1PJHA

Structural studies on delta3-delta2-enoyl-coa isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
259
Chain Sequence
IRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on delta(3)-delta(2)-enoyl-CoA isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords enoyl-CoA isomerase; Eci1p
total genus 101
structure length 259
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2003-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pjhA00
1JXZA 3K50A 3H0QA 2C8TA 3STAA 3OT6A 2Q34A 3V5EA 3QMJA 3KTKA 2J5SA 3RRVA 4JJTA 3R6HA 2CBYA 2J5IA 5FIFA 3SWXA 2Q2XA 5JBXA 3ZWCA 3QYRA 3HLN1 4FN8A 4ELWA 3P5MA 4QIIA 3R9TA 3LKEA 2J5II 4FNBA 3V5IA 4WZ8B 3OC7A 4YLHA 3PE8A 1PJHA 3HE2A 4U18A 1N6EA 4FB8A 3U9TB 2VX2A 2J5GD 4KD6A 4OLQA 3OMEA 4HC8A 4WYOB 3Q7HA 4U0HA 4FJWD 3K8XA 2NP9A 4JFCA 4Z0MA 3TV5A 5DTPA 3BPPA 1FC7A 3T8AA 1PIXA 1Q51A 5DZKA 3L3SA 4JCRA 4I4ZA 1K39A 1Q52A 3R9SA 3FF6A 3KQFA 1XNVA 2BZRA 5KJPA 5JBWA 4G2RA 1EF9A 2VSSF 5DL1A 2F9IB 3WG5A 5KDRB 5FUSA 4ZDFA 1W2XA 1WDKA 3MOYA 3PZKA 1YG6A 3NJDA 3ZW8A 4JSBA 4DI1A 1OD4A 3KTIA 4GHNA 3M6NA 4IZBA 4IZCA 3VIVA 1RJMA 4ZU2A 4QFEA 4U1AA 1WDLA 3N6RB 1WZ8A 1UYTA 3U9SB 2CE3A 1VRGA 2PBPA 3PEAA 3QXIA 4FN7A 4ASIA 3GMAA 3QXZA 4F47A 1FCFA 3T88A 1XO6A 2DEOA 1EF8A 1UYVA 4GM2A 4Q0GA 3DORA 2VSUF 2F6IA 2W3PA 4NNQA 1FC9A 5INGA 4U19A 1DUBA 2F9IA 4JYJA 1ON9A 2A81A 1MJ3A 2VREA 2HW5A 1NZYA 4MXIA 5INFA 5INIA 2DUBA 3G64A 3I47A 4MI2A 3T3WA 3QREA 4ELSA 5C9GA 5G1SA 3GLMA 4KNPA 4HNKA 5DZKH 1SG4A 3TVUA 2WTBA 3P85A 4I52A 3FDUA 4B3HA 3KTJA 2J5GA 4I42A 4FZWC 5IKLB 1UYSA 4JYLA 3BF0A 1FC6A 3SLLA 5KDRA 3Q1TA 3IAVA 4FNDA 5CTCA 1J7XA 4L6WA 1YG8A 4EMLA 3TT7A 3TRRA 2VSSA 4ELXA 3JU1A 2QQ3A 3KTGA 5DU8A 3GF7A 4FZWA 4OG1A 5E0NX 4K3WA 3GF3A 5MGBA 2ZQRA 2Q35A 2F9YA 5CTBA 3ZWBA 3Q0JA 3ZW9A 4ZDDA 2FBMA 5DTWA 2F9YB 3H81A 2X58A 3ZWAA 4JVTA 4NEKA 3PGQA 2D3TA 2ZL3A 1ON3A 4ZDEA 3TDCA 5DKPA 2FZSA 3QK8A 2A7SA 4JWVA 1TYFA 3NJBA 5E0SH 2ZQQA 3TT6A 2X24A 2UZFA 3H02A 2VSSE 3QKAA 1Y7OA 3U9RB 4B3JA 3IB9A 4JOTA 2GTRA 4EMMA 1HNUA 3HRXA 2J5IB 4U0GA 3T8BA 4RYFA 4IZDA 3BEZA 3LAOA 4B3IA 3GKBA 4QIJA 2A7KA 3TVWA 4WCZA 3IBBA 1XNYA 3R9QA 4L8KA 5DU6A 3RSIA 3ISAA 2VSUE 3Q0GA 4KPKA 1O8UA 4RCNA 1NZYB 1HNOA 2EJ5A 1N6DA 3TZ3A 5C90A 4K29A 3MT6A 3H0JA 4JCQA 2PG8A 3H0SA 3HINA 4EMPA 2VSUA 3RSTA 1DCIA 4KWBA 3T89A 1XX4A 4JCSA 1EY3A 3DJAA 2ZL4A 5DU4A 3TLFA 1N6FA 1K32A 3MYBA 1WDMA 1HZDA 1XNWA 4OMRA 3M6MA 4ZDCA 2ZL0A 4LK5A 4Q1IA 3R0OA 2F6QA 2ZL2A 2IEXA 4RYFH 4U0GH 3KTHA 3ST9A 5DUCA 5G1RA 5G1QA 1OD2A 3H0UA 1SZOA 4ZDBA 4K2NA 3QWDA 4MOUA 5E0SA 5DUFA 3HP0A 3MFMA 2PPYA 1UIYA 3P2LA 1TG6A 2VSUC 4JCTA 1RJNA 1X0UA 1UYRA 2FW2A
chains in the Genus database with same CATH superfamily
1JXZA 3K50A 3H0QA 2C8TA 3STAA 3OT6A 2Q34A 3V5EA 3QMJA 3KTKA 2J5SA 3RRVA 4JJTA 3R6HA 2CBYA 2J5IA 5FIFA 3SWXA 2Q2XA 5JBXA 3ZWCA 3QYRA 3HLN1 4FN8A 4ELWA 3P5MA 4QIIA 3R9TA 3LKEA 2J5II 4FNBA 3V5IA 4WZ8B 3OC7A 4YLHA 3PE8A 1PJHA 3HE2A 4U18A 1N6EA 4FB8A 4J2UA 3U9TB 2VX2A 2J5GD 4KD6A 4OLQA 3OMEA 4HC8A 4WYOB 3Q7HA 4U0HA 4FJWD 3K8XA 2NP9A 4JFCA 4Z0MA 3TV5A 5DTPA 3BPPA 1FC7A 3T8AA 1PIXA 1Q51A 5DZKA 3L3SA 4JCRA 4I4ZA 1K39A 1Q52A 4NARA 3R9SA 3FF6A 3KQFA 1XNVA 2BZRA 5KJPA 5JBWA 4G2RA 1EF9A 2VSSF 5DL1A 2F9IB 4HDTA 3WG5A 5KDRB 5FUSA 4ZDFA 1W2XA 1WDKA 3MOYA 3PZKA 1YG6A 3NJDA 3ZW8A 4JSBA 4DI1A 1OD4A 3KTIA 4GHNA 3M6NA 4IZBA 4IZCA 3VIVA 1RJMA 4ZU2A 4QFEA 4U1AA 1WDLA 3N6RB 1WZ8A 1UYTA 3U9SB 2CE3A 1VRGA 2PBPA 3PEAA 3QXIA 4FN7A 4ASIA 3GMAA 3QXZA 4F47A 1FCFA 3T88A 1XO6A 2DEOA 1EF8A 1UYVA 4GM2A 4Q0GA 3DORA 2VSUF 2F6IA 2W3PA 4NNQA 1FC9A 5INGA 4U19A 1DUBA 2F9IA 4JYJA 1ON9A 2A81A 1MJ3A 2VREA 2HW5A 1NZYA 4MXIA 5INFA 5INIA 2DUBA 3G64A 3I47A 4MI2A 3T3WA 3QREA 4ELSA 5C9GA 5G1SA 3GLMA 4KNPA 4HNKA 5DZKH 1SG4A 3TVUA 2WTBA 3P85A 4I52A 3FDUA 4B3HA 3KTJA 2J5GA 4I42A 4FZWC 5IKLB 1UYSA 4JYLA 3BF0A 1FC6A 3SLLA 5KDRA 3Q1TA 3IAVA 4FNDA 5CTCA 1J7XA 4L6WA 1YG8A 4EMLA 3TT7A 3TRRA 2VSSA 4ELXA 3JU1A 2QQ3A 3KTGA 5DU8A 3GF7A 4FZWA 4OG1A 5E0NX 4K3WA 3GF3A 5MGBA 2ZQRA 2Q35A 2F9YA 3BPTA 5CTBA 3ZWBA 3Q0JA 3ZW9A 4ZDDA 2FBMA 5DTWA 2F9YB 3H81A 2X58A 3ZWAA 4JVTA 4NEKA 3PGQA 2D3TA 2ZL3A 1ON3A 4ZDEA 3TDCA 5DKPA 2FZSA 3QK8A 2A7SA 4JWVA 1TYFA 2YJGA 3NJBA 5E0SH 2ZQQA 3TT6A 2X24A 2UZFA 3H02A 2VSSE 3QKAA 1Y7OA 3U9RB 4B3JA 3IB9A 4JOTA 2GTRA 4EMMA 1HNUA 3HRXA 2J5IB 4U0GA 3T8BA 4RYFA 4IZDA 3BEZA 3LAOA 5HUQA 4B3IA 3GKBA 4QIJA 2A7KA 3TVWA 4WCZA 3IBBA 1XNYA 3R9QA 4L8KA 5DU6A 3RSIA 3ISAA 2VSUE 3Q0GA 4KPKA 1O8UA 4RCNA 1NZYB 1HNOA 2EJ5A 1N6DA 3TZ3A 5C90A 4K29A 3MT6A 3H0JA 4JCQA 2PG8A 3H0SA 3HINA 4EMPA 2VSUA 3RSTA 1DCIA 4KWBA 3T89A 1XX4A 4JCSA 1EY3A 3DJAA 2ZL4A 5DU4A 3TLFA 1N6FA 1K32A 3MYBA 1WDMA 1HZDA 1XNWA 4OMRA 3M6MA 4ZDCA 2ZL0A 4LK5A 4Q1IA 3R0OA 2F6QA 2ZL2A 2IEXA 4RYFH 4U0GH 3KTHA 3ST9A 5DUCA 5G1RA 5G1QA 1OD2A 3H0UA 1SZOA 4ZDBA 4K2NA 3QWDA 4MOUA 5E0SA 5DUFA 3HP0A 3MFMA 2PPYA 1UIYA 3P2LA 1TG6A 2VSUC 4JCTA 1RJNA 1X0UA 1UYRA 2FW2A
chains in the Genus database with same CATH topology
1JXZA 3K50A 3H0QA 2C8TA 3STAA 3OT6A 2Q34A 3V5EA 3QMJA 3KTKA 2J5SA 3RRVA 4JJTA 3R6HA 2CBYA 2J5IA 5FIFA 3SWXA 2Q2XA 5JBXA 3ZWCA 3QYRA 3HLN1 4FN8A 4ELWA 3P5MA 4QIIA 3R9TA 3LKEA 2J5II 4FNBA 3V5IA 4WZ8B 3OC7A 4YLHA 3PE8A 1PJHA 3HE2A 4U18A 1N6EA 4FB8A 4J2UA 3U9TB 2VX2A 2J5GD 4KD6A 4OLQA 3OMEA 4HC8A 4WYOB 3Q7HA 4U0HA 4FJWD 3K8XA 2NP9A 4JFCA 4Z0MA 3TV5A 5DTPA 3BPPA 1FC7A 3T8AA 1PIXA 1Q51A 5DZKA 3L3SA 4JCRA 4I4ZA 1K39A 1Q52A 4NARA 3R9SA 3FF6A 3KQFA 1XNVA 2BZRA 5KJPA 5JBWA 4G2RA 1EF9A 2VSSF 5DL1A 2F9IB 4HDTA 3WG5A 5KDRB 5FUSA 4ZDFA 1W2XA 1WDKA 3MOYA 3PZKA 1YG6A 3NJDA 3ZW8A 4JSBA 4DI1A 1OD4A 3KTIA 4GHNA 3M6NA 4IZBA 4IZCA 3VIVA 1RJMA 4ZU2A 4QFEA 4U1AA 1WDLA 3N6RB 1WZ8A 1UYTA 3U9SB 2CE3A 1VRGA 2PBPA 3PEAA 3QXIA 4FN7A 4ASIA 3GMAA 3QXZA 4F47A 1FCFA 3T88A 1XO6A 2DEOA 1EF8A 1UYVA 4GM2A 4Q0GA 3DORA 2VSUF 2F6IA 2W3PA 4NNQA 1FC9A 5INGA 4U19A 1DUBA 2F9IA 4JYJA 1ON9A 2A81A 1MJ3A 2VREA 2HW5A 1NZYA 4MXIA 5INFA 5INIA 2DUBA 3G64A 3I47A 4MI2A 3T3WA 3QREA 4ELSA 5C9GA 5G1SA 3GLMA 4KNPA 4HNKA 5DZKH 1SG4A 3TVUA 2WTBA 3P85A 4I52A 3FDUA 4B3HA 3KTJA 2J5GA 4I42A 4FZWC 5IKLB 1UYSA 4JYLA 3BF0A 1FC6A 3SLLA 5KDRA 3Q1TA 3IAVA 4FNDA 5CTCA 1J7XA 4L6WA 1YG8A 4EMLA 3TT7A 3TRRA 2VSSA 4ELXA 3JU1A 2QQ3A 3KTGA 5DU8A 3GF7A 4FZWA 4OG1A 5E0NX 4K3WA 3GF3A 5MGBA 2ZQRA 2Q35A 2F9YA 3BPTA 5CTBA 3ZWBA 3Q0JA 3ZW9A 4ZDDA 2FBMA 5DTWA 2F9YB 3H81A 2X58A 3ZWAA 4JVTA 4NEKA 3PGQA 2D3TA 2ZL3A 1ON3A 4ZDEA 3TDCA 5DKPA 2FZSA 3QK8A 2A7SA 4JWVA 1TYFA 2YJGA 3NJBA 5E0SH 2ZQQA 3TT6A 2X24A 2UZFA 3H02A 2VSSE 3QKAA 1Y7OA 3U9RB 4B3JA 3IB9A 4JOTA 2GTRA 4EMMA 1HNUA 3HRXA 2J5IB 4U0GA 3T8BA 4RYFA 4IZDA 3BEZA 3LAOA 5HUQA 4B3IA 3GKBA 4QIJA 2A7KA 3TVWA 4WCZA 3IBBA 1XNYA 3R9QA 4L8KA 5DU6A 3RSIA 3ISAA 2VSUE 3Q0GA 4KPKA 1O8UA 4RCNA 1NZYB 1HNOA 2EJ5A 1N6DA 3TZ3A 5C90A 4K29A 3MT6A 3H0JA 4JCQA 2PG8A 3H0SA 3HINA 4EMPA 2VSUA 3RSTA 1DCIA 4KWBA 3T89A 1XX4A 4JCSA 1EY3A 3DJAA 2ZL4A 5DU4A 3TLFA 1N6FA 1K32A 3MYBA 1WDMA 1HZDA 1XNWA 4OMRA 3M6MA 4ZDCA 2ZL0A 4LK5A 4Q1IA 3R0OA 2F6QA 2ZL2A 2IEXA 4RYFH 4U0GH 3KTHA 3ST9A 5DUCA 5G1RA 5G1QA 1OD2A 3H0UA 1SZOA 4ZDBA 4K2NA 3QWDA 4MOUA 5E0SA 5DUFA 3HP0A 3MFMA 2PPYA 1UIYA 3P2LA 1TG6A 2VSUC 4JCTA 1RJNA 1X0UA 1UYRA 2FW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXZ A;  3K50 A;  3H0Q A;  2C8T A;  3STA A;  3OT6 A;  2Q34 A;  3V5E A;  3QMJ A;  3KTK A;  2J5S A;  3RRV A;  4JJT A;  3R6H A;  2CBY A;  2J5I A;  5FIF A;  3SWX A;  2Q2X A;  5JBX A;  3ZWC A;  3QYR A;  3HLN 1;  4FN8 A;  4ELW A;  3P5M A;  4QII A;  3R9T A;  3LKE A;  2J5I I;  4FNB A;  3V5I A;  4WZ8 B;  3OC7 A;  4YLH A;  3PE8 A;  1PJH A;  3HE2 A;  4U18 A;  1N6E A;  4FB8 A;  3U9T B;  2VX2 A;  2J5G D;  4KD6 A;  4OLQ A;  3OME A;  4HC8 A;  4WYO B;  3Q7H A;  4U0H A;  4FJW D;  3K8X A;  2NP9 A;  4JFC A;  4Z0M A;  3TV5 A;  5DTP A;  3BPP A;  1FC7 A;  3T8A A;  1PIX A;  1Q51 A;  5DZK A;  3L3S A;  4JCR A;  4I4Z A;  1K39 A;  1Q52 A;  3R9S A;  3FF6 A;  3KQF A;  1XNV A;  2BZR A;  5KJP A;  5JBW A;  4G2R A;  1EF9 A;  2VSS F;  5DL1 A;  2F9I B;  3WG5 A;  5KDR B;  5FUS A;  4ZDF A;  1W2X A;  1WDK A;  3MOY A;  3PZK A;  1YG6 A;  3NJD A;  3ZW8 A;  4JSB A;  4DI1 A;  1OD4 A;  3KTI A;  4GHN A;  3M6N A;  4IZB A;  4IZC A;  3VIV A;  1RJM A;  4ZU2 A;  4QFE A;  4U1A A;  1WDL A;  3N6R B;  1WZ8 A;  1UYT A;  3U9S B;  2CE3 A;  1VRG A;  2PBP A;  3PEA A;  3QXI A;  4FN7 A;  4ASI A;  3GMA A;  3QXZ A;  4F47 A;  1FCF A;  3T88 A;  1XO6 A;  2DEO A;  1EF8 A;  1UYV A;  4GM2 A;  4Q0G A;  3DOR A;  2VSU F;  2F6I A;  2W3P A;  4NNQ A;  1FC9 A;  5ING A;  4U19 A;  1DUB A;  2F9I A;  4JYJ A;  1ON9 A;  2A81 A;  1MJ3 A;  2VRE A;  2HW5 A;  1NZY A;  4MXI A;  5INF A;  5INI A;  2DUB A;  3G64 A;  3I47 A;  4MI2 A;  3T3W A;  3QRE A;  4ELS A;  5C9G A;  5G1S A;  3GLM A;  4KNP A;  4HNK A;  5DZK H;  1SG4 A;  3TVU A;  2WTB A;  3P85 A;  4I52 A;  3FDU A;  4B3H A;  3KTJ A;  2J5G A;  4I42 A;  4FZW C;  5IKL B;  1UYS A;  4JYL A;  3BF0 A;  1FC6 A;  3SLL A;  5KDR A;  3Q1T A;  3IAV A;  4FND A;  5CTC A;  1J7X A;  4L6W A;  1YG8 A;  4EML A;  3TT7 A;  3TRR A;  2VSS A;  4ELX A;  3JU1 A;  2QQ3 A;  3KTG A;  5DU8 A;  3GF7 A;  4FZW A;  4OG1 A;  5E0N X;  4K3W A;  3GF3 A;  5MGB A;  2ZQR A;  2Q35 A;  2F9Y A;  5CTB A;  3ZWB A;  3Q0J A;  3ZW9 A;  4ZDD A;  2FBM A;  5DTW A;  2F9Y B;  3H81 A;  2X58 A;  3ZWA A;  4JVT A;  4NEK A;  3PGQ A;  2D3T A;  2ZL3 A;  1ON3 A;  4ZDE A;  3TDC A;  5DKP A;  2FZS A;  3QK8 A;  2A7S A;  4JWV A;  1TYF A;  3NJB A;  5E0S H;  2ZQQ A;  3TT6 A;  2X24 A;  2UZF A;  3H02 A;  2VSS E;  3QKA A;  1Y7O A;  3U9R B;  4B3J A;  3IB9 A;  4JOT A;  2GTR A;  4EMM A;  1HNU A;  3HRX A;  2J5I B;  4U0G A;  3T8B A;  4RYF A;  4IZD A;  3BEZ A;  3LAO A;  4B3I A;  3GKB A;  4QIJ A;  2A7K A;  3TVW A;  4WCZ A;  3IBB A;  1XNY A;  3R9Q A;  4L8K A;  5DU6 A;  3RSI A;  3ISA A;  2VSU E;  3Q0G A;  4KPK A;  1O8U A;  4RCN A;  1NZY B;  1HNO A;  2EJ5 A;  1N6D A;  3TZ3 A;  5C90 A;  4K29 A;  3MT6 A;  3H0J A;  4JCQ A;  2PG8 A;  3H0S A;  3HIN A;  4EMP A;  2VSU A;  3RST A;  1DCI A;  4KWB A;  3T89 A;  1XX4 A;  4JCS A;  1EY3 A;  3DJA A;  2ZL4 A;  5DU4 A;  3TLF A;  1N6F A;  1K32 A;  3MYB A;  1WDM A;  1HZD A;  1XNW A;  4OMR A;  3M6M A;  4ZDC A;  2ZL0 A;  4LK5 A;  4Q1I A;  3R0O A;  2F6Q A;  2ZL2 A;  2IEX A;  4RYF H;  4U0G H;  3KTH A;  3ST9 A;  5DUC A;  5G1R A;  5G1Q A;  1OD2 A;  3H0U A;  1SZO A;  4ZDB A;  4K2N A;  3QWD A;  4MOU A;  5E0S A;  5DUF A;  3HP0 A;  3MFM A;  2PPY A;  1UIY A;  3P2L A;  1TG6 A;  2VSU C;  4JCT A;  1RJN A;  1X0U A;  1UYR A;  2FW2 A; 
#chains in the Genus database with same CATH topology
 1JXZ A;  3K50 A;  3H0Q A;  2C8T A;  3STA A;  3OT6 A;  2Q34 A;  3V5E A;  3QMJ A;  3KTK A;  2J5S A;  3RRV A;  4JJT A;  3R6H A;  2CBY A;  2J5I A;  5FIF A;  3SWX A;  2Q2X A;  5JBX A;  3ZWC A;  3QYR A;  3HLN 1;  4FN8 A;  4ELW A;  3P5M A;  4QII A;  3R9T A;  3LKE A;  2J5I I;  4FNB A;  3V5I A;  4WZ8 B;  3OC7 A;  4YLH A;  3PE8 A;  1PJH A;  3HE2 A;  4U18 A;  1N6E A;  4FB8 A;  4J2U A;  3U9T B;  2VX2 A;  2J5G D;  4KD6 A;  4OLQ A;  3OME A;  4HC8 A;  4WYO B;  3Q7H A;  4U0H A;  4FJW D;  3K8X A;  2NP9 A;  4JFC A;  4Z0M A;  3TV5 A;  5DTP A;  3BPP A;  1FC7 A;  3T8A A;  1PIX A;  1Q51 A;  5DZK A;  3L3S A;  4JCR A;  4I4Z A;  1K39 A;  1Q52 A;  4NAR A;  3R9S A;  3FF6 A;  3KQF A;  1XNV A;  2BZR A;  5KJP A;  5JBW A;  4G2R A;  1EF9 A;  2VSS F;  5DL1 A;  2F9I B;  4HDT A;  3WG5 A;  5KDR B;  5FUS A;  4ZDF A;  1W2X A;  1WDK A;  3MOY A;  3PZK A;  1YG6 A;  3NJD A;  3ZW8 A;  4JSB A;  4DI1 A;  1OD4 A;  3KTI A;  4GHN A;  3M6N A;  4IZB A;  4IZC A;  3VIV A;  1RJM A;  4ZU2 A;  4QFE A;  4U1A A;  1WDL A;  3N6R B;  1WZ8 A;  1UYT A;  3U9S B;  2CE3 A;  1VRG A;  2PBP A;  3PEA A;  3QXI A;  4FN7 A;  4ASI A;  3GMA A;  3QXZ A;  4F47 A;  1FCF A;  3T88 A;  1XO6 A;  2DEO A;  1EF8 A;  1UYV A;  4GM2 A;  4Q0G A;  3DOR A;  2VSU F;  2F6I A;  2W3P A;  4NNQ A;  1FC9 A;  5ING A;  4U19 A;  1DUB A;  2F9I A;  4JYJ A;  1ON9 A;  2A81 A;  1MJ3 A;  2VRE A;  2HW5 A;  1NZY A;  4MXI A;  5INF A;  5INI A;  2DUB A;  3G64 A;  3I47 A;  4MI2 A;  3T3W A;  3QRE A;  4ELS A;  5C9G A;  5G1S A;  3GLM A;  4KNP A;  4HNK A;  5DZK H;  1SG4 A;  3TVU A;  2WTB A;  3P85 A;  4I52 A;  3FDU A;  4B3H A;  3KTJ A;  2J5G A;  4I42 A;  4FZW C;  5IKL B;  1UYS A;  4JYL A;  3BF0 A;  1FC6 A;  3SLL A;  5KDR A;  3Q1T A;  3IAV A;  4FND A;  5CTC A;  1J7X A;  4L6W A;  1YG8 A;  4EML A;  3TT7 A;  3TRR A;  2VSS A;  4ELX A;  3JU1 A;  2QQ3 A;  3KTG A;  5DU8 A;  3GF7 A;  4FZW A;  4OG1 A;  5E0N X;  4K3W A;  3GF3 A;  5MGB A;  2ZQR A;  2Q35 A;  2F9Y A;  3BPT A;  5CTB A;  3ZWB A;  3Q0J A;  3ZW9 A;  4ZDD A;  2FBM A;  5DTW A;  2F9Y B;  3H81 A;  2X58 A;  3ZWA A;  4JVT A;  4NEK A;  3PGQ A;  2D3T A;  2ZL3 A;  1ON3 A;  4ZDE A;  3TDC A;  5DKP A;  2FZS A;  3QK8 A;  2A7S A;  4JWV A;  1TYF A;  2YJG A;  3NJB A;  5E0S H;  2ZQQ A;  3TT6 A;  2X24 A;  2UZF A;  3H02 A;  2VSS E;  3QKA A;  1Y7O A;  3U9R B;  4B3J A;  3IB9 A;  4JOT A;  2GTR A;  4EMM A;  1HNU A;  3HRX A;  2J5I B;  4U0G A;  3T8B A;  4RYF A;  4IZD A;  3BEZ A;  3LAO A;  5HUQ A;  4B3I A;  3GKB A;  4QIJ A;  2A7K A;  3TVW A;  4WCZ A;  3IBB A;  1XNY A;  3R9Q A;  4L8K A;  5DU6 A;  3RSI A;  3ISA A;  2VSU E;  3Q0G A;  4KPK A;  1O8U A;  4RCN A;  1NZY B;  1HNO A;  2EJ5 A;  1N6D A;  3TZ3 A;  5C90 A;  4K29 A;  3MT6 A;  3H0J A;  4JCQ A;  2PG8 A;  3H0S A;  3HIN A;  4EMP A;  2VSU A;  3RST A;  1DCI A;  4KWB A;  3T89 A;  1XX4 A;  4JCS A;  1EY3 A;  3DJA A;  2ZL4 A;  5DU4 A;  3TLF A;  1N6F A;  1K32 A;  3MYB A;  1WDM A;  1HZD A;  1XNW A;  4OMR A;  3M6M A;  4ZDC A;  2ZL0 A;  4LK5 A;  4Q1I A;  3R0O A;  2F6Q A;  2ZL2 A;  2IEX A;  4RYF H;  4U0G H;  3KTH A;  3ST9 A;  5DUC A;  5G1R A;  5G1Q A;  1OD2 A;  3H0U A;  1SZO A;  4ZDB A;  4K2N A;  3QWD A;  4MOU A;  5E0S A;  5DUF A;  3HP0 A;  3MFM A;  2PPY A;  1UIY A;  3P2L A;  1TG6 A;  2VSU C;  4JCT A;  1RJN A;  1X0U A;  1UYR A;  2FW2 A; 
#chains in the Genus database with same CATH homology
 1JXZ A;  3K50 A;  3H0Q A;  2C8T A;  3STA A;  3OT6 A;  2Q34 A;  3V5E A;  3QMJ A;  3KTK A;  2J5S A;  3RRV A;  4JJT A;  3R6H A;  2CBY A;  2J5I A;  5FIF A;  3SWX A;  2Q2X A;  5JBX A;  3ZWC A;  3QYR A;  3HLN 1;  4FN8 A;  4ELW A;  3P5M A;  4QII A;  3R9T A;  3LKE A;  2J5I I;  4FNB A;  3V5I A;  4WZ8 B;  3OC7 A;  4YLH A;  3PE8 A;  1PJH A;  3HE2 A;  4U18 A;  1N6E A;  4FB8 A;  4J2U A;  3U9T B;  2VX2 A;  2J5G D;  4KD6 A;  4OLQ A;  3OME A;  4HC8 A;  4WYO B;  3Q7H A;  4U0H A;  4FJW D;  3K8X A;  2NP9 A;  4JFC A;  4Z0M A;  3TV5 A;  5DTP A;  3BPP A;  1FC7 A;  3T8A A;  1PIX A;  1Q51 A;  5DZK A;  3L3S A;  4JCR A;  4I4Z A;  1K39 A;  1Q52 A;  4NAR A;  3R9S A;  3FF6 A;  3KQF A;  1XNV A;  2BZR A;  5KJP A;  5JBW A;  4G2R A;  1EF9 A;  2VSS F;  5DL1 A;  2F9I B;  4HDT A;  3WG5 A;  5KDR B;  5FUS A;  4ZDF A;  1W2X A;  1WDK A;  3MOY A;  3PZK A;  1YG6 A;  3NJD A;  3ZW8 A;  4JSB A;  4DI1 A;  1OD4 A;  3KTI A;  4GHN A;  3M6N A;  4IZB A;  4IZC A;  3VIV A;  1RJM A;  4ZU2 A;  4QFE A;  4U1A A;  1WDL A;  3N6R B;  1WZ8 A;  1UYT A;  3U9S B;  2CE3 A;  1VRG A;  2PBP A;  3PEA A;  3QXI A;  4FN7 A;  4ASI A;  3GMA A;  3QXZ A;  4F47 A;  1FCF A;  3T88 A;  1XO6 A;  2DEO A;  1EF8 A;  1UYV A;  4GM2 A;  4Q0G A;  3DOR A;  2VSU F;  2F6I A;  2W3P A;  4NNQ A;  1FC9 A;  5ING A;  4U19 A;  1DUB A;  2F9I A;  4JYJ A;  1ON9 A;  2A81 A;  1MJ3 A;  2VRE A;  2HW5 A;  1NZY A;  4MXI A;  5INF A;  5INI A;  2DUB A;  3G64 A;  3I47 A;  4MI2 A;  3T3W A;  3QRE A;  4ELS A;  5C9G A;  5G1S A;  3GLM A;  4KNP A;  4HNK A;  5DZK H;  1SG4 A;  3TVU A;  2WTB A;  3P85 A;  4I52 A;  3FDU A;  4B3H A;  3KTJ A;  2J5G A;  4I42 A;  4FZW C;  5IKL B;  1UYS A;  4JYL A;  3BF0 A;  1FC6 A;  3SLL A;  5KDR A;  3Q1T A;  3IAV A;  4FND A;  5CTC A;  1J7X A;  4L6W A;  1YG8 A;  4EML A;  3TT7 A;  3TRR A;  2VSS A;  4ELX A;  3JU1 A;  2QQ3 A;  3KTG A;  5DU8 A;  3GF7 A;  4FZW A;  4OG1 A;  5E0N X;  4K3W A;  3GF3 A;  5MGB A;  2ZQR A;  2Q35 A;  2F9Y A;  3BPT A;  5CTB A;  3ZWB A;  3Q0J A;  3ZW9 A;  4ZDD A;  2FBM A;  5DTW A;  2F9Y B;  3H81 A;  2X58 A;  3ZWA A;  4JVT A;  4NEK A;  3PGQ A;  2D3T A;  2ZL3 A;  1ON3 A;  4ZDE A;  3TDC A;  5DKP A;  2FZS A;  3QK8 A;  2A7S A;  4JWV A;  1TYF A;  2YJG A;  3NJB A;  5E0S H;  2ZQQ A;  3TT6 A;  2X24 A;  2UZF A;  3H02 A;  2VSS E;  3QKA A;  1Y7O A;  3U9R B;  4B3J A;  3IB9 A;  4JOT A;  2GTR A;  4EMM A;  1HNU A;  3HRX A;  2J5I B;  4U0G A;  3T8B A;  4RYF A;  4IZD A;  3BEZ A;  3LAO A;  5HUQ A;  4B3I A;  3GKB A;  4QIJ A;  2A7K A;  3TVW A;  4WCZ A;  3IBB A;  1XNY A;  3R9Q A;  4L8K A;  5DU6 A;  3RSI A;  3ISA A;  2VSU E;  3Q0G A;  4KPK A;  1O8U A;  4RCN A;  1NZY B;  1HNO A;  2EJ5 A;  1N6D A;  3TZ3 A;  5C90 A;  4K29 A;  3MT6 A;  3H0J A;  4JCQ A;  2PG8 A;  3H0S A;  3HIN A;  4EMP A;  2VSU A;  3RST A;  1DCI A;  4KWB A;  3T89 A;  1XX4 A;  4JCS A;  1EY3 A;  3DJA A;  2ZL4 A;  5DU4 A;  3TLF A;  1N6F A;  1K32 A;  3MYB A;  1WDM A;  1HZD A;  1XNW A;  4OMR A;  3M6M A;  4ZDC A;  2ZL0 A;  4LK5 A;  4Q1I A;  3R0O A;  2F6Q A;  2ZL2 A;  2IEX A;  4RYF H;  4U0G H;  3KTH A;  3ST9 A;  5DUC A;  5G1R A;  5G1Q A;  1OD2 A;  3H0U A;  1SZO A;  4ZDB A;  4K2N A;  3QWD A;  4MOU A;  5E0S A;  5DUF A;  3HP0 A;  3MFM A;  2PPY A;  1UIY A;  3P2L A;  1TG6 A;  2VSU C;  4JCT A;  1RJN A;  1X0U A;  1UYR A;  2FW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...