1PK3A

Scm sam domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
RANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSEMMMKYMGLKLGPALKICNLVNKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sex comb on midleg CG9495-PA
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
total genus 28
structure length 76
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk3A00
1X9XA 2L5YA 1Z1VA 1JI7A 1UQVA 4NL9C 1SV4A 4RQMA 5F3XB 1X40A 1SXEA 2EANA 2DL0A 3HILA 2QKQA 3H8MA 3BS5B 4RQNA 2KMDA 2D8CA 3SENA 2F3NA 2EAPA 1SV0C 1OW5A 4PZNA 2KE7A 1B4FA 2EAMA 3KKAC 5J8YA 2F8KA 4IS7A 1PK1B 1V38A 1OXJA 2KSOA 2YTUA 2E8MA 2QARB 2KG5A 1COKA 2E8NA 2QB0A 4PZOA 2K4PA 2Y9UA 3BQ7A 5JTIA 2DKZA 3TADA 1KW4A 2GLEA 1RG6A 2JV3A 1WWVA 5JRTA 4NL9A 2E8PA 3BS5A 2KIVA 2F44A 1PK3A 2K60A 3K1RB 1SV0A 3TACB 1SXDA 2LMRA 5JU5A 3KKAA 1PK1A 1F0MA 2FE9A 2Y9TA 1B0XA 3BS7A 2QARA 5KNIA 2LPEA 2QB1A 3SEIA 5J8YC 5L1MA 2E8OA 1UCVA 4NJ8A 2EAOA 2KSOB 1V85A 1LKYB 1DXSA 4MHVA 3IDWA 2ESEA 1SGGA 1X66A 2ES6A 2D3DA 2QB0B 2DKXA 3TADC 1LKYA 2B6GA 1WWUA
chains in the Genus database with same CATH superfamily
3LVVA 1JI7A 2FPLA 7ICEA 5KFZA 1KKXA 5KFMA 1X40A 1MN8A 5ALUA 4UAWA 3EW9A 3RAQA 5ALRA 4R63A 1RZTA 1KFSA 3NRZA 4YR2A 2C2DA 3GIKA 1T4GA 4PZNA 1NK5A 4DFJA 1ZQOA 3OSNA 1NKCA 1D8BA 4NLBA 8ICQA 3F2BA 4KLDA 5AIAA 4DFMA 2YMPA 4RQ8A 5GTIU 4JV0A 4P0QB 4DL4A 1L5UA 4F93B 3IM1A 3C2MA 3PX6A 4RQ1A 2FLLA 2H5XA 4OO1J 5AKIA 4JV1A 1WWVA 1B22A 2F1IA 2PI5A 5JRTA 4KLJA 3PV8A 2DPIA 2C22A 4RQ0A 1L8LA 2W54A 5ALSA 4RT3A 4LZGA 2HHXA 2KJ9A 1PK3A 4B9VA 3G6XA 4PHAA 5CWRA 2C28A 3UMBA 3H7IA 2JR5A 1ECWA 5J2IA 4KX5A 9ICXA 4QZHA 2DPJA 1NZBA 2LPEA 3Q8LA 1ZETA 1LVHA 3NRWA 3L3FX 4M2YA 2YN4A 4OD0A 2KSOB 2ZIWB 2Y1JA 3KHLA 2IHMA 1DXSA 5DQIA 1J97A 3ZDDA 3L4PA 2M0NA 3AL0B 7ICJA 5AKYA 5AI0A 1Z19A 2ZIUA 4M9HA 3T5JA 3QEBZ 2FJ6A 1AROP 4C80A 5T14A 5FP0A 2F2AB 1Z4OA 4TUQA 2L5YA 1J2NA 4UB3A 4DL3A 4RQMA 4P4PA 4QW9A 2HBKA 4M9JA 2OHFA 2BCQA 9ICKA 5H2FU 4Y2UA 4IC9A 3M7DA 8ICYA 5L1JA 2R8JA 5E79U 4IS7A 5HMLA 2EZYA 3SAHA 5EE1A 1TAQA 1OXJA 3LWLA 9ICQA 4KLGA 4X5VA 2AQ0A 3C5GA 1NK7A 4F5RA 1COOA 2ZIVA 2BR0A 3AU2A 3T3FA 3MFHA 3M1YA 4FS1A 3OPXA 4Y2VA 3WK8A 3SV3A 3BQTA 4QZDA 4Q45A 1FO4A 1HUZA 5J0SA 9ICPA 3K4GA 4ELVA 5ALTA 3RH6A 1WYGA 2Y1IA 4YP3A 5KFCA 2BDPA 4J9RA 1YZ6A 4EYIB 8ICFA 4K4GA 5JU5A 3GQCA 4MF2A 3VCBA 4EX7A 1QQ5A 2CPRA 4DQQA 9ICSA 4BDPA 4DL2A 1RYRA 3THVA 3SEIA 3JPRA 4DL5A 3SD7A 2W9BB 3AUOA 5CHGA 4FBUA 4Y2TA 4P0QA 5AM3A 1VDVA 2VJ4A 1ZQDA 1Z3EB 1N61A 3QYPA 3ZD9A 1U48A 3WK7A 4K4IA 3KZXA 4ECZA 2G5IB 4F91B 4A8EA 2JH1A 1DK2A 1KN5A 3D2QA 1D9FA 1QSLA 1SZPA 1WWUA 4I2JA 1X9XA 2ZJAA 4EEKA 1NKBA 1ZQMA 4UB8U 2KVSA 1BNOA 4ECTA 5AM2A 5J2AA 2H3ZA 2E1FA 2ISPA 2EAPA 5IINA 2F8KA 1ZJMA 5J0RA 2ATLA 2KSOA 2YTUA 3RH5A 2ZIWA 2V4RA 3OHAA 3FAHA 1GO3F 4O9MA 2QARB 5AM1A 1L7NA 3AQEA 5KFKA 3QU7A 5KAFU 5L1LA 3SAGA 3WKDA 2DKZA 4XA5A 4JV2A 3TADA 5KG4A 2GH1A 3D2SA 1ZQEA 4RQ4A 1X6IA 2KK0A 1FEZA 1T7PA 5AICA 4ED7A 4NLCA 1V97A 3AMZA 1ZQJA 3LVWA 3M6KA 4Y2PA 2EDUA 5DB7A 4FZMA 3IHQB 4BWMA 2FLPA 5G5HA 2E8OA 2P66A 3PSIA 3TANA 1QQ6A 5KFUA 4F4KA 1ZQRA 3PY8A 3ZI4A 1S0OA 8ICMA 2E1EA 2A1AA 3CNHA 3D2NA 3TFRA 3GIMA 3RJKA 2K8AA 4DFDA 3KTQA 5ALOA 3NVVA 1JN3A 5TZVA 5HR6A 3C28A 4UATA 4JWMA 1X9MA 2EH9A 1L7PA 4I29A 1RM6C 2H3VA 3B0YA 2P35A 5HNKA 2C2RA 1IIPA 2YB4A 7ICNA 3BZKA 2V9WA 1XS9D 2W9BA 2BDUA 2Q0ZX 3RFAA 3G6VA 1ZQFA 2XICA 1CI4A 2KNJA 5J2HA 1M6YA 5J0UA 5ALEA 2D6FC 4DS4A 2W11A 2Y9UA 5KT5A 4C4TA 2K4IA 3K1ZA 3RBDA 4YVZA 3JPPA 3NVYA 4O3OA 4KLMA 2KKPA 3N7PD 3LWMA 4USAA 1XSLA 5DKWA 5KFIA 5BPCA 4Y2QA 4OJLA 2RP5A 2GOLA 2HI0A 4DOAA 2W9MA 4LJXA 4KLHA 4C8LA 2WF6A 5IIOA 3N28A 4OCZA 3HJEA 4PL2A 3MFIA 3F2CA 1ZQLA 1Y88A 2QARA 2ZUCA 8ICNA 1F5SA 3RJEA 3PW7A 2ZTEA 1NJYA 3F2DA 5HP4A 4BXOB 5J0XA 3IRUA 7ICUA 3Q8KA 4Q43A 5KG7A 3QX7A 2RDJA 3MR3A 5AK3A 5BOMA 2KD1A 1T8EA 4P4MA 4YG2A 4Y2JA 4MFCA 1JROA 3BDPA 2K8CB 3C21A 4DQRA 1PVRA 4FZLA 4UW9A 5DDMA 4KLEA 2ZUDA 3E2EA 3CW2C 4NL9C 4F5OA 1V9PA 4O5EA 2Y0SF 3SQIA 3EPGA 1X2IA 5KFXA 5D4BA 3UPQA 1ZQVA 2XY5A 3GFKB 3JPTA 2NRZA 1BPYA 4QZFA 3A0BU 2XGPA 1QTMA 1ZD2P 5J0WA 5KFGA 5J2BA 5KFQA 5J2DA 2KP7A 3SZ2A 2C2EA 4ECYA 4F8RA 4I2IA 4ICAA 8ICZA 2IBKA 4IRDA 4M9NA 2FPMA 3D6JA 9ICCA 3M9OB 5J2KA 2G0AA 4ECWA 4ED3A 2DBYA 2PFNA 2HHSA 1UA0A 3I76A 1ZQGA 4F4WA 1Q3VA 3TACB 3UMCA 3C1ZA 2OYYA 1WG8A 3PW2A 1TK5A 1XU4A 3I28A 3QZ7A 2WFAA 4OJPA 2AGQA 4AP9A 5JUMA 1RYSA 4HYKA 2WF8A 3QU9A 2Y0SC 4NXZA 3GDXA 5KFVA 2G07A 3V6JA 3ICXA 5D49A 3WK9A 1ZQWA 2AU0A 3SV4A 4KLIA 2JXJA 3OTQA 2PKEA 5AK5A 4P2HA 5KFPA 1ZD3A 5C5JA 2OCEA 2EANA 3HILA 1WUDA 4FO6A 5KTQA 1TKDA 4QW8A 2LBOA 7ICGA 1DK3A 4Z6DA 2E3TA 3H4BA 5J0QA 4YD1A 4BXOA 5J8YA 4IRKA 2B21A 2ISOA 1Z4NA 5AM0A 2HW3A 3S6JA 4EELA 3QUTA 3JPSA 1Q3UA 2W8LA 1H38A 4YXMA 2YMQA 1BPZA 8ICOA 4CNQA 2BPGA 2KJ8A 2FDRA 5ALXA 1X9WA 3TAPA 3FDSA 3H8WA 5J0YA 3BJYA 5JTIA 1HUOA 1N2XA 3F5EA 3V7KA 3PSTA 2R8KA 1Z1BA 3PO4A 5ALJA 2JV3A 4QWBA 4JB3A 3MGVA 4BGDA 4CF3A 2BCRA 1A6SA 1B43A 5EE3A 2DWQA 2ZJ5A 4Q8FA 7ICSA 3H4DA 4LVSA 2KTQA 4CCHA 2ZXIA 2KZMA 4C0ZA 1D8YA 1SB3C 3SR6A 2G08A 2H3FA 3N4MB 1JRPA 2I1QA 4F2SA 4KMOB 5AKLA 3H8SA 8ICIA 3F53A 4C8OA 1IV8A 2Z7JA 4C8KA 3CP8A 3OJSA 1N48A 1LV5A 2NRVA 4FBTA 2YY6A 4YMMA 4E0DA 5DGAA 1SGGA 4BWJA 5J29A 1P7DA 2OH2A 5K4LA 3PMLA 4UAZA 4ZH4A 4F5NA 1KLNA 5AIBA 3C2LA 1BPEA 2BHNA 9ICGA 4GC6A 4CRXA 2XCAA 1J2MA 4BX9C 1JALA 4J9QA 3V6KA 3GU3A 4QNLA 2XC9A 4JMUA 2WAQF 4YCXA 3GIIA 3ALRA 3E0FA 4UQGA 3ISCA 1ZD5A 4J9MA 5KT3A 1FFVA 5CEHA 2HOFA 5KL1B 7ICFA 9ICBA 9ICVA 2KJ5A 2H3QA 4P0PB 2EZXA 3BQ2A 4DQIA 4O3MA 3AQFA 4DOBA 4ED1A 4UB4A 2HHTA 4RUCA 1XWLA 4PZOA 4F3OA 4QZAA 1JXLA 1C20A 4HAIA 2F77X 5DQHA 3QUBA 4UB5A 2HMXA 3H0MB 2KKVA 3DV9A 5HHHA 7ICQA 4RZRA 8ICUA 4CGZA 4KLLA 3NVZA 4EEYA 7ICKA 4UAVA 1MA7A 1ZXIA 2UVWA 4DFKA 1SKSA 3MR2A 5TISU 2Y9TA 3G6YA 3UM9A 4YD2A 5KT4A 2W3RA 2W9AA 4GXKA 3C2KA 2HHUA 4KLSA 1SZHA 3NASA 5EWGA 4KLOA 5EE0A 1VJ5A 5G5GA 5DGBA 4ACOA 1QH9A 1ZRNA 1V85A 2IOFA 3PW5A 3E58A 1NK6A 1U9LA 4UASA 3JPNA 2WAQC 3ISDA 2UVRA 2ZTCA 3HW8A 5GTHU 1NK0A 3QUCA 1QLNA 3AEVA 3ZD8A 1LKYA 1ZQAA 4QZGA 4O0IA 4EBDA 4KN7A 3MR5A 4EBEA 1KFTA 2RQ5A 4ELTA 2DL0A 4IR9A 1S77D 5J2EA 3BS5B 4RQNA 2ASLA 2PFOA 1L7MA 4TURA 4KLUA 2F76X 3M8SA 3ZDAA 4RPXA 2KHVA 4DSJA 3QU5A 2VA8A 3JPQA 2DGZA 4RNMA 2KZZA 2F8LA 1L7OA 3TARA 3O0FA 3T5KA 3R9KA 1BPXA 3QU2A 1U4BA 1DGSA 4Y2RA 4ED8A 1ZQSA 4JUZA 5AI6A 5HHIA 3RJJA 4G9BA 7ICTA 5J0OA 5J2GA 4DS5A 2UVVA 1RXWA 5L1IA 3WU2U 5IIMA 3T5LA 1KRPA 5DBAA 1XNSA 4YFKA 3EWAA 2KZ3A 4C7YA 4J9NA 5KG3A 1ZQUA 1KFDA 4DF8A 1B0XA 5HMMA 3LK9A 4P0PA 1HIWA 2A1JB 1RPLA 4C4SA 4EZ9A 1N5WA 2ZXHA 3ETRA 1ZD4A 2CXYA 2NRXA 5AKJA 3KBBA 2PFPA 1TE2A 1L8OA 1PUZA 3IDWA 2ESEA 1RYUA 4PH5A 4EBCA 5KT6A 4NM1A 4U7CA 1K1SA 2NRTA 4NY8A 4F72A 1IM4A 4KX3A 3T5HA 3PW4A 4CE6A 2BCUA 5ALWA 1JMSA 2JMGA 1UT8A 1D8LA 4EX6A 4IR1A 4ED2A 1A77A 5KFTA 5ALQA 4F4ZA 5ALKA 5AKHA 1S8OA 4PGXA 2B0CA 4US8A 8ICLA 4FFDA 2KIWA 3AU6A 4IQWA 5ALDA 1XC9A 2EAMA 2NO5A 2EQYA 1X42A 5HR7A 1PVQA 2LKYA 5AK4A 2JRZA 5D46A 5DG9A 4RQ3A 3GV7B 4I2GA 1XSNA 4IL6U 2BPFA 1NJZA 2FPKA 1CEZA 9ICLA 3BQ7A 3K75D 1LB2B 2BZFA 1TFRA 3GILA 1O08A 4DO9A 7ICPA 5ALVA 1D9DA 4GXIA 1ZJNA 2VKQA 1X9SA 1BVSA 2I6XA 3MR6A 4Y2XA 5IIIA 4O5CA 3BS5A 2F44A 3KHRA 1TVAA 2J6TA 3KZIU 3U26A 8ICAA 3HX0A 1L3VA 1SKRA 1S10A 5J2FA 3PO5A 3C29A 4Z6EA 4IQTA 5KFFA 3Q8QB 2ZG6A 3UXOA 4RPZA 2WB1F 3ZDBA 4TUSA 4B9UA 2F1JA 4I28A 3BQ0A 1XO1A 2J6SA 2FMQA 1ED1A 2FI1A 5KFHA 4QIWF 3OHBA 2KICA 2BKEA 1RQNA 3M9NB 4C8MA 4M6WB 2WTFA 3ONNA 3WKEA 2BGWA 3PMNA 3H8JA 2AH5A 4FZNA 4C8NA 2J6UA 2QB0B 3ISBA 3WK6A 4MFAA 2HSZA 2XGQA 3RRHA 2W43A 4J03A 3AN1A 3GV8B 3TQ1A 2XIDA 1Z1VA 2F1HA 2CN1A 1YZ7A 7ICHA 1NK8A 1ZQBA 4DSFA 2HHVA 5KFDA 4F50A 3PW0A 4OJ6A 4JWNA 2A1JA 3KKAC 4KTQA 2WHEA 1NK9A 4JK1A 3PR4A 3L5KA 5IILA 4QZ8A 2A19A 4YQWA 4IQVA 4M47A 4KN4A 5DLFA 5KL8B 1MQ2A 4NLKA 1L6NA 4B9NA 5EOZA 2E8NA 2DFLA 1S0NA 4QZIA 3BZCA 1SL0A 2PXIA 2WB1C 4EYHB 4GXJA 4PHPA 1TAUA 4NL9A 2HBLA 2AXTU 1ZRMA 4C4RA 2E8PA 9ICOA 4QIWC 2W9CB 2W04A 1F44A 4RQ2A 1T3QA 4KLFA 8ICGA 4PJ0U 1MSWD 1NKEA 1S76D 2MUTB 1KBUA 4QZCA 2FE9A 2MU2A 4DQPA 1T3NA 2YX8A 4FS2A 4F4XA 4RUAA 4DL6A 3EPIA 3PR5B 4NJ8A 4NLZA 2EAOA 2LM1A 2BPCA 2NO4A 4DLEA 1HJPA 3Q8MA 8ICTA 1XSPA 2JZBB 3FYHA 9ICFA 3KHGA 3UXNA 2XO7A 4YXJA 2GWSA 2KFZA 1N56A 3CYMA 5KG5A 3H0RB 4ED0A 3RJIA 4U6PA 3MGHA 1SV0C 4M0AA 2W8KA 4QWAA 4F4YA 1JX4A 1KL9A 3F5AA 2BCVA 4C7ZA 1YT3A 3B9JA 3I1YA 2ASDA 3EZ5A 3IP4B 7ICVA 1ZQQA 2HCFA 4RQ6A 4NM2A 4M6WA 4RT2A 4ZOHC 5AM5A 3SYZA 5CB1A 5AKZA 8ICHA 4XRHA 3M9MB 2HVHA 2QB0A 5IIKA 7ICLA 2JEJA 3PSPA 3NTUA 4TQRA 1S0VA 4YMOA 2VA2A 5CP2A 2W55A 3QE9Y 2GLEA 2PMZF 2BQ3A 4I2FA 4KITB 2IA6A 5AKEA 2O6KA 2BCSA 4I2HA 4GLXA 4EZ6A 3ED5A 2K4HA 2IOFK 4YR0A 1UT5A 1S5LU 3GZFA 4QZ9A 2K60A 2HOQA 2HOIA 1JIHA 3KD3A 9ICAA 4I2AA 1UPHA 9ICNA 2DF4B 3RB6A 4J9OA 4F2RA 1ZQHA 4PGQA 1ZQXA 4XQ8A 1A76A 2QLTA 5KNIA 4ECRA 2G09A 3RB4A 1S9FA 2HHQA 9ICUA 3TAQA 2P6RA 2JEGA 3LDAA 4I27A 4I2DA 1LKYB 3RH4A 2KFNA 3N97B 2A3VA 4Y2YA 5KFSA 2XCPA 2R8HA 4ECUA 5DG7A 1X66A 2ES6A 5ALMA 1QCKA 5AI4A 2W9CA 1ZQYA 2AQ4A 4J9SA 3HKZF 2G06A 5KFEA 1RQLA 4NLGA 2RRDA 3V7LA 2OEHA 4UBCA 1NNLA 1WCNA 4RQ5A 4EENA 2MUTA 2KVCA 1AQ6A 9ICMA 3OSPA 3IN5A 8ICJA 4G3IA 3SENA 4ECQA 8ICPA 4MFFA 1KQQA 2PMZC 4DSEA 1CRXA 2VANA 4PHDA 1U47A 1EXNA 1PZNA 5J0TA 2LYBA 3Q8SB 4MEXA 1PVPA 3OGUA 3UMGA 4GC7A 2HBMA 4UB2A 8ICBA 2AGPA 2V4QA 4CDGA 3RB0A 3MABA 4UARA 2JZBA 2K4PA 4CF4A 1KW4A 5KAIU 5DG8A 2YMLA 4Z6CA 4KLQA 2DQNB 1N63A 3DEEA 2RLTA 3ETLA 5KT2A 5KG0A 4B6JA 2LI6A 3MBYA 2KIVA 5EWEA 2ZJ8A 4ED6A 1QSSA 1L3UA 3PNCA 4DFPA 4R65A 2ZUBA 2XY7A 1IXRA 3BS7A 9ICEA 1JXEA 3HKZC 3KFUF 1QQ7A 3M8RA 9ICIA 3SI8A 2LHTA 2XI9A 4UAUA 3OJUA 3BQ1A 4YN4A 1ZQZA 7ICIA 2D3DA 1RXVA 2K8BB 5KFBA 1BNPA 3VC8A 2N1RA 1O03A 5ALFA 1FIQA 1T94A 3SAFA 1TV9A 2W7PA 5ALGA 3V72A 3QEAZ 2PFQA 2Q4TA 4PHEA 5KFLA 4QZBA 8ICKA 1L3TA 3RF9A 4UAYA 1VLBA 2KMDA 2ZTDA 1XO0A 2HDOA 1NJXA 4DQSA 3ZDCA 3TI0A 4YR3A 2MAXA 1PK1B 3ORYA 4DSKA 2WF7A 2LYHA 2YQEA 4Q8EA 4DSIA 3MDAA 3IG5A 2E8MA 2H3IA 4O3QA 8ICCA 4NLNA 2I5HA 4XUSA 2XY6A 4R64A 1U45A 4B9MA 2R8IA 4DOCA 5KFOA 3MC1A 1BPBA 9ICHA 3UQ2A 4F5PA 4LZDA 1RG6A 3IV6A 4R8UB 1ZQNA 4ELUA 5KFWA 4UB1A 3C1YA 3TKAA 5EWFA 7ICRA 2WF5A 4M04A 1NJWA 4OJ5A 3IG8A 3SMVA 4KMUA 5KFNA 5BOLA 2LMRA 5L1KA 9ICJA 4P4OA 3QUQA 3RBEA 4GFJA 1F0MA 1ZQIA 2HVIA 1S97A 4UBBA 4I2BA 1K5OA 3UXPA 2QB1A 2ZIXB 1S0MA 1ZQCA 3RAXA 5KT7A 2KOBA 1N60A 1SL2A 4M9GA 3HWTA 1SWWA 9ICRA 5KFJA 3WKAA 2IMWP 3DDHA 1Z00B 3RJFA 3NGDA 2I9GA 5J2JA 2HBJA 3UQ0A 3TADC 4PGYA 4TUPA 2R8GA 4YMNA 9ICTA 1A0PA 3ZDEA 1UQVA 5F9LA 4R66A 4IRCA 5F3XB 2W03A 2AJQA 1DOQA 4OJOA 5CRXA 4I2EA 1NOMA 2D8CA 3PZPA 2F3NA 4PL1A 4B9TA 2NRWA 3FM9A 2KE7A 2RHFA 4BUGA 1RDFA 4RNOA 4MEYA 5KFYA 2JEIA 2GO7A 4J9KA 3TFSA 1Q8KA 1ZQTA 4NWIA 3HP6A 4ECSA 2JH7A 3WK5A 5ALNA 2KG5A 1C7YA 8ICSA 3N7RC 2PI4A 2IHNA 3Q8RB 3AM9A 3RJHA 2VA3A 2G5HB 3C5FA 3RB3A 4F92B 2AGOA 1NI3A 3HT3A 5AHXA 4O3SA 4DF4A 3PX0A 2MRLA 1KDHA 5ALIA 4O5KA 5CR0A 3RTVA 1FFUA 3N7SC 5J0PA 5F9NA 2CRXA 5KG6A 5AM4A 2DUYA 5J2CA 4RPYA 1PK1A 3FC4A 3RR7A 4I2CA 5DLGA 2ASJA 3T79A 5EE9A 5DB8A 8ICEA 3V6HA 5DQGA 4QWCA 4QWDA 3QNMA 4MF8A 1N5XA 1QSYA 1DRGA 4B9LA 1ZQKA 3CRXA 4R8UA 1CUKA 1BGXT 2P6UA 1BPDA 2MSNA 4F5QA 4O3PA 5ALLA 2ODGA 2LM4A 3QZ8A 1WCLA 2IOHA 8ICVA 2DKXA 3A0HU 1OUQA 4O3NA 5IIJA 4K4HA 4DSLA 2JEFA 4FE3A 1UA1A 2VJ5A 4GIBA 5CA7A 4UB6U 2YB1A 8ICXA 2OXOA 5DDYA 2ZIXA 2JGAA 5AI8A 1KSPA 1V38A 3GIJA 2FMSA 5DBBA 5AI5A 2JHDA 4TQSA 1ZQ1C 1Z00A 3LYSA 2LYAA 3NVWA 2KN7A 1KTQA 1Q46A 2BQRA 2UVUA 3MGIA 4Q44A 4ECXA 5KG2A 4RNNA 7ICOA 2NV3A 4B9SA 2OWOA 5ALPA 2FMPA 3Q8PB 5C0YA 1ZOLA 2YMMA 3C23A 7ICMA 1K1QA 4DLGA 2EZZA 3K1RB 3V7JA 3EYZA 1L3SA 1SXDA 5AK6A 3RJGA 1DGJA 3KKAA 3NUQA 5DB6A 3PSFA 8ICWA 4QWEA 2OM6A 3RR8A 2MA1A 5CJ7A 2K4EA 2BQUA 1ZQPA 3EUB2 4CF5A 1UCVA 5AI9A 1X6JA 4RU9A 1ZYQA 4IQUA 3MDCA 2W3SA 4J9LA 5B66U 4M9LA 3QU4A 5AKKA 1NZPA 3HRDD 2W7OA 2KV2A 5ALYA 4PPXA 3J81j 3NS1A 2HHWA 1SV4A 4ECVA 1MQ3A 2RDIA 1SXEA 5KFAA 5AKGA 5B5EU 2QKQA 1KEJA 3WK4A 4NV0A 2M9NA 3H8MA 1MC8A 1SWVA 1IG6A 1OW5A 4DEZA 4US9A 1SKWA 9ICWA 4Z6FA 1B4FA 4AYBF 4O3RA 1N62A 4F71A 4DWIA 3WKBA 1HEKA 2K89A 3KOOA 5DBCA 4J9PA 4DCCA 3GV5B 1TAMA 1UHUA 3PX4A 3QXGA 3M6ZA 5AKXA 3HPOA 1COKA 4KLTA 3JPOA 4Y2SA 2WF9A 3WKCA 1TK8A 1SIJA 3PVXA 2ZIUB 4DL7A 3H0LB 2VIXA 3B0XA 4WJ3B 5ALZA 4BJQA 1SV0A 1NK4A 5KG1A 4QZEA 2NYVA 1TK0A 1U49A 1SL1A 5L1MA 5J8YC 4RQ7A 2E5SA 2ALZA 2FLNA 5ALHA 5L9XA 2AHOB 5A0LA 3KHHA 4QJFB 2XVTA 3RRGA 5KFRA 4MHVA 8ICRA 2ZIVB 1URJA 2R18A 4AYBC 3H40A 5DB9A 2KEYA 1JUDA 2B6GA 2KHQA
chains in the Genus database with same CATH topology
1X9XA 2L5YA 1Z1VA 1JI7A 1UQVA 4NL9C 1SV4A 4RQMA 5F3XB 1X40A 1SXEA 2EANA 2DL0A 3HILA 2QKQA 3H8MA 3BS5B 4RQNA 2KMDA 2D8CA 3SENA 2F3NA 2EAPA 1SV0C 1OW5A 4PZNA 2KE7A 1B4FA 2EAMA 3KKAC 5J8YA 2F8KA 4IS7A 1PK1B 1V38A 1OXJA 2KSOA 2YTUA 2E8MA 2QARB 2KG5A 1COKA 2E8NA 2QB0A 4PZOA 2K4PA 2Y9UA 3BQ7A 5JTIA 2DKZA 3TADA 1KW4A 2GLEA 1RG6A 2JV3A 1WWVA 5JRTA 4NL9A 2E8PA 3BS5A 2KIVA 2F44A 1PK3A 2K60A 3K1RB 1SV0A 3TACB 1SXDA 2LMRA 5JU5A 3KKAA 1PK1A 1F0MA 2FE9A 2Y9TA 1B0XA 3BS7A 2QARA 5KNIA 2LPEA 2QB1A 3SEIA 5J8YC 5L1MA 2E8OA 1UCVA 4NJ8A 2EAOA 2KSOB 1V85A 1LKYB 1DXSA 4MHVA 3IDWA 2ESEA 1SGGA 1X66A 2ES6A 2D3DA 2QB0B 2DKXA 3TADC 1LKYA 2B6GA 1WWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9X A;  2L5Y A;  1Z1V A;  1JI7 A;  1UQV A;  4NL9 C;  1SV4 A;  4RQM A;  5F3X B;  1X40 A;  1SXE A;  2EAN A;  2DL0 A;  3HIL A;  2QKQ A;  3H8M A;  3BS5 B;  4RQN A;  2KMD A;  2D8C A;  3SEN A;  2F3N A;  2EAP A;  1SV0 C;  1OW5 A;  4PZN A;  2KE7 A;  1B4F A;  2EAM A;  3KKA C;  5J8Y A;  2F8K A;  4IS7 A;  1PK1 B;  1V38 A;  1OXJ A;  2KSO A;  2YTU A;  2E8M A;  2QAR B;  2KG5 A;  1COK A;  2E8N A;  2QB0 A;  4PZO A;  2K4P A;  2Y9U A;  3BQ7 A;  5JTI A;  2DKZ A;  3TAD A;  1KW4 A;  2GLE A;  1RG6 A;  2JV3 A;  1WWV A;  5JRT A;  4NL9 A;  2E8P A;  3BS5 A;  2KIV A;  2F44 A;  1PK3 A;  2K60 A;  3K1R B;  1SV0 A;  3TAC B;  1SXD A;  2LMR A;  5JU5 A;  3KKA A;  1PK1 A;  1F0M A;  2FE9 A;  2Y9T A;  1B0X A;  3BS7 A;  2QAR A;  5KNI A;  2LPE A;  2QB1 A;  3SEI A;  5J8Y C;  5L1M A;  2E8O A;  1UCV A;  4NJ8 A;  2EAO A;  2KSO B;  1V85 A;  1LKY B;  1DXS A;  4MHV A;  3IDW A;  2ESE A;  1SGG A;  1X66 A;  2ES6 A;  2D3D A;  2QB0 B;  2DKX A;  3TAD C;  1LKY A;  2B6G A;  1WWU A; 
#chains in the Genus database with same CATH topology
 3LVV A;  1JI7 A;  2FPL A;  7ICE A;  5KFZ A;  1KKX A;  5KFM A;  1X40 A;  1MN8 A;  5ALU A;  4UAW A;  3EW9 A;  3RAQ A;  5ALR A;  4R63 A;  1RZT A;  1KFS A;  3NRZ A;  4YR2 A;  2C2D A;  3GIK A;  1T4G A;  4PZN A;  1NK5 A;  4DFJ A;  1ZQO A;  3OSN A;  1NKC A;  1D8B A;  4NLB A;  8ICQ A;  3F2B A;  4KLD A;  5AIA A;  4DFM A;  2YMP A;  4RQ8 A;  5GTI U;  4JV0 A;  4P0Q B;  4DL4 A;  1L5U A;  4F93 B;  3IM1 A;  3C2M A;  3PX6 A;  4RQ1 A;  2FLL A;  2H5X A;  4OO1 J;  5AKI A;  4JV1 A;  1WWV A;  1B22 A;  2F1I A;  2PI5 A;  5JRT A;  4KLJ A;  3PV8 A;  2DPI A;  2C22 A;  4RQ0 A;  1L8L A;  2W54 A;  5ALS A;  4RT3 A;  4LZG A;  2HHX A;  2KJ9 A;  1PK3 A;  4B9V A;  3G6X A;  4PHA A;  5CWR A;  2C28 A;  3UMB A;  3H7I A;  2JR5 A;  1ECW A;  5J2I A;  4KX5 A;  9ICX A;  4QZH A;  2DPJ A;  1NZB A;  2LPE A;  3Q8L A;  1ZET A;  1LVH A;  3NRW A;  3L3F X;  4M2Y A;  2YN4 A;  4OD0 A;  2KSO B;  2ZIW B;  2Y1J A;  3KHL A;  2IHM A;  1DXS A;  5DQI A;  1J97 A;  3ZDD A;  3L4P A;  2M0N A;  3AL0 B;  7ICJ A;  5AKY A;  5AI0 A;  1Z19 A;  2ZIU A;  4M9H A;  3T5J A;  3QEB Z;  2FJ6 A;  1ARO P;  4C80 A;  5T14 A;  5FP0 A;  2F2A B;  1Z4O A;  4TUQ A;  2L5Y A;  1J2N A;  4UB3 A;  4DL3 A;  4RQM A;  4P4P A;  4QW9 A;  2HBK A;  4M9J A;  2OHF A;  2BCQ A;  9ICK A;  5H2F U;  4Y2U A;  4IC9 A;  3M7D A;  8ICY A;  5L1J A;  2R8J A;  5E79 U;  4IS7 A;  5HML A;  2EZY A;  3SAH A;  5EE1 A;  1TAQ A;  1OXJ A;  3LWL A;  9ICQ A;  4KLG A;  4X5V A;  2AQ0 A;  3C5G A;  1NK7 A;  4F5R A;  1COO A;  2ZIV A;  2BR0 A;  3AU2 A;  3T3F A;  3MFH A;  3M1Y A;  4FS1 A;  3OPX A;  4Y2V A;  3WK8 A;  3SV3 A;  3BQT A;  4QZD A;  4Q45 A;  1FO4 A;  1HUZ A;  5J0S A;  9ICP A;  3K4G A;  4ELV A;  5ALT A;  3RH6 A;  1WYG A;  2Y1I A;  4YP3 A;  5KFC A;  2BDP A;  4J9R A;  1YZ6 A;  4EYI B;  8ICF A;  4K4G A;  5JU5 A;  3GQC A;  4MF2 A;  3VCB A;  4EX7 A;  1QQ5 A;  2CPR A;  4DQQ A;  9ICS A;  4BDP A;  4DL2 A;  1RYR A;  3THV A;  3SEI A;  3JPR A;  4DL5 A;  3SD7 A;  2W9B B;  3AUO A;  5CHG A;  4FBU A;  4Y2T A;  4P0Q A;  5AM3 A;  1VDV A;  2VJ4 A;  1ZQD A;  1Z3E B;  1N61 A;  3QYP A;  3ZD9 A;  1U48 A;  3WK7 A;  4K4I A;  3KZX A;  4ECZ A;  2G5I B;  4F91 B;  4A8E A;  2JH1 A;  1DK2 A;  1KN5 A;  3D2Q A;  1D9F A;  1QSL A;  1SZP A;  1WWU A;  4I2J A;  1X9X A;  2ZJA A;  4EEK A;  1NKB A;  1ZQM A;  4UB8 U;  2KVS A;  1BNO A;  4ECT A;  5AM2 A;  5J2A A;  2H3Z A;  2E1F A;  2ISP A;  2EAP A;  5IIN A;  2F8K A;  1ZJM A;  5J0R A;  2ATL A;  2KSO A;  2YTU A;  3RH5 A;  2ZIW A;  2V4R A;  3OHA A;  3FAH A;  1GO3 F;  4O9M A;  2QAR B;  5AM1 A;  1L7N A;  3AQE A;  5KFK A;  3QU7 A;  5KAF U;  5L1L A;  3SAG A;  3WKD A;  2DKZ A;  4XA5 A;  4JV2 A;  3TAD A;  5KG4 A;  2GH1 A;  3D2S A;  1ZQE A;  4RQ4 A;  1X6I A;  2KK0 A;  1FEZ A;  1T7P A;  5AIC A;  4ED7 A;  4NLC A;  1V97 A;  3AMZ A;  1ZQJ A;  3LVW A;  3M6K A;  4Y2P A;  2EDU A;  5DB7 A;  4FZM A;  3IHQ B;  4BWM A;  2FLP A;  5G5H A;  2E8O A;  2P66 A;  3PSI A;  3TAN A;  1QQ6 A;  5KFU A;  4F4K A;  1ZQR A;  3PY8 A;  3ZI4 A;  1S0O A;  8ICM A;  2E1E A;  2A1A A;  3CNH A;  3D2N A;  3TFR A;  3GIM A;  3RJK A;  2K8A A;  4DFD A;  3KTQ A;  5ALO A;  3NVV A;  1JN3 A;  5TZV A;  5HR6 A;  3C28 A;  4UAT A;  4JWM A;  1X9M A;  2EH9 A;  1L7P A;  4I29 A;  1RM6 C;  2H3V A;  3B0Y A;  2P35 A;  5HNK A;  2C2R A;  1IIP A;  2YB4 A;  7ICN A;  3BZK A;  2V9W A;  1XS9 D;  2W9B A;  2BDU A;  2Q0Z X;  3RFA A;  3G6V A;  1ZQF A;  2XIC A;  1CI4 A;  2KNJ A;  5J2H A;  1M6Y A;  5J0U A;  5ALE A;  2D6F C;  4DS4 A;  2W11 A;  2Y9U A;  5KT5 A;  4C4T A;  2K4I A;  3K1Z A;  3RBD A;  4YVZ A;  3JPP A;  3NVY A;  4O3O A;  4KLM A;  2KKP A;  3N7P D;  3LWM A;  4USA A;  1XSL A;  5DKW A;  5KFI A;  5BPC A;  4Y2Q A;  4OJL A;  2RP5 A;  2GOL A;  2HI0 A;  4DOA A;  2W9M A;  4LJX A;  4KLH A;  4C8L A;  2WF6 A;  5IIO A;  3N28 A;  4OCZ A;  3HJE A;  4PL2 A;  3MFI A;  3F2C A;  1ZQL A;  1Y88 A;  2QAR A;  2ZUC A;  8ICN A;  1F5S A;  3RJE A;  3PW7 A;  2ZTE A;  1NJY A;  3F2D A;  5HP4 A;  4BXO B;  5J0X A;  3IRU A;  7ICU A;  3Q8K A;  4Q43 A;  5KG7 A;  3QX7 A;  2RDJ A;  3MR3 A;  5AK3 A;  5BOM A;  2KD1 A;  1T8E A;  4P4M A;  4YG2 A;  4Y2J A;  4MFC A;  1JRO A;  3BDP A;  2K8C B;  3C21 A;  4DQR A;  1PVR A;  4FZL A;  4UW9 A;  5DDM A;  4KLE A;  2ZUD A;  3E2E A;  3CW2 C;  4NL9 C;  4F5O A;  1V9P A;  4O5E A;  2Y0S F;  3SQI A;  3EPG A;  1X2I A;  5KFX A;  5D4B A;  3UPQ A;  1ZQV A;  2XY5 A;  3GFK B;  3JPT A;  2NRZ A;  1BPY A;  4QZF A;  3A0B U;  2XGP A;  1QTM A;  1ZD2 P;  5J0W A;  5KFG A;  5J2B A;  5KFQ A;  5J2D A;  2KP7 A;  3SZ2 A;  2C2E A;  4ECY A;  4F8R A;  4I2I A;  4ICA A;  8ICZ A;  2IBK A;  4IRD A;  4M9N A;  2FPM A;  3D6J A;  9ICC A;  3M9O B;  5J2K A;  2G0A A;  4ECW A;  4ED3 A;  2DBY A;  2PFN A;  2HHS A;  1UA0 A;  3I76 A;  1ZQG A;  4F4W A;  1Q3V A;  3TAC B;  3UMC A;  3C1Z A;  2OYY A;  1WG8 A;  3PW2 A;  1TK5 A;  1XU4 A;  3I28 A;  3QZ7 A;  2WFA A;  4OJP A;  2AGQ A;  4AP9 A;  5JUM A;  1RYS A;  4HYK A;  2WF8 A;  3QU9 A;  2Y0S C;  4NXZ A;  3GDX A;  5KFV A;  2G07 A;  3V6J A;  3ICX A;  5D49 A;  3WK9 A;  1ZQW A;  2AU0 A;  3SV4 A;  4KLI A;  2JXJ A;  3OTQ A;  2PKE A;  5AK5 A;  4P2H A;  5KFP A;  1ZD3 A;  5C5J A;  2OCE A;  2EAN A;  3HIL A;  1WUD A;  4FO6 A;  5KTQ A;  1TKD A;  4QW8 A;  2LBO A;  7ICG A;  1DK3 A;  4Z6D A;  2E3T A;  3H4B A;  5J0Q A;  4YD1 A;  4BXO A;  5J8Y A;  4IRK A;  2B21 A;  2ISO A;  1Z4N A;  5AM0 A;  2HW3 A;  3S6J A;  4EEL A;  3QUT A;  3JPS A;  1Q3U A;  2W8L A;  1H38 A;  4YXM A;  2YMQ A;  1BPZ A;  8ICO A;  4CNQ A;  2BPG A;  2KJ8 A;  2FDR A;  5ALX A;  1X9W A;  3TAP A;  3FDS A;  3H8W A;  5J0Y A;  3BJY A;  5JTI A;  1HUO A;  1N2X A;  3F5E A;  3V7K A;  3PST A;  2R8K A;  1Z1B A;  3PO4 A;  5ALJ A;  2JV3 A;  4QWB A;  4JB3 A;  3MGV A;  4BGD A;  4CF3 A;  2BCR A;  1A6S A;  1B43 A;  5EE3 A;  2DWQ A;  2ZJ5 A;  4Q8F A;  7ICS A;  3H4D A;  4LVS A;  2KTQ A;  4CCH A;  2ZXI A;  2KZM A;  4C0Z A;  1D8Y A;  1SB3 C;  3SR6 A;  2G08 A;  2H3F A;  3N4M B;  1JRP A;  2I1Q A;  4F2S A;  4KMO B;  5AKL A;  3H8S A;  8ICI A;  3F53 A;  4C8O A;  1IV8 A;  2Z7J A;  4C8K A;  3CP8 A;  3OJS A;  1N48 A;  1LV5 A;  2NRV A;  4FBT A;  2YY6 A;  4YMM A;  4E0D A;  5DGA A;  1SGG A;  4BWJ A;  5J29 A;  1P7D A;  2OH2 A;  5K4L A;  3PML A;  4UAZ A;  4ZH4 A;  4F5N A;  1KLN A;  5AIB A;  3C2L A;  1BPE A;  2BHN A;  9ICG A;  4GC6 A;  4CRX A;  2XCA A;  1J2M A;  4BX9 C;  1JAL A;  4J9Q A;  3V6K A;  3GU3 A;  4QNL A;  2XC9 A;  4JMU A;  2WAQ F;  4YCX A;  3GII A;  3ALR A;  3E0F A;  4UQG A;  3ISC A;  1ZD5 A;  4J9M A;  5KT3 A;  1FFV A;  5CEH A;  2HOF A;  5KL1 B;  7ICF A;  9ICB A;  9ICV A;  2KJ5 A;  2H3Q A;  4P0P B;  2EZX A;  3BQ2 A;  4DQI A;  4O3M A;  3AQF A;  4DOB A;  4ED1 A;  4UB4 A;  2HHT A;  4RUC A;  1XWL A;  4PZO A;  4F3O A;  4QZA A;  1JXL A;  1C20 A;  4HAI A;  2F77 X;  5DQH A;  3QUB A;  4UB5 A;  2HMX A;  3H0M B;  2KKV A;  3DV9 A;  5HHH A;  7ICQ A;  4RZR A;  8ICU A;  4CGZ A;  4KLL A;  3NVZ A;  4EEY A;  7ICK A;  4UAV A;  1MA7 A;  1ZXI A;  2UVW A;  4DFK A;  1SKS A;  3MR2 A;  5TIS U;  2Y9T A;  3G6Y A;  3UM9 A;  4YD2 A;  5KT4 A;  2W3R A;  2W9A A;  4GXK A;  3C2K A;  2HHU A;  4KLS A;  1SZH A;  3NAS A;  5EWG A;  4KLO A;  5EE0 A;  1VJ5 A;  5G5G A;  5DGB A;  4ACO A;  1QH9 A;  1ZRN A;  1V85 A;  2IOF A;  3PW5 A;  3E58 A;  1NK6 A;  1U9L A;  4UAS A;  3JPN A;  2WAQ C;  3ISD A;  2UVR A;  2ZTC A;  3HW8 A;  5GTH U;  1NK0 A;  3QUC A;  1QLN A;  3AEV A;  3ZD8 A;  1LKY A;  1ZQA A;  4QZG A;  4O0I A;  4EBD A;  4KN7 A;  3MR5 A;  4EBE A;  1KFT A;  2RQ5 A;  4ELT A;  2DL0 A;  4IR9 A;  1S77 D;  5J2E A;  3BS5 B;  4RQN A;  2ASL A;  2PFO A;  1L7M A;  4TUR A;  4KLU A;  2F76 X;  3M8S A;  3ZDA A;  4RPX A;  2KHV A;  4DSJ A;  3QU5 A;  2VA8 A;  3JPQ A;  2DGZ A;  4RNM A;  2KZZ A;  2F8L A;  1L7O A;  3TAR A;  3O0F A;  3T5K A;  3R9K A;  1BPX A;  3QU2 A;  1U4B A;  1DGS A;  4Y2R A;  4ED8 A;  1ZQS A;  4JUZ A;  5AI6 A;  5HHI A;  3RJJ A;  4G9B A;  7ICT A;  5J0O A;  5J2G A;  4DS5 A;  2UVV A;  1RXW A;  5L1I A;  3WU2 U;  5IIM A;  3T5L A;  1KRP A;  5DBA A;  1XNS A;  4YFK A;  3EWA A;  2KZ3 A;  4C7Y A;  4J9N A;  5KG3 A;  1ZQU A;  1KFD A;  4DF8 A;  1B0X A;  5HMM A;  3LK9 A;  4P0P A;  1HIW A;  2A1J B;  1RPL A;  4C4S A;  4EZ9 A;  1N5W A;  2ZXH A;  3ETR A;  1ZD4 A;  2CXY A;  2NRX A;  5AKJ A;  3KBB A;  2PFP A;  1TE2 A;  1L8O A;  1PUZ A;  3IDW A;  2ESE A;  1RYU A;  4PH5 A;  4EBC A;  5KT6 A;  4NM1 A;  4U7C A;  1K1S A;  2NRT A;  4NY8 A;  4F72 A;  1IM4 A;  4KX3 A;  3T5H A;  3PW4 A;  4CE6 A;  2BCU A;  5ALW A;  1JMS A;  2JMG A;  1UT8 A;  1D8L A;  4EX6 A;  4IR1 A;  4ED2 A;  1A77 A;  5KFT A;  5ALQ A;  4F4Z A;  5ALK A;  5AKH A;  1S8O A;  4PGX A;  2B0C A;  4US8 A;  8ICL A;  4FFD A;  2KIW A;  3AU6 A;  4IQW A;  5ALD A;  1XC9 A;  2EAM A;  2NO5 A;  2EQY A;  1X42 A;  5HR7 A;  1PVQ A;  2LKY A;  5AK4 A;  2JRZ A;  5D46 A;  5DG9 A;  4RQ3 A;  3GV7 B;  4I2G A;  1XSN A;  4IL6 U;  2BPF A;  1NJZ A;  2FPK A;  1CEZ A;  9ICL A;  3BQ7 A;  3K75 D;  1LB2 B;  2BZF A;  1TFR A;  3GIL A;  1O08 A;  4DO9 A;  7ICP A;  5ALV A;  1D9D A;  4GXI A;  1ZJN A;  2VKQ A;  1X9S A;  1BVS A;  2I6X A;  3MR6 A;  4Y2X A;  5III A;  4O5C A;  3BS5 A;  2F44 A;  3KHR A;  1TVA A;  2J6T A;  3KZI U;  3U26 A;  8ICA A;  3HX0 A;  1L3V A;  1SKR A;  1S10 A;  5J2F A;  3PO5 A;  3C29 A;  4Z6E A;  4IQT A;  5KFF A;  3Q8Q B;  2ZG6 A;  3UXO A;  4RPZ A;  2WB1 F;  3ZDB A;  4TUS A;  4B9U A;  2F1J A;  4I28 A;  3BQ0 A;  1XO1 A;  2J6S A;  2FMQ A;  1ED1 A;  2FI1 A;  5KFH A;  4QIW F;  3OHB A;  2KIC A;  2BKE A;  1RQN A;  3M9N B;  4C8M A;  4M6W B;  2WTF A;  3ONN A;  3WKE A;  2BGW A;  3PMN A;  3H8J A;  2AH5 A;  4FZN A;  4C8N A;  2J6U A;  2QB0 B;  3ISB A;  3WK6 A;  4MFA A;  2HSZ A;  2XGQ A;  3RRH A;  2W43 A;  4J03 A;  3AN1 A;  3GV8 B;  3TQ1 A;  2XID A;  1Z1V A;  2F1H A;  2CN1 A;  1YZ7 A;  7ICH A;  1NK8 A;  1ZQB A;  4DSF A;  2HHV A;  5KFD A;  4F50 A;  3PW0 A;  4OJ6 A;  4JWN A;  2A1J A;  3KKA C;  4KTQ A;  2WHE A;  1NK9 A;  4JK1 A;  3PR4 A;  3L5K A;  5IIL A;  4QZ8 A;  2A19 A;  4YQW A;  4IQV A;  4M47 A;  4KN4 A;  5DLF A;  5KL8 B;  1MQ2 A;  4NLK A;  1L6N A;  4B9N A;  5EOZ A;  2E8N A;  2DFL A;  1S0N A;  4QZI A;  3BZC A;  1SL0 A;  2PXI A;  2WB1 C;  4EYH B;  4GXJ A;  4PHP A;  1TAU A;  4NL9 A;  2HBL A;  2AXT U;  1ZRM A;  4C4R A;  2E8P A;  9ICO A;  4QIW C;  2W9C B;  2W04 A;  1F44 A;  4RQ2 A;  1T3Q A;  4KLF A;  8ICG A;  4PJ0 U;  1MSW D;  1NKE A;  1S76 D;  2MUT B;  1KBU A;  4QZC A;  2FE9 A;  2MU2 A;  4DQP A;  1T3N A;  2YX8 A;  4FS2 A;  4F4X A;  4RUA A;  4DL6 A;  3EPI A;  3PR5 B;  4NJ8 A;  4NLZ A;  2EAO A;  2LM1 A;  2BPC A;  2NO4 A;  4DLE A;  1HJP A;  3Q8M A;  8ICT A;  1XSP A;  2JZB B;  3FYH A;  9ICF A;  3KHG A;  3UXN A;  2XO7 A;  4YXJ A;  2GWS A;  2KFZ A;  1N56 A;  3CYM A;  5KG5 A;  3H0R B;  4ED0 A;  3RJI A;  4U6P A;  3MGH A;  1SV0 C;  4M0A A;  2W8K A;  4QWA A;  4F4Y A;  1JX4 A;  1KL9 A;  3F5A A;  2BCV A;  4C7Z A;  1YT3 A;  3B9J A;  3I1Y A;  2ASD A;  3EZ5 A;  3IP4 B;  7ICV A;  1ZQQ A;  2HCF A;  4RQ6 A;  4NM2 A;  4M6W A;  4RT2 A;  4ZOH C;  5AM5 A;  3SYZ A;  5CB1 A;  5AKZ A;  8ICH A;  4XRH A;  3M9M B;  2HVH A;  2QB0 A;  5IIK A;  7ICL A;  2JEJ A;  3PSP A;  3NTU A;  4TQR A;  1S0V A;  4YMO A;  2VA2 A;  5CP2 A;  2W55 A;  3QE9 Y;  2GLE A;  2PMZ F;  2BQ3 A;  4I2F A;  4KIT B;  2IA6 A;  5AKE A;  2O6K A;  2BCS A;  4I2H A;  4GLX A;  4EZ6 A;  3ED5 A;  2K4H A;  2IOF K;  4YR0 A;  1UT5 A;  1S5L U;  3GZF A;  4QZ9 A;  2K60 A;  2HOQ A;  2HOI A;  1JIH A;  3KD3 A;  9ICA A;  4I2A A;  1UPH A;  9ICN A;  2DF4 B;  3RB6 A;  4J9O A;  4F2R A;  1ZQH A;  4PGQ A;  1ZQX A;  4XQ8 A;  1A76 A;  2QLT A;  5KNI A;  4ECR A;  2G09 A;  3RB4 A;  1S9F A;  2HHQ A;  9ICU A;  3TAQ A;  2P6R A;  2JEG A;  3LDA A;  4I27 A;  4I2D A;  1LKY B;  3RH4 A;  2KFN A;  3N97 B;  2A3V A;  4Y2Y A;  5KFS A;  2XCP A;  2R8H A;  4ECU A;  5DG7 A;  1X66 A;  2ES6 A;  5ALM A;  1QCK A;  5AI4 A;  2W9C A;  1ZQY A;  2AQ4 A;  4J9S A;  3HKZ F;  2G06 A;  5KFE A;  1RQL A;  4NLG A;  2RRD A;  3V7L A;  2OEH A;  4UBC A;  1NNL A;  1WCN A;  4RQ5 A;  4EEN A;  2MUT A;  2KVC A;  1AQ6 A;  9ICM A;  3OSP A;  3IN5 A;  8ICJ A;  4G3I A;  3SEN A;  4ECQ A;  8ICP A;  4MFF A;  1KQQ A;  2PMZ C;  4DSE A;  1CRX A;  2VAN A;  4PHD A;  1U47 A;  1EXN A;  1PZN A;  5J0T A;  2LYB A;  3Q8S B;  4MEX A;  1PVP A;  3OGU A;  3UMG A;  4GC7 A;  2HBM A;  4UB2 A;  8ICB A;  2AGP A;  2V4Q A;  4CDG A;  3RB0 A;  3MAB A;  4UAR A;  2JZB A;  2K4P A;  4CF4 A;  1KW4 A;  5KAI U;  5DG8 A;  2YML A;  4Z6C A;  4KLQ A;  2DQN B;  1N63 A;  3DEE A;  2RLT A;  3ETL A;  5KT2 A;  5KG0 A;  4B6J A;  2LI6 A;  3MBY A;  2KIV A;  5EWE A;  2ZJ8 A;  4ED6 A;  1QSS A;  1L3U A;  3PNC A;  4DFP A;  4R65 A;  2ZUB A;  2XY7 A;  1IXR A;  3BS7 A;  9ICE A;  1JXE A;  3HKZ C;  3KFU F;  1QQ7 A;  3M8R A;  9ICI A;  3SI8 A;  2LHT A;  2XI9 A;  4UAU A;  3OJU A;  3BQ1 A;  4YN4 A;  1ZQZ A;  7ICI A;  2D3D A;  1RXV A;  2K8B B;  5KFB A;  1BNP A;  3VC8 A;  2N1R A;  1O03 A;  5ALF A;  1FIQ A;  1T94 A;  3SAF A;  1TV9 A;  2W7P A;  5ALG A;  3V72 A;  3QEA Z;  2PFQ A;  2Q4T A;  4PHE A;  5KFL A;  4QZB A;  8ICK A;  1L3T A;  3RF9 A;  4UAY A;  1VLB A;  2KMD A;  2ZTD A;  1XO0 A;  2HDO A;  1NJX A;  4DQS A;  3ZDC A;  3TI0 A;  4YR3 A;  2MAX A;  1PK1 B;  3ORY A;  4DSK A;  2WF7 A;  2LYH A;  2YQE A;  4Q8E A;  4DSI A;  3MDA A;  3IG5 A;  2E8M A;  2H3I A;  4O3Q A;  8ICC A;  4NLN A;  2I5H A;  4XUS A;  2XY6 A;  4R64 A;  1U45 A;  4B9M A;  2R8I A;  4DOC A;  5KFO A;  3MC1 A;  1BPB A;  9ICH A;  3UQ2 A;  4F5P A;  4LZD A;  1RG6 A;  3IV6 A;  4R8U B;  1ZQN A;  4ELU A;  5KFW A;  4UB1 A;  3C1Y A;  3TKA A;  5EWF A;  7ICR A;  2WF5 A;  4M04 A;  1NJW A;  4OJ5 A;  3IG8 A;  3SMV A;  4KMU A;  5KFN A;  5BOL A;  2LMR A;  5L1K A;  9ICJ A;  4P4O A;  3QUQ A;  3RBE A;  4GFJ A;  1F0M A;  1ZQI A;  2HVI A;  1S97 A;  4UBB A;  4I2B A;  1K5O A;  3UXP A;  2QB1 A;  2ZIX B;  1S0M A;  1ZQC A;  3RAX A;  5KT7 A;  2KOB A;  1N60 A;  1SL2 A;  4M9G A;  3HWT A;  1SWW A;  9ICR A;  5KFJ A;  3WKA A;  2IMW P;  3DDH A;  1Z00 B;  3RJF A;  3NGD A;  2I9G A;  5J2J A;  2HBJ A;  3UQ0 A;  3TAD C;  4PGY A;  4TUP A;  2R8G A;  4YMN A;  9ICT A;  1A0P A;  3ZDE A;  1UQV A;  5F9L A;  4R66 A;  4IRC A;  5F3X B;  2W03 A;  2AJQ A;  1DOQ A;  4OJO A;  5CRX A;  4I2E A;  1NOM A;  2D8C A;  3PZP A;  2F3N A;  4PL1 A;  4B9T A;  2NRW A;  3FM9 A;  2KE7 A;  2RHF A;  4BUG A;  1RDF A;  4RNO A;  4MEY A;  5KFY A;  2JEI A;  2GO7 A;  4J9K A;  3TFS A;  1Q8K A;  1ZQT A;  4NWI A;  3HP6 A;  4ECS A;  2JH7 A;  3WK5 A;  5ALN A;  2KG5 A;  1C7Y A;  8ICS A;  3N7R C;  2PI4 A;  2IHN A;  3Q8R B;  3AM9 A;  3RJH A;  2VA3 A;  2G5H B;  3C5F A;  3RB3 A;  4F92 B;  2AGO A;  1NI3 A;  3HT3 A;  5AHX A;  4O3S A;  4DF4 A;  3PX0 A;  2MRL A;  1KDH A;  5ALI A;  4O5K A;  5CR0 A;  3RTV A;  1FFU A;  3N7S C;  5J0P A;  5F9N A;  2CRX A;  5KG6 A;  5AM4 A;  2DUY A;  5J2C A;  4RPY A;  1PK1 A;  3FC4 A;  3RR7 A;  4I2C A;  5DLG A;  2ASJ A;  3T79 A;  5EE9 A;  5DB8 A;  8ICE A;  3V6H A;  5DQG A;  4QWC A;  4QWD A;  3QNM A;  4MF8 A;  1N5X A;  1QSY A;  1DRG A;  4B9L A;  1ZQK A;  3CRX A;  4R8U A;  1CUK A;  1BGX T;  2P6U A;  1BPD A;  2MSN A;  4F5Q A;  4O3P A;  5ALL A;  2ODG A;  2LM4 A;  3QZ8 A;  1WCL A;  2IOH A;  8ICV A;  2DKX A;  3A0H U;  1OUQ A;  4O3N A;  5IIJ A;  4K4H A;  4DSL A;  2JEF A;  4FE3 A;  1UA1 A;  2VJ5 A;  4GIB A;  5CA7 A;  4UB6 U;  2YB1 A;  8ICX A;  2OXO A;  5DDY A;  2ZIX A;  2JGA A;  5AI8 A;  1KSP A;  1V38 A;  3GIJ A;  2FMS A;  5DBB A;  5AI5 A;  2JHD A;  4TQS A;  1ZQ1 C;  1Z00 A;  3LYS A;  2LYA A;  3NVW A;  2KN7 A;  1KTQ A;  1Q46 A;  2BQR A;  2UVU A;  3MGI A;  4Q44 A;  4ECX A;  5KG2 A;  4RNN A;  7ICO A;  2NV3 A;  4B9S A;  2OWO A;  5ALP A;  2FMP A;  3Q8P B;  5C0Y A;  1ZOL A;  2YMM A;  3C23 A;  7ICM A;  1K1Q A;  4DLG A;  2EZZ A;  3K1R B;  3V7J A;  3EYZ A;  1L3S A;  1SXD A;  5AK6 A;  3RJG A;  1DGJ A;  3KKA A;  3NUQ A;  5DB6 A;  3PSF A;  8ICW A;  4QWE A;  2OM6 A;  3RR8 A;  2MA1 A;  5CJ7 A;  2K4E A;  2BQU A;  1ZQP A;  3EUB 2;  4CF5 A;  1UCV A;  5AI9 A;  1X6J A;  4RU9 A;  1ZYQ A;  4IQU A;  3MDC A;  2W3S A;  4J9L A;  5B66 U;  4M9L A;  3QU4 A;  5AKK A;  1NZP A;  3HRD D;  2W7O A;  2KV2 A;  5ALY A;  4PPX A;  3J81 j;  3NS1 A;  2HHW A;  1SV4 A;  4ECV A;  1MQ3 A;  2RDI A;  1SXE A;  5KFA A;  5AKG A;  5B5E U;  2QKQ A;  1KEJ A;  3WK4 A;  4NV0 A;  2M9N A;  3H8M A;  1MC8 A;  1SWV A;  1IG6 A;  1OW5 A;  4DEZ A;  4US9 A;  1SKW A;  9ICW A;  4Z6F A;  1B4F A;  4AYB F;  4O3R A;  1N62 A;  4F71 A;  4DWI A;  3WKB A;  1HEK A;  2K89 A;  3KOO A;  5DBC A;  4J9P A;  4DCC A;  3GV5 B;  1TAM A;  1UHU A;  3PX4 A;  3QXG A;  3M6Z A;  5AKX A;  3HPO A;  1COK A;  4KLT A;  3JPO A;  4Y2S A;  2WF9 A;  3WKC A;  1TK8 A;  1SIJ A;  3PVX A;  2ZIU B;  4DL7 A;  3H0L B;  2VIX A;  3B0X A;  4WJ3 B;  5ALZ A;  4BJQ A;  1SV0 A;  1NK4 A;  5KG1 A;  4QZE A;  2NYV A;  1TK0 A;  1U49 A;  1SL1 A;  5L1M A;  5J8Y C;  4RQ7 A;  2E5S A;  2ALZ A;  2FLN A;  5ALH A;  5L9X A;  2AHO B;  5A0L A;  3KHH A;  4QJF B;  2XVT A;  3RRG A;  5KFR A;  4MHV A;  8ICR A;  2ZIV B;  1URJ A;  2R18 A;  4AYB C;  3H40 A;  5DB9 A;  2KEY A;  1JUD A;  2B6G A;  2KHQ A; 
#chains in the Genus database with same CATH homology
 1X9X A;  2L5Y A;  1Z1V A;  1JI7 A;  1UQV A;  4NL9 C;  1SV4 A;  4RQM A;  5F3X B;  1X40 A;  1SXE A;  2EAN A;  2DL0 A;  3HIL A;  2QKQ A;  3H8M A;  3BS5 B;  4RQN A;  2KMD A;  2D8C A;  3SEN A;  2F3N A;  2EAP A;  1SV0 C;  1OW5 A;  4PZN A;  2KE7 A;  1B4F A;  2EAM A;  3KKA C;  5J8Y A;  2F8K A;  4IS7 A;  1PK1 B;  1V38 A;  1OXJ A;  2KSO A;  2YTU A;  2E8M A;  2QAR B;  2KG5 A;  1COK A;  2E8N A;  2QB0 A;  4PZO A;  2K4P A;  2Y9U A;  3BQ7 A;  5JTI A;  2DKZ A;  3TAD A;  1KW4 A;  2GLE A;  1RG6 A;  2JV3 A;  1WWV A;  5JRT A;  4NL9 A;  2E8P A;  3BS5 A;  2KIV A;  2F44 A;  1PK3 A;  2K60 A;  3K1R B;  1SV0 A;  3TAC B;  1SXD A;  2LMR A;  5JU5 A;  3KKA A;  1PK1 A;  1F0M A;  2FE9 A;  2Y9T A;  1B0X A;  3BS7 A;  2QAR A;  5KNI A;  2LPE A;  2QB1 A;  3SEI A;  5J8Y C;  5L1M A;  2E8O A;  1UCV A;  4NJ8 A;  2EAO A;  2KSO B;  1V85 A;  1LKY B;  1DXS A;  4MHV A;  3IDW A;  2ESE A;  1SGG A;  1X66 A;  2ES6 A;  2D3D A;  2QB0 B;  2DKX A;  3TAD C;  1LKY A;  2B6G A;  1WWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...