1PJHA

Structural studies on delta3-delta2-enoyl-coa isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
259
Chain Sequence
IRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords enoyl-CoA isomerase; Eci1p
publication title Structural studies on delta(3)-delta(2)-enoyl-CoA isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 101
structure length 259
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2003-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pjhA00
3Q0GA 2ZL3A 4LK5A 3HE2A 1HZDA 3TDCA 3QREA 2VSUE 1HNOA 2FBMA 4JYJA 1VRGA 2J5IB 2A81A 4WCZA 2PG8A 3MOYA 4F47A 2J5GA 2EJ5A 2A7KA 1NZYB 3HRXA 3IAVA 4G2RA 2PPYA 2Q34A 3R9TA 4QIIA 1X0UA 3P5MA 3BPPA 5DU8A 3KTGA 4MOUA 3H0QA 1N6DA 1OD2A 4ZDCA 1WDMA 4KPKA 3RSTA 1FC7A 1J7XA 3H0JA 4JOTA 1XNWA 2C8TA 5INIA 3BEZA 4NNQA 4U1AA 4K3WA 2A7SA 4HNKA 4KD6A 5JBWA 2GTRA 2VX2A 4FJWD 3QMJA 3QYRA 3TVUA 1WDLA 2NP9A 3QWDA 4ELSA 4RYFA 5G1SA 4NEKA 3HP0A 4RYFH 4JFCA 3Q0JA 3OMEA 4JSBA 3ISAA 5FUSA 3SLLA 5INFA 5E0SA 1Q52A 1SZOA 4RCNA 4EMPA 4FNBA 2Q35A 3NJBA 4WZ8B 5KJPA 4MI2A 4U19A 1SG4A 2VSUA 5IKLB 1K39A 1XX4A 3DJAA 5DL1A 5E0NX 3TLFA 3JU1A 1RJNA 1O8UA 1HNUA 3DORA 5DTWA 3TT6A 3G64A 1PJHA 1XO6A 4L6WA 3P2LA 3R9QA 5FIFA 3V5EA 2VSUC 3R9SA 3KQFA 2BZRA 4Z0MA 2VSUF 3T8BA 3FDUA 3GLMA 3QXIA 3GKBA 5C9GA 4JCTA 4B3IA 3QKAA 5KDRB 1EY3A 3QK8A 3HLN1 4ZDBA 3OC7A 2ZQQA 4JVTA 4YLHA 3LKEA 4IZDA 2CBYA 3TT7A 2ZL2A 2F9IA 1XNYA 2CE3A 4FN8A 4U0GH 4FZWA 3U9TB 3GF7A 3IBBA 2Q2XA 1TG6A 4I42A 3GMAA 2WTBA 5DKPA 1K32A 4IZCA 3PEAA 2IEXA 4ELXA 4QFEA 1DCIA 2DEOA 2VSSE 2HW5A 4U18A 3Q1TA 3KTHA 2D3TA 1TYFA 3P85A 2F9IB 4FN7A 3T8AA 4ASIA 1ON3A 1Q51A 3KTJA 3N6RB 3BF0A 4OLQA 1UYSA 1MJ3A 2F9YB 3HINA 4K2NA 1UIYA 3ZWBA 3H0UA 4EMLA 5DUCA 3T88A 1WZ8A 4MXIA 1YG6A 4DI1A 4U0HA 4I52A 3PGQA 5DUFA 3MT6A 2J5II 5JBXA 2W3PA 2F6IA 1EF9A 2UZFA 3FF6A 4ZDFA 3R6HA 2X24A 5C90A 2ZL4A 3WG5A 2PBPA 2ZQRA 4JCRA 5INGA 2QQ3A 5KDRA 4GHNA 3TZ3A 3SWXA 3NJDA 4HC8A 1FC6A 2ZL0A 3RRVA 4GM2A 1PIXA 3LAOA 3ZW9A 3M6MA 5G1QA 4OMRA 3VIVA 1RJMA 4QIJA 4WYOB 2DUBA 3QXZA 3K8XA 4JWVA 2J5SA 4OG1A 4Q1IA 4KNPA 1Y7OA 3TRRA 2J5GD 3H81A 4U0GA 1WDKA 4JYLA 4EMMA 3L3SA 3TVWA 4ZU2A 2VSSA 3MYBA 2F9YA 4B3HA 4FB8A 3ZWCA 3OT6A 4L8KA 3U9SB 3IB9A 4FZWC 3KTKA 5G1RA 1UYVA 3Q7HA 2VSSF 3U9RB 3TV5A 3ZW8A 4JJTA 4B3JA 3H0SA 2FW2A 4IZBA 1UYTA 1JXZA 1ON9A 3H02A 5DU4A 2X58A 4FNDA 3PE8A 3I47A 4ZDEA 3RSIA 1DUBA 1UYRA 1W2XA 4Q0GA 3T3WA 5DZKA 5DU6A 1N6FA 1OD4A 3PZKA 5DZKH 3V5IA 3M6NA 3STAA 3GF3A 2FZSA 4ELWA 3T89A 1XNVA 4KWBA 5MGBA 5CTCA 4JCQA 5DTPA 2VREA 1FCFA 1FC9A 1EF8A 5CTBA 2J5IA 2F6QA 4ZDDA 5E0SH 1N6EA 4K29A 3R0OA 3KTIA 3K50A 1YG8A 4I4ZA 3ZWAA 3ST9A 4JCSA 1NZYA 3MFMA
chains in the Genus database with same CATH superfamily
3Q0GA 2ZL3A 4LK5A 3HE2A 1HZDA 3TDCA 3QREA 2VSUE 1HNOA 2FBMA 4JYJA 1VRGA 2J5IB 2A81A 4WCZA 2PG8A 3MOYA 4F47A 2J5GA 2EJ5A 2A7KA 1NZYB 3HRXA 3IAVA 4G2RA 2PPYA 2Q34A 3R9TA 4QIIA 1X0UA 3P5MA 3BPPA 5DU8A 3KTGA 4MOUA 3H0QA 1N6DA 1OD2A 4ZDCA 1WDMA 4KPKA 3RSTA 1FC7A 1J7XA 3H0JA 4JOTA 1XNWA 2C8TA 5INIA 3BEZA 4NNQA 4U1AA 4K3WA 2A7SA 4HNKA 4KD6A 5JBWA 2GTRA 2VX2A 4FJWD 3QMJA 5HUQA 3QYRA 3TVUA 1WDLA 2NP9A 3QWDA 4ELSA 4RYFA 5G1SA 4NEKA 3HP0A 4RYFH 4JFCA 3Q0JA 3OMEA 4JSBA 3ISAA 5FUSA 3SLLA 5INFA 5E0SA 1Q52A 1SZOA 4RCNA 4EMPA 4FNBA 2Q35A 3NJBA 4WZ8B 5KJPA 4MI2A 4U19A 1SG4A 2VSUA 5IKLB 1K39A 1XX4A 3DJAA 5DL1A 5E0NX 3TLFA 3JU1A 1RJNA 3BPTA 1O8UA 1HNUA 3DORA 5DTWA 3TT6A 3G64A 1PJHA 1XO6A 4L6WA 3P2LA 3R9QA 5FIFA 3V5EA 2VSUC 3R9SA 3KQFA 2BZRA 4Z0MA 2VSUF 3T8BA 3FDUA 3GLMA 3QXIA 3GKBA 5C9GA 4JCTA 4B3IA 3QKAA 5KDRB 1EY3A 3QK8A 3HLN1 4ZDBA 3OC7A 2ZQQA 4JVTA 4YLHA 3LKEA 4IZDA 2CBYA 3TT7A 2ZL2A 2F9IA 1XNYA 2CE3A 4FN8A 4U0GH 4FZWA 3U9TB 3GF7A 3IBBA 2Q2XA 1TG6A 4I42A 3GMAA 2WTBA 5DKPA 1K32A 4IZCA 3PEAA 2IEXA 4ELXA 4HDTA 4QFEA 1DCIA 2DEOA 2VSSE 2HW5A 4U18A 3Q1TA 3KTHA 2D3TA 1TYFA 3P85A 2F9IB 4FN7A 3T8AA 4ASIA 1ON3A 1Q51A 3KTJA 3N6RB 3BF0A 4OLQA 1UYSA 1MJ3A 2F9YB 3HINA 4K2NA 1UIYA 3ZWBA 3H0UA 4EMLA 5DUCA 3T88A 1WZ8A 4MXIA 1YG6A 4DI1A 4U0HA 4I52A 2YJGA 3PGQA 5DUFA 3MT6A 2J5II 5JBXA 2W3PA 2F6IA 1EF9A 2UZFA 3FF6A 4ZDFA 3R6HA 2X24A 5C90A 2ZL4A 3WG5A 2PBPA 2ZQRA 4JCRA 5INGA 2QQ3A 5KDRA 4GHNA 3TZ3A 3SWXA 3NJDA 4HC8A 1FC6A 2ZL0A 3RRVA 4GM2A 1PIXA 3LAOA 3ZW9A 3M6MA 5G1QA 4OMRA 3VIVA 1RJMA 4QIJA 4WYOB 2DUBA 3QXZA 3K8XA 4JWVA 2J5SA 4OG1A 4Q1IA 4KNPA 1Y7OA 3TRRA 2J5GD 3H81A 4U0GA 1WDKA 4JYLA 4EMMA 3L3SA 3TVWA 4ZU2A 2VSSA 4J2UA 3MYBA 2F9YA 4B3HA 4FB8A 3ZWCA 3OT6A 4L8KA 3U9SB 3IB9A 4FZWC 3KTKA 5G1RA 1UYVA 3Q7HA 2VSSF 3U9RB 3TV5A 3ZW8A 4NARA 4JJTA 4B3JA 3H0SA 2FW2A 4IZBA 1UYTA 1JXZA 1ON9A 3H02A 5DU4A 2X58A 4FNDA 3PE8A 3I47A 4ZDEA 3RSIA 1DUBA 1UYRA 1W2XA 4Q0GA 3T3WA 5DZKA 5DU6A 1N6FA 1OD4A 3PZKA 5DZKH 3V5IA 3M6NA 3STAA 3GF3A 2FZSA 4ELWA 3T89A 1XNVA 4KWBA 5MGBA 5CTCA 4JCQA 5DTPA 2VREA 1FCFA 1FC9A 1EF8A 5CTBA 2J5IA 2F6QA 4ZDDA 5E0SH 1N6EA 4K29A 3R0OA 3KTIA 3K50A 1YG8A 4I4ZA 3ZWAA 3ST9A 4JCSA 1NZYA 3MFMA
chains in the Genus database with same CATH topology
3Q0GA 2ZL3A 4LK5A 3HE2A 1HZDA 3TDCA 3QREA 2VSUE 1HNOA 2FBMA 4JYJA 1VRGA 2J5IB 2A81A 4WCZA 2PG8A 3MOYA 4F47A 2J5GA 2EJ5A 2A7KA 1NZYB 3HRXA 3IAVA 4G2RA 2PPYA 2Q34A 3R9TA 4QIIA 1X0UA 3P5MA 3BPPA 5DU8A 3KTGA 4MOUA 3H0QA 1N6DA 1OD2A 4ZDCA 1WDMA 4KPKA 3RSTA 1FC7A 1J7XA 3H0JA 4JOTA 1XNWA 2C8TA 5INIA 3BEZA 4NNQA 4U1AA 4K3WA 2A7SA 4HNKA 4KD6A 5JBWA 2GTRA 2VX2A 4FJWD 3QMJA 5HUQA 3QYRA 3TVUA 1WDLA 2NP9A 3QWDA 4ELSA 4RYFA 5G1SA 4NEKA 3HP0A 4RYFH 4JFCA 3Q0JA 3OMEA 4JSBA 3ISAA 5FUSA 3SLLA 5INFA 5E0SA 1Q52A 1SZOA 4RCNA 4EMPA 4FNBA 2Q35A 3NJBA 4WZ8B 5KJPA 4MI2A 4U19A 1SG4A 2VSUA 5IKLB 1K39A 1XX4A 3DJAA 5DL1A 5E0NX 3TLFA 3JU1A 1RJNA 3BPTA 1O8UA 1HNUA 3DORA 5DTWA 3TT6A 3G64A 1PJHA 1XO6A 4L6WA 3P2LA 3R9QA 5FIFA 3V5EA 2VSUC 3R9SA 3KQFA 2BZRA 4Z0MA 2VSUF 3T8BA 3FDUA 3GLMA 3QXIA 3GKBA 5C9GA 4JCTA 4B3IA 3QKAA 5KDRB 1EY3A 3QK8A 3HLN1 4ZDBA 3OC7A 2ZQQA 4JVTA 4YLHA 3LKEA 4IZDA 2CBYA 3TT7A 2ZL2A 2F9IA 1XNYA 2CE3A 4FN8A 4U0GH 4FZWA 3U9TB 3GF7A 3IBBA 2Q2XA 1TG6A 4I42A 3GMAA 2WTBA 5DKPA 1K32A 4IZCA 3PEAA 2IEXA 4ELXA 4HDTA 4QFEA 1DCIA 2DEOA 2VSSE 2HW5A 4U18A 3Q1TA 3KTHA 2D3TA 1TYFA 3P85A 2F9IB 4FN7A 3T8AA 4ASIA 1ON3A 1Q51A 3KTJA 3N6RB 3BF0A 4OLQA 1UYSA 1MJ3A 2F9YB 3HINA 4K2NA 1UIYA 3ZWBA 3H0UA 4EMLA 5DUCA 3T88A 1WZ8A 4MXIA 1YG6A 4DI1A 4U0HA 4I52A 2YJGA 3PGQA 5DUFA 3MT6A 2J5II 5JBXA 2W3PA 2F6IA 1EF9A 2UZFA 3FF6A 4ZDFA 3R6HA 2X24A 5C90A 2ZL4A 3WG5A 2PBPA 2ZQRA 4JCRA 5INGA 2QQ3A 5KDRA 4GHNA 3TZ3A 3SWXA 3NJDA 4HC8A 1FC6A 2ZL0A 3RRVA 4GM2A 1PIXA 3LAOA 3ZW9A 3M6MA 5G1QA 4OMRA 3VIVA 1RJMA 4QIJA 4WYOB 2DUBA 3QXZA 3K8XA 4JWVA 2J5SA 4OG1A 4Q1IA 4KNPA 1Y7OA 3TRRA 2J5GD 3H81A 4U0GA 1WDKA 4JYLA 4EMMA 3L3SA 3TVWA 4ZU2A 2VSSA 4J2UA 3MYBA 2F9YA 4B3HA 4FB8A 3ZWCA 3OT6A 4L8KA 3U9SB 3IB9A 4FZWC 3KTKA 5G1RA 1UYVA 3Q7HA 2VSSF 3U9RB 3TV5A 3ZW8A 4NARA 4JJTA 4B3JA 3H0SA 2FW2A 4IZBA 1UYTA 1JXZA 1ON9A 3H02A 5DU4A 2X58A 4FNDA 3PE8A 3I47A 4ZDEA 3RSIA 1DUBA 1UYRA 1W2XA 4Q0GA 3T3WA 5DZKA 5DU6A 1N6FA 1OD4A 3PZKA 5DZKH 3V5IA 3M6NA 3STAA 3GF3A 2FZSA 4ELWA 3T89A 1XNVA 4KWBA 5MGBA 5CTCA 4JCQA 5DTPA 2VREA 1FCFA 1FC9A 1EF8A 5CTBA 2J5IA 2F6QA 4ZDDA 5E0SH 1N6EA 4K29A 3R0OA 3KTIA 3K50A 1YG8A 4I4ZA 3ZWAA 3ST9A 4JCSA 1NZYA 3MFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0G A;  2ZL3 A;  4LK5 A;  3HE2 A;  1HZD A;  3TDC A;  3QRE A;  2VSU E;  1HNO A;  2FBM A;  4JYJ A;  1VRG A;  2J5I B;  2A81 A;  4WCZ A;  2PG8 A;  3MOY A;  4F47 A;  2J5G A;  2EJ5 A;  2A7K A;  1NZY B;  3HRX A;  3IAV A;  4G2R A;  2PPY A;  2Q34 A;  3R9T A;  4QII A;  1X0U A;  3P5M A;  3BPP A;  5DU8 A;  3KTG A;  4MOU A;  3H0Q A;  1N6D A;  1OD2 A;  4ZDC A;  1WDM A;  4KPK A;  3RST A;  1FC7 A;  1J7X A;  3H0J A;  4JOT A;  1XNW A;  2C8T A;  5INI A;  3BEZ A;  4NNQ A;  4U1A A;  4K3W A;  2A7S A;  4HNK A;  4KD6 A;  5JBW A;  2GTR A;  2VX2 A;  4FJW D;  3QMJ A;  3QYR A;  3TVU A;  1WDL A;  2NP9 A;  3QWD A;  4ELS A;  4RYF A;  5G1S A;  4NEK A;  3HP0 A;  4RYF H;  4JFC A;  3Q0J A;  3OME A;  4JSB A;  3ISA A;  5FUS A;  3SLL A;  5INF A;  5E0S A;  1Q52 A;  1SZO A;  4RCN A;  4EMP A;  4FNB A;  2Q35 A;  3NJB A;  4WZ8 B;  5KJP A;  4MI2 A;  4U19 A;  1SG4 A;  2VSU A;  5IKL B;  1K39 A;  1XX4 A;  3DJA A;  5DL1 A;  5E0N X;  3TLF A;  3JU1 A;  1RJN A;  1O8U A;  1HNU A;  3DOR A;  5DTW A;  3TT6 A;  3G64 A;  1PJH A;  1XO6 A;  4L6W A;  3P2L A;  3R9Q A;  5FIF A;  3V5E A;  2VSU C;  3R9S A;  3KQF A;  2BZR A;  4Z0M A;  2VSU F;  3T8B A;  3FDU A;  3GLM A;  3QXI A;  3GKB A;  5C9G A;  4JCT A;  4B3I A;  3QKA A;  5KDR B;  1EY3 A;  3QK8 A;  3HLN 1;  4ZDB A;  3OC7 A;  2ZQQ A;  4JVT A;  4YLH A;  3LKE A;  4IZD A;  2CBY A;  3TT7 A;  2ZL2 A;  2F9I A;  1XNY A;  2CE3 A;  4FN8 A;  4U0G H;  4FZW A;  3U9T B;  3GF7 A;  3IBB A;  2Q2X A;  1TG6 A;  4I42 A;  3GMA A;  2WTB A;  5DKP A;  1K32 A;  4IZC A;  3PEA A;  2IEX A;  4ELX A;  4QFE A;  1DCI A;  2DEO A;  2VSS E;  2HW5 A;  4U18 A;  3Q1T A;  3KTH A;  2D3T A;  1TYF A;  3P85 A;  2F9I B;  4FN7 A;  3T8A A;  4ASI A;  1ON3 A;  1Q51 A;  3KTJ A;  3N6R B;  3BF0 A;  4OLQ A;  1UYS A;  1MJ3 A;  2F9Y B;  3HIN A;  4K2N A;  1UIY A;  3ZWB A;  3H0U A;  4EML A;  5DUC A;  3T88 A;  1WZ8 A;  4MXI A;  1YG6 A;  4DI1 A;  4U0H A;  4I52 A;  3PGQ A;  5DUF A;  3MT6 A;  2J5I I;  5JBX A;  2W3P A;  2F6I A;  1EF9 A;  2UZF A;  3FF6 A;  4ZDF A;  3R6H A;  2X24 A;  5C90 A;  2ZL4 A;  3WG5 A;  2PBP A;  2ZQR A;  4JCR A;  5ING A;  2QQ3 A;  5KDR A;  4GHN A;  3TZ3 A;  3SWX A;  3NJD A;  4HC8 A;  1FC6 A;  2ZL0 A;  3RRV A;  4GM2 A;  1PIX A;  3LAO A;  3ZW9 A;  3M6M A;  5G1Q A;  4OMR A;  3VIV A;  1RJM A;  4QIJ A;  4WYO B;  2DUB A;  3QXZ A;  3K8X A;  4JWV A;  2J5S A;  4OG1 A;  4Q1I A;  4KNP A;  1Y7O A;  3TRR A;  2J5G D;  3H81 A;  4U0G A;  1WDK A;  4JYL A;  4EMM A;  3L3S A;  3TVW A;  4ZU2 A;  2VSS A;  3MYB A;  2F9Y A;  4B3H A;  4FB8 A;  3ZWC A;  3OT6 A;  4L8K A;  3U9S B;  3IB9 A;  4FZW C;  3KTK A;  5G1R A;  1UYV A;  3Q7H A;  2VSS F;  3U9R B;  3TV5 A;  3ZW8 A;  4JJT A;  4B3J A;  3H0S A;  2FW2 A;  4IZB A;  1UYT A;  1JXZ A;  1ON9 A;  3H02 A;  5DU4 A;  2X58 A;  4FND A;  3PE8 A;  3I47 A;  4ZDE A;  3RSI A;  1DUB A;  1UYR A;  1W2X A;  4Q0G A;  3T3W A;  5DZK A;  5DU6 A;  1N6F A;  1OD4 A;  3PZK A;  5DZK H;  3V5I A;  3M6N A;  3STA A;  3GF3 A;  2FZS A;  4ELW A;  3T89 A;  1XNV A;  4KWB A;  5MGB A;  5CTC A;  4JCQ A;  5DTP A;  2VRE A;  1FCF A;  1FC9 A;  1EF8 A;  5CTB A;  2J5I A;  2F6Q A;  4ZDD A;  5E0S H;  1N6E A;  4K29 A;  3R0O A;  3KTI A;  3K50 A;  1YG8 A;  4I4Z A;  3ZWA A;  3ST9 A;  4JCS A;  1NZY A;  3MFM A; 
#chains in the Genus database with same CATH topology
 3Q0G A;  2ZL3 A;  4LK5 A;  3HE2 A;  1HZD A;  3TDC A;  3QRE A;  2VSU E;  1HNO A;  2FBM A;  4JYJ A;  1VRG A;  2J5I B;  2A81 A;  4WCZ A;  2PG8 A;  3MOY A;  4F47 A;  2J5G A;  2EJ5 A;  2A7K A;  1NZY B;  3HRX A;  3IAV A;  4G2R A;  2PPY A;  2Q34 A;  3R9T A;  4QII A;  1X0U A;  3P5M A;  3BPP A;  5DU8 A;  3KTG A;  4MOU A;  3H0Q A;  1N6D A;  1OD2 A;  4ZDC A;  1WDM A;  4KPK A;  3RST A;  1FC7 A;  1J7X A;  3H0J A;  4JOT A;  1XNW A;  2C8T A;  5INI A;  3BEZ A;  4NNQ A;  4U1A A;  4K3W A;  2A7S A;  4HNK A;  4KD6 A;  5JBW A;  2GTR A;  2VX2 A;  4FJW D;  3QMJ A;  5HUQ A;  3QYR A;  3TVU A;  1WDL A;  2NP9 A;  3QWD A;  4ELS A;  4RYF A;  5G1S A;  4NEK A;  3HP0 A;  4RYF H;  4JFC A;  3Q0J A;  3OME A;  4JSB A;  3ISA A;  5FUS A;  3SLL A;  5INF A;  5E0S A;  1Q52 A;  1SZO A;  4RCN A;  4EMP A;  4FNB A;  2Q35 A;  3NJB A;  4WZ8 B;  5KJP A;  4MI2 A;  4U19 A;  1SG4 A;  2VSU A;  5IKL B;  1K39 A;  1XX4 A;  3DJA A;  5DL1 A;  5E0N X;  3TLF A;  3JU1 A;  1RJN A;  3BPT A;  1O8U A;  1HNU A;  3DOR A;  5DTW A;  3TT6 A;  3G64 A;  1PJH A;  1XO6 A;  4L6W A;  3P2L A;  3R9Q A;  5FIF A;  3V5E A;  2VSU C;  3R9S A;  3KQF A;  2BZR A;  4Z0M A;  2VSU F;  3T8B A;  3FDU A;  3GLM A;  3QXI A;  3GKB A;  5C9G A;  4JCT A;  4B3I A;  3QKA A;  5KDR B;  1EY3 A;  3QK8 A;  3HLN 1;  4ZDB A;  3OC7 A;  2ZQQ A;  4JVT A;  4YLH A;  3LKE A;  4IZD A;  2CBY A;  3TT7 A;  2ZL2 A;  2F9I A;  1XNY A;  2CE3 A;  4FN8 A;  4U0G H;  4FZW A;  3U9T B;  3GF7 A;  3IBB A;  2Q2X A;  1TG6 A;  4I42 A;  3GMA A;  2WTB A;  5DKP A;  1K32 A;  4IZC A;  3PEA A;  2IEX A;  4ELX A;  4HDT A;  4QFE A;  1DCI A;  2DEO A;  2VSS E;  2HW5 A;  4U18 A;  3Q1T A;  3KTH A;  2D3T A;  1TYF A;  3P85 A;  2F9I B;  4FN7 A;  3T8A A;  4ASI A;  1ON3 A;  1Q51 A;  3KTJ A;  3N6R B;  3BF0 A;  4OLQ A;  1UYS A;  1MJ3 A;  2F9Y B;  3HIN A;  4K2N A;  1UIY A;  3ZWB A;  3H0U A;  4EML A;  5DUC A;  3T88 A;  1WZ8 A;  4MXI A;  1YG6 A;  4DI1 A;  4U0H A;  4I52 A;  2YJG A;  3PGQ A;  5DUF A;  3MT6 A;  2J5I I;  5JBX A;  2W3P A;  2F6I A;  1EF9 A;  2UZF A;  3FF6 A;  4ZDF A;  3R6H A;  2X24 A;  5C90 A;  2ZL4 A;  3WG5 A;  2PBP A;  2ZQR A;  4JCR A;  5ING A;  2QQ3 A;  5KDR A;  4GHN A;  3TZ3 A;  3SWX A;  3NJD A;  4HC8 A;  1FC6 A;  2ZL0 A;  3RRV A;  4GM2 A;  1PIX A;  3LAO A;  3ZW9 A;  3M6M A;  5G1Q A;  4OMR A;  3VIV A;  1RJM A;  4QIJ A;  4WYO B;  2DUB A;  3QXZ A;  3K8X A;  4JWV A;  2J5S A;  4OG1 A;  4Q1I A;  4KNP A;  1Y7O A;  3TRR A;  2J5G D;  3H81 A;  4U0G A;  1WDK A;  4JYL A;  4EMM A;  3L3S A;  3TVW A;  4ZU2 A;  2VSS A;  4J2U A;  3MYB A;  2F9Y A;  4B3H A;  4FB8 A;  3ZWC A;  3OT6 A;  4L8K A;  3U9S B;  3IB9 A;  4FZW C;  3KTK A;  5G1R A;  1UYV A;  3Q7H A;  2VSS F;  3U9R B;  3TV5 A;  3ZW8 A;  4NAR A;  4JJT A;  4B3J A;  3H0S A;  2FW2 A;  4IZB A;  1UYT A;  1JXZ A;  1ON9 A;  3H02 A;  5DU4 A;  2X58 A;  4FND A;  3PE8 A;  3I47 A;  4ZDE A;  3RSI A;  1DUB A;  1UYR A;  1W2X A;  4Q0G A;  3T3W A;  5DZK A;  5DU6 A;  1N6F A;  1OD4 A;  3PZK A;  5DZK H;  3V5I A;  3M6N A;  3STA A;  3GF3 A;  2FZS A;  4ELW A;  3T89 A;  1XNV A;  4KWB A;  5MGB A;  5CTC A;  4JCQ A;  5DTP A;  2VRE A;  1FCF A;  1FC9 A;  1EF8 A;  5CTB A;  2J5I A;  2F6Q A;  4ZDD A;  5E0S H;  1N6E A;  4K29 A;  3R0O A;  3KTI A;  3K50 A;  1YG8 A;  4I4Z A;  3ZWA A;  3ST9 A;  4JCS A;  1NZY A;  3MFM A; 
#chains in the Genus database with same CATH homology
 3Q0G A;  2ZL3 A;  4LK5 A;  3HE2 A;  1HZD A;  3TDC A;  3QRE A;  2VSU E;  1HNO A;  2FBM A;  4JYJ A;  1VRG A;  2J5I B;  2A81 A;  4WCZ A;  2PG8 A;  3MOY A;  4F47 A;  2J5G A;  2EJ5 A;  2A7K A;  1NZY B;  3HRX A;  3IAV A;  4G2R A;  2PPY A;  2Q34 A;  3R9T A;  4QII A;  1X0U A;  3P5M A;  3BPP A;  5DU8 A;  3KTG A;  4MOU A;  3H0Q A;  1N6D A;  1OD2 A;  4ZDC A;  1WDM A;  4KPK A;  3RST A;  1FC7 A;  1J7X A;  3H0J A;  4JOT A;  1XNW A;  2C8T A;  5INI A;  3BEZ A;  4NNQ A;  4U1A A;  4K3W A;  2A7S A;  4HNK A;  4KD6 A;  5JBW A;  2GTR A;  2VX2 A;  4FJW D;  3QMJ A;  5HUQ A;  3QYR A;  3TVU A;  1WDL A;  2NP9 A;  3QWD A;  4ELS A;  4RYF A;  5G1S A;  4NEK A;  3HP0 A;  4RYF H;  4JFC A;  3Q0J A;  3OME A;  4JSB A;  3ISA A;  5FUS A;  3SLL A;  5INF A;  5E0S A;  1Q52 A;  1SZO A;  4RCN A;  4EMP A;  4FNB A;  2Q35 A;  3NJB A;  4WZ8 B;  5KJP A;  4MI2 A;  4U19 A;  1SG4 A;  2VSU A;  5IKL B;  1K39 A;  1XX4 A;  3DJA A;  5DL1 A;  5E0N X;  3TLF A;  3JU1 A;  1RJN A;  3BPT A;  1O8U A;  1HNU A;  3DOR A;  5DTW A;  3TT6 A;  3G64 A;  1PJH A;  1XO6 A;  4L6W A;  3P2L A;  3R9Q A;  5FIF A;  3V5E A;  2VSU C;  3R9S A;  3KQF A;  2BZR A;  4Z0M A;  2VSU F;  3T8B A;  3FDU A;  3GLM A;  3QXI A;  3GKB A;  5C9G A;  4JCT A;  4B3I A;  3QKA A;  5KDR B;  1EY3 A;  3QK8 A;  3HLN 1;  4ZDB A;  3OC7 A;  2ZQQ A;  4JVT A;  4YLH A;  3LKE A;  4IZD A;  2CBY A;  3TT7 A;  2ZL2 A;  2F9I A;  1XNY A;  2CE3 A;  4FN8 A;  4U0G H;  4FZW A;  3U9T B;  3GF7 A;  3IBB A;  2Q2X A;  1TG6 A;  4I42 A;  3GMA A;  2WTB A;  5DKP A;  1K32 A;  4IZC A;  3PEA A;  2IEX A;  4ELX A;  4HDT A;  4QFE A;  1DCI A;  2DEO A;  2VSS E;  2HW5 A;  4U18 A;  3Q1T A;  3KTH A;  2D3T A;  1TYF A;  3P85 A;  2F9I B;  4FN7 A;  3T8A A;  4ASI A;  1ON3 A;  1Q51 A;  3KTJ A;  3N6R B;  3BF0 A;  4OLQ A;  1UYS A;  1MJ3 A;  2F9Y B;  3HIN A;  4K2N A;  1UIY A;  3ZWB A;  3H0U A;  4EML A;  5DUC A;  3T88 A;  1WZ8 A;  4MXI A;  1YG6 A;  4DI1 A;  4U0H A;  4I52 A;  2YJG A;  3PGQ A;  5DUF A;  3MT6 A;  2J5I I;  5JBX A;  2W3P A;  2F6I A;  1EF9 A;  2UZF A;  3FF6 A;  4ZDF A;  3R6H A;  2X24 A;  5C90 A;  2ZL4 A;  3WG5 A;  2PBP A;  2ZQR A;  4JCR A;  5ING A;  2QQ3 A;  5KDR A;  4GHN A;  3TZ3 A;  3SWX A;  3NJD A;  4HC8 A;  1FC6 A;  2ZL0 A;  3RRV A;  4GM2 A;  1PIX A;  3LAO A;  3ZW9 A;  3M6M A;  5G1Q A;  4OMR A;  3VIV A;  1RJM A;  4QIJ A;  4WYO B;  2DUB A;  3QXZ A;  3K8X A;  4JWV A;  2J5S A;  4OG1 A;  4Q1I A;  4KNP A;  1Y7O A;  3TRR A;  2J5G D;  3H81 A;  4U0G A;  1WDK A;  4JYL A;  4EMM A;  3L3S A;  3TVW A;  4ZU2 A;  2VSS A;  4J2U A;  3MYB A;  2F9Y A;  4B3H A;  4FB8 A;  3ZWC A;  3OT6 A;  4L8K A;  3U9S B;  3IB9 A;  4FZW C;  3KTK A;  5G1R A;  1UYV A;  3Q7H A;  2VSS F;  3U9R B;  3TV5 A;  3ZW8 A;  4NAR A;  4JJT A;  4B3J A;  3H0S A;  2FW2 A;  4IZB A;  1UYT A;  1JXZ A;  1ON9 A;  3H02 A;  5DU4 A;  2X58 A;  4FND A;  3PE8 A;  3I47 A;  4ZDE A;  3RSI A;  1DUB A;  1UYR A;  1W2X A;  4Q0G A;  3T3W A;  5DZK A;  5DU6 A;  1N6F A;  1OD4 A;  3PZK A;  5DZK H;  3V5I A;  3M6N A;  3STA A;  3GF3 A;  2FZS A;  4ELW A;  3T89 A;  1XNV A;  4KWB A;  5MGB A;  5CTC A;  4JCQ A;  5DTP A;  2VRE A;  1FCF A;  1FC9 A;  1EF8 A;  5CTB A;  2J5I A;  2F6Q A;  4ZDD A;  5E0S H;  1N6E A;  4K29 A;  3R0O A;  3KTI A;  3K50 A;  1YG8 A;  4I4Z A;  3ZWA A;  3ST9 A;  4JCS A;  1NZY A;  3MFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...