1PJHA

Structural studies on delta3-delta2-enoyl-coa isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
266
structure length
259
Chain Sequence
b'IRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords enoyl-CoA isomerase; Eci1p
publication title Structural studies on delta(3)-delta(2)-enoyl-CoA isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 101
structure length 259
sequence length 266
chains with identical sequence B, C
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2003-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1pjhA00
1EF9A 1YG8A 3H0QA 2EJ5A 3PZKA 3QYRA 3HP0A 3P2LA 4JJTA 1X0UA 3TZ3A 1K32A 3V5EA 3ZWBA 4G2RA 5FUSA 3DORA 3GLMA 3U9RB 4FNBA 3GKBA 4B3IA 1WDLA 1JXZA 3TDCA 5CTBA 2A7KA 3R9TA 3T89A 4ZU2A 3FF6A 3HRXA 4K2NA 1UIYA 3QWDA 4EMPA 5C90A 1DUBA 1WDMA 3V5IA 2Q35A 1FCFA 5JBXA 1OD2A 5MGBA 2HW5A 4KWBA 3T88A 5KJPA 2F6IA 3TRRA 1N6EA 5DTPA 3KTJA 3T8BA 1NZYA 1TYFA 4WCZA 4KD6A 1W2XA 2FW2A 4ZDBA 3T3WA 2PG8A 1XNVA 4LK5A 1O8UA 1ON3A 4MXIA 2ZL3A 4EMLA 3NJDA 1OD4A 2ZQRA 3HINA 2F9IA 1SG4A 3ZWCA 3OT6A 3QK8A 4JVTA 3QREA 2A7SA 4JCSA 1MJ3A 3STAA 4MOUA 4FN7A 5DUCA 4F47A 2DUBA 1XNWA 2ZL4A 2PBPA 4ASIA 2GTRA 4JCTA 4ZDEA 3ZWAA 3FDUA 3KTKA 3QMJA 3ST9A 3I47A 2A81A 2VSSF 2FZSA 4EMMA 2VSUF 4OLQA 3G64A 4U0HA 4YLHA 4Z0MA 4ELXA 4JSBA 2QQ3A 3NJBA 1DCIA 2CBYA 3KTIA 5DU4A 3R6HA 5G1QA 3U9TB 4IZDA 4U0GA 3IB9A 3JU1A 4OG1A 2VX2A 2VSSE 4I4ZA 2VSUE 4FN8A 4U0GH 2Q34A 4ZDFA 3TT7A 1NZYB 2F9YB 3MFMA 4NNQA 4FZWA 4JFCA 2J5GA 3DJAA 3QXIA 1UYRA 3TV5A 3ZW8A 4ELSA 3KTHA 3ISAA 4FB8A 3Q0JA 3GMAA 3TVUA 3P85A 3TT6A 1UYTA 4L8KA 5DZKH 3VIVA 4B3HA 3KTGA 3Q1TA 2F9YA 2F9IB 3KQFA 3OMEA 1YG6A 3GF7A 1TG6A 3BPPA 2NP9A 4GHNA 2DEOA 1FC6A 5DUFA 2BZRA 2PPYA 2VREA 5IKLB 3IAVA 4JYJA 1HNOA 4OMRA 5FIFA 3ZW9A 3H02A 2X58A 5INIA 3MT6A 2FBMA 2Q2XA 3MYBA 3K50A 2D3TA 1RJNA 5E0SA 5INFA 1XNYA 4RYFH 1HNUA 2X24A 2C8TA 5E0SH 5DU6A 4K3WA 2W3PA 5DKPA 1N6FA 4ZDCA 3H0UA 3RSIA 5JBWA 5C9GA 3QKAA 3H0SA 3HLN1 4WZ8B 4U1AA 1N6DA 1XO6A 4U18A 4B3JA 1EY3A 2J5IB 3MOYA 3LKEA 3R0OA 3HE2A 4L6WA 1EF8A 3TVWA 3N6RB 3T8AA 5DU8A 4FZWC 3P5MA 2IEXA 4HC8A 2J5IA 3R9SA 3SLLA 2ZL2A 2J5SA 2WTBA 3BF0A 3U9SB 3L3SA 4QIJA 3K8XA 4K29A 1VRGA 4FNDA 3H0JA 5DZKA 5KDRA 3Q7HA 3GF3A 4JCQA 3M6NA 4JCRA 1XX4A 5INGA 3OC7A 4IZCA 5DTWA 3H81A 1Y7OA 1Q51A 5DL1A 2J5GD 4KPKA 5E0NX 3SWXA 1FC7A 1WDKA 1SZOA 1ON9A 3TLFA 4Q1IA 4JWVA 3PE8A 4ELWA 4JOTA 1UYVA 4QFEA 2ZQQA 4QIIA 4ZDDA 4DI1A 3M6MA 4RYFA 3IBBA 4JYLA 3PGQA 4FJWD 1PJHA 1FC9A 3Q0GA 2ZL0A 3RSTA 1K39A 2CE3A 3QXZA 1WZ8A 2J5II 4KNPA 5G1RA 1UYSA 3BEZA 4Q0GA 3RRVA 4IZBA 1Q52A 4HNKA 4NEKA 4RCNA 5CTCA 3LAOA 4U19A 1RJMA 4I42A 3WG5A 4I52A 2VSUC 4GM2A 4WYOB 2F6QA 2UZFA 5KDRB 1J7XA 3PEAA 1HZDA 1PIXA 5G1SA 2VSSA 2VSUA 3R9QA 4MI2A
chains in the Genus database with same CATH superfamily
1EF9A 1YG8A 3H0QA 2EJ5A 3PZKA 3QYRA 3HP0A 3P2LA 4JJTA 1X0UA 3TZ3A 1K32A 3V5EA 3ZWBA 4G2RA 5FUSA 3DORA 3GLMA 3U9RB 4FNBA 3GKBA 4B3IA 1WDLA 1JXZA 3TDCA 5CTBA 2A7KA 3R9TA 3T89A 4ZU2A 3FF6A 3HRXA 4K2NA 1UIYA 3QWDA 4EMPA 5C90A 1DUBA 1WDMA 3V5IA 2Q35A 1FCFA 5JBXA 1OD2A 5MGBA 2HW5A 4KWBA 3T88A 5KJPA 2F6IA 3TRRA 1N6EA 5DTPA 3KTJA 3T8BA 1NZYA 1TYFA 4WCZA 4KD6A 1W2XA 2FW2A 4ZDBA 3T3WA 2PG8A 1XNVA 4LK5A 1O8UA 1ON3A 4MXIA 2ZL3A 4EMLA 3NJDA 1OD4A 2ZQRA 3HINA 2F9IA 1SG4A 3ZWCA 3OT6A 3QK8A 4JVTA 3QREA 2A7SA 4JCSA 1MJ3A 3STAA 4MOUA 4FN7A 5DUCA 4F47A 2DUBA 1XNWA 2ZL4A 2PBPA 4ASIA 2GTRA 4JCTA 4ZDEA 3ZWAA 3FDUA 3KTKA 3QMJA 3ST9A 3I47A 2A81A 2VSSF 2FZSA 4EMMA 2VSUF 4OLQA 3G64A 4U0HA 4YLHA 4Z0MA 4ELXA 4JSBA 2QQ3A 3NJBA 1DCIA 2CBYA 3KTIA 5DU4A 3R6HA 5G1QA 3U9TB 4IZDA 4U0GA 3IB9A 3JU1A 4OG1A 2VX2A 2VSSE 4I4ZA 2VSUE 4FN8A 4U0GH 2Q34A 4ZDFA 3TT7A 1NZYB 2F9YB 3MFMA 4NNQA 4FZWA 4JFCA 2J5GA 3DJAA 3QXIA 1UYRA 3TV5A 3ZW8A 4ELSA 3KTHA 3ISAA 4FB8A 3Q0JA 3GMAA 3TVUA 3P85A 4NARA 3TT6A 1UYTA 4L8KA 5DZKH 3VIVA 4B3HA 3KTGA 3Q1TA 2F9YA 2F9IB 3KQFA 3OMEA 1YG6A 3GF7A 1TG6A 3BPPA 2NP9A 4GHNA 2DEOA 1FC6A 5DUFA 2BZRA 2PPYA 2VREA 5IKLB 3IAVA 4JYJA 1HNOA 4OMRA 5FIFA 3ZW9A 3H02A 2X58A 5INIA 3MT6A 2FBMA 2Q2XA 3MYBA 3K50A 2D3TA 1RJNA 5E0SA 5INFA 1XNYA 4RYFH 1HNUA 2X24A 2C8TA 5E0SH 5DU6A 4K3WA 2W3PA 5DKPA 1N6FA 4ZDCA 3H0UA 3RSIA 5JBWA 5C9GA 3QKAA 3H0SA 3HLN1 4WZ8B 4U1AA 1N6DA 1XO6A 4U18A 4B3JA 1EY3A 2J5IB 3MOYA 4J2UA 3LKEA 3R0OA 3HE2A 4L6WA 1EF8A 3TVWA 3N6RB 3T8AA 5DU8A 4FZWC 3P5MA 2IEXA 4HC8A 2J5IA 3R9SA 3SLLA 2ZL2A 2J5SA 2WTBA 3BF0A 3BPTA 3U9SB 3L3SA 4QIJA 3K8XA 4K29A 2YJGA 1VRGA 4FNDA 3H0JA 5DZKA 5KDRA 3Q7HA 3GF3A 4JCQA 3M6NA 4JCRA 1XX4A 5INGA 3OC7A 4IZCA 5DTWA 3H81A 1Y7OA 1Q51A 5DL1A 2J5GD 5HUQA 4KPKA 5E0NX 3SWXA 1FC7A 1WDKA 1SZOA 1ON9A 3TLFA 4Q1IA 4JWVA 4HDTA 3PE8A 4ELWA 4JOTA 1UYVA 4QFEA 2ZQQA 4QIIA 4ZDDA 4DI1A 3M6MA 4RYFA 3IBBA 4JYLA 3PGQA 4FJWD 1PJHA 1FC9A 3Q0GA 2ZL0A 3RSTA 1K39A 2CE3A 3QXZA 1WZ8A 2J5II 4KNPA 5G1RA 1UYSA 3BEZA 4Q0GA 3RRVA 4IZBA 1Q52A 4HNKA 4NEKA 4RCNA 5CTCA 3LAOA 4U19A 1RJMA 4I42A 3WG5A 4I52A 2VSUC 4GM2A 4WYOB 2F6QA 2UZFA 5KDRB 1J7XA 3PEAA 1HZDA 1PIXA 5G1SA 2VSSA 2VSUA 3R9QA 4MI2A
chains in the Genus database with same CATH topology
1EF9A 1YG8A 3H0QA 2EJ5A 3PZKA 3QYRA 3HP0A 3P2LA 4JJTA 1X0UA 3TZ3A 1K32A 3V5EA 3ZWBA 4G2RA 5FUSA 3DORA 3GLMA 3U9RB 4FNBA 3GKBA 4B3IA 1WDLA 1JXZA 3TDCA 5CTBA 2A7KA 3R9TA 3T89A 4ZU2A 3FF6A 3HRXA 4K2NA 1UIYA 3QWDA 4EMPA 5C90A 1DUBA 1WDMA 3V5IA 2Q35A 1FCFA 5JBXA 1OD2A 5MGBA 2HW5A 4KWBA 3T88A 5KJPA 2F6IA 3TRRA 1N6EA 5DTPA 3KTJA 3T8BA 1NZYA 1TYFA 4WCZA 4KD6A 1W2XA 2FW2A 4ZDBA 3T3WA 2PG8A 1XNVA 4LK5A 1O8UA 1ON3A 4MXIA 2ZL3A 4EMLA 3NJDA 1OD4A 2ZQRA 3HINA 2F9IA 1SG4A 3ZWCA 3OT6A 3QK8A 4JVTA 3QREA 2A7SA 4JCSA 1MJ3A 3STAA 4MOUA 4FN7A 5DUCA 4F47A 2DUBA 1XNWA 2ZL4A 2PBPA 4ASIA 2GTRA 4JCTA 4ZDEA 3ZWAA 3FDUA 3KTKA 3QMJA 3ST9A 3I47A 2A81A 2VSSF 2FZSA 4EMMA 2VSUF 4OLQA 3G64A 4U0HA 4YLHA 4Z0MA 4ELXA 4JSBA 2QQ3A 3NJBA 1DCIA 2CBYA 3KTIA 5DU4A 3R6HA 5G1QA 3U9TB 4IZDA 4U0GA 3IB9A 3JU1A 4OG1A 2VX2A 2VSSE 4I4ZA 2VSUE 4FN8A 4U0GH 2Q34A 4ZDFA 3TT7A 1NZYB 2F9YB 3MFMA 4NNQA 4FZWA 4JFCA 2J5GA 3DJAA 3QXIA 1UYRA 3TV5A 3ZW8A 4ELSA 3KTHA 3ISAA 4FB8A 3Q0JA 3GMAA 3TVUA 3P85A 4NARA 3TT6A 1UYTA 4L8KA 5DZKH 3VIVA 4B3HA 3KTGA 3Q1TA 2F9YA 2F9IB 3KQFA 3OMEA 1YG6A 3GF7A 1TG6A 3BPPA 2NP9A 4GHNA 2DEOA 1FC6A 5DUFA 2BZRA 2PPYA 2VREA 5IKLB 3IAVA 4JYJA 1HNOA 4OMRA 5FIFA 3ZW9A 3H02A 2X58A 5INIA 3MT6A 2FBMA 2Q2XA 3MYBA 3K50A 2D3TA 1RJNA 5E0SA 5INFA 1XNYA 4RYFH 1HNUA 2X24A 2C8TA 5E0SH 5DU6A 4K3WA 2W3PA 5DKPA 1N6FA 4ZDCA 3H0UA 3RSIA 5JBWA 5C9GA 3QKAA 3H0SA 3HLN1 4WZ8B 4U1AA 1N6DA 1XO6A 4U18A 4B3JA 1EY3A 2J5IB 3MOYA 4J2UA 3LKEA 3R0OA 3HE2A 4L6WA 1EF8A 3TVWA 3N6RB 3T8AA 5DU8A 4FZWC 3P5MA 2IEXA 4HC8A 2J5IA 3R9SA 3SLLA 2ZL2A 2J5SA 2WTBA 3BF0A 3BPTA 3U9SB 3L3SA 4QIJA 3K8XA 4K29A 2YJGA 1VRGA 4FNDA 3H0JA 5DZKA 5KDRA 3Q7HA 3GF3A 4JCQA 3M6NA 4JCRA 1XX4A 5INGA 3OC7A 4IZCA 5DTWA 3H81A 1Y7OA 1Q51A 5DL1A 2J5GD 5HUQA 4KPKA 5E0NX 3SWXA 1FC7A 1WDKA 1SZOA 1ON9A 3TLFA 4Q1IA 4JWVA 4HDTA 3PE8A 4ELWA 4JOTA 1UYVA 4QFEA 2ZQQA 4QIIA 4ZDDA 4DI1A 3M6MA 4RYFA 3IBBA 4JYLA 3PGQA 4FJWD 1PJHA 1FC9A 3Q0GA 2ZL0A 3RSTA 1K39A 2CE3A 3QXZA 1WZ8A 2J5II 4KNPA 5G1RA 1UYSA 3BEZA 4Q0GA 3RRVA 4IZBA 1Q52A 4HNKA 4NEKA 4RCNA 5CTCA 3LAOA 4U19A 1RJMA 4I42A 3WG5A 4I52A 2VSUC 4GM2A 4WYOB 2F6QA 2UZFA 5KDRB 1J7XA 3PEAA 1HZDA 1PIXA 5G1SA 2VSSA 2VSUA 3R9QA 4MI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF9 A;  1YG8 A;  3H0Q A;  2EJ5 A;  3PZK A;  3QYR A;  3HP0 A;  3P2L A;  4JJT A;  1X0U A;  3TZ3 A;  1K32 A;  3V5E A;  3ZWB A;  4G2R A;  5FUS A;  3DOR A;  3GLM A;  3U9R B;  4FNB A;  3GKB A;  4B3I A;  1WDL A;  1JXZ A;  3TDC A;  5CTB A;  2A7K A;  3R9T A;  3T89 A;  4ZU2 A;  3FF6 A;  3HRX A;  4K2N A;  1UIY A;  3QWD A;  4EMP A;  5C90 A;  1DUB A;  1WDM A;  3V5I A;  2Q35 A;  1FCF A;  5JBX A;  1OD2 A;  5MGB A;  2HW5 A;  4KWB A;  3T88 A;  5KJP A;  2F6I A;  3TRR A;  1N6E A;  5DTP A;  3KTJ A;  3T8B A;  1NZY A;  1TYF A;  4WCZ A;  4KD6 A;  1W2X A;  2FW2 A;  4ZDB A;  3T3W A;  2PG8 A;  1XNV A;  4LK5 A;  1O8U A;  1ON3 A;  4MXI A;  2ZL3 A;  4EML A;  3NJD A;  1OD4 A;  2ZQR A;  3HIN A;  2F9I A;  1SG4 A;  3ZWC A;  3OT6 A;  3QK8 A;  4JVT A;  3QRE A;  2A7S A;  4JCS A;  1MJ3 A;  3STA A;  4MOU A;  4FN7 A;  5DUC A;  4F47 A;  2DUB A;  1XNW A;  2ZL4 A;  2PBP A;  4ASI A;  2GTR A;  4JCT A;  4ZDE A;  3ZWA A;  3FDU A;  3KTK A;  3QMJ A;  3ST9 A;  3I47 A;  2A81 A;  2VSS F;  2FZS A;  4EMM A;  2VSU F;  4OLQ A;  3G64 A;  4U0H A;  4YLH A;  4Z0M A;  4ELX A;  4JSB A;  2QQ3 A;  3NJB A;  1DCI A;  2CBY A;  3KTI A;  5DU4 A;  3R6H A;  5G1Q A;  3U9T B;  4IZD A;  4U0G A;  3IB9 A;  3JU1 A;  4OG1 A;  2VX2 A;  2VSS E;  4I4Z A;  2VSU E;  4FN8 A;  4U0G H;  2Q34 A;  4ZDF A;  3TT7 A;  1NZY B;  2F9Y B;  3MFM A;  4NNQ A;  4FZW A;  4JFC A;  2J5G A;  3DJA A;  3QXI A;  1UYR A;  3TV5 A;  3ZW8 A;  4ELS A;  3KTH A;  3ISA A;  4FB8 A;  3Q0J A;  3GMA A;  3TVU A;  3P85 A;  3TT6 A;  1UYT A;  4L8K A;  5DZK H;  3VIV A;  4B3H A;  3KTG A;  3Q1T A;  2F9Y A;  2F9I B;  3KQF A;  3OME A;  1YG6 A;  3GF7 A;  1TG6 A;  3BPP A;  2NP9 A;  4GHN A;  2DEO A;  1FC6 A;  5DUF A;  2BZR A;  2PPY A;  2VRE A;  5IKL B;  3IAV A;  4JYJ A;  1HNO A;  4OMR A;  5FIF A;  3ZW9 A;  3H02 A;  2X58 A;  5INI A;  3MT6 A;  2FBM A;  2Q2X A;  3MYB A;  3K50 A;  2D3T A;  1RJN A;  5E0S A;  5INF A;  1XNY A;  4RYF H;  1HNU A;  2X24 A;  2C8T A;  5E0S H;  5DU6 A;  4K3W A;  2W3P A;  5DKP A;  1N6F A;  4ZDC A;  3H0U A;  3RSI A;  5JBW A;  5C9G A;  3QKA A;  3H0S A;  3HLN 1;  4WZ8 B;  4U1A A;  1N6D A;  1XO6 A;  4U18 A;  4B3J A;  1EY3 A;  2J5I B;  3MOY A;  3LKE A;  3R0O A;  3HE2 A;  4L6W A;  1EF8 A;  3TVW A;  3N6R B;  3T8A A;  5DU8 A;  4FZW C;  3P5M A;  2IEX A;  4HC8 A;  2J5I A;  3R9S A;  3SLL A;  2ZL2 A;  2J5S A;  2WTB A;  3BF0 A;  3U9S B;  3L3S A;  4QIJ A;  3K8X A;  4K29 A;  1VRG A;  4FND A;  3H0J A;  5DZK A;  5KDR A;  3Q7H A;  3GF3 A;  4JCQ A;  3M6N A;  4JCR A;  1XX4 A;  5ING A;  3OC7 A;  4IZC A;  5DTW A;  3H81 A;  1Y7O A;  1Q51 A;  5DL1 A;  2J5G D;  4KPK A;  5E0N X;  3SWX A;  1FC7 A;  1WDK A;  1SZO A;  1ON9 A;  3TLF A;  4Q1I A;  4JWV A;  3PE8 A;  4ELW A;  4JOT A;  1UYV A;  4QFE A;  2ZQQ A;  4QII A;  4ZDD A;  4DI1 A;  3M6M A;  4RYF A;  3IBB A;  4JYL A;  3PGQ A;  4FJW D;  1PJH A;  1FC9 A;  3Q0G A;  2ZL0 A;  3RST A;  1K39 A;  2CE3 A;  3QXZ A;  1WZ8 A;  2J5I I;  4KNP A;  5G1R A;  1UYS A;  3BEZ A;  4Q0G A;  3RRV A;  4IZB A;  1Q52 A;  4HNK A;  4NEK A;  4RCN A;  5CTC A;  3LAO A;  4U19 A;  1RJM A;  4I42 A;  3WG5 A;  4I52 A;  2VSU C;  4GM2 A;  4WYO B;  2F6Q A;  2UZF A;  5KDR B;  1J7X A;  3PEA A;  1HZD A;  1PIX A;  5G1S A;  2VSS A;  2VSU A;  3R9Q A;  4MI2 A; 
#chains in the Genus database with same CATH topology
 1EF9 A;  1YG8 A;  3H0Q A;  2EJ5 A;  3PZK A;  3QYR A;  3HP0 A;  3P2L A;  4JJT A;  1X0U A;  3TZ3 A;  1K32 A;  3V5E A;  3ZWB A;  4G2R A;  5FUS A;  3DOR A;  3GLM A;  3U9R B;  4FNB A;  3GKB A;  4B3I A;  1WDL A;  1JXZ A;  3TDC A;  5CTB A;  2A7K A;  3R9T A;  3T89 A;  4ZU2 A;  3FF6 A;  3HRX A;  4K2N A;  1UIY A;  3QWD A;  4EMP A;  5C90 A;  1DUB A;  1WDM A;  3V5I A;  2Q35 A;  1FCF A;  5JBX A;  1OD2 A;  5MGB A;  2HW5 A;  4KWB A;  3T88 A;  5KJP A;  2F6I A;  3TRR A;  1N6E A;  5DTP A;  3KTJ A;  3T8B A;  1NZY A;  1TYF A;  4WCZ A;  4KD6 A;  1W2X A;  2FW2 A;  4ZDB A;  3T3W A;  2PG8 A;  1XNV A;  4LK5 A;  1O8U A;  1ON3 A;  4MXI A;  2ZL3 A;  4EML A;  3NJD A;  1OD4 A;  2ZQR A;  3HIN A;  2F9I A;  1SG4 A;  3ZWC A;  3OT6 A;  3QK8 A;  4JVT A;  3QRE A;  2A7S A;  4JCS A;  1MJ3 A;  3STA A;  4MOU A;  4FN7 A;  5DUC A;  4F47 A;  2DUB A;  1XNW A;  2ZL4 A;  2PBP A;  4ASI A;  2GTR A;  4JCT A;  4ZDE A;  3ZWA A;  3FDU A;  3KTK A;  3QMJ A;  3ST9 A;  3I47 A;  2A81 A;  2VSS F;  2FZS A;  4EMM A;  2VSU F;  4OLQ A;  3G64 A;  4U0H A;  4YLH A;  4Z0M A;  4ELX A;  4JSB A;  2QQ3 A;  3NJB A;  1DCI A;  2CBY A;  3KTI A;  5DU4 A;  3R6H A;  5G1Q A;  3U9T B;  4IZD A;  4U0G A;  3IB9 A;  3JU1 A;  4OG1 A;  2VX2 A;  2VSS E;  4I4Z A;  2VSU E;  4FN8 A;  4U0G H;  2Q34 A;  4ZDF A;  3TT7 A;  1NZY B;  2F9Y B;  3MFM A;  4NNQ A;  4FZW A;  4JFC A;  2J5G A;  3DJA A;  3QXI A;  1UYR A;  3TV5 A;  3ZW8 A;  4ELS A;  3KTH A;  3ISA A;  4FB8 A;  3Q0J A;  3GMA A;  3TVU A;  3P85 A;  4NAR A;  3TT6 A;  1UYT A;  4L8K A;  5DZK H;  3VIV A;  4B3H A;  3KTG A;  3Q1T A;  2F9Y A;  2F9I B;  3KQF A;  3OME A;  1YG6 A;  3GF7 A;  1TG6 A;  3BPP A;  2NP9 A;  4GHN A;  2DEO A;  1FC6 A;  5DUF A;  2BZR A;  2PPY A;  2VRE A;  5IKL B;  3IAV A;  4JYJ A;  1HNO A;  4OMR A;  5FIF A;  3ZW9 A;  3H02 A;  2X58 A;  5INI A;  3MT6 A;  2FBM A;  2Q2X A;  3MYB A;  3K50 A;  2D3T A;  1RJN A;  5E0S A;  5INF A;  1XNY A;  4RYF H;  1HNU A;  2X24 A;  2C8T A;  5E0S H;  5DU6 A;  4K3W A;  2W3P A;  5DKP A;  1N6F A;  4ZDC A;  3H0U A;  3RSI A;  5JBW A;  5C9G A;  3QKA A;  3H0S A;  3HLN 1;  4WZ8 B;  4U1A A;  1N6D A;  1XO6 A;  4U18 A;  4B3J A;  1EY3 A;  2J5I B;  3MOY A;  4J2U A;  3LKE A;  3R0O A;  3HE2 A;  4L6W A;  1EF8 A;  3TVW A;  3N6R B;  3T8A A;  5DU8 A;  4FZW C;  3P5M A;  2IEX A;  4HC8 A;  2J5I A;  3R9S A;  3SLL A;  2ZL2 A;  2J5S A;  2WTB A;  3BF0 A;  3BPT A;  3U9S B;  3L3S A;  4QIJ A;  3K8X A;  4K29 A;  2YJG A;  1VRG A;  4FND A;  3H0J A;  5DZK A;  5KDR A;  3Q7H A;  3GF3 A;  4JCQ A;  3M6N A;  4JCR A;  1XX4 A;  5ING A;  3OC7 A;  4IZC A;  5DTW A;  3H81 A;  1Y7O A;  1Q51 A;  5DL1 A;  2J5G D;  5HUQ A;  4KPK A;  5E0N X;  3SWX A;  1FC7 A;  1WDK A;  1SZO A;  1ON9 A;  3TLF A;  4Q1I A;  4JWV A;  4HDT A;  3PE8 A;  4ELW A;  4JOT A;  1UYV A;  4QFE A;  2ZQQ A;  4QII A;  4ZDD A;  4DI1 A;  3M6M A;  4RYF A;  3IBB A;  4JYL A;  3PGQ A;  4FJW D;  1PJH A;  1FC9 A;  3Q0G A;  2ZL0 A;  3RST A;  1K39 A;  2CE3 A;  3QXZ A;  1WZ8 A;  2J5I I;  4KNP A;  5G1R A;  1UYS A;  3BEZ A;  4Q0G A;  3RRV A;  4IZB A;  1Q52 A;  4HNK A;  4NEK A;  4RCN A;  5CTC A;  3LAO A;  4U19 A;  1RJM A;  4I42 A;  3WG5 A;  4I52 A;  2VSU C;  4GM2 A;  4WYO B;  2F6Q A;  2UZF A;  5KDR B;  1J7X A;  3PEA A;  1HZD A;  1PIX A;  5G1S A;  2VSS A;  2VSU A;  3R9Q A;  4MI2 A; 
#chains in the Genus database with same CATH homology
 1EF9 A;  1YG8 A;  3H0Q A;  2EJ5 A;  3PZK A;  3QYR A;  3HP0 A;  3P2L A;  4JJT A;  1X0U A;  3TZ3 A;  1K32 A;  3V5E A;  3ZWB A;  4G2R A;  5FUS A;  3DOR A;  3GLM A;  3U9R B;  4FNB A;  3GKB A;  4B3I A;  1WDL A;  1JXZ A;  3TDC A;  5CTB A;  2A7K A;  3R9T A;  3T89 A;  4ZU2 A;  3FF6 A;  3HRX A;  4K2N A;  1UIY A;  3QWD A;  4EMP A;  5C90 A;  1DUB A;  1WDM A;  3V5I A;  2Q35 A;  1FCF A;  5JBX A;  1OD2 A;  5MGB A;  2HW5 A;  4KWB A;  3T88 A;  5KJP A;  2F6I A;  3TRR A;  1N6E A;  5DTP A;  3KTJ A;  3T8B A;  1NZY A;  1TYF A;  4WCZ A;  4KD6 A;  1W2X A;  2FW2 A;  4ZDB A;  3T3W A;  2PG8 A;  1XNV A;  4LK5 A;  1O8U A;  1ON3 A;  4MXI A;  2ZL3 A;  4EML A;  3NJD A;  1OD4 A;  2ZQR A;  3HIN A;  2F9I A;  1SG4 A;  3ZWC A;  3OT6 A;  3QK8 A;  4JVT A;  3QRE A;  2A7S A;  4JCS A;  1MJ3 A;  3STA A;  4MOU A;  4FN7 A;  5DUC A;  4F47 A;  2DUB A;  1XNW A;  2ZL4 A;  2PBP A;  4ASI A;  2GTR A;  4JCT A;  4ZDE A;  3ZWA A;  3FDU A;  3KTK A;  3QMJ A;  3ST9 A;  3I47 A;  2A81 A;  2VSS F;  2FZS A;  4EMM A;  2VSU F;  4OLQ A;  3G64 A;  4U0H A;  4YLH A;  4Z0M A;  4ELX A;  4JSB A;  2QQ3 A;  3NJB A;  1DCI A;  2CBY A;  3KTI A;  5DU4 A;  3R6H A;  5G1Q A;  3U9T B;  4IZD A;  4U0G A;  3IB9 A;  3JU1 A;  4OG1 A;  2VX2 A;  2VSS E;  4I4Z A;  2VSU E;  4FN8 A;  4U0G H;  2Q34 A;  4ZDF A;  3TT7 A;  1NZY B;  2F9Y B;  3MFM A;  4NNQ A;  4FZW A;  4JFC A;  2J5G A;  3DJA A;  3QXI A;  1UYR A;  3TV5 A;  3ZW8 A;  4ELS A;  3KTH A;  3ISA A;  4FB8 A;  3Q0J A;  3GMA A;  3TVU A;  3P85 A;  4NAR A;  3TT6 A;  1UYT A;  4L8K A;  5DZK H;  3VIV A;  4B3H A;  3KTG A;  3Q1T A;  2F9Y A;  2F9I B;  3KQF A;  3OME A;  1YG6 A;  3GF7 A;  1TG6 A;  3BPP A;  2NP9 A;  4GHN A;  2DEO A;  1FC6 A;  5DUF A;  2BZR A;  2PPY A;  2VRE A;  5IKL B;  3IAV A;  4JYJ A;  1HNO A;  4OMR A;  5FIF A;  3ZW9 A;  3H02 A;  2X58 A;  5INI A;  3MT6 A;  2FBM A;  2Q2X A;  3MYB A;  3K50 A;  2D3T A;  1RJN A;  5E0S A;  5INF A;  1XNY A;  4RYF H;  1HNU A;  2X24 A;  2C8T A;  5E0S H;  5DU6 A;  4K3W A;  2W3P A;  5DKP A;  1N6F A;  4ZDC A;  3H0U A;  3RSI A;  5JBW A;  5C9G A;  3QKA A;  3H0S A;  3HLN 1;  4WZ8 B;  4U1A A;  1N6D A;  1XO6 A;  4U18 A;  4B3J A;  1EY3 A;  2J5I B;  3MOY A;  4J2U A;  3LKE A;  3R0O A;  3HE2 A;  4L6W A;  1EF8 A;  3TVW A;  3N6R B;  3T8A A;  5DU8 A;  4FZW C;  3P5M A;  2IEX A;  4HC8 A;  2J5I A;  3R9S A;  3SLL A;  2ZL2 A;  2J5S A;  2WTB A;  3BF0 A;  3BPT A;  3U9S B;  3L3S A;  4QIJ A;  3K8X A;  4K29 A;  2YJG A;  1VRG A;  4FND A;  3H0J A;  5DZK A;  5KDR A;  3Q7H A;  3GF3 A;  4JCQ A;  3M6N A;  4JCR A;  1XX4 A;  5ING A;  3OC7 A;  4IZC A;  5DTW A;  3H81 A;  1Y7O A;  1Q51 A;  5DL1 A;  2J5G D;  5HUQ A;  4KPK A;  5E0N X;  3SWX A;  1FC7 A;  1WDK A;  1SZO A;  1ON9 A;  3TLF A;  4Q1I A;  4JWV A;  4HDT A;  3PE8 A;  4ELW A;  4JOT A;  1UYV A;  4QFE A;  2ZQQ A;  4QII A;  4ZDD A;  4DI1 A;  3M6M A;  4RYF A;  3IBB A;  4JYL A;  3PGQ A;  4FJW D;  1PJH A;  1FC9 A;  3Q0G A;  2ZL0 A;  3RST A;  1K39 A;  2CE3 A;  3QXZ A;  1WZ8 A;  2J5I I;  4KNP A;  5G1R A;  1UYS A;  3BEZ A;  4Q0G A;  3RRV A;  4IZB A;  1Q52 A;  4HNK A;  4NEK A;  4RCN A;  5CTC A;  3LAO A;  4U19 A;  1RJM A;  4I42 A;  3WG5 A;  4I52 A;  2VSU C;  4GM2 A;  4WYO B;  2F6Q A;  2UZF A;  5KDR B;  1J7X A;  3PEA A;  1HZD A;  1PIX A;  5G1S A;  2VSS A;  2VSU A;  3R9Q A;  4MI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...