1PK3A

Scm sam domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
b'RANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSEMMMKYMGLKLGPALKICNLVNKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sex comb on midleg CG9495-PA
molecule tags Transcription repression
source organism Drosophila melanogaster
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
total genus 28
structure length 76
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk3A00
1RG6A 2KSOB 5F3XB 1X40A 2EAPA 3KKAA 1SGGA 3SEIA 2Y9UA 1SV0C 2K4PA 2Y9TA 3BQ7A 4IS7A 4RQNA 5JU5A 2F3NA 2QB1A 1SXDA 3BS5A 5JTIA 3IDWA 2QARA 4NJ8A 2E8MA 2KSOA 3TADC 4PZNA 2ES6A 3KKAC 4RQMA 3TACB 1PK3A 2DL0A 2KMDA 4NL9A 2E8PA 1DXSA 3BS5B 2QARB 1B0XA 1KW4A 1COKA 4MHVA 1PK1A 2QB0B 1V38A 1WWUA 1B4FA 1PK1B 2QB0A 3H8MA 1X66A 1Z1VA 2KG5A 2F8KA 1F0MA 5JRTA 2EAMA 2L5YA 2KE7A 1LKYB 2DKZA 1UQVA 2JV3A 5J8YA 1UCVA 2YTUA 2QKQA 2EANA 3BS7A 2B6GA 4NL9C 1JI7A 1SXEA 1SV4A 2LPEA 2KIVA 2D8CA 2DKXA 3K1RB 1WWVA 1OXJA 3HILA 2GLEA 2K60A 1X9XA 5J8YC 5KNIA 4PZOA 2E8OA 5L1MA 3TADA 2EAOA 2ESEA 1OW5A 2D3DA 1SV0A 2E8NA 1LKYA 3SENA 1V85A 2F44A 2FE9A 2LMRA
chains in the Genus database with same CATH superfamily
2W7OA 4I2JA 5IIIA 4KITB 2LHTA 5FP0A 3SEIA 4DEZA 1FEZA 2IOFA 4QZIA 2YX8A 5C5JA 9ICHA 2DGZA 2VIXA 4RQNA 4P0QA 1RZTA 3QXGA 5DGBA 3PW5A 3WK4A 2FI1A 5KG2A 3LVWA 3RB0A 2K8CB 2Y0SC 1Q3VA 5AKHA 5KFQA 2K4HA 2KSOA 4ECYA 1ZQXA 4DO9A 3R9KA 2WB1F 2XY6A 2PKEA 3KKAC 4QWDA 5KFKA 1PVRA 2WFAA 5L1KA 5AIBA 4RUAA 3Q8PB 3SAGA 2E8PA 8ICMA 3KHHA 4KLIA 9ICJA 1JXEA 5KFOA 4KLGA 3MFIA 1ZRNA 2KOBA 2QB0B 2K4EA 2PMZC 5KFZA 1BVSA 1L8OA 4XRHA 2QB0A 3QU7A 4RQ7A 3LWLA 2FPKA 1S0VA 3BQ2A 2W3SA 8ICFA 3MABA 4P4PA 4TUSA 5JRTA 1TV9A 2EAMA 3KHRA 1UQVA 4YG2A 5AI5A 4ICAA 3K75D 2BPFA 1MSWD 3HILA 1DK2A 3QNMA 4DFJA 1SL0A 1J2MA 4M6WA 2B0CA 3RJGA 2ZJ8A 2UVRA 2VKQA 4RQ3A 4EBEA 3RBEA 3JPRA 5ALWA 3C23A 4B9MA 1V97A 1CRXA 4YMMA 1TK5A 3L4PA 2R8IA 3RAXA 4F92B 1ZQLA 5KFEA 5IIOA 2IHMA 2EAPA 5IIMA 3L5KA 1SGGA 3QU2A 4US9A 1Z1BA 2BCRA 4DSJA 4JV2A 1UA0A 2EQYA 2HBJA 3DDHA 1FO4A 1ECWA 1Z3EB 3D2QA 3M9MB 4PHPA 2R8GA 4IRCA 8ICCA 1L3VA 3NVYA 2ZTDA 4B6JA 4I2GA 4QIWF 2NRZA 2IMWP 2IBKA 4O5CA 1KLNA 1MQ3A 3ZD9A 4F5QA 5GTIU 2DPIA 3F2CA 1WCLA 3GZFA 5AKJA 1C20A 3RJIA 1S0NA 4AYBC 4B9TA 3KZXA 8ICBA 2K4IA 5J0TA 2BCSA 4I28A 5J2JA 4QZ8A 2C2EA 3AU6A 2PFNA 4NM1A 2FJ6A 2KE7A 2PI4A 3PW7A 3TFSA 4ECWA 2V4RA 2DF4B 3IN5A 4C4TA 4RQ6A 1DK3A 1WYGA 3PSFA 4MF8A 7ICSA 2W9AA 5DQIA 1KFTA 3WK6A 3TARA 1ZQEA 3OHAA 2K60A 5CP2A 4ED2A 4BWMA 1ZQPA 4I2AA 1ZQIA 1MQ2A 4BUGA 4YFKA 3KZIU 2XY5A 2ZIUB 2W9BA 4RQ2A 1EXNA 1FFUA 5AM0A 5IIJA 1JALA 2ZTEA 7ICGA 3PO4A 2YB1A 3SAHA 8ICUA 1QH9A 3NTUA 3H4BA 5DB8A 1BPYA 2MSNA 4CE6A 3RRHA 5G5GA 3WK9A 3PW0A 2XC9A 4M04A 1HJPA 2MRLA 3G6XA 1VDVA 4XA5A 2A19A 3M9NB 3RH6A 2R8KA 4GXIA 2E5SA 3F2BA 3H0RB 2ZXIA 4BXOA 9ICAA 4F4YA 2F3NA 1RQNA 3N7RC 1LB2B 3GDXA 2ZIWA 1ZETA 1SIJA 2QARA 1ZQJA 1JX4A 2BCUA 4KLFA 1QCKA 5DBBA 2JH7A 1IG6A 2XVTA 2KFZA 1XC9A 2AGQA 1T94A 3V7LA 8ICRA 2WF5A 1IIPA 1DXSA 3OPXA 4NLZA 4P4OA 1O03A 1N5XA 1ZQHA 4I2BA 3PSPA 1PK1A 4MFCA 4YMOA 3CNHA 3PR4A 5AM5A 3MFHA 4Z6DA 1K5OA 3FDSA 5KFMA 4JV1A 1SWWA 4QZCA 1JRPA 2DPJA 2J6TA 3RF9A 4KLMA 1L3UA 4JWMA 3QZ7A 3M1YA 1BNPA 3UQ2A 1V9PA 1CI4A 1WUDA 7ICQA 4USAA 5J0QA 2WTFA 3H8SA 5J2CA 3T79A 2AJQA 4RUCA 4K4GA 4C7YA 2ZUDA 3PMNA 4DL5A 2BQ3A 2DKXA 1NKCA 4ELUA 3QU4A 4J9MA 1SWVA 3QUQA 2G5HB 4CRXA 7ICNA 2HBLA 3M8RA 1ZQZA 2RQ5A 5L1MA 1L5UA 5EWGA 8ICVA 2EAOA 2IOHA 1AROP 1D8LA 4EBCA 3GV5B 2ZIVA 1SZPA 1X40A 2XI9A 4UB8U 2K8AA 4DF4A 2FMQA 3QUTA 9ICLA 4R65A 4F50A 3JPOA 3EPGA 1C7YA 4JK1A 3VC8A 2ZUCA 3ZD8A 4QWAA 1XU4A 3VCBA 1CEZA 5J2BA 1NNLA 2E3TA 3ETLA 4MFFA 2XGPA 1KSPA 3HWTA 5KL1B 8ICZA 1QSSA 4RQ1A 3THVA 4GC6A 8ICNA 1X6JA 1XNSA 3QU5A 3EUB2 2FPMA 4DOBA 5AHXA 4BXOB 2F2AB 2HHXA 9ICNA 3RJHA 1N60A 4DFPA 5HHHA 1J97A 4Y2JA 2FMSA 2JZBB 4JUZA 4UAWA 4F4XA 2UVUA 1U48A 2W9CA 2JGAA 4QZDA 5HMLA 4RPZA 3BQTA 3HW8A 1SZHA 4Y2TA 4NLNA 2WAQF 2XY7A 4EELA 2KIWA 4PL2A 2B6GA 1SV4A 2LYBA 3MR3A 4O3NA 1ZYQA 7ICIA 4R64A 1Q3UA 4RNOA 3UXPA 2PMZF 3E58A 1ZQCA 3D2SA 1XWLA 5KT2A 4XUSA 1OW5A 1K1QA 9ICSA 1TE2A 5HMMA 4ED7A 5DGAA 4NV0A 5KFHA 4FZMA 4DLGA 2W54A 4RU9A 4F4WA 4B9LA 5KFWA 4GXJA 3RB6A 4Q8EA 2AHOB 4ECSA 4P4MA 4PGQA 1L6NA 2Y9UA 2KJ5A 5K4LA 5IINA 1RM6C 4UAVA 2XICA 1YZ7A 1NJWA 4QZAA 2VANA 5JTIA 1XS9D 1S0OA 5ALSA 3OJSA 3QU9A 4AYBF 3UQ0A 4BGDA 4BX9C 2QLTA 2NV3A 4DWIA 4DSIA 3UXNA 4GLXA 3QUBA 1KL9A 2ZJAA 5L9XA 4Q45A 3T5KA 1XSLA 1HUZA 9ICEA 3MGVA 2IOFK 3WK8A 3O0FA 2RHFA 4DFMA 2KZZA 7ICHA 2FMPA 1B0XA 5AKEA 4IQTA 3CW2C 4F91B 2KICA 3T5HA 4ECQA 8ICYA 2F77X 3JPTA 5J2KA 3G6VA 1SKWA 2OM6A 3LK9A 4R66A 1HUOA 2WF8A 2HMXA 2FLPA 4C0ZA 3V6JA 2F8KA 4Y2VA 2AXTU 2OCEA 3J81j 3PX0A 4Q8FA 4FZLA 3BS7A 1ZJNA 9ICMA 2W55A 4M6WB 4PGYA 5J2IA 1HIWA 2AQ4A 4KLQA 2LKYA 3AEVA 2YY6A 2KTQA 1OUQA 2BCVA 2DUYA 4EEKA 3NRWA 2MUTB 3SMVA 4QZBA 4NLCA 4O3RA 4F8RA 4YVZA 1ZQWA 2I5HA 5CHGA 5EE3A 4FO6A 3UPQA 3RB4A 1N61A 2UVWA 2M0NA 1A76A 2BQUA 4B9NA 4FZNA 4FS2A 2J6UA 2YMPA 3M7DA 2E1EA 4ECXA 2W9BB 4C8LA 2LYAA 4CF4A 1KBUA 2XIDA 3HX0A 2JXJA 2FLNA 4Z6EA 1P7DA 2N1RA 5BOLA 3C21A 1QQ6A 8ICKA 4Y2SA 2M9NA 4NJ8A 1IXRA 1JROA 3AL0B 1ZQBA 4F4ZA 4DLEA 2P6RA 1DOQA 1UPHA 1N48A 1KRPA 3KFUF 1M6YA 3C5FA 2H3FA 3SV3A 4BJQA 2ALZA 4GC7A 3A0BU 5HR7A 1TVAA 2NRVA 2G0AA 2KKVA 4BDPA 5AI9A 5ALZA 2MAXA 1L7MA 2VJ4A 4M9GA 4QWEA 2EZZA 4I29A 2L5YA 1X2IA 7ICJA 3KHGA 3N7PD 3PV8A 4JWNA 3F5EA 2YTUA 5E79U 2KVCA 2ASDA 1JI7A 3WU2U 1NJZA 1JN3A 1UHUA 2D8CA 1OXJA 3EYZA 1FIQA 5KFNA 5J2EA 3TFRA 8ICXA 1RDFA 4YXMA 1JXLA 4Y2RA 2KK0A 2G09A 3TAPA 9ICQA 1PZNA 2F76X 5C0YA 2JEGA 2F1IA 4J9PA 4ECUA 9ICXA 3UMCA 5F9LA 1ZQTA 1KFSA 2E8NA 1U45A 1QSLA 1N5WA 3FAHA 3KBBA 4DQPA 3FM9A 5F3XB 2AGPA 4GFJA 3I1YA 4OJPA 2CXYA 1H38A 3PSTA 4M0AA 4MFAA 2GOLA 2AH5A 5DBAA 2WB1C 5AKKA 3AUOA 5JU5A 2DFLA 4UAYA 4F71A 2F8LA 4UASA 2HDOA 3BQ1A 4C8KA 1BGXT 2QB1A 4ZOHC 4DF8A 4QWBA 7ICOA 2BHNA 2BKEA 3GFKB 3BJYA 2LI6A 1Q8KA 4PZNA 1L7PA 3CYMA 3ZDCA 4B9SA 1KQQA 5J2GA 3C5GA 3PNCA 2YMQA 2A1JA 3OHBA 2AGOA 4DOCA 1K1SA 5ALYA 4TUPA 5EWFA 3H8JA 1V38A 5KFBA 3OGUA 4QZ9A 5L1LA 4TQSA 5KFLA 1NK4A 4GXKA 3AMZA 4KN4A 1X66A 1Z1VA 5AKIA 1IM4A 7ICMA 1T3QA 1X9WA 2HSZA 5AI6A 5KT6A 2A1AA 5ALMA 4I2HA 5DLGA 5DDMA 4C7ZA 3K1ZA 2JZBA 1D9DA 3LYSA 5ALDA 1WCNA 1NOMA 1T4GA 1KDHA 7ICEA 1KN5A 5T14A 2KD1A 5BOMA 2R8HA 1SB3C 3MR5A 4CGZA 1D9FA 2XGQA 3I76A 4OJ5A 4RPYA 2W3RA 5J0RA 1LKYA 3SENA 7ICLA 1SKRA 3RJEA 3ISDA 1RG6A 4TUQA 2VA2A 4IR9A 2OH2A 4MEXA 1TFRA 5CRXA 4DL4A 2NO5A 2H5XA 2Q4TA 4I2IA 1NJYA 2WF9A 1Z00B 3PW2A 3PSIA 4O0IA 2Q0ZX 5J2DA 4QZEA 1SXDA 1XSNA 5ALKA 4ED8A 3N4MB 1NKEA 5AKLA 3PZPA 5KT7A 2I9GA 5J2HA 5ALQA 2R18A 3RH4A 2BDUA 4P0QB 3NUQA 2HHUA 2ATLA 5ALIA 4NL9A 4F2RA 3Q8SB 1ZQUA 3RR8A 1Z4OA 2JEFA 5DQHA 3V6KA 8ICSA 4US8A 5H2FU 1ZD4A 2K89A 4DL7A 4G3IA 1NI3A 3TKAA 4DQSA 3MGHA 4G9BA 5EE0A 1L8LA 2J6SA 1SKSA 1LKYB 1Q46A 5AM1A 4TQRA 4YR3A 5KG7A 2QKQA 5KFTA 4KLUA 2V9WA 1SXEA 3G6YA 4GIBA 4UB5A 5ALRA 2KIVA 2F1HA 3MDCA 3ORYA 2XO7A 4UB3A 1UA1A 3RR7A 1NK7A 5KFPA 5KTQA 5J0SA 2BCQA 1QQ7A 3TADA 3SV4A 2ESEA 1QQ5A 1X9MA 4ELTA 5DB6A 1N62A 3HKZC 5AK6A 2BDPA 1ZRMA 2KSOB 2LYHA 4ECTA 3C2MA 3NRZA 4HYKA 1Z19A 4EYHB 5ALGA 4A8EA 5AK3A 1ZD3A 4UBBA 5ALEA 3SQIA 5ALFA 4ED0A 8ICTA 4M9HA 5KG6A 4KLHA 2ZXHA 2Y9TA 2YMLA 1A6SA 5DG9A 4FFDA 4EZ6A 2CN1A 5CA7A 4EEYA 3M8SA 5KFRA 3OTQA 4IQVA 4UB6U 4PHDA 5DLFA 1X6IA 2I1QA 3ZI4A 4CCHA 4ED3A 2C22A 3RJKA 1URJA 4J9KA 1BPDA 4EBDA 3WKBA 2NRXA 5G5HA 1NK0A 2H3QA 3MBYA 1T8EA 1KW4A 1U47A 4DL3A 2HHVA 4QJFB 4IRDA 4NLKA 4BWJA 7ICKA 1TK8A 1U9LA 4UARA 3JPSA 2KG5A 5KG1A 8ICWA 5EWEA 4YCXA 5DBCA 3C28A 3BDPA 1L7OA 2JV3A 4IQUA 2NYVA 4J9RA 3SZ2A 2KNJA 5J0UA 2G07A 2YB4A 3EWAA 3C29A 4CF5A 4OJLA 5CWRA 1XO0A 3D2NA 1A0PA 4KLTA 2DQNB 4B9UA 2KHVA 5KFXA 1NJXA 1RPLA 5EE9A 5AICA 2Y1JA 1TAQA 2OHFA 4QZHA 2JEIA 4I2CA 2HHWA 5ALHA 4YXJA 2W11A 3IG5A 4YR2A 1KTQA 2DWQA 2R8JA 3UMGA 4CF3A 2P6UA 3ICXA 4YP3A 2HHSA 4R8UA 3IV6A 4UAZA 3IRUA 4P2HA 5KFYA 1HEKA 3HRDD 5ALTA 5ALJA 4UATA 4F3OA 1UT8A 1VLBA 3IDWA 2VJ5A 2PXIA 3GIKA 2HOIA 1B22A 8ICEA 2B21A 5L1JA 7ICTA 3GIIA 9ICCA 1KKXA 3NVVA 5KT4A 2WF6A 1JUDA 1ZQFA 2MA1A 3QE9Y 3RJJA 4R8UB 4J9QA 2FLLA 4O3SA 1WWUA 2O6KA 3HT3A 3A0HU 3RB3A 2WHEA 3FYHA 2K8BB 4NLGA 4I2EA 3OSNA 2ISPA 1KEJA 4O3PA 1ZD5A 2EANA 3IG8A 4JB3A 1IV8A 4KLOA 4F5RA 2VA3A 4DSFA 3IP4B 5ALNA 1NK8A 4B9VA 4IRKA 2V4QA 4DSKA 1QTMA 5D4BA 4UAUA 1N56A 2D6FC 4F5OA 5KFFA 5AIAA 3SR6A 1SL1A 2GH1A 5J2AA 1V85A 3AN1A 3M6KA 2WAQC 3N7SC 3D6JA 5ALPA 5JUMA 2OYYA 4M9JA 9ICKA 1RXVA 5A0LA 3MR2A 2EH9A 4XQ8A 3H7IA 4ELVA 4P0PA 2K4PA 1ZQKA 4FBUA 3MR6A 4YD1A 4KLSA 2BZFA 5KFAA 1PUZA 4C4RA 7ICRA 1N2XA 2KZ3A 1TAMA 4LJXA 4DOAA 4ECVA 1ZQQA 4LZGA 2C2DA 3AU2A 3GIJA 2VA8A 3F2DA 4UW9A 4EZ9A 3C1YA 8ICGA 5L1IA 4Z6CA 3V6HA 1L3SA 4MHVA 1NZPA 4PL1A 1TAUA 4KX3A 1JMSA 5KFVA 1KFDA 2JR5A 8ICLA 1X9SA 1PVPA 3Q8RB 4IC9A 1F0MA 3I28A 1S0MA 3QZ8A 3B0YA 4YMNA 4RQ5A 3GQCA 9ICFA 3NVWA 5GTHU 3GILA 2LPEA 4RQ0A 2ZIXB 2CRXA 4I2DA 2F1JA 2HBKA 3QX7A 8ICIA 5TISU 1X9XA 2IHNA 1ZQAA 5J8YC 3PX4A 4RNNA 4YN4A 4IR1A 2D3DA 3WKDA 1BPBA 1NK9A 2W9MA 4O3MA 2PFQA 3E2EA 1RYRA 2KVSA 4C8MA 3IHQB 4U7CA 1ZQRA 3H8WA 4CNQA 3KKAA 4KMOB 3PMLA 1D8YA 2PI5A 2JH1A 4O5EA 3QYPA 4YD2A 3T5JA 5AKXA 2CPRA 4YR0A 4KN7A 3BQ7A 4IS7A 2BPGA 5BPCA 5KFDA 5ALVA 8ICPA 1S10A 4MEYA 1XO1A 4EYIB 1Z00A 2DBYA 2EZYA 3TQ1A 2JRZA 4PPXA 1MC8A 4DQQA 3CP8A 2BR0A 4P0PB 5ALUA 1N63A 3ISCA 1LVHA 4RQ8A 3UM9A 2RLTA 4MF2A 3TACB 2HHQA 1RXWA 4Y2XA 5D46A 5EE1A 5KT3A 2QARB 4PJ0U 5DB7A 1RYUA 2HBMA 9ICTA 4JMUA 4J03A 2EZXA 5DG7A 5J29A 3LWMA 4HAIA 3RRGA 2HI0A 1ZQGA 3MGIA 3PW4A 1DGJA 3K4GA 5DDYA 2BQRA 5KFGA 1ZQ1C 2MU2A 4FE3A 5HP4A 4NL9C 3OSPA 4FBTA 5B66U 3K1RB 2HOFA 3ZDAA 5B5EU 4KTQA 2ZIWB 5KG3A 3DV9A 2LM1A 3GU3A 3EPIA 1BPZA 2NRTA 3C1ZA 3RFAA 5DKWA 4Y2PA 4DFDA 2GO7A 4Y2UA 1S77D 3FC4A 4DL2A 7ICUA 1QSYA 3WK5A 1L3TA 5AKZA 1U49A 1LV5A 2Y0SF 4C4SA 3QEBZ 1AQ6A 2KV2A 3SYZA 2HHTA 4DQRA 5CJ7A 4NWIA 2W8LA 2ZIVB 4I2FA 2LBOA 2MUTA 2ZG6A 3H4DA 3PX6A 4F93B 4C8OA 2KZMA 3BS5A 5KAFU 4UBCA 1S76D 3KD3A 2FDRA 3PR5B 3RBDA 4OJ6A 2KHQA 3E0FA 2C2RA 4KLEA 7ICPA 1YZ6A 3ZDDA 3JPQA 8ICQA 2DL0A 2KMDA 1CUKA 4F72A 2G06A 1DRGA 9ICUA 2ASJA 4DFKA 3WK7A 1COKA 4DS4A 3HPOA 4RT2A 1ZOLA 3LVVA 1ZQMA 1BNOA 3OJUA 3BZKA 2KN7A 1B4FA 4J9OA 3H8MA 4ED1A 2KJ8A 5AKGA 2JMGA 5ALLA 4LZDA 1YT3A 3WKCA 4PH5A 4ACOA 4Y2QA 3ISBA 1UCVA 1RYSA 1UT5A 3C2LA 4WJ3B 4RQ4A 4EENA 3PVXA 2Y1IA 4CDGA 5CEHA 1PVQA 2ZIXA 5J0XA 2OEHA 1TK0A 2OWOA 4PZOA 3H40A 4DCCA 2A3VA 5AM4A 4NM2A 3ZDEA 3T5LA 3PY8A 1ZD2P 3H0MB 4Q43A 3AM9A 1MN8A 4FS1A 3SD7A 3N97B 3AQFA 5KAIU 5AK4A 9ICBA 2W7PA 2BPCA 3KHLA 1BPXA 9ICWA 2KKPA 3HJEA 3MDAA 5KL8B 3GV8B 1COOA 1F5SA 4OJOA 1VJ5A 2XCPA 4J9SA 1ZQSA 3V7KA 2YQEA 2H3ZA 3S6JA 4Z6FA 4JV0A 4IL6U 2ES6A 4RQMA 4O3QA 3KTQA 5AM3A 3SAFA 4O5KA 3BS5B 5HHIA 3B9JA 2RDJA 1T7PA 3UMBA 4I27A 3GV7B 8ICJA 1MA7A 2HVHA 3HP6A 1JIHA 4UB1A 9ICRA 4J9LA 4F2SA 1X42A 4RZRA 1ZXIA 5IIKA 1B43A 5ALOA 4UQGA 2HCFA 3Q8QB 1TKDA 4PHEA 4LVSA 3NS1A 5CB1A 4E0DA 5DQGA 5HR6A 4Y2YA 4K4HA 4M9LA 2KP7A 5EOZA 5J2FA 1F44A 4NY8A 5KNIA 2E8OA 3TI0A 3GIMA 3QUCA 2PFPA 1SV0A 2LM4A 5AI0A 3Q8KA 3B0XA 4ECZA 2KFNA 3RJFA 7ICFA 1A77A 3ALRA 1U4BA 5KFIA 7ICVA 1ZQYA 4ECRA 3RTVA 5KFSA 2P66A 4RNMA 3RH5A 1SV0C 5AI8A 2NO4A 3NGDA 1J2NA 5KG5A 5TZVA 2P35A 3ONNA 3F5AA 2YMMA 3H0LB 2HOQA 5F9NA 4KLLA 1D8BA 4Q44A 1O08A 1ZJMA 2AU0A 4J9NA 2RDIA 3DEEA 2G5IB 2E8MA 2RP5A 4DS5A 3TADC 4UB4A 1S97A 1BPEA 2I6XA 4O3OA 4EX6A 3IM1A 2W04A 2ZTCA 5KFUA 5J0OA 4ED6A 4ZH4A 4F5PA 3M9OB 3EZ5A 2PFOA 5HNKA 2E1FA 1T3NA 4QIWC 1XSPA 4AP9A 4K4IA 4M47A 5CR0A 4EX7A 1PK1B 3N28A 2GWSA 1ED1A 9ICGA 2UVVA 3BZCA 1DGSA 5ALXA 2ZIUA 1S8OA 9ICPA 5J0YA 2AQ0A 5KG4A 3Q8MA 2DKZA 1Z4NA 4QWCA 1Y88A 1SL2A 5KG0A 5J8YA 2KJ9A 2YN4A 2Z7JA 5DG8A 4U6PA 2ODGA 5IILA 2OXOA 1WWVA 4OD0A 2FPLA 8ICAA 1FFVA 2W9CB 2GLEA 4F5NA 4KLDA 3BQ0A 4QZGA 1ZQDA 2WF7A 2JEJA 2A1JB 2JHDA 1ZQOA 2HW3A 4TURA 2H3VA 4PGXA 3JPPA 2H3IA 4DSEA 1ZQNA 5D49A 3TANA 4M2YA 2FE9A 2HVIA 5AKYA 3CRXA 4QW9A 4M9NA 5AK5A 1NK6A 9ICOA 4NLBA 5AM2A 3V72A 4C8NA 3HKZF 1NZBA 2BGWA 5DB9A 3C2KA 3KOOA 2ZJ5A 3L3FX 8ICOA 1L7NA 2W8KA 4KLJA 1S9FA 1GO3F 1QLNA 4UB2A 2C28A 4PHAA 3WKEA 4DQIA 4C80A 5KFJA 3F53A 1NK5A 4O9MA 2G08A 2RRDA 2W03A 3NVZA 3NASA 1PK3A 3AQEA 2W43A 1WG8A 3U26A 3ZDBA 8ICHA 2IA6A 4OO1J 4KX5A 3MC1A 3T3FA 4IQWA 1ZQVA 4QZFA 4DL6A 3PO5A 2XCAA 1S5LU 9ICVA 4RT3A 4NXZA 3UXOA 3Q8LA 3WKAA 3QEAZ 1NKBA 5AI4A 3EW9A 1RQLA 5KFCA 4YQWA 4KMUA 4R63A 4QW8A 3M6ZA 4F4KA 5J0PA 4DSLA 4QNLA 3V7JA 3ED5A 2KEYA 5KT5A 2EDUA 9ICIA 3RAQA 2ISOA 3LDAA 3JPNA 3SI8A 2ZUBA 4OCZA 3TAQA 2NRWA 4X5VA 3ETRA 2F44A 4RPXA 5J0WA 2ASLA 2LMRA
chains in the Genus database with same CATH topology
1RG6A 2KSOB 5F3XB 1X40A 2EAPA 3KKAA 1SGGA 3SEIA 2Y9UA 1SV0C 2K4PA 2Y9TA 3BQ7A 4IS7A 4RQNA 5JU5A 2F3NA 2QB1A 1SXDA 3BS5A 5JTIA 3IDWA 2QARA 4NJ8A 2E8MA 2KSOA 3TADC 4PZNA 2ES6A 3KKAC 4RQMA 3TACB 1PK3A 2DL0A 2KMDA 4NL9A 2E8PA 1DXSA 3BS5B 2QARB 1B0XA 1KW4A 1COKA 4MHVA 1PK1A 2QB0B 1V38A 1WWUA 1B4FA 1PK1B 2QB0A 3H8MA 1X66A 1Z1VA 2KG5A 2F8KA 1F0MA 5JRTA 2EAMA 2L5YA 2KE7A 1LKYB 2DKZA 1UQVA 2JV3A 5J8YA 1UCVA 2YTUA 2QKQA 2EANA 3BS7A 2B6GA 4NL9C 1JI7A 1SXEA 1SV4A 2LPEA 2KIVA 2D8CA 2DKXA 3K1RB 1WWVA 1OXJA 3HILA 2GLEA 2K60A 1X9XA 5J8YC 5KNIA 4PZOA 2E8OA 5L1MA 3TADA 2EAOA 2ESEA 1OW5A 2D3DA 1SV0A 2E8NA 1LKYA 3SENA 1V85A 2F44A 2FE9A 2LMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RG6 A;  2KSO B;  5F3X B;  1X40 A;  2EAP A;  3KKA A;  1SGG A;  3SEI A;  2Y9U A;  1SV0 C;  2K4P A;  2Y9T A;  3BQ7 A;  4IS7 A;  4RQN A;  5JU5 A;  2F3N A;  2QB1 A;  1SXD A;  3BS5 A;  5JTI A;  3IDW A;  2QAR A;  4NJ8 A;  2E8M A;  2KSO A;  3TAD C;  4PZN A;  2ES6 A;  3KKA C;  4RQM A;  3TAC B;  1PK3 A;  2DL0 A;  2KMD A;  4NL9 A;  2E8P A;  1DXS A;  3BS5 B;  2QAR B;  1B0X A;  1KW4 A;  1COK A;  4MHV A;  1PK1 A;  2QB0 B;  1V38 A;  1WWU A;  1B4F A;  1PK1 B;  2QB0 A;  3H8M A;  1X66 A;  1Z1V A;  2KG5 A;  2F8K A;  1F0M A;  5JRT A;  2EAM A;  2L5Y A;  2KE7 A;  1LKY B;  2DKZ A;  1UQV A;  2JV3 A;  5J8Y A;  1UCV A;  2YTU A;  2QKQ A;  2EAN A;  3BS7 A;  2B6G A;  4NL9 C;  1JI7 A;  1SXE A;  1SV4 A;  2LPE A;  2KIV A;  2D8C A;  2DKX A;  3K1R B;  1WWV A;  1OXJ A;  3HIL A;  2GLE A;  2K60 A;  1X9X A;  5J8Y C;  5KNI A;  4PZO A;  2E8O A;  5L1M A;  3TAD A;  2EAO A;  2ESE A;  1OW5 A;  2D3D A;  1SV0 A;  2E8N A;  1LKY A;  3SEN A;  1V85 A;  2F44 A;  2FE9 A;  2LMR A; 
#chains in the Genus database with same CATH topology
 2W7O A;  4I2J A;  5III A;  4KIT B;  2LHT A;  5FP0 A;  3SEI A;  4DEZ A;  1FEZ A;  2IOF A;  4QZI A;  2YX8 A;  5C5J A;  9ICH A;  2DGZ A;  2VIX A;  4RQN A;  4P0Q A;  1RZT A;  3QXG A;  5DGB A;  3PW5 A;  3WK4 A;  2FI1 A;  5KG2 A;  3LVW A;  3RB0 A;  2K8C B;  2Y0S C;  1Q3V A;  5AKH A;  5KFQ A;  2K4H A;  2KSO A;  4ECY A;  1ZQX A;  4DO9 A;  3R9K A;  2WB1 F;  2XY6 A;  2PKE A;  3KKA C;  4QWD A;  5KFK A;  1PVR A;  2WFA A;  5L1K A;  5AIB A;  4RUA A;  3Q8P B;  3SAG A;  2E8P A;  8ICM A;  3KHH A;  4KLI A;  9ICJ A;  1JXE A;  5KFO A;  4KLG A;  3MFI A;  1ZRN A;  2KOB A;  2QB0 B;  2K4E A;  2PMZ C;  5KFZ A;  1BVS A;  1L8O A;  4XRH A;  2QB0 A;  3QU7 A;  4RQ7 A;  3LWL A;  2FPK A;  1S0V A;  3BQ2 A;  2W3S A;  8ICF A;  3MAB A;  4P4P A;  4TUS A;  5JRT A;  1TV9 A;  2EAM A;  3KHR A;  1UQV A;  4YG2 A;  5AI5 A;  4ICA A;  3K75 D;  2BPF A;  1MSW D;  3HIL A;  1DK2 A;  3QNM A;  4DFJ A;  1SL0 A;  1J2M A;  4M6W A;  2B0C A;  3RJG A;  2ZJ8 A;  2UVR A;  2VKQ A;  4RQ3 A;  4EBE A;  3RBE A;  3JPR A;  5ALW A;  3C23 A;  4B9M A;  1V97 A;  1CRX A;  4YMM A;  1TK5 A;  3L4P A;  2R8I A;  3RAX A;  4F92 B;  1ZQL A;  5KFE A;  5IIO A;  2IHM A;  2EAP A;  5IIM A;  3L5K A;  1SGG A;  3QU2 A;  4US9 A;  1Z1B A;  2BCR A;  4DSJ A;  4JV2 A;  1UA0 A;  2EQY A;  2HBJ A;  3DDH A;  1FO4 A;  1ECW A;  1Z3E B;  3D2Q A;  3M9M B;  4PHP A;  2R8G A;  4IRC A;  8ICC A;  1L3V A;  3NVY A;  2ZTD A;  4B6J A;  4I2G A;  4QIW F;  2NRZ A;  2IMW P;  2IBK A;  4O5C A;  1KLN A;  1MQ3 A;  3ZD9 A;  4F5Q A;  5GTI U;  2DPI A;  3F2C A;  1WCL A;  3GZF A;  5AKJ A;  1C20 A;  3RJI A;  1S0N A;  4AYB C;  4B9T A;  3KZX A;  8ICB A;  2K4I A;  5J0T A;  2BCS A;  4I28 A;  5J2J A;  4QZ8 A;  2C2E A;  3AU6 A;  2PFN A;  4NM1 A;  2FJ6 A;  2KE7 A;  2PI4 A;  3PW7 A;  3TFS A;  4ECW A;  2V4R A;  2DF4 B;  3IN5 A;  4C4T A;  4RQ6 A;  1DK3 A;  1WYG A;  3PSF A;  4MF8 A;  7ICS A;  2W9A A;  5DQI A;  1KFT A;  3WK6 A;  3TAR A;  1ZQE A;  3OHA A;  2K60 A;  5CP2 A;  4ED2 A;  4BWM A;  1ZQP A;  4I2A A;  1ZQI A;  1MQ2 A;  4BUG A;  4YFK A;  3KZI U;  2XY5 A;  2ZIU B;  2W9B A;  4RQ2 A;  1EXN A;  1FFU A;  5AM0 A;  5IIJ A;  1JAL A;  2ZTE A;  7ICG A;  3PO4 A;  2YB1 A;  3SAH A;  8ICU A;  1QH9 A;  3NTU A;  3H4B A;  5DB8 A;  1BPY A;  2MSN A;  4CE6 A;  3RRH A;  5G5G A;  3WK9 A;  3PW0 A;  2XC9 A;  4M04 A;  1HJP A;  2MRL A;  3G6X A;  1VDV A;  4XA5 A;  2A19 A;  3M9N B;  3RH6 A;  2R8K A;  4GXI A;  2E5S A;  3F2B A;  3H0R B;  2ZXI A;  4BXO A;  9ICA A;  4F4Y A;  2F3N A;  1RQN A;  3N7R C;  1LB2 B;  3GDX A;  2ZIW A;  1ZET A;  1SIJ A;  2QAR A;  1ZQJ A;  1JX4 A;  2BCU A;  4KLF A;  1QCK A;  5DBB A;  2JH7 A;  1IG6 A;  2XVT A;  2KFZ A;  1XC9 A;  2AGQ A;  1T94 A;  3V7L A;  8ICR A;  2WF5 A;  1IIP A;  1DXS A;  3OPX A;  4NLZ A;  4P4O A;  1O03 A;  1N5X A;  1ZQH A;  4I2B A;  3PSP A;  1PK1 A;  4MFC A;  4YMO A;  3CNH A;  3PR4 A;  5AM5 A;  3MFH A;  4Z6D A;  1K5O A;  3FDS A;  5KFM A;  4JV1 A;  1SWW A;  4QZC A;  1JRP A;  2DPJ A;  2J6T A;  3RF9 A;  4KLM A;  1L3U A;  4JWM A;  3QZ7 A;  3M1Y A;  1BNP A;  3UQ2 A;  1V9P A;  1CI4 A;  1WUD A;  7ICQ A;  4USA A;  5J0Q A;  2WTF A;  3H8S A;  5J2C A;  3T79 A;  2AJQ A;  4RUC A;  4K4G A;  4C7Y A;  2ZUD A;  3PMN A;  4DL5 A;  2BQ3 A;  2DKX A;  1NKC A;  4ELU A;  3QU4 A;  4J9M A;  1SWV A;  3QUQ A;  2G5H B;  4CRX A;  7ICN A;  2HBL A;  3M8R A;  1ZQZ A;  2RQ5 A;  5L1M A;  1L5U A;  5EWG A;  8ICV A;  2EAO A;  2IOH A;  1ARO P;  1D8L A;  4EBC A;  3GV5 B;  2ZIV A;  1SZP A;  1X40 A;  2XI9 A;  4UB8 U;  2K8A A;  4DF4 A;  2FMQ A;  3QUT A;  9ICL A;  4R65 A;  4F50 A;  3JPO A;  3EPG A;  1C7Y A;  4JK1 A;  3VC8 A;  2ZUC A;  3ZD8 A;  4QWA A;  1XU4 A;  3VCB A;  1CEZ A;  5J2B A;  1NNL A;  2E3T A;  3ETL A;  4MFF A;  2XGP A;  1KSP A;  3HWT A;  5KL1 B;  8ICZ A;  1QSS A;  4RQ1 A;  3THV A;  4GC6 A;  8ICN A;  1X6J A;  1XNS A;  3QU5 A;  3EUB 2;  2FPM A;  4DOB A;  5AHX A;  4BXO B;  2F2A B;  2HHX A;  9ICN A;  3RJH A;  1N60 A;  4DFP A;  5HHH A;  1J97 A;  4Y2J A;  2FMS A;  2JZB B;  4JUZ A;  4UAW A;  4F4X A;  2UVU A;  1U48 A;  2W9C A;  2JGA A;  4QZD A;  5HML A;  4RPZ A;  3BQT A;  3HW8 A;  1SZH A;  4Y2T A;  4NLN A;  2WAQ F;  2XY7 A;  4EEL A;  2KIW A;  4PL2 A;  2B6G A;  1SV4 A;  2LYB A;  3MR3 A;  4O3N A;  1ZYQ A;  7ICI A;  4R64 A;  1Q3U A;  4RNO A;  3UXP A;  2PMZ F;  3E58 A;  1ZQC A;  3D2S A;  1XWL A;  5KT2 A;  4XUS A;  1OW5 A;  1K1Q A;  9ICS A;  1TE2 A;  5HMM A;  4ED7 A;  5DGA A;  4NV0 A;  5KFH A;  4FZM A;  4DLG A;  2W54 A;  4RU9 A;  4F4W A;  4B9L A;  5KFW A;  4GXJ A;  3RB6 A;  4Q8E A;  2AHO B;  4ECS A;  4P4M A;  4PGQ A;  1L6N A;  2Y9U A;  2KJ5 A;  5K4L A;  5IIN A;  1RM6 C;  4UAV A;  2XIC A;  1YZ7 A;  1NJW A;  4QZA A;  2VAN A;  5JTI A;  1XS9 D;  1S0O A;  5ALS A;  3OJS A;  3QU9 A;  4AYB F;  3UQ0 A;  4BGD A;  4BX9 C;  2QLT A;  2NV3 A;  4DWI A;  4DSI A;  3UXN A;  4GLX A;  3QUB A;  1KL9 A;  2ZJA A;  5L9X A;  4Q45 A;  3T5K A;  1XSL A;  1HUZ A;  9ICE A;  3MGV A;  2IOF K;  3WK8 A;  3O0F A;  2RHF A;  4DFM A;  2KZZ A;  7ICH A;  2FMP A;  1B0X A;  5AKE A;  4IQT A;  3CW2 C;  4F91 B;  2KIC A;  3T5H A;  4ECQ A;  8ICY A;  2F77 X;  3JPT A;  5J2K A;  3G6V A;  1SKW A;  2OM6 A;  3LK9 A;  4R66 A;  1HUO A;  2WF8 A;  2HMX A;  2FLP A;  4C0Z A;  3V6J A;  2F8K A;  4Y2V A;  2AXT U;  2OCE A;  3J81 j;  3PX0 A;  4Q8F A;  4FZL A;  3BS7 A;  1ZJN A;  9ICM A;  2W55 A;  4M6W B;  4PGY A;  5J2I A;  1HIW A;  2AQ4 A;  4KLQ A;  2LKY A;  3AEV A;  2YY6 A;  2KTQ A;  1OUQ A;  2BCV A;  2DUY A;  4EEK A;  3NRW A;  2MUT B;  3SMV A;  4QZB A;  4NLC A;  4O3R A;  4F8R A;  4YVZ A;  1ZQW A;  2I5H A;  5CHG A;  5EE3 A;  4FO6 A;  3UPQ A;  3RB4 A;  1N61 A;  2UVW A;  2M0N A;  1A76 A;  2BQU A;  4B9N A;  4FZN A;  4FS2 A;  2J6U A;  2YMP A;  3M7D A;  2E1E A;  4ECX A;  2W9B B;  4C8L A;  2LYA A;  4CF4 A;  1KBU A;  2XID A;  3HX0 A;  2JXJ A;  2FLN A;  4Z6E A;  1P7D A;  2N1R A;  5BOL A;  3C21 A;  1QQ6 A;  8ICK A;  4Y2S A;  2M9N A;  4NJ8 A;  1IXR A;  1JRO A;  3AL0 B;  1ZQB A;  4F4Z A;  4DLE A;  2P6R A;  1DOQ A;  1UPH A;  1N48 A;  1KRP A;  3KFU F;  1M6Y A;  3C5F A;  2H3F A;  3SV3 A;  4BJQ A;  2ALZ A;  4GC7 A;  3A0B U;  5HR7 A;  1TVA A;  2NRV A;  2G0A A;  2KKV A;  4BDP A;  5AI9 A;  5ALZ A;  2MAX A;  1L7M A;  2VJ4 A;  4M9G A;  4QWE A;  2EZZ A;  4I29 A;  2L5Y A;  1X2I A;  7ICJ A;  3KHG A;  3N7P D;  3PV8 A;  4JWN A;  3F5E A;  2YTU A;  5E79 U;  2KVC A;  2ASD A;  1JI7 A;  3WU2 U;  1NJZ A;  1JN3 A;  1UHU A;  2D8C A;  1OXJ A;  3EYZ A;  1FIQ A;  5KFN A;  5J2E A;  3TFR A;  8ICX A;  1RDF A;  4YXM A;  1JXL A;  4Y2R A;  2KK0 A;  2G09 A;  3TAP A;  9ICQ A;  1PZN A;  2F76 X;  5C0Y A;  2JEG A;  2F1I A;  4J9P A;  4ECU A;  9ICX A;  3UMC A;  5F9L A;  1ZQT A;  1KFS A;  2E8N A;  1U45 A;  1QSL A;  1N5W A;  3FAH A;  3KBB A;  4DQP A;  3FM9 A;  5F3X B;  2AGP A;  4GFJ A;  3I1Y A;  4OJP A;  2CXY A;  1H38 A;  3PST A;  4M0A A;  4MFA A;  2GOL A;  2AH5 A;  5DBA A;  2WB1 C;  5AKK A;  3AUO A;  5JU5 A;  2DFL A;  4UAY A;  4F71 A;  2F8L A;  4UAS A;  2HDO A;  3BQ1 A;  4C8K A;  1BGX T;  2QB1 A;  4ZOH C;  4DF8 A;  4QWB A;  7ICO A;  2BHN A;  2BKE A;  3GFK B;  3BJY A;  2LI6 A;  1Q8K A;  4PZN A;  1L7P A;  3CYM A;  3ZDC A;  4B9S A;  1KQQ A;  5J2G A;  3C5G A;  3PNC A;  2YMQ A;  2A1J A;  3OHB A;  2AGO A;  4DOC A;  1K1S A;  5ALY A;  4TUP A;  5EWF A;  3H8J A;  1V38 A;  5KFB A;  3OGU A;  4QZ9 A;  5L1L A;  4TQS A;  5KFL A;  1NK4 A;  4GXK A;  3AMZ A;  4KN4 A;  1X66 A;  1Z1V A;  5AKI A;  1IM4 A;  7ICM A;  1T3Q A;  1X9W A;  2HSZ A;  5AI6 A;  5KT6 A;  2A1A A;  5ALM A;  4I2H A;  5DLG A;  5DDM A;  4C7Z A;  3K1Z A;  2JZB A;  1D9D A;  3LYS A;  5ALD A;  1WCN A;  1NOM A;  1T4G A;  1KDH A;  7ICE A;  1KN5 A;  5T14 A;  2KD1 A;  5BOM A;  2R8H A;  1SB3 C;  3MR5 A;  4CGZ A;  1D9F A;  2XGQ A;  3I76 A;  4OJ5 A;  4RPY A;  2W3R A;  5J0R A;  1LKY A;  3SEN A;  7ICL A;  1SKR A;  3RJE A;  3ISD A;  1RG6 A;  4TUQ A;  2VA2 A;  4IR9 A;  2OH2 A;  4MEX A;  1TFR A;  5CRX A;  4DL4 A;  2NO5 A;  2H5X A;  2Q4T A;  4I2I A;  1NJY A;  2WF9 A;  1Z00 B;  3PW2 A;  3PSI A;  4O0I A;  2Q0Z X;  5J2D A;  4QZE A;  1SXD A;  1XSN A;  5ALK A;  4ED8 A;  3N4M B;  1NKE A;  5AKL A;  3PZP A;  5KT7 A;  2I9G A;  5J2H A;  5ALQ A;  2R18 A;  3RH4 A;  2BDU A;  4P0Q B;  3NUQ A;  2HHU A;  2ATL A;  5ALI A;  4NL9 A;  4F2R A;  3Q8S B;  1ZQU A;  3RR8 A;  1Z4O A;  2JEF A;  5DQH A;  3V6K A;  8ICS A;  4US8 A;  5H2F U;  1ZD4 A;  2K89 A;  4DL7 A;  4G3I A;  1NI3 A;  3TKA A;  4DQS A;  3MGH A;  4G9B A;  5EE0 A;  1L8L A;  2J6S A;  1SKS A;  1LKY B;  1Q46 A;  5AM1 A;  4TQR A;  4YR3 A;  5KG7 A;  2QKQ A;  5KFT A;  4KLU A;  2V9W A;  1SXE A;  3G6Y A;  4GIB A;  4UB5 A;  5ALR A;  2KIV A;  2F1H A;  3MDC A;  3ORY A;  2XO7 A;  4UB3 A;  1UA1 A;  3RR7 A;  1NK7 A;  5KFP A;  5KTQ A;  5J0S A;  2BCQ A;  1QQ7 A;  3TAD A;  3SV4 A;  2ESE A;  1QQ5 A;  1X9M A;  4ELT A;  5DB6 A;  1N62 A;  3HKZ C;  5AK6 A;  2BDP A;  1ZRM A;  2KSO B;  2LYH A;  4ECT A;  3C2M A;  3NRZ A;  4HYK A;  1Z19 A;  4EYH B;  5ALG A;  4A8E A;  5AK3 A;  1ZD3 A;  4UBB A;  5ALE A;  3SQI A;  5ALF A;  4ED0 A;  8ICT A;  4M9H A;  5KG6 A;  4KLH A;  2ZXH A;  2Y9T A;  2YML A;  1A6S A;  5DG9 A;  4FFD A;  4EZ6 A;  2CN1 A;  5CA7 A;  4EEY A;  3M8S A;  5KFR A;  3OTQ A;  4IQV A;  4UB6 U;  4PHD A;  5DLF A;  1X6I A;  2I1Q A;  3ZI4 A;  4CCH A;  4ED3 A;  2C22 A;  3RJK A;  1URJ A;  4J9K A;  1BPD A;  4EBD A;  3WKB A;  2NRX A;  5G5H A;  1NK0 A;  2H3Q A;  3MBY A;  1T8E A;  1KW4 A;  1U47 A;  4DL3 A;  2HHV A;  4QJF B;  4IRD A;  4NLK A;  4BWJ A;  7ICK A;  1TK8 A;  1U9L A;  4UAR A;  3JPS A;  2KG5 A;  5KG1 A;  8ICW A;  5EWE A;  4YCX A;  5DBC A;  3C28 A;  3BDP A;  1L7O A;  2JV3 A;  4IQU A;  2NYV A;  4J9R A;  3SZ2 A;  2KNJ A;  5J0U A;  2G07 A;  2YB4 A;  3EWA A;  3C29 A;  4CF5 A;  4OJL A;  5CWR A;  1XO0 A;  3D2N A;  1A0P A;  4KLT A;  2DQN B;  4B9U A;  2KHV A;  5KFX A;  1NJX A;  1RPL A;  5EE9 A;  5AIC A;  2Y1J A;  1TAQ A;  2OHF A;  4QZH A;  2JEI A;  4I2C A;  2HHW A;  5ALH A;  4YXJ A;  2W11 A;  3IG5 A;  4YR2 A;  1KTQ A;  2DWQ A;  2R8J A;  3UMG A;  4CF3 A;  2P6U A;  3ICX A;  4YP3 A;  2HHS A;  4R8U A;  3IV6 A;  4UAZ A;  3IRU A;  4P2H A;  5KFY A;  1HEK A;  3HRD D;  5ALT A;  5ALJ A;  4UAT A;  4F3O A;  1UT8 A;  1VLB A;  3IDW A;  2VJ5 A;  2PXI A;  3GIK A;  2HOI A;  1B22 A;  8ICE A;  2B21 A;  5L1J A;  7ICT A;  3GII A;  9ICC A;  1KKX A;  3NVV A;  5KT4 A;  2WF6 A;  1JUD A;  1ZQF A;  2MA1 A;  3QE9 Y;  3RJJ A;  4R8U B;  4J9Q A;  2FLL A;  4O3S A;  1WWU A;  2O6K A;  3HT3 A;  3A0H U;  3RB3 A;  2WHE A;  3FYH A;  2K8B B;  4NLG A;  4I2E A;  3OSN A;  2ISP A;  1KEJ A;  4O3P A;  1ZD5 A;  2EAN A;  3IG8 A;  4JB3 A;  1IV8 A;  4KLO A;  4F5R A;  2VA3 A;  4DSF A;  3IP4 B;  5ALN A;  1NK8 A;  4B9V A;  4IRK A;  2V4Q A;  4DSK A;  1QTM A;  5D4B A;  4UAU A;  1N56 A;  2D6F C;  4F5O A;  5KFF A;  5AIA A;  3SR6 A;  1SL1 A;  2GH1 A;  5J2A A;  1V85 A;  3AN1 A;  3M6K A;  2WAQ C;  3N7S C;  3D6J A;  5ALP A;  5JUM A;  2OYY A;  4M9J A;  9ICK A;  1RXV A;  5A0L A;  3MR2 A;  2EH9 A;  4XQ8 A;  3H7I A;  4ELV A;  4P0P A;  2K4P A;  1ZQK A;  4FBU A;  3MR6 A;  4YD1 A;  4KLS A;  2BZF A;  5KFA A;  1PUZ A;  4C4R A;  7ICR A;  1N2X A;  2KZ3 A;  1TAM A;  4LJX A;  4DOA A;  4ECV A;  1ZQQ A;  4LZG A;  2C2D A;  3AU2 A;  3GIJ A;  2VA8 A;  3F2D A;  4UW9 A;  4EZ9 A;  3C1Y A;  8ICG A;  5L1I A;  4Z6C A;  3V6H A;  1L3S A;  4MHV A;  1NZP A;  4PL1 A;  1TAU A;  4KX3 A;  1JMS A;  5KFV A;  1KFD A;  2JR5 A;  8ICL A;  1X9S A;  1PVP A;  3Q8R B;  4IC9 A;  1F0M A;  3I28 A;  1S0M A;  3QZ8 A;  3B0Y A;  4YMN A;  4RQ5 A;  3GQC A;  9ICF A;  3NVW A;  5GTH U;  3GIL A;  2LPE A;  4RQ0 A;  2ZIX B;  2CRX A;  4I2D A;  2F1J A;  2HBK A;  3QX7 A;  8ICI A;  5TIS U;  1X9X A;  2IHN A;  1ZQA A;  5J8Y C;  3PX4 A;  4RNN A;  4YN4 A;  4IR1 A;  2D3D A;  3WKD A;  1BPB A;  1NK9 A;  2W9M A;  4O3M A;  2PFQ A;  3E2E A;  1RYR A;  2KVS A;  4C8M A;  3IHQ B;  4U7C A;  1ZQR A;  3H8W A;  4CNQ A;  3KKA A;  4KMO B;  3PML A;  1D8Y A;  2PI5 A;  2JH1 A;  4O5E A;  3QYP A;  4YD2 A;  3T5J A;  5AKX A;  2CPR A;  4YR0 A;  4KN7 A;  3BQ7 A;  4IS7 A;  2BPG A;  5BPC A;  5KFD A;  5ALV A;  8ICP A;  1S10 A;  4MEY A;  1XO1 A;  4EYI B;  1Z00 A;  2DBY A;  2EZY A;  3TQ1 A;  2JRZ A;  4PPX A;  1MC8 A;  4DQQ A;  3CP8 A;  2BR0 A;  4P0P B;  5ALU A;  1N63 A;  3ISC A;  1LVH A;  4RQ8 A;  3UM9 A;  2RLT A;  4MF2 A;  3TAC B;  2HHQ A;  1RXW A;  4Y2X A;  5D46 A;  5EE1 A;  5KT3 A;  2QAR B;  4PJ0 U;  5DB7 A;  1RYU A;  2HBM A;  9ICT A;  4JMU A;  4J03 A;  2EZX A;  5DG7 A;  5J29 A;  3LWM A;  4HAI A;  3RRG A;  2HI0 A;  1ZQG A;  3MGI A;  3PW4 A;  1DGJ A;  3K4G A;  5DDY A;  2BQR A;  5KFG A;  1ZQ1 C;  2MU2 A;  4FE3 A;  5HP4 A;  4NL9 C;  3OSP A;  4FBT A;  5B66 U;  3K1R B;  2HOF A;  3ZDA A;  5B5E U;  4KTQ A;  2ZIW B;  5KG3 A;  3DV9 A;  2LM1 A;  3GU3 A;  3EPI A;  1BPZ A;  2NRT A;  3C1Z A;  3RFA A;  5DKW A;  4Y2P A;  4DFD A;  2GO7 A;  4Y2U A;  1S77 D;  3FC4 A;  4DL2 A;  7ICU A;  1QSY A;  3WK5 A;  1L3T A;  5AKZ A;  1U49 A;  1LV5 A;  2Y0S F;  4C4S A;  3QEB Z;  1AQ6 A;  2KV2 A;  3SYZ A;  2HHT A;  4DQR A;  5CJ7 A;  4NWI A;  2W8L A;  2ZIV B;  4I2F A;  2LBO A;  2MUT A;  2ZG6 A;  3H4D A;  3PX6 A;  4F93 B;  4C8O A;  2KZM A;  3BS5 A;  5KAF U;  4UBC A;  1S76 D;  3KD3 A;  2FDR A;  3PR5 B;  3RBD A;  4OJ6 A;  2KHQ A;  3E0F A;  2C2R A;  4KLE A;  7ICP A;  1YZ6 A;  3ZDD A;  3JPQ A;  8ICQ A;  2DL0 A;  2KMD A;  1CUK A;  4F72 A;  2G06 A;  1DRG A;  9ICU A;  2ASJ A;  4DFK A;  3WK7 A;  1COK A;  4DS4 A;  3HPO A;  4RT2 A;  1ZOL A;  3LVV A;  1ZQM A;  1BNO A;  3OJU A;  3BZK A;  2KN7 A;  1B4F A;  4J9O A;  3H8M A;  4ED1 A;  2KJ8 A;  5AKG A;  2JMG A;  5ALL A;  4LZD A;  1YT3 A;  3WKC A;  4PH5 A;  4ACO A;  4Y2Q A;  3ISB A;  1UCV A;  1RYS A;  1UT5 A;  3C2L A;  4WJ3 B;  4RQ4 A;  4EEN A;  3PVX A;  2Y1I A;  4CDG A;  5CEH A;  1PVQ A;  2ZIX A;  5J0X A;  2OEH A;  1TK0 A;  2OWO A;  4PZO A;  3H40 A;  4DCC A;  2A3V A;  5AM4 A;  4NM2 A;  3ZDE A;  3T5L A;  3PY8 A;  1ZD2 P;  3H0M B;  4Q43 A;  3AM9 A;  1MN8 A;  4FS1 A;  3SD7 A;  3N97 B;  3AQF A;  5KAI U;  5AK4 A;  9ICB A;  2W7P A;  2BPC A;  3KHL A;  1BPX A;  9ICW A;  2KKP A;  3HJE A;  3MDA A;  5KL8 B;  3GV8 B;  1COO A;  1F5S A;  4OJO A;  1VJ5 A;  2XCP A;  4J9S A;  1ZQS A;  3V7K A;  2YQE A;  2H3Z A;  3S6J A;  4Z6F A;  4JV0 A;  4IL6 U;  2ES6 A;  4RQM A;  4O3Q A;  3KTQ A;  5AM3 A;  3SAF A;  4O5K A;  3BS5 B;  5HHI A;  3B9J A;  2RDJ A;  1T7P A;  3UMB A;  4I27 A;  3GV7 B;  8ICJ A;  1MA7 A;  2HVH A;  3HP6 A;  1JIH A;  4UB1 A;  9ICR A;  4J9L A;  4F2S A;  1X42 A;  4RZR A;  1ZXI A;  5IIK A;  1B43 A;  5ALO A;  4UQG A;  2HCF A;  3Q8Q B;  1TKD A;  4PHE A;  4LVS A;  3NS1 A;  5CB1 A;  4E0D A;  5DQG A;  5HR6 A;  4Y2Y A;  4K4H A;  4M9L A;  2KP7 A;  5EOZ A;  5J2F A;  1F44 A;  4NY8 A;  5KNI A;  2E8O A;  3TI0 A;  3GIM A;  3QUC A;  2PFP A;  1SV0 A;  2LM4 A;  5AI0 A;  3Q8K A;  3B0X A;  4ECZ A;  2KFN A;  3RJF A;  7ICF A;  1A77 A;  3ALR A;  1U4B A;  5KFI A;  7ICV A;  1ZQY A;  4ECR A;  3RTV A;  5KFS A;  2P66 A;  4RNM A;  3RH5 A;  1SV0 C;  5AI8 A;  2NO4 A;  3NGD A;  1J2N A;  5KG5 A;  5TZV A;  2P35 A;  3ONN A;  3F5A A;  2YMM A;  3H0L B;  2HOQ A;  5F9N A;  4KLL A;  1D8B A;  4Q44 A;  1O08 A;  1ZJM A;  2AU0 A;  4J9N A;  2RDI A;  3DEE A;  2G5I B;  2E8M A;  2RP5 A;  4DS5 A;  3TAD C;  4UB4 A;  1S97 A;  1BPE A;  2I6X A;  4O3O A;  4EX6 A;  3IM1 A;  2W04 A;  2ZTC A;  5KFU A;  5J0O A;  4ED6 A;  4ZH4 A;  4F5P A;  3M9O B;  3EZ5 A;  2PFO A;  5HNK A;  2E1F A;  1T3N A;  4QIW C;  1XSP A;  4AP9 A;  4K4I A;  4M47 A;  5CR0 A;  4EX7 A;  1PK1 B;  3N28 A;  2GWS A;  1ED1 A;  9ICG A;  2UVV A;  3BZC A;  1DGS A;  5ALX A;  2ZIU A;  1S8O A;  9ICP A;  5J0Y A;  2AQ0 A;  5KG4 A;  3Q8M A;  2DKZ A;  1Z4N A;  4QWC A;  1Y88 A;  1SL2 A;  5KG0 A;  5J8Y A;  2KJ9 A;  2YN4 A;  2Z7J A;  5DG8 A;  4U6P A;  2ODG A;  5IIL A;  2OXO A;  1WWV A;  4OD0 A;  2FPL A;  8ICA A;  1FFV A;  2W9C B;  2GLE A;  4F5N A;  4KLD A;  3BQ0 A;  4QZG A;  1ZQD A;  2WF7 A;  2JEJ A;  2A1J B;  2JHD A;  1ZQO A;  2HW3 A;  4TUR A;  2H3V A;  4PGX A;  3JPP A;  2H3I A;  4DSE A;  1ZQN A;  5D49 A;  3TAN A;  4M2Y A;  2FE9 A;  2HVI A;  5AKY A;  3CRX A;  4QW9 A;  4M9N A;  5AK5 A;  1NK6 A;  9ICO A;  4NLB A;  5AM2 A;  3V72 A;  4C8N A;  3HKZ F;  1NZB A;  2BGW A;  5DB9 A;  3C2K A;  3KOO A;  2ZJ5 A;  3L3F X;  8ICO A;  1L7N A;  2W8K A;  4KLJ A;  1S9F A;  1GO3 F;  1QLN A;  4UB2 A;  2C28 A;  4PHA A;  3WKE A;  4DQI A;  4C80 A;  5KFJ A;  3F53 A;  1NK5 A;  4O9M A;  2G08 A;  2RRD A;  2W03 A;  3NVZ A;  3NAS A;  1PK3 A;  3AQE A;  2W43 A;  1WG8 A;  3U26 A;  3ZDB A;  8ICH A;  2IA6 A;  4OO1 J;  4KX5 A;  3MC1 A;  3T3F A;  4IQW A;  1ZQV A;  4QZF A;  4DL6 A;  3PO5 A;  2XCA A;  1S5L U;  9ICV A;  4RT3 A;  4NXZ A;  3UXO A;  3Q8L A;  3WKA A;  3QEA Z;  1NKB A;  5AI4 A;  3EW9 A;  1RQL A;  5KFC A;  4YQW A;  4KMU A;  4R63 A;  4QW8 A;  3M6Z A;  4F4K A;  5J0P A;  4DSL A;  4QNL A;  3V7J A;  3ED5 A;  2KEY A;  5KT5 A;  2EDU A;  9ICI A;  3RAQ A;  2ISO A;  3LDA A;  3JPN A;  3SI8 A;  2ZUB A;  4OCZ A;  3TAQ A;  2NRW A;  4X5V A;  3ETR A;  2F44 A;  4RPX A;  5J0W A;  2ASL A;  2LMR A; 
#chains in the Genus database with same CATH homology
 1RG6 A;  2KSO B;  5F3X B;  1X40 A;  2EAP A;  3KKA A;  1SGG A;  3SEI A;  2Y9U A;  1SV0 C;  2K4P A;  2Y9T A;  3BQ7 A;  4IS7 A;  4RQN A;  5JU5 A;  2F3N A;  2QB1 A;  1SXD A;  3BS5 A;  5JTI A;  3IDW A;  2QAR A;  4NJ8 A;  2E8M A;  2KSO A;  3TAD C;  4PZN A;  2ES6 A;  3KKA C;  4RQM A;  3TAC B;  1PK3 A;  2DL0 A;  2KMD A;  4NL9 A;  2E8P A;  1DXS A;  3BS5 B;  2QAR B;  1B0X A;  1KW4 A;  1COK A;  4MHV A;  1PK1 A;  2QB0 B;  1V38 A;  1WWU A;  1B4F A;  1PK1 B;  2QB0 A;  3H8M A;  1X66 A;  1Z1V A;  2KG5 A;  2F8K A;  1F0M A;  5JRT A;  2EAM A;  2L5Y A;  2KE7 A;  1LKY B;  2DKZ A;  1UQV A;  2JV3 A;  5J8Y A;  1UCV A;  2YTU A;  2QKQ A;  2EAN A;  3BS7 A;  2B6G A;  4NL9 C;  1JI7 A;  1SXE A;  1SV4 A;  2LPE A;  2KIV A;  2D8C A;  2DKX A;  3K1R B;  1WWV A;  1OXJ A;  3HIL A;  2GLE A;  2K60 A;  1X9X A;  5J8Y C;  5KNI A;  4PZO A;  2E8O A;  5L1M A;  3TAD A;  2EAO A;  2ESE A;  1OW5 A;  2D3D A;  1SV0 A;  2E8N A;  1LKY A;  3SEN A;  1V85 A;  2F44 A;  2FE9 A;  2LMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...