3W6UA 3OMLA 4TRRA 3AM3A 1G0OA 4YAGA 4MIYA 3I9JA 5CDUA 2RIRA 4IM7A 3DOJA 3T7CA 3OECA 2LDBA 4N18A 1GDHA 2H1SA 5A1TA 1E92A 4I08A 4DBZA 3RQSA 4WOJA 5A4DA 2AQKA 4IIUA 3ASUA 4BNMA 2BMAA 2O48X 1YL5A 1P1FA 1A72A 3G0OA 4RF5A 1NQOA 2HJSA 1EVIA 1PQWA 3ST7A 2WMDA 3WMWA 3IMFA 1GZ3A
chains in the Genus database with same CATH superfamily
1YBFA 2A33A 1GRQA 4O0MA 1V11B 1SOAA 1NJ5A 2Y2UA 4K3VA 5IDVA 5LQMA 1NNEA 4JSTA 1QWOA 4GBMA 1Y6QA 2IWHA 3KQVA 2XNCA 2AIRA 4L3VA 1N1MA 3VR3A 3T1HB 4AWAA 4F72A 4FIDA 1N6OA 4JCCA 4KE6A 3NOVA 4RLQA 4UMEA 4UFPA 3DO8A 1ZUIA 4URFA 4BLQA 1X1TA 3LNTA 4EABA 3JAMA 2MSDB 5IT4A 4G0PA 1SHUX 3OQPA 5E9AA 3I6MA 2X8JA 1JSLA 4KE7A 4XVHA 4GRAA 1G7RA 1NIJA 4X3PA 4F3YA 4NNOA 1FUUA 1BH2A 4HQNA 5K0JA 4DV7B 2EG5A 3F9CA 4NJMB 2HRZA 2GZRA 2QLMA 1U2GA 3FKSD 2R60A 2QAGC 2X0FA 4I55A 5AFSA 1C30A 1HT2E 2V8OA 3N2GA 4XGKA 4GBED 1P7PA 3MT9A 4PNZA 4D4HA 1XCGB 2YDXA 3MAAC 4RMIA 2FMUA 2VBFA 1HQYE 2QUKA 1O77A 3AETA 2VNSA 4G5HA 2X7JA 4OAOA 5NLLA 4D9KA 1VLMA 2R8PA 3H11A 3QVOA 4HN9A 4NR0A 5CCBA 1FFEA 4N9QA 4NHOA 2BFFB 3PUKA 1B16A 1UBFA 2XCLA 4A6EA 4YJKA 5IWCA 4IS3A 4YLEA 4X1YA 5CTJA 4OO3A 1Z6GA 3D8BA 3RVMA 5JZ9A 2ZJFA 3PR3A 4LTNA 1DG3A 1N2SA 3LHFA 3B9PA 4L57A 3BB3A 2FX3A 3EHEA 1G5FA 2B61A 2GYVA 1IZ7A 2R8EA 3B8HA 3JZMA 1TECE 2ZWVA 5B7PA 3ZD9A 1V11A 4YRRA 2YBEA 3RBVA 3NHZA 1D0SA 2F90A 3GAMA 2LUOA 3ZWBA 2PUDA 3CF2A 4FUTA 1S2NA 1ZX1A 1P2VA 2H4FA 2XUAA 3DGFC 4EGJA 5HK8A 1L4FA 5KYKA 4H2DA 3STXA 4PPGA 2NXWA 4XCXA 3ETEA 3FPGA 1K0UA 2JLQA 4ZCTA 5B1EA 3L7NA 3IVXA 5BNFA 4G24A 3SQWA 4QDKA 2RI6A 4EFMA 4B47A 1QNFA 1GKLA 1KWGA 4X85A 5C4GB 3QW4B 3MRTA 3PB3A 4MP3A 4P3XA 3I1IA 3U17A 1SM4A 2K7FA 3BAFA 4C78A 3QFCA 5A02A 2AW3A 2DFPA 3RS4A 4E3ZA 4AY6A 1RI2A 3PTAA 2OC4A 4ZYUA 3BGIA 4OQYA 5EIEA 3FWYA 4M76B 4UNSA 1W581 2NADA 1K98A 1UC8A 2D3WA 2I22A 3D3WB 3NM6B 1RZRD 2BGGA 5AVTA 1QBKC 2LR0A 2Z0MA 3NCHA 4BJ3A 1UP6A 3CV3A 2ID4A 3PJRA 4A03A 2JIOA 2W6OA 4HDSB 3OEEA 2XPCA 2VAVA 2R8BA 2BE7A 5K2OA 3NWBA 4QJ3A 2IBMA 4PYIA 5K0ZA 3UGKA 1B6RA 1DUIA 4HQLA 1EKXA 5G0WA 3U48A 5JYCA 1V5WA 1QRUA 1CUGA 1WZ2A 4PR3A 3AW9A 4B48A 3OQJA 2VUIB 4CMIA 1L3IA 3OIWA 2OVBA 4MQFB 4XQ9A 4CF5A 2XDYA 2IFTA 3E1GA 2HLNA 3VH3A 1IPHA 5JO9A 3I83A 3WKBA 5CFRA 5CDGA 1PI3A 3I8OA 3DLPX 3B52X 5BOSB 5IYZB 3QFTA 3UAYA 5CEFA 3EDCA 3VU8A 2J6IA 4YROA 1UXIA 2R6GA 3R3YA 3HP4A 1U5BB 4R8SA 1IK6A 3C98A 4HFRA 4UNIA 5DI9A 4AY3A 4GC9A 2LTAA 3OM9A 3T41A 4WBNF 5IF3A 1FTNA 3O03A 4J0EA 2BGNA 4RJ2A 5HMLA 4BZQA 3DCIA 5I7OA 3RYCA 1SHJA 4ACBA 1C8VB 2GPTA 4BATA 5EHXA 1I7QB 4S0ZA 1ENOA 5M34A 4OK3A 5DHUA 1K7FB 5ALMA 3RUAA 4ARSA 4C76A 1N1GA 3FOFC 4LEIA 1JR6A 3IV7A 1FNBA 1NA5A 1P8JA 4FD3A 3C87A 4MYCA 2WRZA 4TTTS 4A2PA 3GGPA 4C3ZA 2H2WA 1JYSA 2IYAA 3VDRA 3ANNA 3EF1A 4FLEA 1OWPA 1MHPA 2J4DA 1NN3A 2YOFA 3BWVA 1L2TA 1PEDA 2PO7A 3FB1A 3Q7EA 4OUKX 2C0CA 3HYRA 2PXXA 4A0HA 3K71B 3AG6A 1W59A 4GMGA 4GMXA 3DV9A 1JLRA 1VKRA 1WNTA 1BDMA 2DBZA 5T6MA 5JO0A 1ZOSA 1WX1A 1YTUA 2XTMA 1EH5A 3RFFA 1UEXC 4KK3A 5AHKA 1NW7A 2QRKA 2WWXA 4RJIA 2VYFA 5E6RA 3W06A 1E61A 3KLPX 4UU7A 2JDID 2X0NA 3ABQB 3O2JA 3R5FA 4QGFA 1GAEO 5MGBA 2NP6A 1FSSA 4QXMA 3QKUA 3SQLA 2WUVA 4GYWA 1XRNA 2NXCA 4NG4A 3TEJA 4G84A 1KI7A 1UWKA 1ZM7A 1XP5A 4YQEA 3ZW9A 4DREA 4EW3A 4LXGA 2C4VA 3LK7A 1ZRMA 4YFVA 4LWQA 4ACAA 5HOQA 4N39A 1WDKA 1Z5OA 5AKHA 1KYIA 3P9ZA 2C2OA 4MJ7A 2C9ZA 5JFOA 1TYAE 2X3FA 5FH9A 2QQ0A 5F7XA 4V24A 3ROKA 4HXFB 5DTMA 1FDTA 3OT1A 1YAHA 1CJTC 1R4MB 3H75A 1CQWA 1U2QA 1ZMRA 4MGIR 2CLSA 1YK1A 1XHFA 2Z08A 5EWLA 1JRLA 1SZCA 3KQQA 4R0MA 2RE8A 1U1EA 2AXEA 4RC9A 4YDSA 2O57A 1ECCA 2NUAA 4JKIA 4Y67A 4NDAA 3LV8A 1M73E 1OU0A 1ZGJA 3ETGA 2AOXA 4JXJA 5JTTA 1ZK0A 2GFQA 2O6LA 2XT0A 2O3RA 3SHWA 2CLLB 2GN9A 2R1ZA 3MRXA 4LWOA 4N7JA 3ROMA 4CFSA 1R6AA 2IP4A 4IHKA 4QKQA 1X7HA 1VSTA 3UXEA 2FR1A 2QHXA 1WHSA 4L02A 1GTMA 3GEPA 4HFNA 1G0NA 4ZCQA 3F8TA 5EPOA 3C4QA 1MC8A 3P26A 3QMWA 4UTRA 2ZUSA 5EP1A 3FCAA 2AUNA 4B7CA 3HR4A 5A9SA 3RWMB 1Y4ZA 3S5UA 2D13A 3CFYA 2SBTA 3U39A 2OM6A 1JFSA 1O5OA 4DXAA 2WNHA 4IKOA 3RC3A 2QZPA 1M8PA 1RC0A 2OOKA 1IN6A 5EIFA 3GLSA 1D2RA 2R1UA 3DW1X 2V1XA 4LHSA 4Q39A 5G41A 3RUEA 2XLBA 3EZLA 4RZIA 3UUEA 1ACJA 1Z4LA 1XZKA 4GKBA 1HE8B 4HDQB 4OA8A 1HQCA 5HBGA 4LQCA 4HLQB 3FLBA 3S27A 4RETA 4TRJA 1O87A 4YRLA 4KQWA 1XD2A 3GFGA 5JTUA 2WIBA 3ZH9B 4GEGA 4U8HA 4CFYA 3HHPA 4PSAA 3OZEA 5L9AA 2PLFA 5JS6A 1EFHA 4XI9A 3PKZA 2MSEB 4F3TA 3K8OE 2GK3A 5EUBA 1E59A 4PCLA 4KQGA 1FNNA 5BYKA 3A9CA 5CIYA 1KO5A 4Z4GA 1XMIA 4NARA 3UT0A 2C88A 3WLOA 4UAUA 2CHVA 1FW8A 1P39A 2PSHA 4L1KA 3KK0A 5EQDA 3GRVA 3OU6A 5DLDA 3AGPA 3BHMA 3GYBA 4AVYA 3K35A 4LI3X 3QU7A 3LCCA 2O07A 4JT9A 1YOBA 1Z26A 4MKGA 1U8CB 3WRYA 3JVVA 4MYHA 4X20B 4B4UA 4CLRB 5C4MA 2C2BA 4QNRA 3A0RB 2NO4A 5FHRA 2O1EA 3HBLA 3MAJA 4OP1A 4Q21A 5EIAA 2JLUA 4DV2B 1EUCA 4DA8A 3OLWA 5J4VA 1TVMA 1SQFA 4OPMA 3FYCA 4RMHA 4K81B 4A2QA 1JXAA 4C7JA 2HEIA 2PZLA 5IPFA 3CSDA 4V2UA 1RKBA 1KP3A 2I3GA 4H4CA 4JYAB 4ALMA 4F3KA 3UA3A 4IHJB 3O26A 2C3UA 4PFSA 1UBRS 1PNVA 1XALA 5T6BA 4TLDA 4FQ7A 4Y30A 1YFKA 1RWNA 1FMTA 2J3QA 2Q99A 4NENA 5I8ZA 3UW1A 5JSYA 4B0OA 1D4OA 4MA4A 1G6Q1 3IAHA 3ASYA 2IOFK 3F6BX 1BOFA 1NI3A 4HLNA 2BPOA 4PHCA 3OX3A 1AS2A 1EBBA 1I4WA 1UK7A 2VJLA 3KZXA 1KEWA 1AB5A 4RHTA 4JS0A 1KORA 5JG7A 4IKPA 1Z39A 1JJ7A 4KW7A 1FUIA 2R8RA 4G0MA 3RK1A 2PGNA 5BT8A 5DGDA 4D9JA 5LWHA 5TS2A 5E4JA 2B21A 3MCUA 2GRUA 4RVHA 4UAVA 5BSWA 3MCAA 4LJYA 3MS4A 5ADWA 4WT7A 4HDNA 4G5SA 4UM9D 1XBTA 3GA5A 1G8JA 1YO6A 3GB9A 3QG1A 4DA9A 3K4QA 1QZTA 2H6EA 2OPBA 2HK6A 2VRNA 2G9NA 1XV5A 2D1RA 4DFDA 1H2HA 1UKEA 1YOVB 2FPPB 5AYVA 5A2QA 1U65A 1XMSA 2QYTA 1XMQB 4NYJQ 4DQDA 4GXQA 1R4NA 4RJKA 1YZ3A 4XDGA 3VR5H 1R1DA 4DSOA 1ITZA 3ND9A 1CTQA 1WW3A 3MGBA 3NEAA 3NWPA 2DWOA 4MUXA 3MRVA 2E4YA 1BW9A 3V97A 1J06A 2XE7A 3KL2A 5JWRA 3WIOA 4R7TA 5ELMA 2XXAB 5JJLA 2HSEA 1VE3A 2R87A 4R1MA 2IY9A 4YJ3B 3O9ZA 1E20A 1JVBA 3QGMA 3VYVA 5JZVA 3K70B 3IULA 2QMZA 4L5CA 2IUUA 3Q11A 1BD4A 1T4BA 4P7JA 1T1RA 2E6KA 3H5VA 5BSVA 1YE5A 2VF2A 1QG2A 3VH2A 5IXJA 3DZGA 5FUBA 1ZNQO 3I6BA 1XSEA 2LIVA 4F96A 3IBGA 2VCHA 1FDVA 1CF2O 1U99A 3AXSA 1I5EA 3OAAA 3I9FA 3I42A 4V0SA 3FI9A 2VBGA 4Q7LA 1OROA 2PUBA 3A14A 1JQDA 4RWZA 3KYDA 1H6AA 2WSYB 4FFRA 2WC1A 2GTHA 5L7WA 1MAAA 2DQKA 5E1DA 4C22A 4MV3A 3NIFB 5L3ZA 1J2TA 1MP0A 2R7NA 3VU1A 1GD1O 1SXJD 1DBIA 3Q7SA 1I0LA 1TX4B 2B2CA 5KSYA 3I8XA 1WP9A 2BTEA 4NCJA 2BMFA 4IX9A 5ENVA 3EGWA 3EIOA 4ZT2A 2YV5A 1OPXA 3FYUC 3F47A 4X1YB 3VU3A 1CB7A 1CX9B 1Q12A 1U28C 3HCEA 3HM9A 5KSWB 1IQRA 2A4MA 1YQWA 3KTFA 3WSVA 4PGMA 1ZINA 2RGXA 2VPYA 1ISGA 1HMPA 2RHBA 2HMAA 4TT3A 2HUPA 3SG0A 2H54A 3BREA 4YT8A 5AK4A 3ZCXA 2EBHX 3WLSA 2JATA 5H7XA 4REMA 2O8EB 1Y89A 2YCLA 4RXTA 2CXUA 1T6NA 3DFUA 5GV8A 3TRDA 3WGJA 3ZXIA 3TZ6A 1U2GC 4LVOA 2QAGA 1QH0A 4M9UA 2JJMA 1CJBA 1ZK1A 1Z4IA 2I2DA 4ISBA 2G9VA 4TSKA 4FS8A 2RBKA 4Z5XA 3NGMA 1O89A 3FCYA 2VQ3A 4X97A 2GCEA 4RVOA 4EY8A 1XEWY 1Z8NA 4C1NA 4ZCPA 5KS2A 5CVCA 2B78A 1P7ZA 1HFKA 2V59A 1M1YA 4Q05A 1O9HA 2GNAA 4K2AA 5F1PA 5UKDA 4RZQA 4R0VA 4MW9A 2C42A 1TM2A 3LXRA 3N5KA 4OKIA 4B79A 2FSPA 5DHRA 5HGXA 5DBOA 1SH7A 5DNWA 4CDRA 4QYMA 1I4DD 2GETA 2V9CA 3GROA 1DBVO 4NYJR 3N2KB 5CU7A 4HUTA 1Z74A 1JNYA 1OX4A 2IS6A 4K9SA 2B1IA 1A82A 1MU0A 1QFYA 5EC8A 8ADHA 3FTQA 1Z5WA 5F2EA 2QMQA 1YI1A 4XFJA 3M6FA 4WXRA 1AJEA 1FPMA 3V34A 1JLSA 3FNQA 4I8XA 1N2XA 3W8FA 4DJ5X 4DSNA 3D31A 2ECPA 4HZUA 4PZDA 1SXIA 1MX5A 2G9QA 1DRKA 2XWPA 2CVZA 4KR3A 2RAUA 3WMEA 4JMLA 2OCBA 2X9NA 4CL3A 1BH6A 4CKZA 2BJHA 2JVIA 3WYAA 1PBNA 3NBXX 3NHFA 1H22A 1UT6A 1I2MA 1OTXA 2AEFA 5EYPB 4F8EA 3SN6A 4ODIA 4K9QA 2IIPA 3EISA 3RSZA 4BQRA 1KPIA 3B1FA 2ZRDA 1HKHA 1D7OA 1IB6A 1FRNA 1SD5A 1JLKA 1UJNA 2DUUA 4O5OA 5AM0A 4PRYA 2C20A 5C37A 2B5WA 3QVUA 4P2GA 1IG0A 5DTQA 4FOOA 1SXPA 4YP9A 2HDHA 4M9CA 3K8ZA 2WT4A 3KLNA 3WBFA 4J0FA 4BVAA 1JG4A 5CDTA 4IY1A 1FTGA 1JDTA 2ZXEA 3VHXA 3OBIA 1Z2OX 1GGHA 1T2FA 2AXQA 4OY3A 1RWBA 1DB3A 3W8RA 4KAJA 3K6JA 2X0RA 1N6RA 4PLVA 2EZ8A 5I9MA 1MX3A 4BVGA 4YAOA 3UT6A 2E21A 3ZNQA 1G3IA 5JZSA 2E82A 3DH0A 5A3VA 3RF7A 1NJ6A 1E6MA 5E4TA 4L5AA 3CG0A 1FTQA 3LS2A 4R2XA 4NESA 1C1DA 2REXB 3B9QA 1QRSA 4U7TB 3U7QA 1G291 2QPTA 1AZWA 2AL7A 3GDOA 2V4MA 3JZAA 3BORA 3QPVA 2AN1A 4MI3A 3F78A 3BGOS 4DEXA 4OHCA 4ZI3A 1ZI9A 1UBHS 4OH1A 2C96A 1E5QA 3KZ1E 4NBWA 4UPEA 2ZXFA 2IYPA 5LP6B 3CJQA 4I6JA 5AOAA 4NPAA 4FMDB 2CKDA 2ECOA 5KNDH 2YHIB 4MYDA 2PMFA 3I2IA 4WZZA 5JY1A 4DM3A 4ZZIA 4JOQA 2BP7B 2JIRA 5H3LA 2ZUUA 4RNDB 1U3TA 2PRYA 3DF7A 2OR3A 4XOUA 5B3JA 1E5DA 3UXYA 1KL7A 4INZA 3HJFA 1K92A 3D3EA 1G8MA 1NXOA 3F3KA 2WAMA 3MZ0A 1WXXA 4E03A 2IS1A 3B1KA 4OSEA 1VPVA 2AZDA 2VYND 2VZEA 1KDZA 4YJHA 3K32A 1NHWA 4L5IA 4B84A 4RKFA 4YJ2A 4YDRA 3QPWA 2J1LA 1KU0A 2NX2A 4R3NA 3LWZA 5IULC 5LOVF 2F7SA 2RDMA 3DEFA 3M9LA 4GZ6A 1AIPA 4B71A 4HOYA 4LK3A 1E0AA 1KFJB 2Z2ZA 3SVTA 1Y6ZA 1C7FA 4NV1A 4PYMA 4II7A 2QTZA 4C07A 4TTRA 1GT91 4RHUA 1KH3A 5FTLA 2WF5A 2JGDA 2I7TA 2WIJA 3MERA 1L4UA 2C9OA 1A1SA 1E89A 2ZYRA 3MXOA 4OQXA 4RSHA 3S55A 3PDIB 3H2BA 2HJRA 5JPDA 3HUFA 4D9FA 3E3AA 1RPNA 2ZATA 3AUFA 5JS1A 4ND4A 4GX0A 1Z0FA 4Q4JB 4MTLA 3UT5B 1UDBA 2PWBA 3KTAA 4A36A 3FY4A 3UC5A 5C53B 4RV5A 1KTVA 4FHCA 1KH2A 1CVRA 4DCPA 2PZJA 5JNUA 4FE3A 3OG9A 4U2DA 3SF8A 1E3SA 3EQ7A 1IY9A 1HLGA 3SBOA 1KAMA 2OQIA 4QD3A 1RI1A 2Q2OA 3HA5A 4QDZA 4BKRA 4EG4A 1QQ7A 2YCBA 2EF0A 1QONA 2ZJ0A 3L01A 3HYCA 2XCRB 2VSOA 3EXG2 3PLNA 5IDYA 1EE9A 4Z54A 1H6CA 1D2AA 2NU6B 1P6QA 3CW2A 2QROA 3NEYA 4LTMA 3BGVA 4BUJA 2CVPA 3H1FA 3L02A 1L4EA 2REQA 1WMSA 3SIRA 4GP9A 5JD4A 4N0EA 4WEOA 1K9VF 3KU1A 3UPTA 4ALNA 2FY8A 4H6WA 1PLJA 2PSFA 5JAUA 5HK9A 1PW7A 3VU0A 2ZYTX 1PWEA 2PY6A 1JG6A 2EHJA 3AR9A 1LPPA 1KHTA 2QU8A 2XMRA 4I66A 4O0LA 4B2PA 1RIIA 2DHRA 3HCPA 4B81A 4D82A 3HJUA 1RXCA 2EWWA 3RIYA 2BMWA 2NQ2C 4RF4A 5KKCA 1VHJA 3NHSA 2GHTA 2BMJA 2EFCB 1PGQA 5G0UA 2FDRA 4W4TA 2W7TA 4PZAA 4WESA 1PVOA 3B70A 1VPLA 3LF2A 1IVNA 2JL1A 1TZJA 3BBPA 4WVFA 3VPDA 2IEBA 3GEBA 3E9NA 4X8LA 4I5EA 4MPPA 3FNEA 3PC2A 1FF9A 4IFEA 4QAQA 4XLZA 4PBRA 3VR4D 4Q01A 5JBIA 4N40A 3CEPB 2G1KA 5ESRA 5LDGA 4J90A 2EC5A 3PUHA 3A11A 4BKPA 3GOHA 1I3MA 1PGPA 4ZOLB 4UQPA 4ND8A 4OBXA 4YK7A 5FOTA 1WPXA 2IWRA 3QJYA 2XZTA 2PRIA 3BMOB 3FWPA 3FNBA 3E2PA 1FSPA 3OJFA 4TN5A 2PH7A 4BMVA 1J07A 2R11A 3C15C 3COZA 3M0EA 4KBYA 1W9MA 3HCRA 3SF8B 3DE3X 1DJQA 1VHWA 1RWOA 4AMBA 5C9ZA 3E9RA 3R0IA 5IVPA 3ELUA 3FWZA 3AR8A 3IEKA 3OPQA 2FEPA 1VHLA 5AICA 2VPXA 3ZWDA 3C39A 3PR2B 4J0QA 1C50A 4UOQA 4B3IA 1BDJA 1NOJA 5AI8A 1IWOA 1I32A 4O4JA 2HA5A 1E2GA 1OJLA 1NVXQ 4RQTA 1XVLA 4P84A 1M5UA 1RRFA 1ZFNA 4LF6B 1L4MA 3GLIB 2GXSA 3KPUA 2ZRFA 2I2CA 3HH8A 1XA3A 4ZAGA 5A7GA 4EZBA 2DLCX 5DNUA 3ZH2A 3W9YA 5FPPA 4EAAA 2MYPA 2WJYA 2YICA 4HG2A 4KOEC 2M2IA 2GKOA 1T8PA 3DT9A 1XDBA 3V80A 4KVZA 5B36A 2I6XA 2HF2A 3F8WA 2ZBQA 3GBVA 2BEUB 3FZNA 4YALA 3USES 1U2SA 2JIPA 2BHNA 1WVMA 4LHXA 4DUYB 1JEJA 2OMEA 3MUNA 1C8KA 4JFAA 2KSQA 4PC7A 4NOMA 3WRYC 4AJ9A 4BLPA 4BNTA 4CGZA 3LCUA 1K89A 2IX3A 1J09A 1JA0A 1OLOA 1VRCA 3KR2A 3OE1A 5E9QA 3UK2A 3ZXXA 3IO3A 1BCSA 4OLFA 3UWKA 1U8FO 3ZTTA 5A3JA 3B1XA 4FOTA 3S2IA 2NOAA 3HPQA 1YOVA 3HADA 3CWCA 1QB8A 5H3HA 1N78A 3EXFA 1XZFA 1PDWA 3I2KA 2Z3VA 2V3WA 1ZGBA 5L3RA 3K3PA 1K08A 5JZBA 1ZXLA 3EZGA 5EZYF 2ZIZA 5HKLA 4EMBA 2RHHA 2H9YA 2J09A 2CW5A 3UAGA 2EU8A 1ILWA 1O96B 1KEEA 4IWNA 1I7DA 3IP3A 3KYIB 3AIOA 4KRFA 4D8YA 2FUNB 3F4LA 1HSZA 4EGAA 1TVEA 1H8HD 2P6PA 3A1FA 4BFCA 2FJPA 5SZJA 2RG1A 2PVSA 3IPAA 3K1AB 3C8DA 3D2LA 1G64A 1RPAA 3R3VA 1XJCA 1XN1A 2OAQ1 3JQDA 4LYAA 2RGBA 2ZJAA 3BXOA 2ZYHA 2PLNA 4NSNA 2CB0A 2G5PA 3TLGB 4Q7QA 4QZVA 4BNZA 3OKPA 2A5LA 3GRPA 1H65A 4QBKA 4R01A 4DNOA 3JTEA 4AURA 1AQJA 1JHQA 3AHCA 3H9JA 4M9QA 2WAXA 3CLHA 3PXCX 4RX1A 2NU7B 4MUFA 4BNJA 4QNMA 1OASA 4NQRA 3BRCA 2NT4A 3UJ7A 1RHMA 2QN8A 2BZGA 4N12A 4L3WA 4WA7A 3GG9A 1CB0A 1QYWA 3TIFA 1E1CA 3ZU5A 1P2GA 1BE8A 3MWDA 2C5AA 1SGWA 1GTSA 5EJ7A 2ZUEA 5B3AA 1F8YA 1QO0A 4EB8A 4MW6A 2X58A 4AZWA 4I2NA 3ICVA 1JVNA 3RSFA 4RTKA 2AMFA 4G65A 3JQEA 4EX7A 1RW4A 2PGAA 3CPSA 4FX5A 1ECFA 1XNHA 1C1XB 3G02A 4Z9XA 1ND6A 3FH0A 2XQIA 3V6LA 1WPRA 3EEBA 5DYGA 4JOSA 2UZIR 1F2TA 3LC1O 3NCTA 2FB9A 3M6VA 2GD2A 4QYXA 1WOYA 4XB6B 1YRHA 2P3LA 5DM0A 1KZYC 1YK0A 2WWHA 3R0ZA 4RCZA 1U11A 3UJNA 3ESDA 3RHZA 2G7ZA 5AVWA 1W48A 2B4RO 5K09A 3NBZC 1YCDA 1D8TA 2FZKA 3KEGA 3PA8A 4K9RA 2ID8A 2QB5A 4JLDA 3W5BA 3VSCA 4BFSA 5DT9A 2AGVA 2EDCA 2P5UA 4Z1OA 3HJRA 1SFRA 2GAOA 3GEGA 3P9CA 4HLUC 3GD7A 1RCTE 4RA9A 2WU0A 3M5WA 2MCFA 2HWWA 1SNYA 3NH6A 3FDXA 4EB6B 1V8BA 3OFNA 1EFPA 5C8XA 2QX6A 1ZGHA 5EJGA 2BFNA 1J0CA 3R5HA 3ND5A 1GKUB 3NATA 4ZI2A 4OGFA 4C3VA 2CL6X 1EHCA 1DIRA 1TVKA 1W1UA 4TRNA 2D2VA 5C80A 2NSHA 5DGTA 2QR5A 3DZFA 1MQ8B 3VNAA 1Z0DA 1VXRA 4EKDA 2G36A 2YVKA 1OXTA 1VL5A 1ORHA 2CXRA 3EAGA 4F9EA 1U28A 3T0GA 5CDFA 3EVEA 3ICWA 3EXHB 4IIBA 5KSPA 1T3ZA 4S24A 1QP7A 1BFKA 4JD5A 4D99A 1USWA 3QPUA 4YMWA 1O94A 1PZFA 1JBKA 1Y63A 2HSDA 2O0KA 4YECA 3EFOB 5EKXA 1PR3A 1JU3A 3N5CA 4HLDA 4M8SA 5IRCD 1HDXA 3E4CA 3RHSA 4NABA 3R23A 3K8YA 1EJ0A 3EAQA 1C3VA 5CH8A 3B1YA 2Y6VA 3VZRA 2DPMA 4ML3A 4XA8A 1IHDA 4S0XA 5K99A 3D0OA 1K2VN 2ZJ2A 1IM8A 1NN5A 4AUEA 1D6MA 3BJEA 2JZOA 5JISA 4RYDA 3TVYA 2NO7A 4K0RA 1HZJA 5K1ZA 4CM6A 4DRYA 2P62A 2H3HA 1F4VA 3LA8A 3JCZA 4KXXA 4M60A 4UHDA 1Y1TA 5LA6F 3TSOA 3HXLA 3BIOA 4D8UA 1DZIA 5HIAA 4DPLA 1K3TA 4Y2SA 3HB1A 4P4GA 3NWOA 5ESWA 3L1JA 1QCZA 2IE8A 4B2LA 5CBKA 1QQTA 4JENA 4P5PA 4MB6A 4UUNA 4D43A 1NN1A 1UMKA 3UFXB 2VDLB 3FTDA 1CE8B 2L17A 4GPZA 4IH9A 1JJBA 2ZIEA 2JH3A 3T5BA 3O31A 3GWGA 1X6VA 4HNUA 1W4BA 2ERXA 4ZU3A 4LJAA 2BI7A 1I3OA 4J7UA 3IEUA 4OHWA 2O2DA 1JDZA 1HYEA 2VSYA 3GIDA 1UMBB 4Y6OA 1U9JA 2QVCA 3CF0A 4HTFA 3O91A 1OLXA 2CDBA 2P6UA 4U2FA 4DYDA 2RCYA 3D6JA 1MHTA 3VHQA 3V3TA 2FPGA 4OBEA 3GAAA 4RHYA 3AUKA 5KB3A 3K0BA 3SLGA 5IT0A 2ZJ8A 4RDCA 4LYGA 3UIEA 4E2FA 1XZPA 2MWMA 1MXFA 1NATA 1OQAA 2J67A 4O2BA 1KVSA 1M34B 4NV3A 5JYDA 4LYDA 2CUNA 3EVGA 3FF1A 4ZOBA 2JF0A 3WI7A 4CPDA 1TAHA 2IODA 3R5SA 3TLEA 3HSKA 1MVNA 3FCOA 1KEUA 4NULA 1QAMA 1WW2A 4TYMA 3UANA 2HZBA 4RK4A 4C7MA 1CRPA 1SVWA 4EBBA 2OY0A 2QRQA 1UBOS 2AHRA 4JGIA 4EFKA 4ZT4A 3JYOA 1TJ5A 1KMCA 4JCOA 4NYIR 3QUAA 4CGYA 4DMMA 1XVVA 3E70C 3LBIA 4DARA 5KJCA 1CJMA 2DSNA 5IHXA 3EMDA 1CR6A 3IPCA 4PFKA 4XPZA 2BCJQ 3SU8A 5BR7A 5HUHA 2CLOB 5EXTA 3SCZA 2V6BA 2UVDA 3NYWA 1XPJA 2C83A 2SKEA 5AK0A 3SDSA 3RC2A 2V6MA 3V42A 4JDUA 1ZU5A 3NRCA 5AM4A 5HM8A 4F5YA 3RCBA 2ZJ4A 1F5SA 3NC4A 1RU3A 3ANTA 4WNAA 3TXAA 5JBNA 3I8SA 1EXNA 3M4NA 2FPKA 4I9FA 4M98A 3VM6A 1DWPA 4AN0A 1CY0A 2HDWA 2GBIA 3KE8A 1FFAA 4MVXA 2DLDA 2EP8A 1SUCA 2QUIA 3PFHA 3P9QA 3SLRA 4CMKA 2QT0A 3NV7A 3QBVA 3WO0A 4DCJA 3THOA 3QVSA 2GZDA 1KK3A 4D74A 5BUZA 5IS2A 1T3HA 3IE2A 4HDOB 1OFHA 1CRQA 2PO5A 4CM4B 1HYGA 1I6LA 2NTNA 1NM5C 2X19A 3N0TA 4QDTA 4A8JA 2H4HA 2WT9A 1R18A 3ZW8A 4B8WA 1C80A 4HGQA 3Q0IA 2AQ8A 1XDUA 3GLGE 1UZMA 2IXFA 1IMOA 4QL3A 5AI4A 4CLRA 2WUDA 5FA8A 2XT6A 4FGLA 5HYVA 3FVWA 3PDCA 3KVVA 1U80A 3PNLA 4YCCA 3L8EA 2WHPB 3FDZB 2WF6A 2ZLBA 1IRXA 3FZGA 4HCJA 4HTFB 5EE5B 3V4PB 1O97D 1QYVA 3I32A 2WA1A 4EUHA 5CA1F 5CUQA 4BQPA 1XNQB 1FU8A 3EQ2A 1WO8A 3TAUA 2KLBA 1P4SA 3A8TA 5C7LO 1P19A 4LKOA 1PWZA 1P3Y1 2EW2A 3SMVA 2QJRA 4JBWA 2X8AA 2PUTA 3SQOA 3WMFA 2I9KA 4ZVUA 3ND6A 5E6UB 4WN3A 2I1LA 3EIXA 3GGJA 1VE1A 2Y1DA 4KUGA 5LNK6 1X7YB 3T4XA 3A2MA 4C7VA 3RRMA 3OF3A 3MHTA 3WGGA 3K0KA 2H17A 3C3BA 1V6SA 1VBMA 2Q8QA 3FMFA 3CX4A 3OHPA 4FNMA 5K0LA 3TG2A 4KREA 3GT3A 4JBGA 4AYWA 3UATA 2JAXA 1P72A 2Z4SA 2VPTA 2NSDA 1Z63A 2NXNA 3TRJA 2JFOA 1JFFB 1M6WA 4OB6A 3UCEA 4S05A 4FWBA 2EJVA 2J08A 4ROSA 1HORA 5LQCA 3VGPA 2N47A 2QL5A 3AVVA 1C4KA 2ZSFA 2O3SA 1EGQA 4HK4A 4L2IB 1UJCA 4WXHA 4YC7A 3VO9A 4AUKA 4MRVA 2AFRA 4CTMA 3H2HA 3VXKA 4TV8A 3TOZA 1DJMA 1HDGO 1DVRA 4JJ8A 2C31A 4TVBA 3DXZA 4O4HA 5KQGA 3O90A 1RXSA 5EUCA 1TYCA 3TQTA 2FR8C 1P5FA 3BSSA 3GPBA 1Z4NA 4KWEA 4OHYA 1FFCA 3A1UA 2H4XA 3B7PA 2QTRA 3DZBA 2Q6OA 2ZBDA 5ALIA 2HT1A 1PD1A 4S1OA 7REQA 2WKRA 1T1EA 2OSBA 5B3LA 3LDAA 3ESBA 1T9BA 3C85A 3P27A 3H5NA 3P9SA 3ZE8A 3P9RA 1G66A 1G98A 4AROA 2IUTA 3RFVA 1S0UA 5C3MA 4D41A 721PA 2NO9A 4H18A 3P0RA 3UMMA 2QOEA 3BDAA 3CX3A 3LDUA 4DIBA 5IC5A 2QYOA 2OCPA 1EWTA 1ZBQA 3OEWA 5DDIP 5FI3A 5A5VA 4FT4A 2B4AA 4HZIA 4JUDX 4M9SA 4JOBA 4OLHA 5JY6A 4AQ7A 1OXMA 3Q2OA 1SQ0A 4IIXA 5KDOA 1OZHA 4ZIRA 2C2MA 3D1JA 3I5MA 3H8WA 4Q9AA 3V32A 4MYUA 1G5QA 4UJ5A 1T0UA 3SJZA 4A73A 5BSGA 1GNSA 5HQTA 4GDMA 2O2YA 1P73A 4LDJA 3SFZA 2ZBUA 4FYXA 2HY7A 2OXFA 1Y9JA 3VX4A 5AW7A 1SC6A 2QAJA 3QF4B 2J7PA 4LNUB 4MS1B 3DKKA 1W96A 1UDAA 3HZZA 4HWGA 4CEJB 4ER7A 3GVPA 3FOCA 4NZPA 1J9ZA 1P9NA 3E1SA 4QXRA 4UOZA 4TM7A 1LBSA 4N0QA 4C0JA 4CLDA 4EB0A 4DR4B 3VR0A 3A2KA 2I6UA 2F48A 4TXJA 1JHDA 1G19A 4RF2A 1QMGA 2JHAA 3SE7A 3TCKA 5MN5A 4HV4A 3L46A 3DL4A 4M22A 1XTVA 3HDYA 4B73A 2AG1A 2OFOA 4BP9A 3Q8WA 1E1NA 2JHFA 4DMLA 2JGDB 2IYTA 3K7EA 4HT3B 3BT7A 4BE9A 2FPXA 1JG1A 5TDHA 1JEQA 4L8GA 1H05A 1AZTA 5HQ3B 2F43B 3BMNA 1QMPA 2FLVA 3LOQA 3ZHZA 3FA2A 4RGVA 4XDYA 1QH8B 4JR1A 1W2WB 1ML3A 2L18A 3W5HA 1A3CA 4P38A 5C31A 2C4NA 3RU9A 5CB6A 3H1PA 5A6VA 1W0JA 2YXDA 4IGEA 4L07A 1BEEA 4U63A 4ZPJA 4L85A 4F4FA 1RWQA 3AXTA 2WVGA 2CUKA 2A9VA 2ZPAA 4ITVA 1CJVC 5KQLA 3KSRA 3GNQA 2I55A 2WU3A 3C4VA 1T8YA 3L7LA 1OZFA 3AY3A 3SS7X 5KNBA 5AVQA 4EA8A 4L5BA 4MKXA 2DHCA 3SD7A 1W88B 2W8BA 3ES9A 3LPCA 1RYMA 4X8HA 4FK8A 4ZALA 3WGLA 4C1BA 5BV8A 3OM1A 1KZHA 2PDAA 1XVTA 4ZXPA 3D6FA 3MS2A 3EIQA 2B94A 5DXFA 2H1WA 1BJRE 2AE1A 3RYTC 5BW4A 1M2HA 4CKWB 3VO1A 1PF7E 3GLUA 2BTQA 5CVEA 1AM4D 4BXOB 4G2NA 3K73O 1ADBA 1G8KA 2C00A 1PT7A 5F51A 3ZI0A 4YGXB 2R1VA 3WJ2A 1FRZA 1N5DA 4YV7A 2W5UA 3A6LA 1B8UA 4YRFA 1D2HA 5I01A 3H9EO 1LVUA 1ZUWA 3F2VA 3LPMA 1BSVA 2VAMA 2KLHA 4QDXA 4TROA 1Z68A 4ZV9A 4MUJA 3W9SA 1Z7BA 1IU9A 3L1VA 1WG8A 3LUAA 1JG3A 4RZXA 5WRFA 2XMZA 4EYGA 5HW0A 1QH9A 3MWJA 3OU7A 5IBQA 3U9TA 1E2BA 1PR1A 3TEFA 4DMGA 1TM5E 3HN6A 1VE9A 4BAUA 4KCGA 3SZOA 3HB7A 2XB4A 2XRMA 4J3NA 4ARIA 2BFEA 4D0SA 1T9HA 9LDBA 3TGWA 3K0CC 4RANA 3ZYCA 3LLUA 5JWOA 1FP4A 3CLRC 4H0CA 1LVHA 2A0YA 3IDSA 1U3FA 4URYR 2HHJA 3QBDA 3QKIA 3G5MA 4W9RA 5DBHX 1FNSA 2Y68A 4O4JB 3RRJA 1QF9A 1Z82A 2P8JA 3UVEA 3IAM6 1H9AA 3VNBA 3IDQA 3NP7A 3SC4A 1SKUA 2GX6A 3N86A 1VM6A 1VCHA 2DTXA 4WFQA 2ZRKA 3ZIDA 4YX9A 3IB3A 1V7ZA 3FJOA 4GVXA 5CT8A 3GDHA 4OXIA 3WHKA 5ADUS 1IHUA 4M99A 2PANA 3IBCA 4MCIA 1OT3A 1E7MA 5GZ6A 3BD8A 3MTGA 4B4KA 2JFFA 3R9XB 1UEJA 1KIAA 1YUNA 2OAP1 1DU4A 1EDOA 1DBWA 1DMSA 2BCGY 2YIVX 2YTZA 3L18A 2HREA 3P4UA 3RTDA 2NUTB 1E0SA 1Z07A 3B5JA 4ARZB 4XPIB 1ORVA 3MSXA 4B6PA 2I6GA 2BR3A 4YUAA 1IHYA 1WV1A 4UNNA 3UB2A 4AQDA 4REQA 2AOUA 3WLRA 3QLEA 4P80A 1X1RA 4AS1A 4RPKA 4R5MA 4NYMQ 3I37X 3P9PA 2VEOA 4O4IA 4PIMA 1XU4A 2QGNA 1MC4A 2ZJ7A 4HY3A 4LAFA 4RMNA 1GKKA 4YYZA 3RTEA 3GHYA 1ECJA 1C3OA 1Z4PX 1U0GA 4PC3A 5HUJA 3UOWA 2XNKA 1Z0SA 1A9SA 3GJZA 3C3EA 1V5FA 3CGGA 3QV2A 1VCNA 2G8NA 4Z9YA 4RKYA 1CZKA 2NUPA 3C3DA 5COAA 3CVXA 1NR7A 4FFBB 3OE7A 3WGUA 3JQAB 3OPXA 2LZ0A 4QULA 5LYJB 1F4LA 4BLTA 4G81A 2KI5A 4FBMA 3RAEC 4RFVA 3JQ6A 4TOIA 5P8WA 4C0HA 3AYZB 1HT3A 3EG5A 2QRJA 5IFKA 2IEAA 4KQCA 5HR5A 1L7AA 1QWSA 3ZK7A 4C20A 1MC5A 1CIJA 3C7TA 2IDMA 2R85A 1T0IA 1M1XB 4DBLE 3GN2A 1U8XX 2WVJA 1O94C 4AB1A 1FYEA 1T9GS 3Q7PA 4ZHQF 3M9WA 2OD7A 1WZIA 3MTDA 4MRMA 5BRJA 3NVMB 1UM9B 4ZGBA 5D1HA 3G0CA 2OKCA 3HBNA 5BY2A 1U3CA 4QAJA 2O9JA 2CFIA 5JPIA 4Q1BA 2NU6A 3TTUA 3WJAA 3FYSA 1AUVA 5K4HA 2WQ6A 2ZM6B 4LBVA 1JIJA 3LP6A 3GOQA 4GFDA 1CT9A 3RLIA 2P1DA 5KAPA 3Q7RA 1NLZA 4W5OA 3QEMA 1YSCA 5L3SB 4M9XA 5B4TA 2VLBA 2ZETA 4IP0A 4DE5A 3S1SA 4JT8A 2HSZA 1OWMA 3IURA 4LS3A 1M0TA 4EB3A 2CVQA 3T99A 3ECCA 3P2OA 1KEPA 1Z08A 4L8WB 4DRZA 3WKAA 2CJWB 3QXHA 3JQRA 4C05A 4WNIA 1QX4A 4DANA 2J5KA 1NBEA 2J45A 5HCUA 4FC6A 5KNCD 4PC6A 3VPCA 4MVYA 4INOA 1IN8A 4JDPA 4QWWA 2OL4A 2IQ5A 2RHWA 1X8XA 3OF2A 2VK4A 2ZTHA 4YCDA 2EAUA