1PK3A

Scm sam domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
RANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSEMMMKYMGLKLGPALKICNLVNKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
molecule keywords Sex comb on midleg CG9495-PA
total genus 28
structure length 76
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk3A00
1OXJA 1X9XA 2Y9UA 2KSOA 5KNIA 1B4FA 1COKA 1V85A 2EAOA 5F3XB 2D3DA 2DKXA 5J8YA 3KKAC 1UCVA 1X66A 2KE7A 3HILA 1LKYA 2E8NA 2YTUA 1V38A 3TADC 2QB0B 1KW4A 3SENA 4IS7A 2F44A 2LPEA 1PK1B 1PK1A 1X40A 2E8MA 1UQVA 2QB0A 5JRTA 2DL0A 1SXDA 3IDWA 5L1MA 3TACB 2ES6A 3BS7A 2FE9A 3BS5B 4PZNA 1PK3A 2KIVA 3SEIA 1SXEA 2KSOB 5J8YC 3KKAA 2B6GA 2F8KA 2D8CA 1F0MA 3BS5A 2ESEA 4MHVA 4NL9C 1WWVA 4RQMA 2GLEA 1OW5A 1JI7A 3H8MA 3BQ7A 2EAMA 5JU5A 2DKZA 2LMRA 1SV0A 2E8OA 2K4PA 2Y9TA 1RG6A 1LKYB 2KMDA 2EANA 1DXSA 1SGGA 2EAPA 4PZOA 3TADA 4NL9A 2K60A 2QKQA 1WWUA 2QB1A 1B0XA 2QARA 2L5YA 2KG5A 2E8PA 3K1RB 5JTIA 1SV4A 1Z1VA 1SV0C 2QARB 2JV3A 4NJ8A 2F3NA 4RQNA
chains in the Genus database with same CATH superfamily
1KTQA 2BCQA 1U49A 2VIXA 2P6UA 5KG7A 1V85A 4KLHA 4CF3A 4QZCA 3IM1A 5KFNA 4KMUA 2H3VA 8ICPA 1LKYA 3ONNA 5T14A 4RPZA 3MFIA 2YY6A 2ASDA 8ICWA 1X6JA 2ZJAA 2FLNA 1ZRMA 2F76X 3V7KA 5AKJA 1Q8KA 2MUTA 3FAHA 1GO3F 4F93B 1L5UA 5AK4A 4CE6A 4U7CA 4ED6A 1UT8A 3K75D 2OH2A 1TE2A 3AL0B 4DFJA 2OWOA 5KG2A 3UPQA 2VA8A 5AKHA 5J0TA 4F2SA 4Y2PA 2IHMA 5DDMA 3M6ZA 4F50A 2XY7A 2HHXA 1ZQRA 4NL9C 5ALYA 5D46A 5AM2A 3V7JA 3V7LA 2G08A 2WF7A 4R65A 5DB8A 4P0PB 3OGUA 3BQ7A 4QZGA 4C8LA 4RQ0A 2BHNA 2BCUA 2HI0A 4IRCA 2EQYA 4DO9A 4EX6A 5KG4A 1URJA 4C4TA 4FBUA 4FS1A 3IN5A 3H4BA 2HOIA 4UAWA 2ZIUA 2K60A 1X42A 1BPBA 5K4LA 3D2NA 5AKEA 4RQ3A 4BDPA 7ICQA 4QWEA 1H38A 1KN5A 2L5YA 1SL1A 4PL2A 1L8OA 3WKCA 4ED1A 4I2HA 5IIJA 1SV0C 3T3FA 4PGQA 4UARA 1DK2A 4NM2A 3RJHA 2NV3A 4JB3A 4RQ6A 3N28A 5F3XB 1UCVA 9ICTA 5KFPA 3C5FA 1SKWA 4ECWA 3HRDD 4YMOA 4ICAA 2HHUA 3ISDA 2W9AA 1NK0A 4UASA 4UAVA 5AM1A 3UQ0A 2AQ0A 4GXJA 1ECWA 4UAYA 3TAQA 2ZJ5A 3AQEA 2ZJ8A 3PW0A 4DL5A 3HT3A 4PZNA 3RBDA 9ICHA 2JR5A 2AU0A 3DV9A 4B6JA 4DF8A 1NJYA 5J8YC 1PVQA 1BNOA 3O0FA 5KT6A 3R9KA 4NLBA 2KFNA 7ICUA 1NK4A 3UMBA 5E79U 3QUTA 5L1IA 3B0XA 3I1YA 1RM6C 4KX3A 3QE9Y 4C7YA 3JPPA 2LI6A 5KFUA 4QZ9A 8ICMA 2EH9A 1L7MA 5ALDA 4DOCA 3WKEA 5A0LA 3SZ2A 4EELA 4YD1A 2K8BB 2A1JA 3QU2A 1FIQA 4RQ2A 1NK9A 4NL9A 2ZXHA 2XY6A 5ALQA 2BZFA 2LYHA 4C8NA 1XU4A 3SI8A 1EXNA 3ICXA 4XQ8A 2KG5A 3KOOA 2KICA 1MQ2A 2QARB 1DGJA 4DFDA 2GO7A 1XSNA 4FE3A 2KSOA 2ZTDA 3WK7A 7ICNA 1FO4A 5KG5A 2W03A 3BDPA 1JRPA 4CCHA 3ETLA 2FLPA 2C2DA 5J0PA 2PMZC 4EYIB 5DG8A 2BDUA 1L8LA 1A77A 4O5KA 1Q3VA 5IINA 2AXTU 1N62A 8ICBA 3ZI4A 2DPIA 2WTFA 1BPDA 3AN1A 2W54A 2OEHA 1CRXA 4RT2A 2Q0ZX 4F4WA 1X9MA 1TK8A 2ZIXA 3GIKA 1ZJMA 3QU4A 3RFAA 4YQWA 2J6TA 3ED5A 4RT3A 1A76A 1SL0A 5JUMA 4KLLA 5DB6A 7ICIA 3RAQA 2PXIA 3QNMA 1JI7A 1N63A 4BUGA 4DQSA 3PO4A 1SKSA 2E1FA 3QX7A 1ZQYA 1SZPA 4J9PA 1ZQWA 2HHVA 3AM9A 4F5OA 1LB2B 2BCSA 2Y9TA 2W9BA 5ALNA 1S77D 2ASLA 1QQ5A 2LM1A 2EANA 4JUZA 3ORYA 3RJGA 2JHDA 4M6WA 5C5JA 4UATA 2IOFK 2KFZA 1T8EA 5BPCA 3M9MB 5DKWA 2KZZA 1XWLA 2A19A 5ALUA 5AM4A 5KG0A 3GDXA 4LJXA 1PUZA 3PNCA 5HMLA 3NTUA 3EWAA 4ELVA 4YMMA 1X9XA 3KFUF 3MGIA 3M9NB 1KSPA 3C1ZA 3WK4A 2KHQA 5HR7A 4UB1A 3PSTA 1X66A 1S9FA 2PFQA 4P2HA 1J2MA 5H2FU 3I28A 1S10A 5J2BA 3SENA 2LPEA 4IRDA 4RZRA 9ICIA 3BQTA 5JRTA 1L3TA 4EBDA 9ICLA 3CP8A 4QIWF 5AI5A 4QZFA 1TVAA 3MR6A 2FE9A 3BS5B 2DFLA 3QUQA 4M2YA 1SWVA 4KLDA 3TQ1A 1MC8A 4Y2YA 1XS9D 3WK8A 4RQ4A 2HBMA 4B9UA 3KKAA 2ZIXB 5KAIU 4Y2UA 1Z3EB 5AI0A 2I9GA 1KDHA 2WF6A 5AM0A 2R8KA 4X5VA 4R66A 1L7OA 2AH5A 2Y1JA 4F2RA 2BDPA 4F4XA 5KFTA 3D6JA 4P4PA 1LV5A 2M9NA 3V72A 4DSLA 3ISBA 3HKZC 5GTIU 2GOLA 1TK5A 5AIBA 3PVXA 1ZQJA 1KFSA 1TAMA 8ICEA 1VJ5A 2BQUA 1N60A 3PZPA 5KT2A 1ZQFA 5D49A 7ICOA 5ALIA 3PW5A 1YT3A 2QKQA 2Q4TA 3GZFA 2KK0A 5KFLA 1T94A 4DSKA 4UBCA 3J81j 2QARA 4Y2VA 2NRTA 2EZYA 5KFRA 3OSNA 5HHIA 3PX4A 3K4GA 2PFOA 5JTIA 8ICXA 8ICSA 4I2IA 2LYBA 4EZ6A 3KHGA 9ICNA 2PFPA 2FPMA 5ALPA 1HUZA 1ZRNA 2W11A 3H7IA 5KNIA 2R18A 8ICVA 2JH1A 4NY8A 4ECUA 4GXIA 4B9NA 4IL6U 2D3DA 3FM9A 3MFHA 9ICFA 7ICTA 2A1JB 5KFWA 9ICGA 8ICGA 2E8NA 2G5HB 5CRXA 1J97A 2VANA 3FDSA 5B66U 4KLJA 2F44A 5J0UA 3V6HA 4QZ8A 3MC1A 3KHRA 1SZHA 1O03A 1WYGA 4DQIA 3Q8LA 1JUDA 8ICCA 3M6KA 3H0MB 4R64A 2R8HA 1ZOLA 1ZQSA 2XGQA 1S8OA 4YXMA 1V9PA 3PSIA 5KFBA 4BXOB 2AGOA 4O9MA 4J9LA 3PSPA 3C28A 4HYKA 1VLBA 4FZNA 4DOBA 1UHUA 4QW9A 3CW2C 4YD2A 5ALRA 5IIIA 1X9SA 5AKYA 1ZQPA 2ALZA 5ALEA 5EWFA 1C20A 3PV8A 4I2JA 4GFJA 2UVUA 3TADA 3NVWA 1KKXA 4J9RA 5KG1A 4DSJA 1ZQXA 1N61A 1BPYA 1WWUA 5CA7A 5EE3A 1U9LA 2R8GA 1WUDA 1QSLA 1FEZA 1AQ6A 3ALRA 3B9JA 4DL4A 4QWCA 2KV2A 2HBJA 5AKGA 3C23A 3ZD8A 5L1LA 1JXEA 1LVHA 2HBKA 5J2FA 2V9WA 4KLTA 3B0YA 5AI6A 2IBKA 1RYRA 7ICEA 1AROP 3C1YA 3TFRA 4TQRA 1N2XA 1S97A 3KZXA 3HILA 2GH1A 3RJFA 1BNPA 4UW9A 1ZQGA 2PKEA 5HP4A 1ZQMA 2K8AA 9ICUA 1UT5A 2H3ZA 3WK6A 3RR8A 1HEKA 1ZQVA 5AK5A 5KFFA 4KLMA 1S76D 2CXYA 5L9XA 4HAIA 7ICVA 5KT4A 4KN7A 2EDUA 4UB8U 3BS7A 1S0MA 2W3RA 4J9NA 4Y2SA 4FBTA 2AQ4A 5ALFA 3HJEA 4DS5A 5J0WA 5EOZA 4US8A 5AM5A 2C2RA 1J2NA 3OHBA 2ISPA 2WAQF 4NLCA 3QXGA 5CJ7A 1JXLA 4NV0A 9ICVA 1YZ7A 3EZ5A 3H8SA 1CUKA 4JWNA 3JPRA 4K4IA 2ZTCA 2KKPA 1RQNA 3JPNA 2W8KA 2WB1F 2H3FA 4I2DA 2E8OA 1ZQBA 5HR6A 3ZDCA 1LKYB 5CR0A 4B9VA 3M1YA 2V4QA 4Q44A 4ACOA 5ALWA 2XIDA 8ICRA 1L3SA 1NKCA 3UM9A 4CGZA 2VJ5A 2ZG6A 3AQFA 4Q43A 1OXJA 1DK3A 4O3OA 4NM1A 5IILA 1X6IA 5C0YA 4O5EA 5CP2A 2DWQA 3SR6A 1NK5A 4OJOA 3NRWA 3N7RC 4YFKA 5B5EU 2YB4A 4F5NA 3DEEA 9ICEA 1JMSA 4EBEA 4LZGA 4DQRA 2E1EA 3N4MB 2W9CA 1PZNA 1N48A 5TISU 2W04A 2IA6A 2HSZA 5BOMA 1DRGA 4PHPA 5L1MA 2F1HA 3TACB 4BXOA 4LVSA 3RRHA 3TKAA 2FLLA 8ICUA 3N7PD 1PK3A 2G06A 2I5HA 2KIVA 3QU9A 5CWRA 3Q8QB 3IRUA 1U48A 2B6GA 5EWGA 2VA3A 3H40A 2UVWA 2JEGA 1OW5A 1Z00A 2KNJA 3IV6A 4EX7A 4NLGA 4DF4A 3H8MA 5AKXA 4J9QA 3NVYA 4M9LA 2JEJA 5ALGA 3DDHA 8ICQA 2DKZA 1NK7A 2ZIUB 2FPLA 3MR5A 3TARA 1ZQOA 3H8JA 4IR1A 2NO4A 4QZAA 4YR2A 2VA2A 2HVIA 4IC9A 1ZYQA 4QJFB 4K4HA 2VJ4A 4C0ZA 1OUQA 3GIIA 8ICHA 4R8UB 4EBCA 4O3RA 2W8LA 3MR2A 2HMXA 2K4HA 5AI9A 1TV9A 2D6FC 4GXKA 8ICAA 3AUOA 3WU2U 1COKA 5KFVA 2BPCA 2EZZA 2JZBA 3BQ1A 3C21A 3BZCA 3GU3A 3NRZA 5ALKA 5FP0A 5KFKA 3PW4A 2JH7A 1QH9A 4QIWC 2W55A 1TFRA 4OJ5A 3H8WA 1JX4A 4PHAA 4TUQA 9ICAA 2YQEA 2HCFA 5KFZA 4DSIA 4F72A 5KFCA 1NJZA 4QZEA 1D8BA 2H3IA 4LZDA 4I29A 2DQNB 4UAUA 1C7YA 4F92B 1XO1A 3PR4A 1Z00B 8ICNA 1CI4A 3RJEA 5J0QA 3OSPA 4QZIA 5DGAA 4DLEA 5D4BA 4QW8A 2WF5A 1BPEA 4OJ6A 2NRWA 5AKLA 2J6UA 1A0PA 3BS5A 4M9NA 1WWVA 3SAHA 3UXPA 2F77X 2DBYA 5DG7A 4PGYA 4I2EA 2G09A 1IG6A 2EAMA 1PVPA 2HHSA 1Q3UA 4PL1A 1ZQQA 3KBBA 2C22A 4O3QA 5KFQA 5HNKA 1RXWA 2N1RA 3T79A 4Z6FA 3T5JA 3RTVA 3F5AA 5CB1A 5ALOA 3I76A 4B9MA 3H0RB 3RH4A 1B0XA 4DL3A 4B9TA 3RB6A 2E8PA 9ICPA 1SV4A 2E5SA 2MAXA 1KBUA 2Y9UA 2LYAA 1BPZA 1F5SA 1ZD4A 3QU5A 5J2CA 4KLFA 3MDAA 3GFKB 2KIWA 1RDFA 1IIPA 4M0AA 4Y2RA 4AP9A 5ALVA 3N97B 3CNHA 5J2DA 4RQ1A 4MFCA 5L1JA 4IRKA 4G3IA 1FFUA 1X2IA 1KW4A 4ED3A 1RXVA 2W9MA 2XI9A 3QU7A 4M9JA 3RH5A 3SV4A 1X40A 5AKZA 2PMZF 3AU2A 4XUSA 2F1IA 2ES6A 3T5LA 2YN4A 9ICKA 4O3NA 3EYZA 1XO0A 2JEFA 2MU2A 1HJPA 4KN4A 2Y0SC 2LBOA 4XRHA 3SAGA 2FPKA 2OHFA 2QLTA 2CPRA 1JIHA 3Q8KA 4TUSA 2RP5A 3ZDBA 1JROA 3RB0A 3PO5A 3TAPA 3RJIA 4Y2QA 4ECRA 4YG2A 2BGWA 2ZXIA 5KFYA 3E2EA 1F44A 2ZIWB 1MN8A 3QZ7A 5AKKA 4IQVA 5ALSA 4Q8FA 4UAZA 4PZOA 5AK3A 1FFVA 1KQQA 2YMQA 4K4GA 4BWJA 3N7SC 1O08A 1QTMA 2NRVA 3ETRA 1ZQIA 1L6NA 4ED7A 4OJLA 2BKEA 3VC8A 1SL2A 4DEZA 1XC9A 5AM3A 2AGPA 2R8JA 5KFJA 2ZUCA 1N5WA 4ECSA 4FO6A 5AI8A 4JV0A 4RQ7A 2WB1C 2KE7A 3UQ2A 2XC9A 4RU9A 1BGXT 2KP7A 4BX9C 4F5QA 8ICOA 3HPOA 2WF8A 1ZQTA 2DPJA 2F1JA 2E3TA 4RNMA 4UB2A 2KEYA 1TAUA 3GIMA 5ALJA 4B9SA 3IHQB 8ICYA 2QB0A 4C8OA 2YMPA 5TZVA 2JGAA 4I2CA 3LDAA 3THVA 5J2JA 1KRPA 2AJQA 4Q45A 8ICFA 2NO5A 3RAXA 3F2BA 1UA0A 5AICA 4KX5A 2XICA 4F4KA 1TKDA 3F2DA 4O3PA 1ZQCA 2XGPA 5HHHA 4Q8EA 4J9KA 4Y2TA 5HMMA 4I27A 4PHDA 3D2SA 2KHVA 3QYPA 2W3SA 5DGBA 1NZBA 2B0CA 4UB4A 3PMLA 3HW8A 2F2AB 3C5GA 1NK8A 1D9FA 2ASJA 3WK5A 4KTQA 1DXSA 2EAPA 5KT5A 3SV3A 1T3NA 3ZDAA 7ICJA 2K8CB 4ECZA 2H3QA 9ICBA 1WG8A 2XVTA 3KTQA 4NWIA 8ICKA 4P0PA 1RZTA 3KHHA 2KVCA 1ZQHA 4BJQA 3EW9A 2F3NA 2KVSA 4NLKA 4C80A 4QNLA 5DG9A 1B4FA 4F3OA 7ICPA 5DQGA 1ZQUA 4M9HA 2DKXA 4F4YA 2J6SA 4DL7A 2W7PA 5J0SA 2PFNA 1D8LA 1IV8A 1QSYA 1Z1BA 2V4RA 4JK1A 3IG8A 1T7PA 4C8MA 3UMGA 3G6YA 1PK1B 3FYHA 8ICJA 1UQVA 4J9MA 2UVRA 3TFSA 2DL0A 4MEXA 2KZ3A 1PVRA 3IDWA 1ZD5A 4DSEA 2JRZA 3S6JA 4UQGA 2BPFA 1ZQLA 1XSLA 2KTQA 1NKEA 2P35A 2UVVA 2ESEA 5J2HA 3JPSA 2KJ5A 4KLUA 5DBCA 4CNQA 1SB3C 9ICOA 4PJ0U 1M6YA 3LK9A 2ISOA 5ALTA 4DL6A 1KEJA 1Q46A 3GIJA 3L5KA 2FMQA 4DS4A 2G0AA 3LYSA 1IM4A 2K4IA 2R8IA 1K1QA 5ALHA 5KFEA 3C2MA 3PSFA 4OJPA 3RR7A 5J0OA 4JV2A 3SAFA 3AEVA 4C4SA 4FZMA 3RRGA 2ODGA 5AHXA 2W43A 4RPYA 5G5HA 3UXOA 3PX0A 1T3QA 1NKBA 3RH6A 4JMUA 4DFKA 1WCNA 4QZBA 2HVHA 3LVWA 1BPXA 1Z19A 4BWMA 4M6WB 5KT3A 4NLZA 3HKZF 4ECTA 7ICMA 4EENA 1N56A 2FDRA 2G07A 3L3FX 3CYMA 4F5PA 2HDOA 4B9LA 3T5HA 3AU6A 3D2QA 2W7OA 5KFOA 4DFMA 3GQCA 5KL1B 2AHOB 4ECYA 3FC4A 5F9NA 5J29A 1NJXA 1ZQDA 1DGSA 4DCCA 4RNNA 2RDIA 1QSSA 2CRXA 1KFTA 5KL8B 1KFDA 5DBAA 2AGQA 4F5RA 1F0MA 4PGXA 3HP6A 4MHVA 3EPGA 4MEYA 4O3MA 4OO1J 3WKDA 3ZD9A 2BCVA 4ZH4A 3TI0A 3SQIA 3HX0A 1K5OA 1RQLA 4YR0A 2YX8A 2XCAA 3KZIU 3PR5B 1V97A 2VKQA 3F5EA 9ICJA 3QUCA 3SYZA 1RG6A 2I6XA 4EEKA 1X9WA 7ICLA 2RRDA 1L3UA 2ZUBA 5J0RA 1YZ6A 3OJUA 3NASA 5ALLA 4R63A 4ZOHC 4O5CA 4Z6EA 4YR3A 1TAQA 2A3VA 1ZQ1C 5J2AA 1S0OA 3M7DA 1BVSA 4RQ8A 3K1RB 2GWSA 4KLIA 4ELTA 1U47A 4RQNA 4F8RA 3OPXA 3Q8PB 5DDYA 4C4RA 4J9OA 1ZQEA 3MDCA 4KLSA 3KKAC 4KLGA 2DF4B 3PX6A 3JPQA 3H0LB 4MFAA 3TADC 4KITB 2K4EA 4EZ9A 4P0QA 2WHEA 2XY5A 3Q8MA 2WFAA 2MRLA 2JMGA 5EE9A 3KHLA 9ICSA 2E8MA 1SIJA 1RYSA 1S0NA 3LWMA 5BOLA 1S0VA 1UPHA 1ZJNA 2RLTA 2YMLA 2BR0A 2NYVA 5KAFU 4Y2JA 4RPXA 3MGVA 4G9BA 5KG6A 3A0HU 4QZDA 3LVVA 4RQ5A 4F91B 1ZQZA 3EUB2 3M8SA 4YP3A 3K1ZA 2D8CA 2IOHA 4GC6A 1IXRA 2GLEA 3QUBA 2NRXA 4ELUA 1QQ6A 5AIAA 2KOBA 2BQRA 3RB3A 4ED2A 1QQ7A 3L4PA 5ALXA 1XSPA 2RHFA 3NS1A 3RJJA 4YCXA 3OHAA 3C29A 1RPLA 2HHTA 2MSNA 4WJ3B 2LMRA 2F8LA 1SV0A 2K4PA 5ALMA 4DWIA 3ZDEA 2KJ9A 4YMNA 1NJWA 2RQ5A 4Z6CA 2PI5A 7ICKA 1COOA 1DOQA 5KFSA 5DLGA 3Q8SB 2OM6A 2QB1A 5J0XA 3GILA 4I2AA 4CF5A 4Z6DA 2WF9A 2Y0SF 5KT7A 5IIMA 4ECXA 4TUPA 4P4MA 4DQPA 2O6KA 5AI4A 5J2IA 2M0NA 4DL2A 5G5GA 3MGHA 4J03A 4C7ZA 4UBBA 2KN7A 5J8YA 1L3VA 3LWLA 5AK6A 4QZHA 5KG3A 4U6PA 1SWWA 5J2EA 4MF8A 5J2KA 2KZMA 4UB5A 3PMNA 3NGDA 3QZ8A 7ICFA 3GV8B 3HWTA 1PK1A 2A1AA 5KFGA 4O3SA 5DLFA 4IQWA 3OJSA 4XA5A 5IIOA 5EWEA 1D9DA 1CEZA 4IQUA 5F9LA 3Q8RB 2FI1A 5GTHU 4DQQA 1TK0A 2HW3A 1NNLA 1T4GA 2IHNA 2KSOB 7ICGA 1N5XA 5DQIA 8ICIA 4QWBA 4TQSA 1KL9A 3AMZA 4GIBA 3V6JA 5AKIA 3NVVA 2ZUDA 2YMMA 5EE0A 2HOQA 1ZD3A 3UMCA 3H4DA 4ED8A 3PY8A 3ISCA 3JPOA 2MUTB 4PPXA 1KLNA 4EYHB 2WAQC 2IOFA 4CDGA 7ICSA 5JU5A 1B43A 4KLEA 4I2BA 1ED1A 3QEBZ 4E0DA 1SGGA 1NK6A 9ICRA 3GV7B 3M9OB 3GV5B 1D8YA 5KTQA 4I28A 3NUQA 4FS2A 5J0YA 4MF2A 3E58A 2OYYA 4Y2XA 3QEAZ 4FFDA 2H5XA 1Z1VA 3PW7A 9ICWA 4RUAA 4RNOA 1NZPA 4YVZA 1A6SA 1WCLA 5CHGA 5DQHA 3T5KA 4P4OA 1MQ3A 2BQ3A 3C2KA 3BJYA 2OXOA 4BGDA 3JPTA 2K89A 1SKRA 3RBEA 5J2GA 4IQTA 4F4ZA 2ZIVB 3E0FA 4KMOB 2QB0B 4IS7A 3ZDDA 4M47A 3U26A 4PH5A 1ZD2P 4FZLA 1U4BA 1ZQNA 3UXNA 2NRZA 7ICRA 3G6XA 2HOFA 2PI4A 4USAA 2P6RA 3OTQA 5DB9A 1RYUA 2JXJA 4IR9A 3WKAA 4QWDA 3SEIA 4I2GA 2XO7A 1B22A 3V6KA 2F8KA 4RUCA 3F2CA 4DOAA 4KLQA 2KD1A 2EZXA 1L7PA 4RQMA 3WKBA 4JV1A 4MFFA 2BCRA 5L1KA 1JN3A 4UB3A 2IMWP 1L7NA 1XNSA 3SD7A 4ECVA 3WK9A 4GLXA 2OCEA 4GC7A 5KFHA 2G5IB 2LHTA 7ICHA 4NLNA 4P0QB 2I1QA 3C2LA 2KMDA 4OCZA 4US9A 5KFAA 5KFIA 2JZBB 5IIKA 3RF9A 2YB1A 4DFPA 3VCBA 2ZIWA 4PHEA 4I2FA 2HBLA 1Z4NA 9ICCA 8ICZA 1VDVA 5CEHA 1UA1A 5KFMA 4DLGA 3RJKA 2ATLA 4AYBC 2JV3A 4YXJA 9ICQA 4NJ8A 4M9GA 1QLNA 4R8UA 4F71A 4UB6U 8ICLA 3TANA 5ALZA 4CF4A 1U45A 2RDJA 4M04A 5DB7A 2EAOA 4YN4A 2BPGA 4NXZA 5DBBA 1HUOA 8ICTA 4C8KA 2YTUA 1V38A 3A0BU 1QCKA 4ECQA 1ZXIA 2FMSA 1NI3A 2Z7JA 3NVZA 3G6VA 1ZQAA 3EPIA 3MABA 1S5LU 2FMPA 1Z4OA 2C28A 4ED0A 2LKYA 1SXDA 4QWAA 3SMVA 4J9SA 2DUYA 9ICXA 4JWMA 3KD3A 3MR3A 3BZKA 3RB4A 3IG5A 5EE1A 4A8EA 1SXEA 2B21A 2XCPA 2FJ6A 2KJ8A 1ZETA 1Y88A 2LM4A 4DSFA 1NOMA 2JEIA 2CN1A 3BQ0A 2C2EA 2MA1A 4CRXA 3CRXA 2W9CB 1JALA 2DGZA 4TURA 1ZQKA 2ZIVA 2KKVA 1MA7A 2W9BB 1K1SA 9ICMA 4KLOA 4AYBF 4EEYA 3BQ2A 3F53A 4O0IA 3MBYA 3PW2A 1P7DA 1MSWD 5KFXA 1HIWA 2HHQA 3M8RA 5KFDA 2Y1IA 3IP4B 2P66A 2ZTEA 2HHWA 4OD0A
chains in the Genus database with same CATH topology
1OXJA 1X9XA 2Y9UA 2KSOA 5KNIA 1B4FA 1COKA 1V85A 2EAOA 5F3XB 2D3DA 2DKXA 5J8YA 3KKAC 1UCVA 1X66A 2KE7A 3HILA 1LKYA 2E8NA 2YTUA 1V38A 3TADC 2QB0B 1KW4A 3SENA 4IS7A 2F44A 2LPEA 1PK1B 1PK1A 1X40A 2E8MA 1UQVA 2QB0A 5JRTA 2DL0A 1SXDA 3IDWA 5L1MA 3TACB 2ES6A 3BS7A 2FE9A 3BS5B 4PZNA 1PK3A 2KIVA 3SEIA 1SXEA 2KSOB 5J8YC 3KKAA 2B6GA 2F8KA 2D8CA 1F0MA 3BS5A 2ESEA 4MHVA 4NL9C 1WWVA 4RQMA 2GLEA 1OW5A 1JI7A 3H8MA 3BQ7A 2EAMA 5JU5A 2DKZA 2LMRA 1SV0A 2E8OA 2K4PA 2Y9TA 1RG6A 1LKYB 2KMDA 2EANA 1DXSA 1SGGA 2EAPA 4PZOA 3TADA 4NL9A 2K60A 2QKQA 1WWUA 2QB1A 1B0XA 2QARA 2L5YA 2KG5A 2E8PA 3K1RB 5JTIA 1SV4A 1Z1VA 1SV0C 2QARB 2JV3A 4NJ8A 2F3NA 4RQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXJ A;  1X9X A;  2Y9U A;  2KSO A;  5KNI A;  1B4F A;  1COK A;  1V85 A;  2EAO A;  5F3X B;  2D3D A;  2DKX A;  5J8Y A;  3KKA C;  1UCV A;  1X66 A;  2KE7 A;  3HIL A;  1LKY A;  2E8N A;  2YTU A;  1V38 A;  3TAD C;  2QB0 B;  1KW4 A;  3SEN A;  4IS7 A;  2F44 A;  2LPE A;  1PK1 B;  1PK1 A;  1X40 A;  2E8M A;  1UQV A;  2QB0 A;  5JRT A;  2DL0 A;  1SXD A;  3IDW A;  5L1M A;  3TAC B;  2ES6 A;  3BS7 A;  2FE9 A;  3BS5 B;  4PZN A;  1PK3 A;  2KIV A;  3SEI A;  1SXE A;  2KSO B;  5J8Y C;  3KKA A;  2B6G A;  2F8K A;  2D8C A;  1F0M A;  3BS5 A;  2ESE A;  4MHV A;  4NL9 C;  1WWV A;  4RQM A;  2GLE A;  1OW5 A;  1JI7 A;  3H8M A;  3BQ7 A;  2EAM A;  5JU5 A;  2DKZ A;  2LMR A;  1SV0 A;  2E8O A;  2K4P A;  2Y9T A;  1RG6 A;  1LKY B;  2KMD A;  2EAN A;  1DXS A;  1SGG A;  2EAP A;  4PZO A;  3TAD A;  4NL9 A;  2K60 A;  2QKQ A;  1WWU A;  2QB1 A;  1B0X A;  2QAR A;  2L5Y A;  2KG5 A;  2E8P A;  3K1R B;  5JTI A;  1SV4 A;  1Z1V A;  1SV0 C;  2QAR B;  2JV3 A;  4NJ8 A;  2F3N A;  4RQN A; 
#chains in the Genus database with same CATH topology
 1KTQ A;  2BCQ A;  1U49 A;  2VIX A;  2P6U A;  5KG7 A;  1V85 A;  4KLH A;  4CF3 A;  4QZC A;  3IM1 A;  5KFN A;  4KMU A;  2H3V A;  8ICP A;  1LKY A;  3ONN A;  5T14 A;  4RPZ A;  3MFI A;  2YY6 A;  2ASD A;  8ICW A;  1X6J A;  2ZJA A;  2FLN A;  1ZRM A;  2F76 X;  3V7K A;  5AKJ A;  1Q8K A;  2MUT A;  3FAH A;  1GO3 F;  4F93 B;  1L5U A;  5AK4 A;  4CE6 A;  4U7C A;  4ED6 A;  1UT8 A;  3K75 D;  2OH2 A;  1TE2 A;  3AL0 B;  4DFJ A;  2OWO A;  5KG2 A;  3UPQ A;  2VA8 A;  5AKH A;  5J0T A;  4F2S A;  4Y2P A;  2IHM A;  5DDM A;  3M6Z A;  4F50 A;  2XY7 A;  2HHX A;  1ZQR A;  4NL9 C;  5ALY A;  5D46 A;  5AM2 A;  3V7J A;  3V7L A;  2G08 A;  2WF7 A;  4R65 A;  5DB8 A;  4P0P B;  3OGU A;  3BQ7 A;  4QZG A;  4C8L A;  4RQ0 A;  2BHN A;  2BCU A;  2HI0 A;  4IRC A;  2EQY A;  4DO9 A;  4EX6 A;  5KG4 A;  1URJ A;  4C4T A;  4FBU A;  4FS1 A;  3IN5 A;  3H4B A;  2HOI A;  4UAW A;  2ZIU A;  2K60 A;  1X42 A;  1BPB A;  5K4L A;  3D2N A;  5AKE A;  4RQ3 A;  4BDP A;  7ICQ A;  4QWE A;  1H38 A;  1KN5 A;  2L5Y A;  1SL1 A;  4PL2 A;  1L8O A;  3WKC A;  4ED1 A;  4I2H A;  5IIJ A;  1SV0 C;  3T3F A;  4PGQ A;  4UAR A;  1DK2 A;  4NM2 A;  3RJH A;  2NV3 A;  4JB3 A;  4RQ6 A;  3N28 A;  5F3X B;  1UCV A;  9ICT A;  5KFP A;  3C5F A;  1SKW A;  4ECW A;  3HRD D;  4YMO A;  4ICA A;  2HHU A;  3ISD A;  2W9A A;  1NK0 A;  4UAS A;  4UAV A;  5AM1 A;  3UQ0 A;  2AQ0 A;  4GXJ A;  1ECW A;  4UAY A;  3TAQ A;  2ZJ5 A;  3AQE A;  2ZJ8 A;  3PW0 A;  4DL5 A;  3HT3 A;  4PZN A;  3RBD A;  9ICH A;  2JR5 A;  2AU0 A;  3DV9 A;  4B6J A;  4DF8 A;  1NJY A;  5J8Y C;  1PVQ A;  1BNO A;  3O0F A;  5KT6 A;  3R9K A;  4NLB A;  2KFN A;  7ICU A;  1NK4 A;  3UMB A;  5E79 U;  3QUT A;  5L1I A;  3B0X A;  3I1Y A;  1RM6 C;  4KX3 A;  3QE9 Y;  4C7Y A;  3JPP A;  2LI6 A;  5KFU A;  4QZ9 A;  8ICM A;  2EH9 A;  1L7M A;  5ALD A;  4DOC A;  3WKE A;  5A0L A;  3SZ2 A;  4EEL A;  4YD1 A;  2K8B B;  2A1J A;  3QU2 A;  1FIQ A;  4RQ2 A;  1NK9 A;  4NL9 A;  2ZXH A;  2XY6 A;  5ALQ A;  2BZF A;  2LYH A;  4C8N A;  1XU4 A;  3SI8 A;  1EXN A;  3ICX A;  4XQ8 A;  2KG5 A;  3KOO A;  2KIC A;  1MQ2 A;  2QAR B;  1DGJ A;  4DFD A;  2GO7 A;  1XSN A;  4FE3 A;  2KSO A;  2ZTD A;  3WK7 A;  7ICN A;  1FO4 A;  5KG5 A;  2W03 A;  3BDP A;  1JRP A;  4CCH A;  3ETL A;  2FLP A;  2C2D A;  5J0P A;  2PMZ C;  4EYI B;  5DG8 A;  2BDU A;  1L8L A;  1A77 A;  4O5K A;  1Q3V A;  5IIN A;  2AXT U;  1N62 A;  8ICB A;  3ZI4 A;  2DPI A;  2WTF A;  1BPD A;  3AN1 A;  2W54 A;  2OEH A;  1CRX A;  4RT2 A;  2Q0Z X;  4F4W A;  1X9M A;  1TK8 A;  2ZIX A;  3GIK A;  1ZJM A;  3QU4 A;  3RFA A;  4YQW A;  2J6T A;  3ED5 A;  4RT3 A;  1A76 A;  1SL0 A;  5JUM A;  4KLL A;  5DB6 A;  7ICI A;  3RAQ A;  2PXI A;  3QNM A;  1JI7 A;  1N63 A;  4BUG A;  4DQS A;  3PO4 A;  1SKS A;  2E1F A;  3QX7 A;  1ZQY A;  1SZP A;  4J9P A;  1ZQW A;  2HHV A;  3AM9 A;  4F5O A;  1LB2 B;  2BCS A;  2Y9T A;  2W9B A;  5ALN A;  1S77 D;  2ASL A;  1QQ5 A;  2LM1 A;  2EAN A;  4JUZ A;  3ORY A;  3RJG A;  2JHD A;  4M6W A;  5C5J A;  4UAT A;  2IOF K;  2KFZ A;  1T8E A;  5BPC A;  3M9M B;  5DKW A;  2KZZ A;  1XWL A;  2A19 A;  5ALU A;  5AM4 A;  5KG0 A;  3GDX A;  4LJX A;  1PUZ A;  3PNC A;  5HML A;  3NTU A;  3EWA A;  4ELV A;  4YMM A;  1X9X A;  3KFU F;  3MGI A;  3M9N B;  1KSP A;  3C1Z A;  3WK4 A;  2KHQ A;  5HR7 A;  4UB1 A;  3PST A;  1X66 A;  1S9F A;  2PFQ A;  4P2H A;  1J2M A;  5H2F U;  3I28 A;  1S10 A;  5J2B A;  3SEN A;  2LPE A;  4IRD A;  4RZR A;  9ICI A;  3BQT A;  5JRT A;  1L3T A;  4EBD A;  9ICL A;  3CP8 A;  4QIW F;  5AI5 A;  4QZF A;  1TVA A;  3MR6 A;  2FE9 A;  3BS5 B;  2DFL A;  3QUQ A;  4M2Y A;  1SWV A;  4KLD A;  3TQ1 A;  1MC8 A;  4Y2Y A;  1XS9 D;  3WK8 A;  4RQ4 A;  2HBM A;  4B9U A;  3KKA A;  2ZIX B;  5KAI U;  4Y2U A;  1Z3E B;  5AI0 A;  2I9G A;  1KDH A;  2WF6 A;  5AM0 A;  2R8K A;  4X5V A;  4R66 A;  1L7O A;  2AH5 A;  2Y1J A;  4F2R A;  2BDP A;  4F4X A;  5KFT A;  3D6J A;  4P4P A;  1LV5 A;  2M9N A;  3V72 A;  4DSL A;  3ISB A;  3HKZ C;  5GTI U;  2GOL A;  1TK5 A;  5AIB A;  3PVX A;  1ZQJ A;  1KFS A;  1TAM A;  8ICE A;  1VJ5 A;  2BQU A;  1N60 A;  3PZP A;  5KT2 A;  1ZQF A;  5D49 A;  7ICO A;  5ALI A;  3PW5 A;  1YT3 A;  2QKQ A;  2Q4T A;  3GZF A;  2KK0 A;  5KFL A;  1T94 A;  4DSK A;  4UBC A;  3J81 j;  2QAR A;  4Y2V A;  2NRT A;  2EZY A;  5KFR A;  3OSN A;  5HHI A;  3PX4 A;  3K4G A;  2PFO A;  5JTI A;  8ICX A;  8ICS A;  4I2I A;  2LYB A;  4EZ6 A;  3KHG A;  9ICN A;  2PFP A;  2FPM A;  5ALP A;  1HUZ A;  1ZRN A;  2W11 A;  3H7I A;  5KNI A;  2R18 A;  8ICV A;  2JH1 A;  4NY8 A;  4ECU A;  4GXI A;  4B9N A;  4IL6 U;  2D3D A;  3FM9 A;  3MFH A;  9ICF A;  7ICT A;  2A1J B;  5KFW A;  9ICG A;  8ICG A;  2E8N A;  2G5H B;  5CRX A;  1J97 A;  2VAN A;  3FDS A;  5B66 U;  4KLJ A;  2F44 A;  5J0U A;  3V6H A;  4QZ8 A;  3MC1 A;  3KHR A;  1SZH A;  1O03 A;  1WYG A;  4DQI A;  3Q8L A;  1JUD A;  8ICC A;  3M6K A;  3H0M B;  4R64 A;  2R8H A;  1ZOL A;  1ZQS A;  2XGQ A;  1S8O A;  4YXM A;  1V9P A;  3PSI A;  5KFB A;  4BXO B;  2AGO A;  4O9M A;  4J9L A;  3PSP A;  3C28 A;  4HYK A;  1VLB A;  4FZN A;  4DOB A;  1UHU A;  4QW9 A;  3CW2 C;  4YD2 A;  5ALR A;  5III A;  1X9S A;  5AKY A;  1ZQP A;  2ALZ A;  5ALE A;  5EWF A;  1C20 A;  3PV8 A;  4I2J A;  4GFJ A;  2UVU A;  3TAD A;  3NVW A;  1KKX A;  4J9R A;  5KG1 A;  4DSJ A;  1ZQX A;  1N61 A;  1BPY A;  1WWU A;  5CA7 A;  5EE3 A;  1U9L A;  2R8G A;  1WUD A;  1QSL A;  1FEZ A;  1AQ6 A;  3ALR A;  3B9J A;  4DL4 A;  4QWC A;  2KV2 A;  2HBJ A;  5AKG A;  3C23 A;  3ZD8 A;  5L1L A;  1JXE A;  1LVH A;  2HBK A;  5J2F A;  2V9W A;  4KLT A;  3B0Y A;  5AI6 A;  2IBK A;  1RYR A;  7ICE A;  1ARO P;  3C1Y A;  3TFR A;  4TQR A;  1N2X A;  1S97 A;  3KZX A;  3HIL A;  2GH1 A;  3RJF A;  1BNP A;  4UW9 A;  1ZQG A;  2PKE A;  5HP4 A;  1ZQM A;  2K8A A;  9ICU A;  1UT5 A;  2H3Z A;  3WK6 A;  3RR8 A;  1HEK A;  1ZQV A;  5AK5 A;  5KFF A;  4KLM A;  1S76 D;  2CXY A;  5L9X A;  4HAI A;  7ICV A;  5KT4 A;  4KN7 A;  2EDU A;  4UB8 U;  3BS7 A;  1S0M A;  2W3R A;  4J9N A;  4Y2S A;  4FBT A;  2AQ4 A;  5ALF A;  3HJE A;  4DS5 A;  5J0W A;  5EOZ A;  4US8 A;  5AM5 A;  2C2R A;  1J2N A;  3OHB A;  2ISP A;  2WAQ F;  4NLC A;  3QXG A;  5CJ7 A;  1JXL A;  4NV0 A;  9ICV A;  1YZ7 A;  3EZ5 A;  3H8S A;  1CUK A;  4JWN A;  3JPR A;  4K4I A;  2ZTC A;  2KKP A;  1RQN A;  3JPN A;  2W8K A;  2WB1 F;  2H3F A;  4I2D A;  2E8O A;  1ZQB A;  5HR6 A;  3ZDC A;  1LKY B;  5CR0 A;  4B9V A;  3M1Y A;  2V4Q A;  4Q44 A;  4ACO A;  5ALW A;  2XID A;  8ICR A;  1L3S A;  1NKC A;  3UM9 A;  4CGZ A;  2VJ5 A;  2ZG6 A;  3AQF A;  4Q43 A;  1OXJ A;  1DK3 A;  4O3O A;  4NM1 A;  5IIL A;  1X6I A;  5C0Y A;  4O5E A;  5CP2 A;  2DWQ A;  3SR6 A;  1NK5 A;  4OJO A;  3NRW A;  3N7R C;  4YFK A;  5B5E U;  2YB4 A;  4F5N A;  3DEE A;  9ICE A;  1JMS A;  4EBE A;  4LZG A;  4DQR A;  2E1E A;  3N4M B;  2W9C A;  1PZN A;  1N48 A;  5TIS U;  2W04 A;  2IA6 A;  2HSZ A;  5BOM A;  1DRG A;  4PHP A;  5L1M A;  2F1H A;  3TAC B;  4BXO A;  4LVS A;  3RRH A;  3TKA A;  2FLL A;  8ICU A;  3N7P D;  1PK3 A;  2G06 A;  2I5H A;  2KIV A;  3QU9 A;  5CWR A;  3Q8Q B;  3IRU A;  1U48 A;  2B6G A;  5EWG A;  2VA3 A;  3H40 A;  2UVW A;  2JEG A;  1OW5 A;  1Z00 A;  2KNJ A;  3IV6 A;  4EX7 A;  4NLG A;  4DF4 A;  3H8M A;  5AKX A;  4J9Q A;  3NVY A;  4M9L A;  2JEJ A;  5ALG A;  3DDH A;  8ICQ A;  2DKZ A;  1NK7 A;  2ZIU B;  2FPL A;  3MR5 A;  3TAR A;  1ZQO A;  3H8J A;  4IR1 A;  2NO4 A;  4QZA A;  4YR2 A;  2VA2 A;  2HVI A;  4IC9 A;  1ZYQ A;  4QJF B;  4K4H A;  2VJ4 A;  4C0Z A;  1OUQ A;  3GII A;  8ICH A;  4R8U B;  4EBC A;  4O3R A;  2W8L A;  3MR2 A;  2HMX A;  2K4H A;  5AI9 A;  1TV9 A;  2D6F C;  4GXK A;  8ICA A;  3AUO A;  3WU2 U;  1COK A;  5KFV A;  2BPC A;  2EZZ A;  2JZB A;  3BQ1 A;  3C21 A;  3BZC A;  3GU3 A;  3NRZ A;  5ALK A;  5FP0 A;  5KFK A;  3PW4 A;  2JH7 A;  1QH9 A;  4QIW C;  2W55 A;  1TFR A;  4OJ5 A;  3H8W A;  1JX4 A;  4PHA A;  4TUQ A;  9ICA A;  2YQE A;  2HCF A;  5KFZ A;  4DSI A;  4F72 A;  5KFC A;  1NJZ A;  4QZE A;  1D8B A;  2H3I A;  4LZD A;  4I29 A;  2DQN B;  4UAU A;  1C7Y A;  4F92 B;  1XO1 A;  3PR4 A;  1Z00 B;  8ICN A;  1CI4 A;  3RJE A;  5J0Q A;  3OSP A;  4QZI A;  5DGA A;  4DLE A;  5D4B A;  4QW8 A;  2WF5 A;  1BPE A;  4OJ6 A;  2NRW A;  5AKL A;  2J6U A;  1A0P A;  3BS5 A;  4M9N A;  1WWV A;  3SAH A;  3UXP A;  2F77 X;  2DBY A;  5DG7 A;  4PGY A;  4I2E A;  2G09 A;  1IG6 A;  2EAM A;  1PVP A;  2HHS A;  1Q3U A;  4PL1 A;  1ZQQ A;  3KBB A;  2C22 A;  4O3Q A;  5KFQ A;  5HNK A;  1RXW A;  2N1R A;  3T79 A;  4Z6F A;  3T5J A;  3RTV A;  3F5A A;  5CB1 A;  5ALO A;  3I76 A;  4B9M A;  3H0R B;  3RH4 A;  1B0X A;  4DL3 A;  4B9T A;  3RB6 A;  2E8P A;  9ICP A;  1SV4 A;  2E5S A;  2MAX A;  1KBU A;  2Y9U A;  2LYA A;  1BPZ A;  1F5S A;  1ZD4 A;  3QU5 A;  5J2C A;  4KLF A;  3MDA A;  3GFK B;  2KIW A;  1RDF A;  1IIP A;  4M0A A;  4Y2R A;  4AP9 A;  5ALV A;  3N97 B;  3CNH A;  5J2D A;  4RQ1 A;  4MFC A;  5L1J A;  4IRK A;  4G3I A;  1FFU A;  1X2I A;  1KW4 A;  4ED3 A;  1RXV A;  2W9M A;  2XI9 A;  3QU7 A;  4M9J A;  3RH5 A;  3SV4 A;  1X40 A;  5AKZ A;  2PMZ F;  3AU2 A;  4XUS A;  2F1I A;  2ES6 A;  3T5L A;  2YN4 A;  9ICK A;  4O3N A;  3EYZ A;  1XO0 A;  2JEF A;  2MU2 A;  1HJP A;  4KN4 A;  2Y0S C;  2LBO A;  4XRH A;  3SAG A;  2FPK A;  2OHF A;  2QLT A;  2CPR A;  1JIH A;  3Q8K A;  4TUS A;  2RP5 A;  3ZDB A;  1JRO A;  3RB0 A;  3PO5 A;  3TAP A;  3RJI A;  4Y2Q A;  4ECR A;  4YG2 A;  2BGW A;  2ZXI A;  5KFY A;  3E2E A;  1F44 A;  2ZIW B;  1MN8 A;  3QZ7 A;  5AKK A;  4IQV A;  5ALS A;  4Q8F A;  4UAZ A;  4PZO A;  5AK3 A;  1FFV A;  1KQQ A;  2YMQ A;  4K4G A;  4BWJ A;  3N7S C;  1O08 A;  1QTM A;  2NRV A;  3ETR A;  1ZQI A;  1L6N A;  4ED7 A;  4OJL A;  2BKE A;  3VC8 A;  1SL2 A;  4DEZ A;  1XC9 A;  5AM3 A;  2AGP A;  2R8J A;  5KFJ A;  2ZUC A;  1N5W A;  4ECS A;  4FO6 A;  5AI8 A;  4JV0 A;  4RQ7 A;  2WB1 C;  2KE7 A;  3UQ2 A;  2XC9 A;  4RU9 A;  1BGX T;  2KP7 A;  4BX9 C;  4F5Q A;  8ICO A;  3HPO A;  2WF8 A;  1ZQT A;  2DPJ A;  2F1J A;  2E3T A;  4RNM A;  4UB2 A;  2KEY A;  1TAU A;  3GIM A;  5ALJ A;  4B9S A;  3IHQ B;  8ICY A;  2QB0 A;  4C8O A;  2YMP A;  5TZV A;  2JGA A;  4I2C A;  3LDA A;  3THV A;  5J2J A;  1KRP A;  2AJQ A;  4Q45 A;  8ICF A;  2NO5 A;  3RAX A;  3F2B A;  1UA0 A;  5AIC A;  4KX5 A;  2XIC A;  4F4K A;  1TKD A;  3F2D A;  4O3P A;  1ZQC A;  2XGP A;  5HHH A;  4Q8E A;  4J9K A;  4Y2T A;  5HMM A;  4I27 A;  4PHD A;  3D2S A;  2KHV A;  3QYP A;  2W3S A;  5DGB A;  1NZB A;  2B0C A;  4UB4 A;  3PML A;  3HW8 A;  2F2A B;  3C5G A;  1NK8 A;  1D9F A;  2ASJ A;  3WK5 A;  4KTQ A;  1DXS A;  2EAP A;  5KT5 A;  3SV3 A;  1T3N A;  3ZDA A;  7ICJ A;  2K8C B;  4ECZ A;  2H3Q A;  9ICB A;  1WG8 A;  2XVT A;  3KTQ A;  4NWI A;  8ICK A;  4P0P A;  1RZT A;  3KHH A;  2KVC A;  1ZQH A;  4BJQ A;  3EW9 A;  2F3N A;  2KVS A;  4NLK A;  4C80 A;  4QNL A;  5DG9 A;  1B4F A;  4F3O A;  7ICP A;  5DQG A;  1ZQU A;  4M9H A;  2DKX A;  4F4Y A;  2J6S A;  4DL7 A;  2W7P A;  5J0S A;  2PFN A;  1D8L A;  1IV8 A;  1QSY A;  1Z1B A;  2V4R A;  4JK1 A;  3IG8 A;  1T7P A;  4C8M A;  3UMG A;  3G6Y A;  1PK1 B;  3FYH A;  8ICJ A;  1UQV A;  4J9M A;  2UVR A;  3TFS A;  2DL0 A;  4MEX A;  2KZ3 A;  1PVR A;  3IDW A;  1ZD5 A;  4DSE A;  2JRZ A;  3S6J A;  4UQG A;  2BPF A;  1ZQL A;  1XSL A;  2KTQ A;  1NKE A;  2P35 A;  2UVV A;  2ESE A;  5J2H A;  3JPS A;  2KJ5 A;  4KLU A;  5DBC A;  4CNQ A;  1SB3 C;  9ICO A;  4PJ0 U;  1M6Y A;  3LK9 A;  2ISO A;  5ALT A;  4DL6 A;  1KEJ A;  1Q46 A;  3GIJ A;  3L5K A;  2FMQ A;  4DS4 A;  2G0A A;  3LYS A;  1IM4 A;  2K4I A;  2R8I A;  1K1Q A;  5ALH A;  5KFE A;  3C2M A;  3PSF A;  4OJP A;  3RR7 A;  5J0O A;  4JV2 A;  3SAF A;  3AEV A;  4C4S A;  4FZM A;  3RRG A;  2ODG A;  5AHX A;  2W43 A;  4RPY A;  5G5H A;  3UXO A;  3PX0 A;  1T3Q A;  1NKB A;  3RH6 A;  4JMU A;  4DFK A;  1WCN A;  4QZB A;  2HVH A;  3LVW A;  1BPX A;  1Z19 A;  4BWM A;  4M6W B;  5KT3 A;  4NLZ A;  3HKZ F;  4ECT A;  7ICM A;  4EEN A;  1N56 A;  2FDR A;  2G07 A;  3L3F X;  3CYM A;  4F5P A;  2HDO A;  4B9L A;  3T5H A;  3AU6 A;  3D2Q A;  2W7O A;  5KFO A;  4DFM A;  3GQC A;  5KL1 B;  2AHO B;  4ECY A;  3FC4 A;  5F9N A;  5J29 A;  1NJX A;  1ZQD A;  1DGS A;  4DCC A;  4RNN A;  2RDI A;  1QSS A;  2CRX A;  1KFT A;  5KL8 B;  1KFD A;  5DBA A;  2AGQ A;  4F5R A;  1F0M A;  4PGX A;  3HP6 A;  4MHV A;  3EPG A;  4MEY A;  4O3M A;  4OO1 J;  3WKD A;  3ZD9 A;  2BCV A;  4ZH4 A;  3TI0 A;  3SQI A;  3HX0 A;  1K5O A;  1RQL A;  4YR0 A;  2YX8 A;  2XCA A;  3KZI U;  3PR5 B;  1V97 A;  2VKQ A;  3F5E A;  9ICJ A;  3QUC A;  3SYZ A;  1RG6 A;  2I6X A;  4EEK A;  1X9W A;  7ICL A;  2RRD A;  1L3U A;  2ZUB A;  5J0R A;  1YZ6 A;  3OJU A;  3NAS A;  5ALL A;  4R63 A;  4ZOH C;  4O5C A;  4Z6E A;  4YR3 A;  1TAQ A;  2A3V A;  1ZQ1 C;  5J2A A;  1S0O A;  3M7D A;  1BVS A;  4RQ8 A;  3K1R B;  2GWS A;  4KLI A;  4ELT A;  1U47 A;  4RQN A;  4F8R A;  3OPX A;  3Q8P B;  5DDY A;  4C4R A;  4J9O A;  1ZQE A;  3MDC A;  4KLS A;  3KKA C;  4KLG A;  2DF4 B;  3PX6 A;  3JPQ A;  3H0L B;  4MFA A;  3TAD C;  4KIT B;  2K4E A;  4EZ9 A;  4P0Q A;  2WHE A;  2XY5 A;  3Q8M A;  2WFA A;  2MRL A;  2JMG A;  5EE9 A;  3KHL A;  9ICS A;  2E8M A;  1SIJ A;  1RYS A;  1S0N A;  3LWM A;  5BOL A;  1S0V A;  1UPH A;  1ZJN A;  2RLT A;  2YML A;  2BR0 A;  2NYV A;  5KAF U;  4Y2J A;  4RPX A;  3MGV A;  4G9B A;  5KG6 A;  3A0H U;  4QZD A;  3LVV A;  4RQ5 A;  4F91 B;  1ZQZ A;  3EUB 2;  3M8S A;  4YP3 A;  3K1Z A;  2D8C A;  2IOH A;  4GC6 A;  1IXR A;  2GLE A;  3QUB A;  2NRX A;  4ELU A;  1QQ6 A;  5AIA A;  2KOB A;  2BQR A;  3RB3 A;  4ED2 A;  1QQ7 A;  3L4P A;  5ALX A;  1XSP A;  2RHF A;  3NS1 A;  3RJJ A;  4YCX A;  3OHA A;  3C29 A;  1RPL A;  2HHT A;  2MSN A;  4WJ3 B;  2LMR A;  2F8L A;  1SV0 A;  2K4P A;  5ALM A;  4DWI A;  3ZDE A;  2KJ9 A;  4YMN A;  1NJW A;  2RQ5 A;  4Z6C A;  2PI5 A;  7ICK A;  1COO A;  1DOQ A;  5KFS A;  5DLG A;  3Q8S B;  2OM6 A;  2QB1 A;  5J0X A;  3GIL A;  4I2A A;  4CF5 A;  4Z6D A;  2WF9 A;  2Y0S F;  5KT7 A;  5IIM A;  4ECX A;  4TUP A;  4P4M A;  4DQP A;  2O6K A;  5AI4 A;  5J2I A;  2M0N A;  4DL2 A;  5G5G A;  3MGH A;  4J03 A;  4C7Z A;  4UBB A;  2KN7 A;  5J8Y A;  1L3V A;  3LWL A;  5AK6 A;  4QZH A;  5KG3 A;  4U6P A;  1SWW A;  5J2E A;  4MF8 A;  5J2K A;  2KZM A;  4UB5 A;  3PMN A;  3NGD A;  3QZ8 A;  7ICF A;  3GV8 B;  3HWT A;  1PK1 A;  2A1A A;  5KFG A;  4O3S A;  5DLF A;  4IQW A;  3OJS A;  4XA5 A;  5IIO A;  5EWE A;  1D9D A;  1CEZ A;  4IQU A;  5F9L A;  3Q8R B;  2FI1 A;  5GTH U;  4DQQ A;  1TK0 A;  2HW3 A;  1NNL A;  1T4G A;  2IHN A;  2KSO B;  7ICG A;  1N5X A;  5DQI A;  8ICI A;  4QWB A;  4TQS A;  1KL9 A;  3AMZ A;  4GIB A;  3V6J A;  5AKI A;  3NVV A;  2ZUD A;  2YMM A;  5EE0 A;  2HOQ A;  1ZD3 A;  3UMC A;  3H4D A;  4ED8 A;  3PY8 A;  3ISC A;  3JPO A;  2MUT B;  4PPX A;  1KLN A;  4EYH B;  2WAQ C;  2IOF A;  4CDG A;  7ICS A;  5JU5 A;  1B43 A;  4KLE A;  4I2B A;  1ED1 A;  3QEB Z;  4E0D A;  1SGG A;  1NK6 A;  9ICR A;  3GV7 B;  3M9O B;  3GV5 B;  1D8Y A;  5KTQ A;  4I28 A;  3NUQ A;  4FS2 A;  5J0Y A;  4MF2 A;  3E58 A;  2OYY A;  4Y2X A;  3QEA Z;  4FFD A;  2H5X A;  1Z1V A;  3PW7 A;  9ICW A;  4RUA A;  4RNO A;  1NZP A;  4YVZ A;  1A6S A;  1WCL A;  5CHG A;  5DQH A;  3T5K A;  4P4O A;  1MQ3 A;  2BQ3 A;  3C2K A;  3BJY A;  2OXO A;  4BGD A;  3JPT A;  2K89 A;  1SKR A;  3RBE A;  5J2G A;  4IQT A;  4F4Z A;  2ZIV B;  3E0F A;  4KMO B;  2QB0 B;  4IS7 A;  3ZDD A;  4M47 A;  3U26 A;  4PH5 A;  1ZD2 P;  4FZL A;  1U4B A;  1ZQN A;  3UXN A;  2NRZ A;  7ICR A;  3G6X A;  2HOF A;  2PI4 A;  4USA A;  2P6R A;  3OTQ A;  5DB9 A;  1RYU A;  2JXJ A;  4IR9 A;  3WKA A;  4QWD A;  3SEI A;  4I2G A;  2XO7 A;  1B22 A;  3V6K A;  2F8K A;  4RUC A;  3F2C A;  4DOA A;  4KLQ A;  2KD1 A;  2EZX A;  1L7P A;  4RQM A;  3WKB A;  4JV1 A;  4MFF A;  2BCR A;  5L1K A;  1JN3 A;  4UB3 A;  2IMW P;  1L7N A;  1XNS A;  3SD7 A;  4ECV A;  3WK9 A;  4GLX A;  2OCE A;  4GC7 A;  5KFH A;  2G5I B;  2LHT A;  7ICH A;  4NLN A;  4P0Q B;  2I1Q A;  3C2L A;  2KMD A;  4OCZ A;  4US9 A;  5KFA A;  5KFI A;  2JZB B;  5IIK A;  3RF9 A;  2YB1 A;  4DFP A;  3VCB A;  2ZIW A;  4PHE A;  4I2F A;  2HBL A;  1Z4N A;  9ICC A;  8ICZ A;  1VDV A;  5CEH A;  1UA1 A;  5KFM A;  4DLG A;  3RJK A;  2ATL A;  4AYB C;  2JV3 A;  4YXJ A;  9ICQ A;  4NJ8 A;  4M9G A;  1QLN A;  4R8U A;  4F71 A;  4UB6 U;  8ICL A;  3TAN A;  5ALZ A;  4CF4 A;  1U45 A;  2RDJ A;  4M04 A;  5DB7 A;  2EAO A;  4YN4 A;  2BPG A;  4NXZ A;  5DBB A;  1HUO A;  8ICT A;  4C8K A;  2YTU A;  1V38 A;  3A0B U;  1QCK A;  4ECQ A;  1ZXI A;  2FMS A;  1NI3 A;  2Z7J A;  3NVZ A;  3G6V A;  1ZQA A;  3EPI A;  3MAB A;  1S5L U;  2FMP A;  1Z4O A;  2C28 A;  4ED0 A;  2LKY A;  1SXD A;  4QWA A;  3SMV A;  4J9S A;  2DUY A;  9ICX A;  4JWM A;  3KD3 A;  3MR3 A;  3BZK A;  3RB4 A;  3IG5 A;  5EE1 A;  4A8E A;  1SXE A;  2B21 A;  2XCP A;  2FJ6 A;  2KJ8 A;  1ZET A;  1Y88 A;  2LM4 A;  4DSF A;  1NOM A;  2JEI A;  2CN1 A;  3BQ0 A;  2C2E A;  2MA1 A;  4CRX A;  3CRX A;  2W9C B;  1JAL A;  2DGZ A;  4TUR A;  1ZQK A;  2ZIV A;  2KKV A;  1MA7 A;  2W9B B;  1K1S A;  9ICM A;  4KLO A;  4AYB F;  4EEY A;  3BQ2 A;  3F53 A;  4O0I A;  3MBY A;  3PW2 A;  1P7D A;  1MSW D;  5KFX A;  1HIW A;  2HHQ A;  3M8R A;  5KFD A;  2Y1I A;  3IP4 B;  2P66 A;  2ZTE A;  2HHW A;  4OD0 A; 
#chains in the Genus database with same CATH homology
 1OXJ A;  1X9X A;  2Y9U A;  2KSO A;  5KNI A;  1B4F A;  1COK A;  1V85 A;  2EAO A;  5F3X B;  2D3D A;  2DKX A;  5J8Y A;  3KKA C;  1UCV A;  1X66 A;  2KE7 A;  3HIL A;  1LKY A;  2E8N A;  2YTU A;  1V38 A;  3TAD C;  2QB0 B;  1KW4 A;  3SEN A;  4IS7 A;  2F44 A;  2LPE A;  1PK1 B;  1PK1 A;  1X40 A;  2E8M A;  1UQV A;  2QB0 A;  5JRT A;  2DL0 A;  1SXD A;  3IDW A;  5L1M A;  3TAC B;  2ES6 A;  3BS7 A;  2FE9 A;  3BS5 B;  4PZN A;  1PK3 A;  2KIV A;  3SEI A;  1SXE A;  2KSO B;  5J8Y C;  3KKA A;  2B6G A;  2F8K A;  2D8C A;  1F0M A;  3BS5 A;  2ESE A;  4MHV A;  4NL9 C;  1WWV A;  4RQM A;  2GLE A;  1OW5 A;  1JI7 A;  3H8M A;  3BQ7 A;  2EAM A;  5JU5 A;  2DKZ A;  2LMR A;  1SV0 A;  2E8O A;  2K4P A;  2Y9T A;  1RG6 A;  1LKY B;  2KMD A;  2EAN A;  1DXS A;  1SGG A;  2EAP A;  4PZO A;  3TAD A;  4NL9 A;  2K60 A;  2QKQ A;  1WWU A;  2QB1 A;  1B0X A;  2QAR A;  2L5Y A;  2KG5 A;  2E8P A;  3K1R B;  5JTI A;  1SV4 A;  1Z1V A;  1SV0 C;  2QAR B;  2JV3 A;  4NJ8 A;  2F3N A;  4RQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...