1PJLA

Crystal structure of human m-nad-me in ternary complex with nad and lu3+
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
551
structure length
551
Chain Sequence
EKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potent and competitive inhibition of malic enzymes by lanthanide ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords NAD-dependent malic enzyme, mitochondrial
total genus 159
structure length 551
sequence length 551
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2003-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pjlA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1pjlA01
1D3AA 4GSLA 3E1KA 4UEJA 2GPTA 3GAZA 4BNWA 5FI5A 4WCDA 1M6WA 1NQOA 2YV1A 2YQ4A 5T57A 4RPLA 3K2EA 4MVJM 3WWZA 1DC6A 1XCBA 3PI7A 3L4SO 2PV7A 2F00A 2VHYA 2DUUA 2V6GA 4LCEA 5IZCC 4IDEA 3DBLB 3LYLA 3ZHBA 5KJFA 4RDIA 3U3XA 4IIVA 3UXYA 1ISIA 5MGBA 4J4HA 3AUAA 3IP3A 4FGWA 4DVJA 1JKIA 4FR5A 1RPNA 2YHIA 3E5MA 1WDKA 4CM4A 2G17A 1ZCJA 2NVBA 4WJZA 2OL4A 4JBIA 4EYEA 1IL0A 3GDGA 4A73A 2QYSA 1W8DA 1SO8A 3AY6A 2BKAA 4EJ6A 3N74A 4XA8A 2PZJA 5EMHA 5HS6A 1T2AA 1NHWA 4IGEA 4BNMA 1H2BA 1I3KA 4PCVA 4U5QA 1NXQA 2B0JA 4R1NA 2O2SA 1WDMA 4DLBA 1C1DB 1HDRA 1WLYA 2Q3EA 4B4VA 5G0UA 4R1SA 3ZNPA 2Q1UA 4N18A 1ZEMA 4J1SA 2JCXA 4CV2A 2QIOA 4R68A 4HXYA 2AG8A 4BB6A 2F1KA 4KUGA 3ADOA 4XB1A 4U0JA 1PEDA 3IUSA 4S3MA 2OMEA 4YJDA 4XRRA 4YAJA 1UXJA 3ASUA 5AOVA 1E77A 1PR9A 1XKQA 4M55A 4II3A 3JQAD 3P19A 4QEDA 2VRCD 3KO8A 1O6ZA 3EUWA 4AJPA 2PD4A 3BMCB 2IE0A 3PJDA 1V3UA 4CQMB 2NADA 2PD6A 4PLYA 5JAMA 4BQRA 3ZW9A 2C0CA 1E7SA 4OSOA 3RUHA 1LDYA 4AL4A 3MJSA 5K6AA 3PYXA 1YONA 1SCUA 5IDQA 2ILTA 4NBRA 2VZ0A 1HSOA 1D8AA 4M89A 4KDFA 4EBFA 4GSKA 1ISMA 3GY0A 4R4JA 3GVIA 2CF6A 3W6ZA 2BELA 2PKQP 2O3SA 3ETGA 2HSDA 2QRJA 3DOJA 4CUKA 3SC6A 1LC3A 4DMLA 1LLUA 4PLHA 4OM8A 4XWYA 5TGDA 4J1NA 4H15A 2AMFA 4ZRMA 3RAJA 5L45A 3H3FA 4YCAA 4FFOA 1PQWA 1T1RA 1I10A 4EEXA 3WDSA 1YDEA 2GZ3A 3LZ6A 1T26A 4E31A 3S2EA 4B8WA 3JD1A 2IYOA 3H9EO 4D41A 1KY4A 1EE2A 2P9GA 3RUIA 4K9DA 4OKNA 2X8LA 2PZKA 1WDLA 5BSHA 1E1KA 1YB1A 3OEYA 2GUGA 3INTA 5A05A 2I76A 2V6MA 3ZHYA 4NBVA 4BV8A 3QWAA 3DAGA 2YYYA 3K92A 1EE9A 3AUTA 1VKOA 3WSVA 4RF2A 4XDYA 1TA4A 4HWKA 2C7VA 3DMTC 2Z1NA 4GWKA 3I1JA 5IZCA 4NJMB 3U4HA 1H9BA 3TZCA 4MIYA 1T2FA 3MJVA 5IN5A 2AE1A 5JE8A 8ADHA 4IDGA 2FPIA 3NDJA 4FB5A 4MKXA 2DTDA 4PVCA 1U3WA 2RHRA 2X9VA 2HRBA 1IPFA 1ZK0A 2OBNA 3FSRA 3EHEA 4IDFA 1JN0A 1WW8A 1E6EA 3LQFA 1PS9A 5JDCC 2AQKA 1ENPA 4DPLA 1BGVA 5CDTA 2OORA 1E3IA 1O0SA 3FD8A 4HUJA 1I3NA 1QYXA 4P38A 3L77A 4NBTA 5DBIA 3Q6IA 3FF4A 1D7OA 2BGLA 4NJOA 3WYEA 3OSUA 3PZRA 2VUTA 4CR6A 1H94A 3GZNB 3I9MA 1WWKA 2I67A 3OJFA 1NNUA 4XD2A 4CM6A 4WEOA 1HDZA 3JQ9C 1K3TA 3GGOA 5JDIC 5JYEA 2WYWA 5KJCA 3HUDA 1RM3A 3Q1LA 4E3ZA 2FP4A 3Q9UA 4GH5A 1GR0A 2NACA 2FMUA 2ZJ1A 3HDJA 3AWDA 2VNAA 3GEMA 4YJFB 4CODB 1HE3A 1UDCA 5CG1A 2EP7A 4IZIA 3Q9NA 1IYZA 5A3JA 2J5KA 3ENNA 1Y8RA 1X7DA 2DU8A 4FD3A 3EGOA 3PXXA 3NJ4A 3ROPA 1XU7A 3I5MA 3ETDA 2JD1A 5CDGA 3DDNA 3LLSA 5EQFA 1NAHA 1K0UA 1WP4A 3HADA 5JBIA 5JDIA 4XGNA 5F3RA 3UW3A 1LSOA 4UREA 3BIOA 1MC5A 1L7EA 4RPHA 1NFFA 4OQZA 4AJOA 2GZ1A 1DOHA 5KKCA 2XOXA 2VYNA 3WQQA 2WD7B 1R4NB 2PWZA 2DBZA 3GVHA 3CMMA 3VVBA 4UUMA 5A4DA 2GD1O 1HDXA 1LRJA 4IIUA 4PG6A 1GFSA 4TWRA 2C29D 2B37A 4EEZA 3KXDA 1B26A 4YT8A 3L6EA 4BO6A 1LNQA 1PJ4A 1V6AA 1U4SA 3AI1A 4ZQBA 4ND3A 1ZSYA 1XU9A 2C2YA 1ZIDA 3GMDA 1VSUA 3PJEA 4B79A 4DBZA 3GPDG 5C7IO 1Q7BA 5TLSA 3PLNA 2AQHA 4JJFA 1O8CA 3JQ8B 2Q2QA 4AJHA 1BW9B 1OOEA 4LN1A 4BNTA 4J16A 1Y81A 4TVBA 1P1FA 1EUZA 1RJWA 3BHJA 3D5TA 1ZSVA 2NTNA 3GQVA 3FNEA 1JTVA 3JYPA 3UOGA 4MVJH 4JQCA 3BTOA 5IJZA 4U6QA 2WD7A 3GA0A 1EK5A 3ZW8A 4N7RA 1Y8QB 3DZKA 4R01A 3ICCA 4M8SA 3S2IA 5JY1A 5T6BA 5COQA 5HWSA 4BMNA 5JYDA 4LRTB 2WTBA 1K6XA 1XGKA 6ADHA 3DC2A 4YAIA 1RM0A 4YAGA 1U4OA 4BNLA 1NM5A 3OQ6A 2GN8A 2HO5A 1WMBA 2X5KO 1LX6A 3ANMA 1PJLA 4CL8A 3FNHA 4GGOA 3FBTA 1ZW1A 5ADHA 3ZWYA 4CMCA 1SEPA 3M2PA 1AHHA 3TN7A 5JAQA 1PS0A 4EITA 4DIBA 1HYHA 4II2A 3RI3A 1I33A 4DLLA 3K30A 1YL6A 3BMOA 3GRPA 4OXYA 1NYTA 4ND5A 5ITWA 5KOIA 3ZWAA 4NJMA 5FEUA 1GTMA 2FHSA 3W1VA 5L51A 2X0NA 1CWUA 3GRKA 4GVXA 1ADCA 2B35A 4DIFA 4ZQEA 5EIOA 4AJLA 2JL1A 5LC1A 4B4WA 4BNFA 4C7JA 3CUKA 2D2IA 5AYVA 1YJQA 2NU7A 1BXKA 4DA9A 4CM5A 2EKPA 2W90A 4OIMA 1R4MA 4QFCA 3X2FA 2ZJ0A 4YJFA 3G3EA 5BNTA 1XEAA 3F5SA 2C54A 1O9BA 1NQAO 5CPBA 3A14A 3D7LA 4J7CA 3G1TA 4BNJA 3I9NA 2VHWA 4XIJA 4HNHA 4NPCA 3ANNA 1LLQA 1CIVA 4RL6A 3JD3A 4ZGWA 4W6ZA 1GYRA 4CLHA 1SPXA 2BD0A 1UR5A 4KZPA 2C7GA 4IY1A 1CEQA 3KSZO 3V2UA 3JQGA 4D3DA 1QYDA 4RLHA 2GZ2A 1SAYA 3SEFA 2W4QA 2PY6A 4BNIA 4D42A 4WOKA 3BMNA 3I6IA 4PLTA 5KVQA 4J1QA 1DRUA 1QKIA 1YS4A 4YRAA 2Y99A 2PGDA 3SBOA 3QWFA 4EI2A 1UP7A 3AOEC 1DIRA 1EK6A 1VJ1A 2Y66A 3KZVA 3NGXA 3O8QA 4D3FA 4I1IA 4BVAA 1C1XB 2SCUA 3D3WB 4MKZA 2ZK7A 4TSKA 1B8PA 3FCOA 1DSSG 5G4KB 2X5JO 2E37A 2G76A 1IOLA 2GERA 3I9OA 2HRZA 1GV1A 3DOCA 4OXNA 1SC6A 2VOEA 1B8UA 9LDTA 4MDHA 3GZNA 3KEQA 4J91A 2VUUA 2XAAA 3HFGA 3Q2KA 4AG3A 3DBRA 1MG0A 1PJSA 1U7TA 2X86A 3DBVO 3PYLA 4CV1A 4ZVVA 4K26A 4KQWA 4OL9A 4ID9A 1E3SA 3RBVA 3ZU4A 3F4LA 4BO8A 4B7XA 4O0LA 3RKUA 5ER9A 1PL6A 1VC2A 4NG5A 2FN7A 5TC4A 3LC7O 4I9NA 1JA9A 1ZBQA 1A7KA 4FGSA 4J0EA 1G1AA 4RF4A 1PX0A 3ITDA 2YHUA 5KJ1A 4XYEA 1X0XA 1FJHA 4RO0A 4LISA 1M6HA 3RUCA 3MTJA 2QZ9A 4MIOA 3L6DA 1H6BA 1DIHA 1HDYA 1Y5MA 2O3UA 2OBYA 1GD1O 4GKVA 3U49A 1RWBA 3WR5A 1QYWA 2DPGA 3O9ZA 4TRRA 5JAIA 1VE9A 1VJ0A 3ZZNA 1YGYA 3QVWA 3C85A 3JQBC 5C5IA 4TRJA 3CPSA 3F9IA 2C2XA 3OJOA 5C3MA 1N9GA 3JV7A 4IUYA 4HBGA 3WG9A 3V2HA 3H9JA 1UXHA 1ZSNA 2EV9A 4CMBA 2NVUB 2A35A 3RASA 3WXBA 1N7GA 1E1LA 1NPTO 1W73A 1X7GA 1BHSA 3WMXA 1LDGA 3DTTA 3SLGA 3WICA 5THQA 3WBBA 1TT5A 1ONOA 4AJKA 1M67A 4CJXA 4Z6KA 1P3DA 5I9NA 2JFGA 4RVSA 1GZ4A 4CQLA 3KSUA 2B83A 4FQ8A 2EKQA 2DFVA 1Z6ZA 3PK0A 3FNFA 4GQAA 4TQGA 2EWMA 2AEFA 2VTDA 3X2EA 3C3XA 3FPCA 2J3KA 2YDYA 5EERA 4E32A 1PWZA 2J6IA 2QW8A 3H9QA 3IOYA 4I5FA 5ILGA 1HE5A 1D1TA 4OAQA 1HZZA 4ZN6A 5IDWA 2O3QA 3DZIA 3LF1A 1O89A 3E9NA 3WNVA 2IXAA 4D79A 1WZEA 3QVXA 3AK4A 2UUOA 3CZMA 2HLPA 4LMRA 3MJCA 3NEPX 4JJGA 2NVUA 1W4ZA 4NU5A 1ISFA 3KUXA 1JVSA 2X0IA 3M6IA 4Q3EA 1LRLA 3D64A 3LU1A 4C4OA 3DBLA 3F1KA 3GEGA 5B4UA 1A71A 2ZB8A 5J23A 3VDRA 2NUAA 4FJ0A 2I65A 3KM0A 5IF3A 2CDBA 3KYBA 4R51A 5TT0A 2D5AA 1KEUA 3PQDA 2NU9A 3DXFA 2FR0A 5JAZA 4NDNE 5DZSA 3RQSA 3T4EA 3BMCA 1N1GA 1QYVA 3ZNQA 4P4GA 2YHIB 5T64A 3DZJA 1J0XO 4IXWA 2ZATA 5CP8A 4UEKA 1ZVMA 3WTCA 4CQLB 3RFXA 4CMJA 5A9TA 1YJ8A 4KDEA 1YWGO 4OGWA 4Y9DA 5GMOA 5TJHA 1RYEA 1G6KA 1U28A 3AY3A 2BFOA 3GHHA 3GC6A 4OJNA 4YB8A 5JO0A 1VKNA 5BT9A 4CM8B 5TRTA 4BNXA 4ZICA 5TIIA 4NQZA 2Q99A 3S2GA 2GCGA 4J9UE 4FFRA 1ONPA 2IZZA 1XR3A 4Q39A 4CMEA 3ZV4A 1V8BA 1HE4A 3DL2A 4HKTA 3WFIA 2YDXA 3WFJA 4E2ZA 4NK4A 2A4KA 4E5YA 3AM3A 4WK6A 3T7EA 3V2GA 4P4NA 4JBGA 4CM4B 3Q2IA 3BZUA 1H2HA 1Q0LA 2BLLA 1GU7A 3I9JA 3M1AA 4K6CA 4CM9A 2JD2A 4BNGA 1ZZEA 3F3SA 4LMPA 4WCFC 4DMMA 5KCZA 1VSVA 3WIEA 3HB5X 3SJ7A 2BFAA 2IODA 4P22A 2VRCA 1JKFA 3WX0A 1X1TA 4D46A 3C8MA 4OQYA 2YFHA 3FTNA 1F14A 2PTGA 3AM4A 3GF4A 2HCTA 1C0IA 5JLAA 4CLXA 1ZEJA 5TQVA 2UYYA 4DRYA 3NTQA 1OI7A 3KB6A 2IYPA 3C7DB 4BO1A 3KHUA 4GLLA 4LRSB 2CDCA 3W8FA 1LLDA 1OBFO 3GG2A 3QQPA 1T2EA 3WSWA 4BKQA 4GMGA 3JTMA 4WPGA 3WGIA 3D1LA 1R15A 4CR7A 3V1TC 1PQPA 4F6LA 2GN4A 2B69A 5AXBA 1JKJA 2EHDA 2Y68A 4XGKA 3B1FA 1H6CA 2JHFA 2AXQA 3INRA 3GVCA 4CPDA 1R4MB 3ZU2A 1YKFA 3F4BA 3E9MA 3GGGA 2FZEA 2X0JA 2CVZA 1MLDA 4ZD6A 2O3TA 4NBUA 1ISJA 2WSBA 1F12A 3LC2O 1PWXA 4OOFA 1VL8A 1DC3A 1PGNA 1HDCA 2AEMA 2FY8A 2EEZA 4M87A 4HADA 4QFDA 4YACA 4R5HA 3PHHA 4NI5A 2W98A 3K96A 3GK3A 3DZHA 3PYMA 3LSYA 3I9KA 2Y05A 2P9EA 4NFSA 4CV0A 3EYWA 1QMGA 3KYDA 2Z5LA 3KETA 5HBRA 4CV3A 4F6CA 5JMWA 4CMIB 1ZK1A 1PJQA 4R69A 1U5CA 4IQ8A 3U4DA 3TFOA 1HYGA 3HWRA 5JW6A 3WGZA 2WYVA 2A94A 1W0CA 2QHXA 4L0QA 3GEDA 4PZDA 4B3IA 2V6BA 2O4CA 2Z95A 5F5NA 2DPHA 5DNAA 2VT2A 2UAGA 2G0TA 3BA1A 3VTZA 2P4HX 5AXDA 5ES3A 5DCWA 4QQRA 2Y0DA 3DBHA 4NFHA 4HP8A 1LDMA 2WE8A 2BRUA 3U62A 4ALNA 2ZYGA 3I3OA 1DRWA 1QV7A 3HFSA 4JGBA 2GN9A 4BS9A 3PFWO 2X5OA 1HETA 4E5NA 4XYBA 3ZI0A 4MO2A 1NFQA 4BNVA 4QO7A 4YAKA 1JQBA 3P2YA 2FSVA 3F47A 3FWNA 4BNHA 1DAOA 1KVQA 3QJ5A 4URFA 1P31A 3UCEA 3CIFA 1PJ2A 1V9LA 2W2LD 1SZJG 2Q4BA 4AVYA 2W2KB 4RQUA 2Y1GA 1KVRA 1LUAA 1P9LA 2ZB7A 1KEVA 2VT3A 1B8VA 1ZK4A 2EJWA 4D43A 3JD4A 5COAA 1GUYA 2CF5A 1A9YA 1GUZA 4E5PA 3F1LA 1SOWA 2JJYA 2B36A 1ZJYA 1P1RA 4UVDA 2I5PO 1PSDA 3E8XA 1VLLA 3NDRA 1ADFA 1O5IA 5L4SA 3RWBA 4FW8A 1LI4A 3ABIA 2Y0CA 3PP8A 4KTTE 1I0ZA 1Y1PA 5CG2A 4IXTA 3UF0A 4J43A 3VPFA 4PG7A 1E5QA 3WGGA 1TEHA 3JQAA 5DOVA 4J4TA 1LJ8A 1QV6A 4QXMA 1ZFNA 2GO1A 4YVFA 3KYCA 2VUSA 3KLMX 2J3IA 3AI2A 1UXGA 5ER6A 1OC2A 4I9UA 3L0DA 5H81A 1F17A 1KY5A 4TRNA 3JYLA 4PRLA 4A27A 4B4UA 3H5RA 4BV9A 4CR8A 4CLDA 4FJ1A 1J5PA 3NT2A 1J6UA 4FBGA 4OH1A 4E12A 1QLHA 3M1LA 4LSMA 4XCVA 4Q3AA 1GPJA 3BMOB 3VZPA 4R5MA 4O6VA 4RF5A 4HY3A 3ZHZA 2I6TA 1LTHR 3QIVA 3PJFA 1U2GA 4BKOA 3DFZA 5KVVA 1GPDG 3PLRA 2WYUA 2Q2WA 1ULUA 2H6EA 4IDDA 3C7CB 4XJSA 3VHRA 1EBUA 2CMDA 4OHUA 1EVJA 2PH5A 3G1UA 4CMGA 1DFGA 1I32A 4CLRB 4Z3KA 2HMVA 4M49A 1PZGA 3HB4X 4NHEA 3NT4A 3VZRA 4CMAA 4RJTA 4A26A 3ONDA 1LLCA 3HZZA 3IMFA 5TSDA 3DONA 4JN6B 5ICMA 5G0WA 1GEGA 7ADHA 3NUGA 3VPGA 4H7PA 3L6OO 4LCJA 2NSDA 4UAGA 5I7FA 3MWDB 1I01A 3PZBA 2IZ0A 3VDQA 3Q0EA 2VHZA 1LDEA 3R1IA 3G79A 1IZ0A 4BIIA 2WE7A 3EZYA 3TL3A 3RUDA 1RM5A 3JQ8A 4DGSA 5DF1A 2O2YA 5I8WA 2WM3A 4X54A 1LXCA 4BMVA 3ICPA 4BL5A 1BMDA 1GY8A 3R3JA 1G0OA 1M2WA 3P2OA 3SXPA 5AXCA 2NTVA 3PPIA 4FDAA 4F45A 1KC3A 5KVCA 5JC1A 4PN3A 1Z45A 4WGGA 3HN2A 3ORFA 1DLJA 4Y98A 5AVOA 2VWPA 3BHMA 4RLSA 3E82A 4D44A 1R4NA 3QSGA 5TJ9A 4AJIA 4JIGA 4YJHA 1IPEA 4CMKA 3K9QO 1DO8A 1EFKA 2WJPA 1LQTA 1PL8A 3DBHB 2BI7A 3GGPA 4GWGA 4PG8A 3CKYA 3GT0A 1CYDA 2X7HA 5G4LA 1CF2O 1M76A 4YYZA 3RIHA 5IN4A 4ZU3A 1MUUA 2D59A 1PL7A 2IZ1A 3E9QA 5CEEA 3OJEA 2BH9A 4I8XA 3VH1A 1TVEA 3ZV6A 1NX6A 2AA3A 1VL0A 2WEKA 3ZDFA 5BSEA 4IQGA 5T5QA 3L9XA 1FDTA 3OICA 3MTGA 3NTOA 4WNIA 3L07A 5ICSA 3E03A 1WVGA 1RYDA 1EMDA 3NYWA 5L7YA 1DIGA 3VH3A 2R00A 4J4BA 1NAIA 5IXYA 4UUPA 4MIEA 1MXFA 4LSWA 3ULKA 2B4RO 3CSDA 5JO9A 4BNNA 2VTEA 1OAAA 2YFQA 2PA3A 4XYLA 4A0SA 1UDBA 1KYQA 2I3GA 4WKGA 2EXXA 2YZ7A 2O23A 4ALLA 4CM8A 1UAYA 1J49A 4LW8A 3H5NA 3TRIA 1E1MA 1LU9A 1T2CA 3OETA 1IE3A 4IS3A 2PNFA 5JC8A 2D1YA 4OXKA 1ML3A 4WCFA 3AUSA 3BTVA 4FFLA 4RVFA 3T7CA 1Q1NA 3PWKA 2V6FA 4GGPA 1GQ2A 1MFPA 1BSVA 3OJ0A 5A06A 2P68A 4AJNA 5A1TA 5B4TA 1PZFA 2NNLD 4BNZA 2Y1FA 4XYGA 5L53A 1GV0A 1I2ZA 2EF1A 2RHCA 2ZKLA 1SMKA 2E49A 2PK3A 1C1DA 4J0FA 1NPYA 2DBVO 1DDOA 2QX7A 1BTOA 4CMEC 1M75A 4MVJF 4FS3A 1AUPA 5CFZA 4CLOA 2JKVA 4YQZA 2WD8A 3DAFA 2EW8A 4W4TA 3AI3A 1Z7EA 4J1TA 3RC2A 4Z0PA 1DEHA 2HK9A 1KBZA 3ST7A 2NTJA 4BGVA 3LVFO 4YTEA 2IEBA 3MJEA 1YBMA 5DCYA 4PG4A 3QRWA 3QWIA 3O4RA 3EMKA 2OGUA 4E4YA 5JSFA 2J8ZA 4GAEA 4O5OA 3WOHA 2R2GA 1H93A 1UH5A 2Q1TA 4BO2A 4ZQGA 3AOGA 4N5LA 4UULA 3PHGA 4G5HA 5L95A 1R6DA 3OJLA 4RDHA 2A92A 3RUAA 3SJUA 4CQMA 4CM9D 4XQ9A 4HFNA 1DHRA 4RPGA 2VRBA 1A7AA 3JQFC 4PZEA 3JYQA 2AG5A 3PJGA 3RFVA 3PHIA 4I08A 1B15A 3HE3A 3PEFA 3NTRA 2YV2A 4E5KA 4EGFA 3DMTA 4ROSA 3WJ7A 4WLUA 4R9SA 1HYEA 3OBBA 4J9VA 4BGUA 5A04A 5TNXA 4FSHA 1HE2A 1LQUA 3VKVA 3V5NA 1CRWG 4NFYA 1BDBA 2WWRA 3D4PA 3ZWCA 4CQMD 4AJ1A 1I24A 2VWGA 2V65A 3IS3A 2Y67A 4YBZA 3U4CA 4MOWA 4PLFA 4ALKA 1D4FA 5FF9A 1U2DA 1Z7BA 1E6UA 3ROKA 5L3ZA 2XXJA 2C82A 1YH3A 4D3SA 1PR3A 2TMGA 2VWHA 3IQDB 1ZH8A 1GUFA 5DP2A 4XEHA 1EFLA 1SNYA 3VC7A 3FWZA 4ALJA 4BOYA 3RU9A 4PVDA 3Q11A 3N7UA 4HNGA 4XIYA 1PJTA 2X58A 1BVRA 5LCXA 1JDJA 3WWYA 4R41A 1E7MA 4BO0A 2UV8A 1E1NA 3IIEA 5TT1A 1PZEA 1Q0QA 2JCVA 3RC9A 1YB4A 1P1JA 3KLPX 1V0JA 4MJLA 3BMQB 4KWIA 5B37A 3PIDA 1R0LA 2E4AA 1HDOA 2EG9A 3RU7A 5HA5A 1T1SA 2DVMA 4WECA 4UEOA 4IJVA 4Z9XA 2PZMA 2JHGA 1EEHA 1R12A 5F1OA 3DR3A 1VPDA 4YWJA 3RJ5A 3ZU3A 1NVGA 3FTPA 3QHAA 5EINA 4E5MA 1VL6A 2Y1CA 3H5AA 1HWYA 1MX3A 1HT0A 2CFCA 1P1HA 3JQBA 4NK5A 2J5QA 3OH8A 5BR7A 1PGJA 3ZWXA 1B2LA 4BMSA 2GRAA 4WASA 1FK8A 3DFUA 4I5DA 3ZWMA 1A5ZA 3STHA 1DIAA 1TT5B 3TOXA 2O7QA 1MB4A 4MKRA 2NM0A 3K5PA 5ENVA 2EKLA 2YY7A 5G2OA 2BGMA 3VAZA 3UFXA 4J3FA 4E2YA 3BAZA 4QTZA 1D1SA 3JYOA 4ND2A 4L76A 3RUEA 1BG6A 4RVDA 4PGFA 1A4IA 2RCYA 1H6DA 3I4CA 3R6DA 4KQXA 4W82A 3QWBA 2ZQYA 1CQIA 4U8GA 3MOGA 3GN1A 3VH2A 5TX7A 4XYMA 4WE3A 4PLGA 3AJRA 4ZA2A 2P9CA 3RFTA 2DM6A 1S7CA 1XHLA 4YA6A 6LDHA 5I7SA 3ZV3A 5C37A 3F46A 4NR0A 1EUDA 2OZPA 2VNSA 1GCUA 5L7TA 3N58A 2AHRA 3D4NA 3RKRA 1ZO8A 3WGQA 4RORA 2EIHA 4L73A 2A9FA 1P33A 3PHJA 4O1MA 2NVWA 2DBRA 5GZ1A 1QSGA 2BHLA 1YBAA 1C1XA 4D0SA 1X15A 2CDAA 4NNJA 4Y67A 3TZHA 3AFMA 5L40A 1E3JA 1U3TA 3CE6A 4PIVA 3WS7A 2I9PA 3OHSX 3VKUA 3WIDA 3VVCA 4BKRA 3OECA 3RD5A 3LT1A 3ZWWA 1WMAA 3PVZA 5A9SA 4UVEA 2E6UX 1SB8A 1VI2A 2I3AA 1KOLA 3QVTA 3GNQA 4QSMA 1HF3A 3INGA 2R00C 3GNSA 3IDSA 3TZQA 5FWNA 2OP1A 3RC1A 3JQFA 3ROQA 1I5RA 3D3WA 2C59A 4IS2A 4LGVA 5G0SA 2AEJA 1IZ9A 1CETA 1Y9AA 3IC5A 3LT4A 2OXIA 4I5EA 1WPQA 1GQYA 1YQGA 3DAPA 1NQ5A 1C14A 3CTMA 4MVJP 4DLAA 3RSHA 3CZRA 5CHEA 1H9AA 1YOVA 2YW9A 3ZH2A 1U1IA 3GAFA 3PHLA 4QT0A 4A7PA 2BGKA 2PKQO 1NVTA 4J49A 4N5NA 4BKUA 4FPXA 4G65A 2O3RA 3TZKA 3H6KA 5K9ZA 1U3VA 1Y8QA 4DQXA 1FDVA 4BNKA 4E2WA 4KUEA 1B3BA 5COBA 1SOVA 4IJKA 1T4DA 3FNGA 3FR7A 3IJPA 2CNBA 3QY9A 3QW2A 4IDAA 1ADBA 3HDQA 2HMTA 3I52A 1IUKA 4FFNA 2BI8A 4J7UA 3GG9A 2HKIA 4ILKA 1R37A 1TI7A 3ANLA 2W2LA 1P0CA 1NPDA 4I5GA 4L74A 4UUOA 3AY7A 1K89A 3B70A 3ADPA 5HRUA 1HLPA 3FRJA 1GEEA 4FCCA 4M54A 3V8BA 3UVEA 1NTOA 4RVUA 2GNAA 4S1VA 3P7MA 4Q3NA 5L7WA 1OMOA 4IINA 2HDHA 2JFFA 3KSDO 3O03A 5B1YA 1A72A 4ITUA 1MG5A 3AU8A 4IDCA 4IPTA 4J6FA 1KETA 4RZIA 3P5SA 4YJGB 3AUUA 2X0RA 4GPD1 2EW2A 2V7PA 3PWZA 2YV3A 1LDNA 5KWEA 1ULSA 2VQ3A 4MVJE 3C1OA 3OQBA 1U3UA 4GL4A 2D3TA 4W9NC 1F8GA 2QG4A 4PLWA 1WNTA 2HMSA 3H7AA 4AJ4A 1MGOA 1NQTA 1P1KA 3ETEA 3RUFA 4R3NA 1IY8A 1OC4A 3ENKA 3JQ7A 5BSGA 1UP4A 1EVYA 1BWSA 5BQFA 1DRVA 1GZ3A 1A9ZA 1X14A 4G81A 1X0VA 3JSAA 3OM9A 5DT9A 3W4JA 5JS6A 4QX6A 1Y8RB 1FF9A 3D0OA 1A4UA 1FDWA 2NU6A 2DTXA 2PH3A 4MP6A 1ENOA 1HL3A 4Y6RA 3LC1O 5EL0A 3FBGA 5MDHA 4RCVA 2B5VA 3H2ZA 3JCZA 1AXGA 1GZ6A 1ENZA 4RF3A 3EDMA 5AXAA 1Y9EA 4FC7A 3A28A 1E3WB 1TT7A 1YDWA 3GLQA 1GDHA 2GSDA 5JNLA 2LDXA 1E7WA 1NR7A 4RVGA 3DB2A 3IL2A 3I83A 1E3WA 5DULA 2GGSA 3LT2A 1QYCA 1IHYA 4OMUA 2B5WA 4Z9FA 4G2NA 4MVJA 3IKVA 4KMSA 1IHXA 4P4LA 2ZYDA 1E7QA 4GX5A 1MXHA 2P5UA 5EESA 4JP2A 1ZK3A 3GUCA 4L9RA 5CPFA 3KYCB 1EVZA 3KBOA 5TS3A 4DL9A 2Q1WA 2O3JA 4IGFA 5FI3A 1XDWA 2HMWA 3JQAB 3ZHXA 2G82A 3GPIA 3OP4A 3UGKA 1P44A 5B12A 4EDFA 4CLEA 5G0VA 1DAPA 4RGBA 4JXKA 4Z0TA 4Y8VA 2OHXA 1HXHA 4TMFA 5GZ6A 1A27A 4LVCA 2CUKA 2OOSA 4U0KA 3PQEA 3S1LA 2PKRA 4FOOA 1S6YA 4JBHA 3TOZA 5AQ1A 1W6UA 4DQUA 2X9NA 5KTKA 2DT5A 4DYDA 1AE1A 3UHAA 4YQYA 3KOUA 1MV8A 1PU2A 4ZRNA 3F5QA 3QP9A 2X22A 4Z0HO 3GDFA 2CZCA 3WGOA 1ENYA 2ZTVA 3PWSA 2Y0EA 1K6JA 1F06A 3WQSB 5JDCA 1UJMA 3SVTA 3DHEA 1YOVB 3FN4A 1Q0HA 4E6PA 1DLIA 2EERA 1Z75A 1V35A 5K6AC 3PTZA 1EDZA 2H5LA 8LDHA 3PGXA 3R3SA 4IBOA 4Q3BA 3CXRA 4K1LA 3Q3CA 4H3VA 5BNIA 3ZWBA 3EVTA 1EQ2A 4B7CA 4HX5A 4UVIA 4YT5A 4XQGA 3W6UA 4ALMA 1UAGA 4FFMA 2NQTA 4YPOA 5LDGA 3PDJA 2HMUA 3C7AA 3OQ1A 4EUFA 4U6SA 4YJGA 1PGOA 2G1UA 3TNLA 5L9AA 1YRLA 1I30A 3QVSA 3GOHA 4OKIA 1QG6A 4ALIA 5KJEA 2E48A 3HG7A 1ZNQO 4E0BA 4BO9A 4CMIA 2W2KA 3C1AA 5KIAA 4PLCA 4CUZA 4JJIA 4XJTA 3UICA 1E92A 4AICA 4W7HA 3KYDB 1KIFA 2X23A 2O4UX 4R1TA 3IAHA 2ZB4A 4EW6A 4YRBA 3U4IA 3TL2A 4JP3A 1KERA 1KVUA 4TKLA 5IAAA 4F3YA 1EQUA 1NVMB 3BYZA 5B4VA 2HQ1A 3NGLA 4M86A 2J3JA 3GR6A 3JQ6A 1NBOA 2Y1EA 1BXZA 3HQ4O 4GX1A 2FPGA 2VHXA 3UKOA 3V1YA 4W99A 2CVOA 3K6JA 4GX2A 1X1EA 5F1PA 4XR9A 3H3JA 1AXEA 3AW9A 4OO3A 2I99A 4TZTA 3PQFA 3DHNA 5THKA 3RCBA 1PZHA 5DN9A 3WNQA 5U9CA 4CL3A 3DO5A 5EQDA 3RROA 3K8ZA 1YXMA 2X6TA 3TF5A 1LRKA 1DPGA 3NKLA 4HFRA 4CMHA 4E13A 1H0KA 3U0BA 4M1QA 4XRGA 2RH4A 3SLKA 1ZUD1 5DP1A 3TQHA 2HJRA 2DLDA 3TDKA 4WEQA 4L75A 1PIWA 3LF2A 2Q4EA 4FC6A 5A5EA 2OO5A 3OIFA 4WUVA 4BO7A 1DJQA 3B6ZA 4MP3A 1U7HA 3OA0A 4KTVE 3JD2A 2Q1SA 4D0RA 1P0FA 5H83A 1I2CA 1P77A 4L8VA 4WLVA 2QRKA 1I2BA 1FDUA 1C0LA 1E7RA 1XSEA 4IQ0A 3VPXA 3VPHA 1E3LA 1U9JA 3VOSA 2GASA 5HM8A 3L9WA 1DIBA 1E7YA 3CEAA 1TLTA 2YQ5A 4WLFA 4D7AA 1U8XX 3FHLA 3LDHA 2ZTMA 1QORA 2DTEA 4GI2A 4RQTA 1Z74A 4XB2A 1E6WA 1N1EA 3EZLA 4MVJD 1H6AA 2GF2A 1H5QA 1LSUA 5KVSA 3EK2A 4BUCA 1GADO 3ITKA 2XXBA 4A5OA 3OIGA 1ADGA 4WOJA 1JU9A 1XQ6A 4A03A 2C07A 2I66A 3JYNA 3NX4A 4PZCA 1TXGA 3PFFA 5KJ6A 1DFIA 1K5HA 1LBEA 5I7VA 3TSCA 1NASA 3BMQA 5JXWA 3H4VA 3SX2A 1LA2A 3O26A 4ND4A 4L4RA 4N54A 3WGYA 3GNTA 2P4QA 4RVHA 1JWAB 2C20A 4EZBA 1YQXA 4BB5A 2OP0A 1B7GO 1L1FA 2H63A 2X1HA 4BQPA 3SC4A 2BFMA 5CAEA 1LSJA 2AW5A 2RBEA 1KEWA 1IB6A 4BO3A 4B3HA 1BVUA 3PDUA 1ZK2A 3DZBA 3G49A 4LK3A 3W4KA 3BTSA 1LDBA 2BF7A 2TMDA 1KVSA 5H82A 2JCYA 4OOEA 2NQ8A 3EVNA 4JNKA 3I6QA 3UAGA 3O38A 5DDIP 4EJ0A 4RV9A 3UUWA 4AJEA 1DC5A 1CQJA 2PGJA 3DZFA 1X7HA 1LC0A 3I23A 5EN4A 4NMHA 4AFNA 4WCFB 1PJ3A 3WBFA 4TVOA 2RIRA 1LEHA 1GYQA 3FR8A 1HTBA 3CMCO 3NV9A 1F0YA 5T8KA 1XA0A 2D0IA 4R54A 3HNPA 4IDBA 1OFGA 1XIVA 1R16A 3K31A 3DZGA 2JAPA 4XGIA 1HRDA 3ZGYA 4O63O 2DFDA 1DB3A 1JLLA 4PLPA 9LDBA 1N9GB 4E2XA 1MP0A 3VH4A 4B8ZA 1J4AA 5I9MA 3AU9A 1O94A 2VYVD 4GLOA 4DREA 2J3HA 1EUCA 1PGPA 3E5RA 3OEWA 5U1PA 5C7LO 1C0PA 3PIIA 2DAPA 1X13A 2NLOA 4XKJA 2WDZA 3IP1A 1ZJZA 2QRLA 4GMFA 1JWBB 4NZ9A 4UUNA 1IULA 1PGQA 3MEQA 2P91A 4IMPA 4MVJG 3A1NA 1DJNA 5JCXA 4TKMA 1EBFA 3E6AA 2W8ZA 1MC4A 2HUNA 3TPCA 5A03A 1ISGA 1P45A 3EY4A 1WZIA 2P2SA 3QV1A 3UCXA 2BMAA 4JROA 3WLFA 2Q50A 2CY0A 2PFGA 2GN6A 5BNFA 4EUEA 3L4BA 3GHYA 4RZHA 2H9IA 1NR1A 1WAMA 3ROMA 4YAEA 3BHIA 4J90A 2DC1A 3TWOA 1AHIA 1GQQA 2DUWA 1K2WA 1N8KA 3DQPA 3HHPA 5F21A 5A02A 4YRDA 1B0AA 1I3MA 5IG2A 2D4AA 1I3LA 1DFHA 4NBWA 2EGHA 4KWHA 1SB9A 4ZJUA 3U5TA 3H9UA 4KP7A 4OYRA 2B4TO 3ZWNA 2EP5A 2PR2A 4JX8A 3GFGA 5LDHA 4HV4A 3FI9A 3HJAA 2ET6A 3COSA 2J5RA 1N7HA 3DBRB 3U9LA 1C0KA 1I36A 5F1KA 4CLOB 1QR6A 1XYGA 1HSZA 1FDSA 1JVBA 1U5AA 1UZMA 2CD9A 3MOIA 4NIMA 3W4IA 3FPLA 3I9LA 3WGTA 3QLJA 2ZCUA 2FZWA 3BTUA 3H8VA 4KUHA 2GR9A 2RH8A 2IXBA 1HEUA 5EJ2A 1NP3A 3A9WA 1CDOA 4BO4A 3ZN2A 5C7OO 3IKTA 3GZ4A 1LSSA 2AE2A 3UN1A 5F5LA 3WLEA 4MVJI 1U8FO 7MDHA 3AOEA 2JD0A 4QO8A 5IZ4A 5ILOA 4Q3CA 3NJ8A 1N5DA 1ZKMA 4TZKA 2XPCA 4XX0A 3BXXA 1VRWA 1SBYA 1FXSA 3KRTA 4ESOA 4CUJA 4PFJA 4BGEA 2H1SA 1Z73A 1JAXA 2Z1MA 3JQDA 3I4FA 5HS4A 2VZ8A 2EGGA 2HAEA 3WMWA 4A10A 4Z3DA 1NFRA 3QWHA 1R0SA 4YJHB 4HFMA 4QECA 4Q3DA 1T4BA 1P74A 3MWEB 2QYTA 3ZWVA 4B4OA 3ON5A 5A3VA 3S55A 4DYVA 4E21A 4R1UA 5G4KA 4H16A 2Y1OA 5CDSA 4AJJA 2VZ9A 1ZMTA 2R6JA 2FWMX 4Y6SA 3GVXA 2QQ5A 3W8DA 3EAGA 4JLWA 3O8QB 4FJ2A 3OA2A 5CDYA 1BXGA 2NV6A 2Y1DA 4AJ2A 3M2TA 4CM7A 4DBVO 2E82A 2ZIZA 5DBFA 3WB9A 3ZWPA 1QP8A 1DHTA 4GVLA 4DC0A 4JCOA 1QXSA 1ZXLA 4GX0A 3RBXA 2YUTA 3JQCA 4XDZA 3BMNB 4L4XA 3OFSA 4MPDA 5JY6A 4HFJA 1ZXBA 4WLEA 4IJWA 4L4SA 4CM1A 4E30A 3VPSA 3JQGB 1BDMA 1OZAA 4PLVA 3HSKA 5CDUA 1NWHA 5I9LA 1KS9A 2GDZA 4Y6PA 2VHVA 5IXSA 4ZHSA 2ZTLA 2IDZA 1YVEI 3G17A 4BNUA 3DHYA 5GZ3A 2OUIA 4E33A 2ZQZA 2EJVA 5CEJA 3C1TA 1UZLA 2C5AA 1BW9A 1G0NA 4BKPA 2Q45A 5K0ZA 1O95A 1Y7TA 2VN8A 3EW7A 4INAA 4BGIA 2IRWA 4CLRA 3W8EA 4Q9NA 4DPMA 2VCYA 2Q46A 1YL7A 2VYND 2POQX 3D3EA 1E3EA 3V1UA 1GYPA 1Q7GA 3ZNNA 1RKXA 3AFNA 1VJTA 5ENDA 5I8ZA 3DWFA 1CERA 2UDPA 4TROA 3D5QA 4DTIA 4C7KA 1UXIA 2B4QA 3JQ7B 3B20A 1V3VA 2DBQA 1YE3A 2GYYA 1NHGA 2FSSA 1HKUA 3ASVA 3F6YA 4FOSA 4IM7A 1GAEO 1E5LA 4DWVA 4GKBA 4DIOA 3JQEA 4IMRA 4B7UA 3NAQA 4J2OA 4D45A 1AN9A 1M66A 2OFPA 1FMCA 3HDYA 1JAYA 3ONEA 4YXFA 3IJRA 3B1JA 3D4OA 5HTOA 2DQ4A 4BO5A 4DUPA 5DOZA 3WJAA 3HN7A 4B3JA 4DC1A 3RVDA 1Q7CA 3GUYA 1RM4A 3GN2A 2Q49A 4J2HA 4ZQHA 3B1KA 4A2CA 2FR1A 1EZ4A 4FN4A 3A06A 2D8AA 4U7WA 3WYCA 3TFQA 1B14A 1YL5A 4I9HA 3RJ9A 3DEYX 2FR8A 3DTYA 3KV3O 4F46A 1UP6A 2JAHA 1N2SA 1NWCA 3OF2A 1L7DA 3T4XA 4Z9YA 1QLJA 1R0KA 4MP8A 3ZV5A 1YQDA 3VZQA 2PGLA 2UUPA 1KC1A 4MINA 1B16A 2ZB3A 1MA0A 2Y93A 2D5CA 3LT0A 5TF4A 3ZCXA 3KVOA 3QA9A 3MJTA 5JMPA 1XLTA 1YB5A 5KKAA 3EC7A 1TB4A 1R66A 1HDGO 4R16A 1CJCA 3JD0A 2VOJA 1ONNA 3AM5A 3ZU5A 5A9RA 3U09A 5I7EA 5CEFA 3GFBA 2XF8A 2ZCVA 5ITVA 2HJSA 3OIDA 3NDIA 3WGHA 1Y6JA 2FOIA 3E18A 1Q2XA 4ONEA 3H2SA 3VZSA 1N92A 3K2BA 1HLDA 2CVQA 3MZ0A 2YJZA 3GMSA 4FIZA 5IDYA 4EUHA 5KNLA 4XQEA 1DXYA 3CINA 5JCJA 4CM3A 3ZNOA 5IFLA 1UDAA 1ZMOA 4WLOA 3JQ9A 4NH4A 2UVDA 1T2DA 1BRMA 1XQ1A 2O48X 1AGNA 1KEPA 3H9GA 3QVOA 3LLVA 1E0DA 4BNYA 4DPKA 3S2FA 1UZNA 1Z82A 3H65A 2FPPA 1B3RA 5GY7A 3S8MA 1DBVO 2P5YA 3HDHA 2GLXA 1V3TA 4XZ3A 2LDBA 2CSUA 3QE3A 2FRDA 3G0OA 4YR9A 4WLNA 4YEDA 3OMLA 5A5FA 1T25A 2O7SA 1I8TA 3MJ4A 3GDOA 5DCUA 1BXGB 4YT2A 2PD3A 3GVPA 2O50A 3RC7A 3ONFA 2NU8A 4PG5A 4IZHA 1JW9B 3ZWOA 4K28A 4W7IA 2X9GA 2HU2A 1MFZA 1P1IA 3IUPA 2ZTUA 1GL3A 2JFHA 1GCOA 1ISHA 4J7XA 3KEOA 1XELA 1UUFA 4P8RA 1SEVA 4W9NA 1XG5A 4N5MA 1PS8A 1UXKA 3E48A 3UCFA 3PRJA 4GBJA 2AQ8A 5A9SB 3NT5A 4YT4A 5BSFA 4R9RA 3UH1A 1YO6A 2WMDA 1Y5RA 4XR4A 3TJRA 1QRRA 4QUKA 1PJCA 3A4VA 3L4BC 5L4LA 5G0TA 1C3VA 2RAFA 2PZLA 5FFFA 5IDXA 3R0IA 1VM6A 1ID1A 3K73O 3NRCA 3MCVA 5EPOA 5T67A 4NU6A 3WTBA 4UVGA 3LK7A 1KVTA 1PJBA 1ARZA 3WYBA 1EDOA 2IEDA 3C24A 3TZ6A 1WXDA 4PLZA 2Q2VA 4RPKA 4ZQFA 4R3WA 3GH3A 2HK8A 4RPJA 2QZZA 3DOOA 2X4GA 4IJUA 1PTJA 3DMYA 4WNCA 4XQCA 1YBVA 2DKNA 4BHTA 4OSPA 1K6IA 2BFPA 1ORRA 4DQVA 5DBGA 1T24A 3VTFA 1F8FA 4EJMA 1PQUA 5JCJD 4ND1A 3PGJA 5FYDA 2NWQA 3KTDA 4KOAA 5L4NA 4UVHA 1EVIA 4DXHA 3CH6A 4TRMA 1DC4A 2C5EA 5U4QA 2VWQA 3WQRA 4K6FA 3RBZA 2VYVA 2G5CA 2AQIA 2PLAA 5JPIA 5T8KC 4YDRA 4LVUA 4FFPA 2ZYAA 4O59O 1HZJA 1XWFA 4PRKA 4JK3A 5JFOA 2HK7A
chains in the Genus database with same CATH superfamily
1F60A 1QTIA 2J4FA 3E1KA 4FFBB 3EOBI 4B44A 2WP0A 4UEJA 2GPTA 1HT3A 4BNWA 4ENQA 3FUUA 1DC8A 2VSNA 1TVCA 3CLRC 2YQ4A 1HX7A 5T57A 2XYRA 2ZWIA 1YHNA 3BGIA 4FSXA 3LUFA 1CXZA 1J56A 4RPLA 3WWZA 3ZEIA 3WAKA 2V0NA 4EGQA 4FB4A 2F00A 2RGDA 3FYUC 4LCEA 4DA8A 1M2GA 5LQAA 3FZQA 4W8HA 3LYLA 3ZHBA 4X1IB 3SJZA 5KJFA 4DIMA 1VDMA 5FA8A 4YROA 4RKYA 2A9RA 4ZEMA 3U3XA 4IIVA 3UJAA 1XTJA 2R8XA 4ZQCB 2WINI 3L5OA 3IP3A 3L4EA 2AFIE 3OLQA 4Q1BA 5B2ZA 5DM4A 3LBIA 3ZQ4A 1H4SA 1W2GA 4FR5A 2AFHB 3CM0A 2YHIA 3DOUA 1ZOIA 2PH7A 2DSTA 5CITA 4JBIA 5H9VA 3GDGA 3RVOA 4A73A 2FVXA 2QYSA 1W8DA 2JEOA 3DC7A 4XD7D 2NU9B 1KZ9A 3PC3A 1SQSA 5CCXA 5EMHA 1RXCA 2ZWPA 1Z6PA 4BNMA 3E2IA 1EUCB 3SHVA 3V4ZA 3ISTA 4RMNA 2CYAA 3AB3A 4R1NA 1DUSA 2IOYA 2O2SA 3V3KA 5HIKA 5KYXB 1GGVA 2D1FA 1RHKA 2OCIA 2Q3EA 1PWEA 4W5NA 2ZRMA 3OLWA 2ZJ7A 4QARA 3ICQB 1ZEMA 2JCXA 4CV2A 3MYRA 4MZDA 2WJAA 1AGXA 3HN6A 2IXFA 4WADA 3GUVA 1GT6A 1G8HA 5J43A 2AG8A 3IHKA 2C4MA 4TPKA 3ADOA 5H3LA 2QUJA 4U0JA 4CETA 5LMNB 1EKXA 2H9AA 1QKJA 2IIVA 3A70A 3OE4A 3BL8A 4HWTA 3B3QA 4S3MA 2OMEA 4UHCA 4YJDA 2EBUA 3DEKA 4P35A 4PQYA 1R6VA 1TIKA 5BO5A 1KQOA 4YY3B 4JI2B 5F7JA 3W3AA 1T4GA 3BVPA 1RFLA 4P31A 1XKQA 4M55A 3VR5A 4Y2QA 4QEDA 3U7RA 3C48A 2QF7A 1O6ZA 2HGZA 4K9QA 1TRKA 1OLSB 4UU1A 5AW1A 5K0CA 4QELA 3PJDA 3OJCA 1PT7A 2H1OA 3BFVA 4RWEA 4CIDA 2NADA 3MJFA 1ZD5A 2Z56A 4MJXA 2PUEA 1JZTA 3TMKA 3AIOA 4PYMA 3RUHA 4YN3A 1JEEA 2G06A 5JFTA 2XT0A 5K6AA 2FG6C 1EEXB 1YONA 1YDHA 3E22B 3MN1A 1MHTA 3LE8A 2D1TA 2ILTA 4AKTA 4MWDA 4NBRA 3BE8A 1HTTA 2WOOA 1H2EA 2QBYA 3RM3A 4KDFA 1GRCA 4UUQA 4EBFA 5BQOA 1ISMA 2JFQA 2Q3JA 1A82A 1LBQA 1Z4MA 2MSLA 3GY0A 2AJCA 3IPCA 4DCTA 4X1YB 4DV7B 3CNQS 2FSUA 5FPHA 3ETGA 2P3OA 1ZN8A 3GLHB 3IQFA 3H97A 3WLRA 4LBZA 4DMLA 1ZR4A 3G7NA 4A0HA 4PLHA 3O4VA 3PITA 2QPLA 4OM8A 5IUJC 4D4IA 1MAAA 1U7XA 2GVDC 5K8CA 3H3FA 4YCAA 1RAFA 2XDQB 3CVJA 4BBJA 4P1ZA 3LZ6A 5L6LB 5F4ZA 4K0KB 1KI4A 3KXIA 3ND7A 4B8WA 3IUYA 3JD1A 4LDPA 4ARVA 1G5QA 3H9EO 2V5AA 2X5NA 3LZCA 3VHQA 3A6KA 1EE2A 1W47A 3JU3A 1JDBC 2VPZA 4H77A 4L02A 2D5LA 3R9IA 4CT5A 3QOXA 5A0VA 2X8LA 2V0GA 1ZMBA 1ZOLA 3P9QA 2W6QA 4UFPA 1TDJA 1W88B 4CWAA 5LZ9A 4ARSA 3A6PC 3QMWA 4MS3B 1FQKA 4ER0A 4QUEA 1Z06A 3E2MA 2CL5A 2H92A 1G5HA 1KJYA 4GP9A 3G6KA 4NBVA 5A05A 3UWSA 5FTKA 3ZHYA 5FLXA 2O0KA 2WJJA 3N75A 4G6ZA 2G1KA 1EE9A 4KE6A 2C97A 1YS1X 5JTTA 4IICA 4NOKA 4FYPA 2HQBA 4I4CA 2AT1A 2RI1A 1O2DA 3AUTA 1UMBB 2Q27A 4HQOA 3TCKA 4XDYA 1Z37A 3Q12A 2EGUA 4JI8B 4EG0A 4R84A 3T5AA 2C7VA 4GWKA 2Z1NA 4CGYA 4DIEA 3NBQA 4GGMX 2WU1A 4NJMB 1H9BA 1PZXA 1IN6A 1DKNA 1T2FA 1RKQA 3JWEA 3KB8A 3RHSA 5AW2A 5JE8A 1QVVA 2F9FA 3NDBB 4NPAA 4P08A 4FB5A 3P71T 2DTDA 3ZIUA 2YVKA 3A3YA 4FKBA 1MIHA 4FWBA 4Q12A 1U3WA 2PL1A 2RHRA 4EW1A 5LYJB 4HGYA 1WUTA 1K6EA 1ZUIA 1ETUA 3S0JA 3L05A 5CYPA 5A71A 4YMGA 1ZOSA 2F3SA 1SZPA 1QHFA 4H0NA 4UPVA 1S9HA 1E6EA 3RIYA 2W6OA 3ZWDA 2E1PA 1ENPA 3N2KA 1TX4B 1EGHA 1JHUA 4KJXA 4C0JA 5LNK1 4LGYA 1XROA 3KUUA 4WKCA 3H4TA 4XCXA 2C95A 1D1PA 1MB3A 4K5QA 1GU1A 1U6JA 1W0JA 4NBTA 3CW2A 1D7OA 3FF4A 5FI1B 1W19A 4MDYA 1ZAYA 4OHVA 3SE0A 2MJLA 3I53A 3AVYA 3R4CA 2O2GA 1QTNA 3NQ41 4FYMA 3ZQ6A 4NCAA 1ZRNA 2E87A 3NNDA 3I6YA 1HDZA 3JAWB 2LD4A 2W5UA 5JYEA 2W70A 5KJCA 1RM3A 4FZ5A 4CHGA 3AF6A 1F6WA 2H16A 1GKKA 3HYLA 5CXQA 1VE6A 3TZBA 2ZJ1A 2A6PA 3KQLA 4OH7A 1BX3A 1UDCA 3JPYA 2Q3LA 1KJZA 3KR1A 4IZIA 2QUIA 4YT4A 2H5EA 4QC2A 1L5NA 3SF8A 1OLOA 2J5KA 3CG0A 2NU7B 3RRYA 3EGOA 2XMSA 3PXXA 3PICA 3NJ4A 2AR9A 1BFUA 4F5EA 4DNQA 3GFRA 3QEOA 2R97A 5CVCA 4X20B 3AEKA 1TZJA 4UQOA 4B6RA 3ETDA 1KDOA 4MUKA 5KQGA 3UBTA 3KAQA 3QVUA 4JLDA 1Y37A 3LLSA 1C2YA 1NAHA 3GJ8A 3CT4A 3HADA 1A9OA 3L7YA 4NWIA 3EEIA 4PQFA 4XGNA 3UW3A 3GBVA 4BLSA 4RS4A 4JUAA 2NO5A 3T35A 5E8RA 4ZVNA 4AJOA 2GZ1A 1DBSA 2FEWB 3V1KA 1SVSA 3WQQA 2J59A 1AGYA 2YRXA 3MNFA 2O8DA 3EGXA 4FGLA 4LDAA 2DBZA 3ZE6A 4X85A 3VVBA 1K8ZB 1LVGA 2VKQA 4FS8A 4WZ6A 1X7XB 1U3DA 2ZT6A 3VU1A 1GFSA 1I1QB 4FFVA 4R1OA 3TR5A 1PYDA 1KRHA 4R7TA 4LOKA 2BCEA 7GPBA 2Z08A 1DKPA 4N0DA 5TDHA 2I2BA 3INYA 4HWOA 2IYLD 4KAJA 2BMJA 1T5BA 4ND3A 1M54A 2GFQA 4I66A 5BV8A 1ZSYA 3ZS9A 5LQJA 2C2YA 3FZGA 5EJ6A 2BM9A 3NDPA 4G0WA 4AQDA 4B79A 3THYA 2QTAA 5EMMA 3LX8A 3HYNA 4LHWA 3GPDG 4L2IA 4JMLA 5EJAA 3TG2A 1YJBA 2AQHA 1Z2NX 2Q2QA 4AJHA 4ZEOA 1YOBA 4M1ZA 4LN1A 2FRVA 4WBXC 4BNTA 1Y81A 1UPTA 3T61A 1EUZA 4PS1A 3SGLA 1RI4A 3D5TA 3K7EA 4L5BA 1DTWA 1DAMA 2NTNA 4HEHA 2IUEA 1UWCA 4RFSB 1RP7A 4CCYA 3NEJA 3FNEA 1PG5A 1U0TA 5JCOA 3UOGA 1S3IA 1H3NA 2QP3A 3BTOA 1GLVA 4U6QA 5IJZA 4GPIB 2GEJA 1LK5A 4HO1X 2R4UA 1M6VB 4AQ7A 3NCHA 1Y3BE 2Q0SA 4WY2A 4MQMA 1IXSB 1U7OA 4N7RA 2EHJA 4NENA 4YV1A 1WOMA 2P75A 3QNMA 2JDIA 3ZS8A 3B3JA 3E9EA 2BEKA 5IF9A 1G9XA 2IYQA 4KRXA 3N9IA 4LOAA 2RHMA 2PMDA 4MWEA 1K8RA 4LRTB 5J9FA 1PLLA 4BMNA 3DL0A 4D8XA 1RM0A 1XAIA 2HJWA 4BNLA 1NM5A 2GN8A 4QOJA 5LOVA 3T3NA 4WESB 3SDZA 3C6QA 2HIAA 4O2BF 1P5ZB 3AZQA 4CL8A 5I9IA 1ZGJA 1EHIA 4GGOA 1NXSA 2J4CA 3FBTA 1AKMA 1N6RA 1N3YA 5UKDA 4O2AA 2PRZA 2A5LA 3QMPA 1SEPA 2QRZA 2PU7A 5A62A 1A96A 3TN7A 1SG6A 2E6KA 2R7AA 5HIMA 4QJIA 3W3ZB 4DLLA 1KI9A 1OHHA 1XTVA 1BD3A 3SWWA 1N3IA 2V5VA 4UBKA 1QIJA 5ALEA 1GTMA 1Y80A 4C3ZA 2FHSA 3W1VA 4BRUA 2X0NA 4LA4A 1ZH2A 5CM8B 4V2IA 1SUFA 2O0LA 4QXAA 4ZQEA 3VNAA 4BNFA 3OWHA 4PICA 1EXNA 5LC1A 4B4WA 2RK3A 3CUKA 4C7JA 2WTUA 1WLSA 2P35A 3VMFA 3IR7A 1YJQA 1IHUA 4EJSC 3W6OA 2ZZMA 1BXKA 4MGIR 1XV5A 2SICE 1N2IA 3VSCA 3MWLA 1R4MA 5JXHA 1QBGA 3X2FA 4FKZA 1OV4A 2AI3A 2QRMA 2BE7A 3HJCA 3DE6X 5K9ZA 1O94D 3SJCA 4UUAA 5KI6A 4JL6A 1IBMB 5SZHB 3FIUA 1BCRB 2MYTA 4P9NA 3VFDA 5KNBD 3RKSA 1VHQA 4JHXA 3EPRA 5CPBA 2A9PA 3BICA 1TM4E 4XPIA 3K1ZA 4AC9A 1ESDA 4XIJA 2DHCA 1KO1A 4K1XA 3MILA 3HFJA 3ADCA 1LLQA 1BMFD 2W6NA 5IU6A 2QEQA 1N2ZA 2OGZA 3CUTA 4MI3A 1HOXA 2B99A 3PHCA 2C7GA 4OBEA 5JNUA 4ZREA 2ISCA 3AZOA 1QYDA 2X6QA 3O21A 1SAYA 3WZ2A 3SEFA 5BUZA 4GPZA 5ALGA 5CJ2A 1SOAA 1AQIA 2N75A 3GRUA 1NC3A 3N8KA 4BFCA 4R81A 1K9VF 3KQVA 2WU8A 1DRUA 4UMVA 2Y99A 2P11A 4PIPA 1D1QA 3SBOA 1P4GA 1X1AA 4XIFA 2H5JA 1CUSA 1NBAA 2HQOA 3PR1A 4N9WA 1INLA 4MUEA 1FOEB 2GCOB 1EK6A 3T9EA 4ECAA 4KRGA 2MHCA 2OXRA 2XNHA 3OESA 2HUPA 4N39A 4I1IA 4BVAA 1C9MA 1DCKA 1FZTA 3D3WB 4MB0A 2GN2A 4LC9A 1OLXB 3LMKA 1WX1A 4RHCA 1L4YA 3HR7A 4XH9B 1X7ZB 2AW3A 2FPMA 2G76A 4FQ5A 4GIBA 3CUVA 2HRZA 4LXIA 4IVQA 1FTSA 2GZSA 9LDTA 5J4YA 1TFUA 2BWJA 4MDHA 4RD4A 4WIAA 3KEQA 2OHOA 3GJ0A 3HJUA 3KVRA 2H4ZA 5HUQA 8ABPA 1RBQA 4IO0A 1MG0A 3T5CA 4EFMA 3E9RA 1ADYA 2K4MA 4K26A 2XYPA 4ZVVA 1RI2A 1J0BA 3P2KA 2ZJZA 4I4LA 1K7XB 2KS6A 1AUQA 1ZH0A 2P6OA 1SIWA 1V37A 2YXEA 4ID9A 4GDFA 2YW2A 1Z0ZA 5DRYA 4QSHA 4KU4A 3GJ7A 3UK6A 1PN3A 1YZ3A 4OYLA 2ZIFA 3HEBA 5ER9A 2LIPA 1YUMA 1NF2A 3D3NA 1Z0KA 5TC4A 3PKIA 4LNHA 1ZBQA 4F11A 4IQ4A 2FP3A 3IR6A 4J0EA 1G1AA 1VP9A 5C80A 3OE7A 1NT2A 1KAOA 4FK8A 3EN0A 4LISA 1P6QA 1Z2CA 1M6HA 4YMIA 1VG9B 3FFBA 3VYSB 3USES 1Y5MA 2HWWA 1K4YA 3AFHA 3FOCA 3FROA 3A1TA 1SCUB 3LFUA 5JYBA 4LF9B 3B2EA 5CFRA 4M1WA 2X42A 4WRRA 1YGYA 3ZZNA 3QVWA 4G8JA 2LCIA 3GEPA 4TRJA 1SHJA 4YUVA 3JV7A 2WAMA 3ISVA 2M6LA 4JUBA 4BMOB 4S24A 1PD1A 1UXHA 1ZSNA 3R7BA 4CMBA 2NVUB 4F3CA 2A35A 5JNWA 1R8QA 4RQBA 5AHWA 3IFSA 3OCJA 1E1LA 2BFFA 1E18A 2QI9C 3EVZA 2VXBA 16PKA 1O3YA 2QJWA 2ORED 4Z4GA 4WNYA 1D6SA 2O2CA 2Z30A 4UAVA 3HM9A 4HGOA 1HRKA 1XNGA 2RHHA 2VO1A 5FEMA 4QUJA 2OKGA 3GDWA 3P52A 3AYXB 2NW6A 4CJXA 2RARA 5LZ4A 1S1MA 1GZ4A 3N07A 2QTZA 1SXJC 3WLHA 4E46A 1W49A 3CX4A 3KSUA 4Z4HA 1YQTA 3TXYA 4A6PA 4B4DA 3KCQA 2WK1A 3NS7A 1V4VA 4GYKA 3RIMA 1QHIA 3N0TA 4WBNF 5AK3A 3A27A 1T1IA 2IP2A 3PK0A 3V6LA 1GPKA 1MQ9A 3FGZA 2RGNC 1CRPA 4I1VA 5EERA 2GPAA 1K1EA 2J3KA 2YDYA 2QW8A 2J6IA 3OU7A 2CXHA 1HPLA 3STTA 4K03A 5KTTA 4ZOLF 2GLUA 1D1TA 2R1ZA 4P4SB 1YE5A 4YLGA 5IARA 2ZPUA 2GCNA 1ZICA 5KWIA 5EPEA 221PA 2FWBA 3HPQA 1Q1ZA 3T6KA 3E8MA 4MYRA 3GP8A 3DZIA 2KBEA 3E9NA 3HM2A 3BC1A 3NHZA 4D79A 5EJ5A 1S7GA 4O8CA 3VYWA 1B41A 2GLTA 1G7CA 3CZMA 3VBCA 1O87A 2QN3A 5JPCA 2HJVA 5M34A 3NEPX 1YQEA 3PXEA 3KPJA 4C22A 1W4ZA 1UXOA 2L17A 4JIMA 1QGOA 3PC4A 5BPFA 2X0IA 1E9RA 2Z8YA 4Y9RA 4XX1A 3F7OA 5C1PA 3F1KA 4RNCA 1YZNA 2ZB8A 2FQXA 4TL9A 1WB9A 4ERNA 3A6FA 2IPXA 4O4JF 5F78A 3KYBA 4R51A 5TT0A 3QITA 1EXWA 3C97A 1KEUA 3AEXA 3ICWA 1P2GA 3EOZA 2BM0A 3PQDA 4PSCA 4Y30A 1KQNA 3RIXA 2FFJA 3T15A 3Q0IA 3R3YA 1CX9B 3A36A 4NDNE 5DZSA 5GINE 2O1SA 4U7TB 1BH6A 2VDJA 4RMHA 3BMCA 4YO8A 5AMXA 5KNCD 3DZJA 4QOFA 1AGRA 3NKFA 4IXWA 4UEKA 1ZVMA 3RVMA 1C7ZA 2GFHA 3E9CA 3IPXA 3RFXA 1A50B 4CMJA 4CU5A 5CYOA 4LYGA 3W0LB 3OOJA 1UFOA 1RYEA 1G6KA 3QOWA 3AY3A 3GHHA 3W78A 3WHLA 3WWCA 2ZJYA 2VTVA 3PEEA 2HEGA 1PUXA 1Z34A 4JXJA 4MUBA 2R7KA 3TDMA 5AUNB 2KBFA 1AK2A 4AZ0B 3TD6A 4F7DA 4ZICA 5TIIA 1M6EX 1U31A 1Z9BA 2Q99A 4NOJA 4UMEA 3PFGA 3I8XA 1G20A 2YZGA 4G9BA 1MTZA 4J9UE 4UC0A 5TB5A 4YNBA 4ER5A 4F1WA 5I7RA 5JASA 3IT2A 1RWXA 2HT1A 1I4WA 2JGAA 3JZMA 2ZT8A 4IOKA 4CMEA 5JHGB 1U2ZA 2V7QD 1KAQA 3AINA 3LPAA 3RAGA 1V8BA 2FZCA 1X8JA 3EQ6A 3O74A 4NK4A 1H3EA 4MWSA 1Q7RA 4ZEWA 1GAXA 1YQWA 3K15A 3V2GA 4MLDA 5SY6A 4RADA 5BV0A 1DEAA 4IIXA 4JBGA 1DJPA 2D1RA 1KY3A 3TXAA 2QIPA 4JI6B 2FPLA 3FZEA 1YK0A 1DQNA 1Q0LA 3BZUA 2BLLA 1MEEA 1H69A 4FDTA 4CM9A 2JH9A 3TG8A 1AO3A 4RK4A 2GD0A 3N59A 1E66A 3PFHA 3FPSA 2IODA 3AFGA 2AVDA 1UPUA 4D46A 1X1TA 5J2UB 3EXFB 4L50A 4P4SA 1XXHB 3FTNA 1HO3A 1NMYA 2MSDB 3SG0A 4YPVA 5BN3B 4F4CA 1GPWB 3SKYA 3ZWQA 3AM4A 3GF4A 1C0IA 2G77B 2WLTA 1NW5A 5KREA 2FEOA 3RJTA 5TQVA 2C03A 5AHXA 4DRYA 4ITVA 2B6HA 2XKAA 4FNAA 1YU9A 2IYPA 2QRQA 3C7DB 2G0NA 3FKJA 3Q6NA 4LRSB 3W8FA 1NVBA 4WOBA 3GG2A 2YINC 2ZQ5A 1MRSA 5C2JB 4NCXA 2I3ZA 4JLJA 4RVNA 5CK5A 2ORVA 2VJOA 2PG3A 4K6HA 4CR7A 4Q48A 5MHTA 1GPMA 5IM4F 3X0DA 3E0QA 1H6CA 3NIDB 2JHFA 4HBZA 1VKRA 4IIDA 1ID8A 4AXBA 3RVNA 3INRA 4HAUA 3GVCA 3ZKWB 3WRWA 3NVMB 2GTPA 2C3YA 3FMFA 4CF4A 3E9MA 1NOKA 1MLDA 2CLHB 2R60A 3C6KA 4GYJA 1RRMA 5ENZA 1OZGA 4NBUA 2PMKA 4BAUA 4KX3A 5DVZA 4QHYA 1F12A 3SXUA 2V0CA 4JC5A 1VL8A 3H13A 1QGUA 3ABSB 2OXFA 1HDCA 1TO2E 4L15A 4Q4DA 5EMKA 1J7KA 1GZ7A 1Z15A 3LQ4A 5LWQA 4HADA 1SXJB 4MROA 2OD2A 3HLKA 2R6FA 2I6FA 1GZSA 3K96A 1DP4A 1IG3A 3UWDA 2A78A 5FUYA 5LP6B 2EJCA 3NHYA 4FDVA 3DZHA 4OIFA 1SY7A 3ACBA 3C3EA 4HHEA 2P9EA 3DDUA 5CR9A 4LYHA 3WNDA 2BFWA 1AO0A 3FB4A 4CF7A 3ENWA 3IQZA 4IUBS 4KDCA 2PWYA 4F6CA 2TECE 2Z57A 1RXSA 1XDUA 2A9QA 1LZLA 1PJQA 2B20A 2HPVA 3B1WA 3ORYA 4OFXA 4R69A 2GZRA 3NIWA 1U5CA 3GJTA 4K9LA 4WX2B 5FI0B 1HYGA 1GGFA 5G1NA 3AGPA 1OHHD 3EEQA 2QHXA 4XSGA 4B3IA 3IE1A 2J45A 2O4CA 4WKPA 1G63A 2XCUA 3DLPX 3KQMA 2HYDA 3AEUB 1F8YA 3FYTA 3BXEA 4PO8A 7ABPA 2G0TA 2XUDA 4POOA 3EH2A 3LDAA 1DAGA 4G0NA 1J7JA 1SA0B 2Y0DA 4NFHA 3RTDA 2FSHA 2WF9A 3TPZA 3QUQA 4UASA 1VJCA 1ECBA 4MRMB 2WE8A 2HU8A 5IC5A 2FPGB 4NC9A 3I3OA 1V7PC 4EATA 1YR9A 1XBTA 3HFSA 5T41A 4BS9A 3V6MA 2CXUA 3PFWO 4E5NA 5KYNA 3AC0A 4XYBA 4BNVA 4DA7A 4M9RA 4YAKA 3P45A 5CXXA 3LRXA 5JEDA 3FWNA 2BR5A 4BNHA 2YBDA 1ECLA 2QN1A 4RELA 4B3GA 4Q9IA 5BWCA 1RRKA 2MR6A 1HMYA 1D2NA 4J3JA 3ZTWA 3ZX4A 3LCRA 4D8VA 1P9NA 1T5TA 1AQJA 3ES9A 2Q4BA 4M8KA 3WYFA 3CB4A 2PGNA 3QG1A 1JDUA 2G6TA 1T8YA 2YC2C 5HPYB 2FWPA 5F3DA 1P9LA 2P1ZA 3PTLA 4F4UA 5DX8A 4C30A 3NHWA 1QDLB 4QM6A 1ODSA 3CWCA 3PDWA 4KO4S 3TLYA 2W4IA 4E15A 2BEVA 4E4TA 1N25A 5D00A 1OFVA 2OQIA 5LMZA 3W5HA 5E2IA 1ZH4A 3UW1A 2R68A 2FXIA 4X8LA 1AK1A 1EFHA 5LBIA 3W2HA 4QVGA 1ZVVA 4U7PB 1SHUX 5AKLA 1JEJA 2JJYA 4WN3A 3RYHA 1HNNA 1P1RA 4WJKB 1PSDA 3E8XA 3IOBA 2NZYA 3R6LA 5L4SA 4YDQA 3K2IA 3RWBA 3B1VA 1E69A 1OFUA 2V45A 4M7OA 3EGWA 3TLKA 4BWYA 3NHMA 3ABIA 4FW8A 2Y0CA 4JD5A 4O2AB 4QLAA 4R98A 2XB2A 1M5TA 5DIFA 1I0ZA 4JVOA 4QATA 3AF0A 4IP0A 4J43A 4TMKA 3U3OA 4PG7A 1C7IA 2YNMD 3UF0A 1R2QA 3VPFA 3T06B 4F4JA 1TLLA 3B7WA 4EZIA 2R66A 5DOVA 3F71A 2D1QA 1QV6A 1Z26A 2POCA 5CFLA 2GO1A 4J29A 4X61A 3KYCA 1FNCA 2VUSA 2R7LA 1MO5A 3LCJA 1OC2A 4I9UA 1W1IA 2R6R1 5F2OA 1V1MB 4CT4B 5H81A 1F17A 3OX4A 5BN5A 4BMPB 3A9UA 4WWHA 4TRNA 4MQUA 2G6BA 3COWA 4ZYWA 4CDGA 4M8IA 2FEXA 1QLHA 5FUXA 1L8QA 3OLZA 2VDWB 4Q3AA 1JHAA 1QO9A 3H16A 3HMKA 4JHLA 1J8QA 3EVDA 4U63A 4WFKA 3TIIA 3VZPA 1DQZA 4YIHA 1M2OB 2X8JA 1VMAA 1Z5GA 3QIVA 3WLIA 5LU8A 1KYXA 2P6NA 4JLMA 2O8DB 5B3AA 3LWZA 1YUNA 1G8JA 5E38A 3R44A 4BEWA 3FSGD 3LOUA 3QSYA 2H6EA 1EJ6A 4E5DA 2DHEA 3D7MA 2NNWB 3AFOA 1Q84A 1Z0SA 3C7CB 2H54A 3GZTB 3P2EA 3CBQA 4O4JB 4OHUA 3K5HA 4P84A 4ENTA 4B8YA 4BVBA 4Y1RB 2LKDA 3JVDA 3DCNA 1ULBA 4HQNA 4B3CA 2Q6KA 1J1UA 4CLRB 3RFUA 4E07A 1ZOPA 3L8YA 3SZGA 3L6UA 2HMVA 5ERYA 2RGBA 1Y1KE 2FDRA 2PQMA 5JJ5A 1PZGA 3U3MA 1OFUX 4CMAA 1U0RA 4BX2A 3ONDA 4MV0A 1LLCA 2I34A 1HOTA 1MF7A 3Q2OA 4NZNA 1IUPA 3G5UA 1M3SA 2R6ZA 1W5BA 2AN1A 1BJKA 1QAOA 2YJ6A 3FAZA 1JALA 4NENB 3V4PB 4IUCS 5ICMA 4EAAA 1TMKA 2W7TA 4ZAFA 5D3ZA 4YV0A 3NUGA 3VPGA 4H7PA 4LJ5A 2P90A 2ST1A 3ADDA 2D4HA 3MWDB 4NEGA 2P2LA 4PGHA 2IZ0A 1VB3A 4JV5B 1CP3A 4JAVC 3ZYZA 4OBWA 1F1BA 2JAWA 3SIRA 2WE7A 4JJAA 2DR0A 3R6WA 4GXQA 1YB6A 4LE2A 3LY7A 3DMFA 5DF1A 1G5IA 1SKUA 5I8WA 3GRAA 4Z1OA 3P9YA 4RFVA 4BMVA 4LZJA 3DE5X 3FG9A 1GL9B 1UMCB 3NOXA 5FUWA 4MPTA 4P34A 4B34A 5LQSA 1OX4B 2QRUA 4HMPA 5KNBH 2IUTA 3FHOA 2JFBA 5AXCA 2D6FA 3HVJA 4IJQA 1WVMA 3IKLA 4F45A 4TKUA 3RRMA 5CW1A 3HCWA 5L3SB 5B1DA 1Z45A 1PBNA 4WGGA 1EFDN 3ZLVA 4ZVLA 1E2BA 4BXOB 3ET5A 5AVOA 3FJOA 4FR2A 5CTJA 3BHMA 4HJRA 5HGXA 4Q03A 3UPTA 3U4DA 1Z22A 4DMFA 3QSGA 4BAGA 3HJRA 2HHHB 5IH7A 1J1ZA 1G20E 1GR1A 2OCBA 3KZKA 5JSUA 1DO8A 1EFKA 2WJPA 1PL8A 3DBHB 3QMMA 1TAUA 3DGFC 2HBYA 3GH1A 2MCFA 1P60A 2GD2A 3GT0A 5AD1A 1R4AA 2OGWA 3GEBA 3DV0A 3NV7A 2JJ8A 3QM1A 4Y0NA 5C34B 3RIHA 1KJJA 4ZU3A 1SPBS 1G8KA 2RAUA 5DGXA 2C77A 2ZR7A 3PF9A 2IZ1A 3WL8A 2D5IA 1RJFA 3IYLW 3M82A 4NE9A 1KOFA 2I4NA 1YMVA 3VH1A 3O1HB 3M6AA 1TVEA 4ZZ0A 5FNZA 4F3RA 3PD7A 5J3JA 2X15A 1QU3A 1CVIA 1JR2A 3KT8A 3F6RA 3WWOA 5BSEA 3AKDA 2BW0A 2FW6A 3OU6A 5T5QA 4EA6A 4D9KA 1FDTA 1WPGA 2AWNA 2CK3D 2PBRA 4X90A 5DNWA 5JSKA 1I94B 1FIUA 2BFCA 3VOBA 4ACBA 1P2FA 4JGIA 4K6MA 4I0WB 5ICSA 2MWMA 1GQRA 3SYLA 3OC6A 2NYAA 5FO1A 4MWBA 2ALJA 1JWLA 3VH3A 2R00A 4J4BA 3HNRA 4CXMA 1E9AA 2CYCA 3OZEA 3GJXC 5LQKA 1WA5A 1E8MA 3CSDA 3ULKA 1EUDB 5C9ZA 1OAAA 1IZZA 1TCVA 4V3BA 1SBNE 3BS4A 1UINA 4A0SA 2ECKA 4IILA 4LI3X 2I3GA 1OLSA 1GNPA 2EL9A 2QTMA 3GO4A 1D0IA 3Q8KA 2EXXA 4ALLA 3ZGVA 2EFJA 3AEYA 2VQEB 3H5NA 1M8KA 2JJ2A 1S2NA 2Y77A 1LU9A 5EUCA 3JASB 1IE3A 1FJXA 1Z2AA 2ZI6A 3B1ZA 1U9YA 1T8RA 3M9WA 1ZYUA 4FOTA 2DFPA 5EUBA 2UYGA 2UZ4A 2EZ4A 3AUSA 2GRUA 3BTVA 3KJEA 8ADHA 3D59A 3DDHA 2RH9B 4H08A 1Q1NA 2EJBA 2F4NA 1HL7A 2V6FA 3P2IA 2IS6A 2NOAA 3ZCQA 1K5GA 2W6ID 5A06A 3I0MA 1XRQA 4MW1A 3DMPA 2I7TA 1WQ1R 4BNZA 4B3SB 2Y1FA 5L53A 1GV0A 2VQ6A 1I2ZA 3B3AA 1WCIA 5KMGB 2ZKLA 1GL6A 2V96A 4ZOQI 4L9AA 4DQLA 5LP6F 2GCPA 2QX7A 4CMEC 3NNNA 4F1KA 4NJEB 4C3VA 5HZMA 3C2QA 1O6GA 1P4SA 4F38A 2FGJA 4ICIA 2IHYA 1HFJA 1TU0A 4JI0B 2JKVA 4P54A 4YQZA 1PR4A 2EW8A 4HPJB 3AI3A 1XLWA 1Q57A 3E1SA 1JEYA 1D4OA 5LQUA 3RO7A 2QXTA 4DEYA 5KOJA 3MT7A 1KI6B 5FJJA 3ST7A 3LVFO 4YTEA 1SU6A 3K0AB 4YP7A 3FYCA 2PQ0A 3DAOA 3UT0A 5CB8A 1XZCA 4X3OA 5AP9A 2PLRA 1SC9A 3SIWA 3QRWA 3RTEA 2I2WA 2VSYA 4G1EB 2VP2A 3DT8A 2J3DA 5HGJA 5JSFA 1KXZA 4GAEA 3NYQA 4HC4A 1YR6A 1T6BY 4O5OA 2RHTA 3UANA 3ROXA 4EFLA 6CHYA 5BWLA 1XTIA 4AJ9A 4RV5A 3E3AA 4UULA 4TVSA 1XZIA 1DL5A 3U7QA 1ZINA 1BCSA 2C00A 2RJ3A 4FHEA 1DXQA 2AC2A 4K2AA 4ND8A 1UJCA 2AG0A 3SJUA 2WUEA 2X19A 4KLZA 1W34A 2Z5FA 4N1AA 4RPGA 5E7QA 3RSFA 2G8NA 3ESZA 3JQFC 4PZEA 1B6TA 1M34E 4QAJA 1C8BA 1JDVA 2XDAA 3PHIA 3OLCX 1SQ5A 5BN3A 1B15A 3HE3A 3J81k 2BYTA 1ODTC 1OX5A 1PK8A 5KSYA 4EGFA 5HRCA 3OQNA 4ROSA 3KQNA 1WY7A 4WLUA 4R9SA 4OV6B 1HYEA 4U3JA 1NRXA 5KQLA 5E9AA 3KPUA 2H3EA 2J1LA 3M4XA 4MHSA 2O19A 3D81A 4FSHA 1AV6A 1EWYA 5F12A 3IMKA 1CRWG 1KP2A 1YTUA 2ACKA 1OA0A 1MABA 1WZUA 3D1JA 3I2FA 4UBIA 1KFKB 2KSQA 4CQMD 1D2MA 1T4CB 6REQB 3IS3A 2J7PD 1AQLA 3AP1A 3C6BA 3CONA 4L8FA 4X9XA 2R2AA 1CC1S 2JRLA 5FF9A 5TE9A 5G40A 1Z7BA 3BORA 4HUQA 1RLUA 1E6UA 4UM8B 1BOFA 3FKSA 5L3ZA 3ROKA 3BM5A 1JFSA 4BFXA 1BNCA 5HHTA 1YH3A 3D6TB 1PR3A 4KE7A 3BULA 1ZH8A 4BATA 4FYYA 5DP2A 5JMTA 3WMFA 3VC7A 1THZA 3FWZA 4ALJA 4BOYA 3VISA 4D9CA 2YWCA 1ZNZA 4MYUA 3Q11A 3LFTA 1PJTA 4XIYA 5LCXA 5KC9A 3BWYA 1W87A 5EOVA 5REQB 5DX0A 5EKDA 4BO0A 2GUWA 1LD3A 2YWDA 4GZMA 3ESRA 1P9OA 1DZIA 2UV8A 3RTCA 2ZPAA 3KP1A 3MTDA 3K0SA 5TT1A 3I6MA 4ENVA 2A1TR 2F67A 4H6PA 3VSBA 1BFKA 1VYHA 4B3BA 3BMQB 4KWIA 1BN6A 1L1QA 1R0LA 3O8NA 1VLVA 1HDOA 1JAZA 2GBIA 2BMVA 3PS9A 1GG5A 4JJKA 4LXUA 4EVQA 4UEOA 4Z54A 1HYQA 4MCHA 2PRYA 1LTKA 3PEVA 3PUJA 2VATA 1CP2A 3I12A 1M1UA 5F1OA 2QLNA 3UC5A 4B3DA 1DEKA 3G0IA 2ODQA 2QL7A 2DF8A 4JKOA 1ZWKA 3KQYA 2GAAA 4ZO7A 3ZU3A 4HF7A 4DCPA 4RIIA 4E5MA 5KOHB 2G5GX 4F2WA 1FFSA 1KBOA 3L1VA 5CFQA 1P1HA 2YJTD 1LZKA 4H6XA 2J5QA 4NK5A 2UYHA 2CLDX 1O0CA 5BR7A 5FA6A 4GECA 2QRPA 3SHWA 3ZWXA 5JZMA 1B2LA 5A3RA 4BMSA 4A8JA 2XBMA 1Q44A 3GCWA 2QQGA 1FK8A 2ROQA 1W85A 4WASA 1A5ZA 4FYKA 1RYBA 1Y4UA 1T0HB 1DIAA 1TT5B 3TOXA 4YXWD 4PFSA 3UAOA 2C0PA 3WO0A 1MU0A 1FMFA 2QMEA 2V7QA 3H8SA 3R0JA 2NM0A 1OUMA 3K5PA 2XUFA 4GPBA 1Q0TA 2VRNA 4ENSA 3OJXA 1S9DA 3LUHA 3UFXA 4EJSA 2COUA 4R71A 5JAOA 2FYTA 1R6TA 4QTZA 3FPAA 3SPXA 2F90A 5H4GA 2PE5A 4D56A 3RUEA 1BG6A 2H65A 3GFTA 2PX0A 4IF4A 3N6VA 2L18A 1H6DA 1X9HA 4ZAZA 4D9IA 4KQXA 5J5CA 3QWBA 2NZXA 4AWAA 2ZRBA 3MOGA 1M33A 3NJRA 4ZJZA 3P4YA 5TX7A 4XYMA 3VH2A 1E4YA 5ITZA 1E0AA 1R5JA 3BXHA 2P2NA 4G89A 2ZUFA 3MS7A 3KFLA 1S01A 3RFTA 5I7SA 1S7CA 1EHCA 1DKOA 1VCIA 1ZX1A 2H2IA 1EX6A 1DIOB 3CLVA 2YHSA 3K94A 4KE8A 3F46A 1N6KA 1SVOA 3KXLA 3DA8A 3T7TA 3OZFA 1R64A 2DH6A 2OILA 1A0OA 3AL3A 3AHFA 3SQWA 3A1SA 4MA0A 1Q74A 5FXMA 1ZO8A 1RAEA 2ONJA 5C52B 1Z7YA 3FNBA 2VF7A 5CVDA 4O1MA 2DBRA 4FR0A 3IAUA 1E0SA 3VHXA 2BHLA 1C1XA 2WWTA 4BQSA 4D0SA 1TL7C 1O03A 3FLAA 3UB4A 4Y67A 3O82A 5THXA 5L40A 1E3JA 3CNHA 3AUXA 4G1UC 1U3GA 4PIVA 4CDRA 1D07A 2TS1A 4K0RA 3WIDA 1JG1A 3GEHA 4BKRA 1IDOA 3OECA 4L7VA 3ZWWA 1WMAA 2ZSEA 1C81A 4ZIRA 2E6UX 4TV9A 4RXTA 2WHXA 5FBHA 3WICA 1FUYB 1TA9A 4NX2A 4C9BA 2O8CB 1ZNYA 1XEWX 2FZLA 1QUEA 4HK4A 1IVNA 2R00C 3TZQA 2QTVA 2IP1A 4FCVA 4CKBB 1RBZA 4AO7A 3D3WA 3KIPA 2C5BA 1O97D 5G0SA 3OZTA 3P9PA 2R1TA 2AEJA 3PEYA 1CETA 3WK8A 3F9CA 4HLCA 1KSGA 2OXIA 3U7FB 2HH9A 4AMUA 4I5EA 1M2KA 2H06A 1WPQA 3L0YA 2SBTA 2Q6TA 1O8BA 3PQCA 4AS2A 4AN1A 4IG4A 1EU1A 1NQ5A 4D6YA 2L0XA 4B75A 3RK4A 3UXHA 2ZUDA 3B9RA 2ID4A 1CY4A 1YOVA 2XBLA 2SKDA 3OUZA 1J1IA 1NXPA 4YH1A 2EKBA 3I30X 1E0JA 3GAFA 3L7CA 1B73A 1N6OA 2VXCA 2PKQO 3HDVA 4J49A 2PWAA 2G71A 1YU6A 2QJOA 2O2HA 2ECOA 3H6KA 3M5CA 3P4UA 4NZOA 1Y8QA 3AQIA 4FXOA 2I2XB 2A9VA 1KJWA 3DFIA 1B3BA 3BFXA 5K0NA 4IJKA 3FNRA 1TF2A 3VO1A 1OIVA 1QHYA 4G8BA 4LBVA 3QW2A 4N6GA 1ESEA 3ZTYA 5JRDS 4R05A 3IQGX 1IUKA 4N8EA 2N9UA 4ZZIA 2ZS9A 4NP6A 2PZAA 2M6RA 4XLTA 4F60A 1R3DA 4RPIA 5LXTA 3OQPA 4I4NA 5JH7A 1TO6A 2O2DA 4TTSA 2QE7A 3NKVA 2YYZA 5BRJA 2D62A 3CVYA 4WFIA 3L8GA 3D2BA 5JSZB 1QK5A 3B9PA 1RWVA 1VLZA 1C7FA 3FRJA 1NI5A 5IRCD 4DWOA 3BRQA 4PHHA 5D87A 1UKEA 4ZAWA 1T2UA 3KOYA 2GNAA 5DEIA 4RA6A 3P7MA 3A2KA 5IX8A 5L7WA 1BQEA 5IABA 1OMOA 1NM5C 4OFZA 5FTNA 1EX1A 4F3KA 1KTIA 1AGPA 1Z07A 3TOCA 5B1YA 1X19A 1DG9A 4P36A 1JKXA 4FCTA 4L4UA 2V59A 3AU8A 3WZLA 4RZIA 1GZ5A 1KETA 1U9IA 3PWZA 2TSYB 5DIZA 1GN8A 2YV3A 1LDNA 3C70A 1C1HA 5KWEA 5J4LA 1GPNA 1J25A 3BEOA 2IC5A 3COJA 1K8YB 1FSGA 1K8XB 2FWJA 1U3UA 3L02A 5CLIA 1YFLA 3BFKA 4R8VA 4W9NC 1ZC4A 3QVVA 1I0LA 2RGEA 3WO1A 3K9BA 1IZ8A 2CZGA 2QG4A 3IO5A 2PH1A 4PHFA 4Z53A 1WNTA 2QM7A 3H7AA 4BXOA 4RHTA 1KBQA 4JBWA 3ETEA 3NFRA 4MUIA 3W90A 5HUHA 3KWFA 1IY8A 3ENKA 3T1NA 3K0FB 5BSGA 5I7U