1PK3A

Scm sam domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
RANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLRLNSEMMMKYMGLKLGPALKICNLVNKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sex comb on midleg CG9495-PA
publication title Structural organization of a Sex-comb-on-midleg/polyhomeotic copolymer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repression
total genus 28
structure length 76
sequence length 76
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1pk3A00
1SV4A 2KE7A 1X9XA 1SGGA 2EAOA 4IS7A 2KMDA 3SEIA 2QARA 2DKZA 5J8YA 2KIVA 3BQ7A 3KKAC 5JTIA 2E8PA 4NL9A 2LMRA 3SENA 1OXJA 1PK1B 4PZOA 2L5YA 2EAMA 1SV0A 1B4FA 2LPEA 1DXSA 2F8KA 2EAPA 2ES6A 2QB0A 1KW4A 5JRTA 2K60A 1SXDA 1Z1VA 1OW5A 2F3NA 4MHVA 1UQVA 3TADC 2FE9A 3BS5B 2B6GA 4RQNA 1LKYB 2YTUA 3KKAA 2KSOA 3HILA 2DL0A 3TACB 2F44A 3BS7A 2GLEA 5JU5A 2D8CA 2D3DA 2ESEA 2QB1A 1X40A 5F3XB 2DKXA 3TADA 4NJ8A 3BS5A 1F0MA 1V85A 2E8NA 1LKYA 2E8OA 1WWUA 2K4PA 2Y9TA 1PK1A 2KG5A 1SXEA 2QARB 1JI7A 5J8YC 3K1RB 4NL9C 2KSOB 1WWVA 5L1MA 1COKA 1SV0C 1UCVA 1B0XA 2E8MA 1X66A 2QKQA 3IDWA 5KNIA 2QB0B 4PZNA 3H8MA 1V38A 1PK3A 4RQMA 1RG6A 2JV3A 2EANA 2Y9UA
chains in the Genus database with same CATH superfamily
3CNHA 3TI0A 1X9XA 4OJLA 3PVXA 1AROP 2QARA 5JUMA 1COOA 3KKAC 1QTMA 1WUDA 4YMOA 1JRPA 3V6HA 4C0ZA 5DG8A 4DSJA 2ZIXB 3Q8KA 3EW9A 1XO1A 8ICZA 1VLBA 1Z00B 4NLNA 3JPTA 5AKGA 3OSPA 2OWOA 2KFNA 2BQ3A 4DQIA 2HSZA 5AKKA 1XWLA 4KLDA 4GC6A 4RZRA 1CUKA 2KKPA 5DKWA 3H0MB 3NRZA 5AI4A 2QB1A 4EENA 3BQ1A 5F9LA 3RTVA 4P0QA 3B0YA 4QNLA 1ZQHA 4M9LA 2XCAA 3TAPA 3F2CA 4RUCA 8ICIA 8ICNA 1KKXA 3PR5B 1ZQTA 5KFRA 1LV5A 4RQ1A 2XICA 5C0YA 1SXEA 4UW9A 3SAGA 1NKBA 3OPXA 4PHPA 4K4GA 4QZ8A 3A0HU 3JPQA 8ICEA 3FM9A 1L3SA 5J0PA 1U9LA 1JUDA 5EWGA 1T94A 4CNQA 2BCQA 4YG2A 1S8OA 1L8OA 1ED1A 4PJ0U 1Q3VA 1KDHA 1TVAA 1F5SA 4X5VA 5IIMA 2JV3A 5KFKA 5J0WA 3RJFA 2LHTA 3JPOA 4DSFA 5TISU 1RM6C 5B66U 4ECVA 5AKEA 2KFZA 3KTQA 1BNOA 5JTIA 1U4BA 2EZXA 2W55A 5D46A 1OXJA 5J29A 4PZOA 5KG0A 2L5YA 5CA7A 3RR8A 5AKZA 4OJOA 2YMMA 1BPZA 3TAQA 9ICKA 1PVPA 4RUAA 2C22A 2E1EA 2MUTB 1F44A 3QZ8A 1J97A 2FJ6A 1S9FA 4I2JA 2DBYA 5AHXA 1SL2A 3UM9A 2AGQA 1KSPA 5E79U 1ZQWA 2H3VA 1UA1A 4U7CA 4G9BA 2WF9A 5KFQA 5AI9A 4B9MA 2OH2A 3RJJA 1ZQVA 4ECUA 1S97A 4UB5A 1DGSA 5CP2A 2AQ4A 5DDYA 4I2AA 4KLSA 2YMQA 3CW2C 4PHAA 4KLJA 2B21A 4F2SA 5KTQA 2KJ8A 2K8CB 1O03A 3JPRA 5KFLA 3KHLA 4IRDA 3KBBA 4PPXA 2NRZA 3RJGA 4P4OA 2WB1F 5AK3A 5KG1A 2FLPA 4DL5A 1ZQXA 1ZD4A 4NM2A 1COKA 8ICKA 5DB6A 4TQRA 1X2IA 3KD3A 2P66A 4IQUA 5KFCA 1NK9A 3M9MB 5ALJA 5DLFA 3TQ1A 4M2YA 2YX8A 4RQ2A 1NJXA 1J2NA 1NK7A 5ALQA 2E5SA 2HHSA 2PI5A 4NL9A 2KICA 3SENA 2AGPA 1RZTA 5IIOA 3CP8A 4GFJA 3UPQA 2BCUA 4C8MA 1DRGA 2VJ4A 3QU7A 2ES6A 2HW3A 1PZNA 2LBOA 4DFMA 3MABA 1JALA 3N4MB 4OJ5A 3KHHA 2XY7A 1KTQA 2W3SA 2ZIWA 1K1SA 2NYVA 3N7RC 2WF6A 2KK0A 3C2KA 2XY5A 3AU2A 4R8UB 4UB4A 3E2EA 3LDAA 4IQVA 1LVHA 3I28A 4J9NA 4O5CA 2FPMA 3ALRA 5J2IA 3F2DA 2W3RA 1A77A 4CF3A 1XNSA 5JU5A 7ICRA 2NRXA 4QZ9A 1C7YA 4JB3A 4F2RA 1GO3F 1TAMA 2F1JA 3AMZA 3MR3A 1N48A 1F0MA 7ICJA 1V85A 4Q44A 1LKYA 4DFPA 4UB1A 1D8BA 4ED7A 5KG4A 3G6VA 3BZKA 4DL6A 2H3QA 4QZDA 4QWCA 2MA1A 2JEIA 1TKDA 4FZMA 4E0DA 1SIJA 4PH5A 4DQRA 2PFPA 1BPEA 3PSIA 2C2EA 1NZBA 2V4QA 4FBTA 1N61A 3D6JA 3H8WA 1L3TA 1WG8A 3GU3A 1RYSA 7ICKA 2KNJA 4KLOA 1ZQSA 4UB3A 2FMPA 3N7PD 1RG6A 4P0QB 2Y9UA 4F4ZA 4KLFA 4IQTA 4DLGA 2AXTU 5AIBA 3ED5A 4I28A 3JPNA 3UMCA 2W9CA 4J9PA 9ICVA 3RH6A 4I2FA 2JHDA 1C20A 5ALTA 1ZQRA 1B4FA 3C2MA 4RPYA 2YMPA 4BJQA 2G0AA 3MGVA 2DF4B 3Q8SB 3QEAZ 2JR5A 1QQ6A 1OW5A 4GLXA 3PNCA 3GV8B 2K4IA 5AKIA 2FLNA 7ICFA 1NOMA 4EBEA 5AKJA 3SR6A 5EWEA 1J2MA 5J2AA 3KKAA 3CRXA 2VIXA 3MGIA 4C4TA 4ZH4A 2AQ0A 2GLEA 1RXWA 3HP6A 2DGZA 2JZBA 1JIHA 1KFSA 3KFUF 4Z6DA 3IP4B 4LZGA 2KZ3A 3RJIA 4UBBA 3OHAA 2AGOA 4F4KA 3SZ2A 4EBDA 2O6KA 2MRLA 2W9MA 4UASA 1BPXA 5KFZA 2G07A 4QZBA 3EPIA 1EXNA 2VKQA 2KIWA 1XSPA 5D49A 3WKDA 1XSNA 2ISOA 3M9NB 5J2JA 9ICPA 1B0XA 3TARA 5KG3A 4QZAA 4Y2YA 2CPRA 5KFOA 3THVA 3ZD8A 4BDPA 1L7MA 3DEEA 3PMLA 5DB8A 4J9RA 3L4PA 4Y2VA 3BQ7A 4FS2A 3ZDEA 3SAHA 3KZXA 8ICSA 1NK5A 4DFKA 2KVCA 3UMGA 5AM1A 3C28A 3PSFA 3IN5A 4RQ6A 5J0RA 3MR5A 2K60A 3RFAA 1JMSA 1N5WA 4RQ4A 3AL0B 5ALKA 1Y88A 3AUOA 2RDJA 3B0XA 4UAZA 3GZFA 4EX7A 4DSEA 3EWAA 1S0OA 2WTFA 1IM4A 2BKEA 5AM2A 2W8LA 4J03A 2HDOA 2OEHA 2G5HB 2HHVA 5KFNA 1RQLA 2NRWA 4QZFA 1BNPA 1UHUA 5DDMA 4CDGA 5FP0A 4KMOB 4UB6U 4NLKA 4YXMA 4I27A 2JXJA 2OCEA 5EE3A 3RBEA 4TUSA 3IHQB 4J9LA 1PK1A 2XIDA 1FFUA 2BCRA 2W43A 3RB6A 4EZ6A 5KAIU 3GV7B 2ZIWB 2KG5A 5ALXA 5L1JA 3LWLA 2W11A 4ECQA 5D4BA 1KEJA 5J8YC 2BHNA 3SD7A 4F5NA 3ZI4A 2RLTA 4O3RA 3M8SA 2LKYA 2JMGA 3M6KA 1SKRA 1SKWA 2QB0B 3UXOA 4NWIA 4I2HA 2K89A 2BCVA 3B9JA 3BDPA 2VANA 1RYUA 5IIIA 3SEIA 1NK4A 3PV8A 3H4BA 1HUOA 3GIMA 2KEYA 4JV0A 2LMRA 2V4RA 2R8GA 4EZ9A 1WCLA 4DFDA 3QNMA 4UAUA 4IC9A 4DL3A 4DF8A 4RNOA 1UT8A 4M6WA 3TADC 1XS9D 8ICAA 3V7KA 1S0VA 5ALHA 4ED0A 2UVUA 1ZQNA 3SV3A 1ZXIA 2XY6A 1JN3A 2AU0A 2XVTA 5KT2A 2BDPA 1U48A 2BQUA 2WFAA 1SZHA 3MDAA 2EQYA 1BPBA 1N62A 4B9UA 2VA3A 2W9CB 3TANA 4FZNA 4J9SA 1YZ6A 4G3IA 8ICHA 8ICJA 2YB1A 3C2LA 4R65A 2UVRA 4A8EA 2KZMA 4B9VA 4IRKA 2KV2A 3SQIA 8ICLA 1BGXT 4FS1A 3ONNA 3UQ0A 1ZQYA 4DOAA 3GIJA 2HHWA 2ZJ8A 4BXOA 1FIQA 4PL2A 4F5QA 3H40A 1TK5A 1ZJNA 2PI4A 2FI1A 4ELVA 3PMNA 3AQFA 1NK0A 4ECSA 5KL8B 5DB7A 1NNLA 1T8EA 1MQ3A 5EOZA 4Y2QA 1L7NA 4PZNA 3ZDCA 5T14A 1QSYA 1V38A 5HP4A 2JZBB 2JH1A 4J9MA 1H38A 2F8KA 2GH1A 4RQ3A 9ICCA 1S5LU 4QWBA 3HWTA 4O3QA 5EE1A 1FEZA 4QW8A 4UQGA 4ECYA 5AK5A 2GWSA 4YD1A 4B9NA 5J0QA 4NXZA 4DL4A 3M1YA 3C23A 5ALVA 3ZDAA 4DL7A 2Z7JA 4QZCA 2FPKA 4EELA 3QE9Y 3WKEA 1ZQKA 5JRTA 5J0UA 5EWFA 1Z1VA 1XC9A 2YQEA 3GFKB 2BZFA 5ALPA 1A76A 2GO7A 5KG2A 4RT2A 4DOCA 1ZQIA 4P4MA 3L5KA 4MF8A 2J6UA 5ALOA 3S6JA 3PR4A 1B43A 3ZDDA 3PO5A 5J2BA 4MFFA 2ZJ5A 1URJA 5AI6A 5KFEA 4I29A 8ICTA 1CEZA 1NZPA 2ZUCA 5GTIU 5KFIA 3BS5A 4F4WA 5DG7A 7ICIA 3SI8A 1T3NA 3GQCA 5J0YA 3J81j 1WWUA 3QU9A 2F8LA 3HX0A 5DQGA 4XQ8A 2WF8A 3MR6A 2UVWA 8ICVA 1QQ5A 2LM4A 3UXNA 2HHXA 2JRZA 2Y1JA 3Q8PB 3V7LA 1MA7A 1V97A 1TK8A 3EUB2 2KVSA 5DBBA 5J2CA 4Y2SA 4FE3A 2FPLA 3WK9A 7ICNA 4UAVA 1SWVA 3NUQA 3V72A 1L7PA 3HJEA 2JEJA 1A0PA 4DL2A 4F50A 5AKYA 5DBAA 9ICGA 4C7YA 3UXPA 5KFDA 4US9A 4EBCA 5DQIA 5EE0A 2R8IA 1PK1B 5HMMA 4ED3A 1S76D 5AK6A 5AIAA 5L1KA 1QSSA 7ICGA 2E3TA 3ORYA 5EE9A 4B9SA 4RPZA 4QWEA 1RDFA 3CYMA 1S10A 4ACOA 2HVHA 4O3NA 4KLEA 3SV4A 2F3NA 2DUYA 2CRXA 4IL6U 2G06A 2BPCA 9ICMA 1ZQPA 9ICQA 4IR9A 4PGXA 7ICHA 2KSOA 4Y2PA 4RNMA 3QUCA 5IIKA 2IBKA 3HW8A 5KFXA 3FAHA 2BPFA 4LZDA 3U26A 2HBJA 3OJUA 1Q46A 3LK9A 3Q8MA 2HOIA 1X40A 2XCPA 8ICPA 5F3XB 2OHFA 1ZQQA 1DK3A 5ALFA 4R66A 4UARA 2JGAA 5KFGA 7ICMA 9ICXA 3O0FA 3EYZA 3RH4A 3SMVA 5IILA 5J2GA 3SYZA 1TAUA 9ICHA 1QLNA 4CGZA 4IRCA 2LI6A 3RRGA 4M6WB 5HNKA 5CR0A 2XI9A 2QARB 3LVWA 3NVVA 3DDHA 5ALZA 4FO6A 1XSLA 3K1RB 3PW0A 3GDXA 5KFHA 1MQ2A 2PMZC 1L7OA 1ZD5A 2ZIUA 1TE2A 5AI0A 2DWQA 3OJSA 5KT5A 1ZQZA 3IM1A 5KFUA 1UT5A 2EZZA 5KL1B 4NLCA 2FMQA 2HCFA 3TFSA 3LYSA 2W8KA 4IS7A 4ECRA 5J8YA 2KIVA 3HPOA 2QLTA 3V7JA 1ZQFA 3WKBA 4O3SA 1DXSA 2I1QA 3RBDA 3C21A 4Y2JA 1ZD2P 1FO4A 1KW4A 8ICOA 5J2KA 1SWWA 2CXYA 4MHVA 3MDCA 1Z19A 2FE9A 5BPCA 4DOBA 3OGUA 3RR7A 3H4DA 4F93B 2NRTA 4F5RA 5J2HA 2DL0A 3BQTA 2Y1IA 4ZOHC 5ALSA 2ZTDA 4K4IA 3C29A 1DK2A 2D3DA 2ESEA 3IG8A 4I2BA 2ZIXA 3AQEA 5J0XA 3TADA 3PW7A 3H8JA 4UATA 2W9AA 4R63A 3N97B 2WAQC 9ICEA 3T5KA 2HMXA 1IV8A 2J6TA 3QU2A 2E8OA 4KLIA 4DSIA 1SL1A 4YD2A 3JPSA 2IHNA 3IG5A 2HHTA 2I5HA 4B9TA 8ICXA 1VJ5A 4KITB 4DSLA 8ICQA 3UQ2A 2W7OA 2CN1A 1TFRA 4M9JA 5DQHA 2WF5A 1L3UA 3Q8RB 5KNIA 1ZQLA 2ZUDA 4Q43A 4C7ZA 4UAWA 4LVSA 5KT6A 2H3ZA 3D2QA 3H0LB 4AYBF 4NLBA 5HR6A 2RHFA 5C5JA 5AM0A 2ASLA 5K4LA 3QU5A 1ZQMA 1DGJA 3M6ZA 1ECWA 3RJKA 4KX3A 4I2DA 2BQRA 1HIWA 9ICIA 2NV3A 1N2XA 5KG6A 4MF2A 1KRPA 4BGDA 3VCBA 3T5LA 3E58A 3NGDA 5J0OA 1UQVA 1MC8A 1YT3A 2HBLA 4YQWA 3BJYA 5KFAA 2W9BA 3ISBA 2HOFA 2B6GA 2ZG6A 2KZZA 1KN5A 4KLHA 5HR7A 4GIBA 7ICUA 4DF4A 3IRUA 4F5OA 2WF7A 4TUPA 2F44A 1N56A 2HI0A 3F5EA 2D8CA 2I6XA 2DPIA 3H7IA 1X6IA 3NRWA 2MUTA 2ODGA 3RAQA 1L5UA 4YFKA 2HVIA 5AI5A 3QX7A 1JXLA 4AP9A 1T7PA 5L1IA 2XO7A 4NLGA 5AICA 2Q0ZX 5HHHA 3PX6A 1ZQJA 2W7PA 4MEYA 5TZVA 4F8RA 2KN7A 4OJ6A 2YB4A 1X9WA 5AKLA 1NJYA 1KFDA 2W04A 4Z6FA 3AU6A 2KSOB 4YMNA 4RNNA 4QZGA 4ED6A 2JEGA 3WK6A 3C5GA 4XRHA 2QKQA 1Z3EB 4KX5A 4B9LA 2KP7A 2A19A 9ICWA 4F4YA 4Z6CA 5AK4A 4RQ8A 2YN4A 2EANA 5KT7A 2KE7A 4KLLA 1ZRNA 2KMDA 1D9FA 3I76A 3QUQA 1BVSA 1U45A 4DS5A 4JMUA 1N63A 2NO4A 3L3FX 3RJEA 3GIIA 4HYKA 2EAPA 3T5HA 4ED8A 2DPJA 3RB0A 3Q8LA 4M9NA 3OTQA 5CJ7A 5HMLA 2HBMA 5ALEA 5KT3A 2ISPA 3GV5B 1LKYB 2M0NA 4CRXA 3KHGA 4QIWF 2K4HA 1QCKA 4C8KA 3FC4A 2HOQA 4M47A 1NKEA 1ZQBA 5KFJA 1KL9A 3QZ7A 5KFTA 7ICVA 1RYRA 5IIJA 4QZHA 1RXVA 2K4EA 4EYIB 2I9GA 3Q8QB 2BCSA 1BPDA 4FFDA 4YR3A 2BGWA 2H5XA 4AYBC 2OM6A 5H2FU 4UB2A 3FYHA 2MSNA 5J2FA 1T3QA 4DQSA 3ISCA 1K1QA 2YY6A 3G6YA 5CWRA 2ASJA 2C2RA 4DLEA 1NK6A 1PUZA 5CB1A 2PFOA 5KFFA 4P0PA 4DWIA 1WWVA 4RU9A 4F92B 1MN8A 2Y0SF 4O5KA 2FDRA 5KAFU 2ATLA 4WJ3B 4EX6A 1ZETA 3PO4A 2E8MA 3H8SA 3GILA 1MSWD 4JV2A 5ALWA 5IINA 1NK8A 3C1YA 5DLGA 1TV9A 2KKVA 1IIPA 1Z1BA 2G08A 4Z6EA 4FZLA 5DBCA 2K8AA 2ZTEA 4EYHB 4KN4A 4O3PA 2PXIA 3KOOA 4USAA 3T5JA 4QZIA 2XC9A 3V6KA 8ICCA 4UBCA 3PSTA 1ZQDA 4BX9C 4ED2A 4XA5A 4YMMA 5GTHU 3RRHA 2BR0A 2KOBA 3ISDA 4MEXA 1VDVA 1SL0A 4BUGA 2F1IA 5KFVA 3QXGA 1D9DA 4JK1A 4PHEA 1NJWA 3WK7A 5J0SA 3ETRA 1LB2B 5ALNA 4J9OA 2PFNA 3AEVA 5L9XA 2IOFK 4NY8A 8ICRA 3TACB 1JX4A 1HJPA 4I2GA 9ICRA 3ZDBA 5AKHA 1UPHA 4MFAA 2R8KA 5CEHA 4C4RA 2PMZF 2M9NA 4LJXA 2PFQA 2NO5A 4UB8U 5L1LA 4Y2TA 3HRDD 2B0CA 4PGQA 4Y2UA 2FMSA 3PW4A 2D6FC 4IQWA 3NVZA 2LYHA 4ECTA 5ALRA 2W9BB 2P6RA 1JI7A 1D8YA 1S0NA 2RDIA 4ECWA 1SV0C 2RQ5A 3EPGA 3LVVA 3WK4A 3PSPA 5A0LA 4PGYA 4GXJA 1S77D 3NS1A 4QIWC 1X9SA 2MU2A 2RP5A 2ZTCA 4QWDA 1KLNA 3BQ0A 1N5XA 1NJZA 3WKCA 4Q45A 5AKXA 3NTUA 3NVWA 4TQSA 5KFSA 5KFPA 5KG5A 1ZQOA 4EEKA 2EAMA 4DO9A 4K4HA 1CRXA 7ICOA 9ICAA 4GXKA 1YZ7A 3E0FA 5DGAA 1TK0A 3F5AA 1U49A 3N28A 2V9WA 2WAQF 4QZEA 4F5PA 4RT3A 4YR0A 2YTUA 1RPLA 1L8LA 1K5OA 3M7DA 5B5EU 2Y0SC 5DG9A 4RPXA 5AI8A 9ICNA 3G6XA 4DQQA 1M6YA 1L3VA 1SZPA 1S0MA 4NV0A 4PHDA 3RF9A 2N1RA 3SAFA 9ICUA 7ICLA 3GIKA 4YVZA 3M9OB 2Q4TA 1ZQUA 2LYBA 4OJPA 4TUQA 3MFHA 4Y2RA 1NI3A 3WK5A 1V9PA 4M9HA 1HEKA 2J6SA 5ALMA 5DGBA 2HHQA 1UCVA 2YMLA 5KG7A 4I2EA 3QU4A 4JUZA 1Z4OA 2F76X 3PW2A 1IG6A 2VA8A 2AHOB 2IA6A 1OUQA 3PZPA 2UVVA 4C4SA 4PL1A 3WU2U 2DKZA 2A1JA 4I2IA 4C8OA 4RQ7A 4M0AA 9ICFA 2F2AB 2R8HA 1ZQEA 1T4GA 2E8PA 3JPPA 3K4GA 1P7DA 3MC1A 1ZQCA 3WK8A 3BQ2A 7ICTA 4C8LA 4CCHA 3HKZF 3UMBA 1KFTA 2GOLA 3RAXA 2QB0A 4NLZA 4EEYA 4P0PB 4GC7A 2VA2A 2A3VA 2MAXA 4F71A 4DS4A 3I1YA 4UAYA 4ECXA 4J9KA 1U47A 3RJHA 2E1FA 4Q8EA 1QSLA 2W03A 4U6PA 1L6NA 2ZJAA 2ZXHA 3M8RA 3AN1A 3IV6A 3RB3A 9ICJA 4M04A 4ED1A 2K8BB 8ICBA 2ZIVA 4BXOB 4R64A 2LM1A 3ICXA 1Q3UA 3TKAA 5ALDA 8ICYA 5ALUA 4KN7A 3C5FA 4JV1A 4CF5A 1ZQGA 4ELTA 4B6JA 2E8NA 2OXOA 4CE6A 4MFCA 5KFBA 2Y9TA 4YXJA 3F2BA 4O0IA 4IR1A 3T3FA 3OHBA 3H0RB 2FLLA 2JH7A 2EH9A 1WCNA 4O5EA 2AJQA 2H3IA 2ALZA 4KLTA 3K75D 1Z00A 5ALYA 1KBUA 4OD0A 4P2HA 1X66A 3IDWA 5KFWA 1ZRMA 2ZUBA 3H8MA 1XO0A 1SB3C 3NVYA 1X9MA 5KFYA 1QQ7A 3DV9A 2PKEA 2IOHA 1SGGA 3FDSA 8ICWA 2WB1C 2P35A 4OCZA 3BZCA 3LWMA 1ZQAA 1ZJMA 2LPEA 1IXRA 4F3OA 2KD1A 4Y2XA 8ICUA 2IMWP 2IHMA 4M9GA 2XGQA 3EZ5A 1BPYA 5G5GA 5J2DA 3RB4A 2F1HA 2BDUA 3MR2A 4GXIA 2KJ9A 1SKSA 4O3OA 3BS5B 3D2SA 4C80A 5AM3A 5AM4A 3QUTA 5CRXA 4YR2A 4QW9A 2XGPA 3PX4A 9ICOA 1ZQ1C 3RH5A 1PVRA 4F72A 3R9KA 3PX0A 3KZIU 3WKAA 2KHVA 7ICPA 1B22A 4QWAA 1O08A 4FBUA 4RQ0A 2IOFA 2HBKA 2EZYA 1RQNA 2DKXA 2W54A 4O9MA 4I2CA 4YP3A 4NJ8A 2RRDA 1Z4NA 4JWMA 1HUZA 4NM1A 2G5IB 1N60A 4RQ5A 9ICTA 1X42A 3ZD9A 1FFVA 1WYGA 2ZXIA 1UA0A 3HKZC 4QJFB 3QYPA 5J2EA 3OSNA 1QH9A 4KLQA 4OO1J 2C2DA 8ICMA 4NL9C 7ICSA 2KHQA 1ZOLA 4DQPA 1Q8KA 2OYYA 5BOLA 5BOMA 2KJ5A 4F4XA 1KQQA 2LYAA 3ETLA 3MGHA 5KT4A 4KLMA 2EDUA 3K1ZA 4RQMA 3MFIA 5F9NA 2DQNB 1CI4A 5G5HA 1NKCA 1SV4A 4KLUA 2WHEA 4BWJA 2EAOA 2VJ5A 3T79A 5J0TA 5DB9A 8ICGA 1SV0A 2HHUA 4TURA 3V6JA 4YCXA 2NRVA 1A6SA 1JROA 1SXDA 4CF4A 5HHIA 1DOQA 4DFJA 4O3MA 4RQNA 2KTQA 4XUSA 4DCCA 3F53A 3HILA 3PW5A 3N7SC 3HT3A 4J9QA 1AQ6A 5AM5A 2JEFA 3MBYA 3QUBA 3BS7A 4YN4A 7ICEA 1ZD3A 1ZYQA 3NASA 2H3FA 4KTQA 4F91B 3A0BU 2A1JB 2P6UA 2R8JA 4ECZA 4KMUA 2ZIUB 3TFRA 4P4PA 5ALGA 4DSKA 2C28A 3KHRA 4KLGA 2DFLA 5KFMA 9ICSA 2K4PA 3PY8A 4JWNA 4HAIA 4ICAA 4BWMA 4US8A 4C8NA 1JXEA 3D2NA 2F77X 3QEBZ 2G09A 9ICBA 8ICFA 2A1AA 1PVQA 4ELUA 1X6JA 3AM9A 7ICQA 5L1MA 1XU4A 5ALLA 9ICLA 5CHGA 1TAQA 2ASDA 3C1ZA 5ALIA 4R8UA 4Q8FA 1D8LA 2ZIVB 4DEZA 2BPGA 2AH5A 1PK3A 2R18A 3VC8A
chains in the Genus database with same CATH topology
1SV4A 2KE7A 1X9XA 1SGGA 2EAOA 4IS7A 2KMDA 3SEIA 2QARA 2DKZA 5J8YA 2KIVA 3BQ7A 3KKAC 5JTIA 2E8PA 4NL9A 2LMRA 3SENA 1OXJA 1PK1B 4PZOA 2L5YA 2EAMA 1SV0A 1B4FA 2LPEA 1DXSA 2F8KA 2EAPA 2ES6A 2QB0A 1KW4A 5JRTA 2K60A 1SXDA 1Z1VA 1OW5A 2F3NA 4MHVA 1UQVA 3TADC 2FE9A 3BS5B 2B6GA 4RQNA 1LKYB 2YTUA 3KKAA 2KSOA 3HILA 2DL0A 3TACB 2F44A 3BS7A 2GLEA 5JU5A 2D8CA 2D3DA 2ESEA 2QB1A 1X40A 5F3XB 2DKXA 3TADA 4NJ8A 3BS5A 1F0MA 1V85A 2E8NA 1LKYA 2E8OA 1WWUA 2K4PA 2Y9TA 1PK1A 2KG5A 1SXEA 2QARB 1JI7A 5J8YC 3K1RB 4NL9C 2KSOB 1WWVA 5L1MA 1COKA 1SV0C 1UCVA 1B0XA 2E8MA 1X66A 2QKQA 3IDWA 5KNIA 2QB0B 4PZNA 3H8MA 1V38A 1PK3A 4RQMA 1RG6A 2JV3A 2EANA 2Y9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV4 A;  2KE7 A;  1X9X A;  1SGG A;  2EAO A;  4IS7 A;  2KMD A;  3SEI A;  2QAR A;  2DKZ A;  5J8Y A;  2KIV A;  3BQ7 A;  3KKA C;  5JTI A;  2E8P A;  4NL9 A;  2LMR A;  3SEN A;  1OXJ A;  1PK1 B;  4PZO A;  2L5Y A;  2EAM A;  1SV0 A;  1B4F A;  2LPE A;  1DXS A;  2F8K A;  2EAP A;  2ES6 A;  2QB0 A;  1KW4 A;  5JRT A;  2K60 A;  1SXD A;  1Z1V A;  1OW5 A;  2F3N A;  4MHV A;  1UQV A;  3TAD C;  2FE9 A;  3BS5 B;  2B6G A;  4RQN A;  1LKY B;  2YTU A;  3KKA A;  2KSO A;  3HIL A;  2DL0 A;  3TAC B;  2F44 A;  3BS7 A;  2GLE A;  5JU5 A;  2D8C A;  2D3D A;  2ESE A;  2QB1 A;  1X40 A;  5F3X B;  2DKX A;  3TAD A;  4NJ8 A;  3BS5 A;  1F0M A;  1V85 A;  2E8N A;  1LKY A;  2E8O A;  1WWU A;  2K4P A;  2Y9T A;  1PK1 A;  2KG5 A;  1SXE A;  2QAR B;  1JI7 A;  5J8Y C;  3K1R B;  4NL9 C;  2KSO B;  1WWV A;  5L1M A;  1COK A;  1SV0 C;  1UCV A;  1B0X A;  2E8M A;  1X66 A;  2QKQ A;  3IDW A;  5KNI A;  2QB0 B;  4PZN A;  3H8M A;  1V38 A;  1PK3 A;  4RQM A;  1RG6 A;  2JV3 A;  2EAN A;  2Y9U A; 
#chains in the Genus database with same CATH topology
 3CNH A;  3TI0 A;  1X9X A;  4OJL A;  3PVX A;  1ARO P;  2QAR A;  5JUM A;  1COO A;  3KKA C;  1QTM A;  1WUD A;  4YMO A;  1JRP A;  3V6H A;  4C0Z A;  5DG8 A;  4DSJ A;  2ZIX B;  3Q8K A;  3EW9 A;  1XO1 A;  8ICZ A;  1VLB A;  1Z00 B;  4NLN A;  3JPT A;  5AKG A;  3OSP A;  2OWO A;  2KFN A;  2BQ3 A;  4DQI A;  2HSZ A;  5AKK A;  1XWL A;  4KLD A;  4GC6 A;  4RZR A;  1CUK A;  2KKP A;  5DKW A;  3H0M B;  3NRZ A;  5AI4 A;  2QB1 A;  4EEN A;  3BQ1 A;  5F9L A;  3RTV A;  4P0Q A;  3B0Y A;  4QNL A;  1ZQH A;  4M9L A;  2XCA A;  3TAP A;  3F2C A;  4RUC A;  8ICI A;  8ICN A;  1KKX A;  3PR5 B;  1ZQT A;  5KFR A;  1LV5 A;  4RQ1 A;  2XIC A;  5C0Y A;  1SXE A;  4UW9 A;  3SAG A;  1NKB A;  3OPX A;  4PHP A;  4K4G A;  4QZ8 A;  3A0H U;  3JPQ A;  8ICE A;  3FM9 A;  1L3S A;  5J0P A;  1U9L A;  1JUD A;  5EWG A;  1T94 A;  4CNQ A;  2BCQ A;  4YG2 A;  1S8O A;  1L8O A;  1ED1 A;  4PJ0 U;  1Q3V A;  1KDH A;  1TVA A;  1F5S A;  4X5V A;  5IIM A;  2JV3 A;  5KFK A;  5J0W A;  3RJF A;  2LHT A;  3JPO A;  4DSF A;  5TIS U;  1RM6 C;  5B66 U;  4ECV A;  5AKE A;  2KFZ A;  3KTQ A;  1BNO A;  5JTI A;  1U4B A;  2EZX A;  2W55 A;  5D46 A;  1OXJ A;  5J29 A;  4PZO A;  5KG0 A;  2L5Y A;  5CA7 A;  3RR8 A;  5AKZ A;  4OJO A;  2YMM A;  1BPZ A;  3TAQ A;  9ICK A;  1PVP A;  4RUA A;  2C22 A;  2E1E A;  2MUT B;  1F44 A;  3QZ8 A;  1J97 A;  2FJ6 A;  1S9F A;  4I2J A;  2DBY A;  5AHX A;  1SL2 A;  3UM9 A;  2AGQ A;  1KSP A;  5E79 U;  1ZQW A;  2H3V A;  1UA1 A;  4U7C A;  4G9B A;  2WF9 A;  5KFQ A;  5AI9 A;  4B9M A;  2OH2 A;  3RJJ A;  1ZQV A;  4ECU A;  1S97 A;  4UB5 A;  1DGS A;  5CP2 A;  2AQ4 A;  5DDY A;  4I2A A;  4KLS A;  2YMQ A;  3CW2 C;  4PHA A;  4KLJ A;  2B21 A;  4F2S A;  5KTQ A;  2KJ8 A;  2K8C B;  1O03 A;  3JPR A;  5KFL A;  3KHL A;  4IRD A;  3KBB A;  4PPX A;  2NRZ A;  3RJG A;  4P4O A;  2WB1 F;  5AK3 A;  5KG1 A;  2FLP A;  4DL5 A;  1ZQX A;  1ZD4 A;  4NM2 A;  1COK A;  8ICK A;  5DB6 A;  4TQR A;  1X2I A;  3KD3 A;  2P66 A;  4IQU A;  5KFC A;  1NK9 A;  3M9M B;  5ALJ A;  5DLF A;  3TQ1 A;  4M2Y A;  2YX8 A;  4RQ2 A;  1NJX A;  1J2N A;  1NK7 A;  5ALQ A;  2E5S A;  2HHS A;  2PI5 A;  4NL9 A;  2KIC A;  3SEN A;  2AGP A;  1RZT A;  5IIO A;  3CP8 A;  4GFJ A;  3UPQ A;  2BCU A;  4C8M A;  1DRG A;  2VJ4 A;  3QU7 A;  2ES6 A;  2HW3 A;  1PZN A;  2LBO A;  4DFM A;  3MAB A;  1JAL A;  3N4M B;  4OJ5 A;  3KHH A;  2XY7 A;  1KTQ A;  2W3S A;  2ZIW A;  1K1S A;  2NYV A;  3N7R C;  2WF6 A;  2KK0 A;  3C2K A;  2XY5 A;  3AU2 A;  4R8U B;  4UB4 A;  3E2E A;  3LDA A;  4IQV A;  1LVH A;  3I28 A;  4J9N A;  4O5C A;  2FPM A;  3ALR A;  5J2I A;  3F2D A;  2W3R A;  1A77 A;  4CF3 A;  1XNS A;  5JU5 A;  7ICR A;  2NRX A;  4QZ9 A;  1C7Y A;  4JB3 A;  4F2R A;  1GO3 F;  1TAM A;  2F1J A;  3AMZ A;  3MR3 A;  1N48 A;  1F0M A;  7ICJ A;  1V85 A;  4Q44 A;  1LKY A;  4DFP A;  4UB1 A;  1D8B A;  4ED7 A;  5KG4 A;  3G6V A;  3BZK A;  4DL6 A;  2H3Q A;  4QZD A;  4QWC A;  2MA1 A;  2JEI A;  1TKD A;  4FZM A;  4E0D A;  1SIJ A;  4PH5 A;  4DQR A;  2PFP A;  1BPE A;  3PSI A;  2C2E A;  1NZB A;  2V4Q A;  4FBT A;  1N61 A;  3D6J A;  3H8W A;  1L3T A;  1WG8 A;  3GU3 A;  1RYS A;  7ICK A;  2KNJ A;  4KLO A;  1ZQS A;  4UB3 A;  2FMP A;  3N7P D;  1RG6 A;  4P0Q B;  2Y9U A;  4F4Z A;  4KLF A;  4IQT A;  4DLG A;  2AXT U;  5AIB A;  3ED5 A;  4I28 A;  3JPN A;  3UMC A;  2W9C A;  4J9P A;  9ICV A;  3RH6 A;  4I2F A;  2JHD A;  1C20 A;  5ALT A;  1ZQR A;  1B4F A;  3C2M A;  4RPY A;  2YMP A;  4BJQ A;  2G0A A;  3MGV A;  2DF4 B;  3Q8S B;  3QEA Z;  2JR5 A;  1QQ6 A;  1OW5 A;  4GLX A;  3PNC A;  3GV8 B;  2K4I A;  5AKI A;  2FLN A;  7ICF A;  1NOM A;  4EBE A;  5AKJ A;  3SR6 A;  5EWE A;  1J2M A;  5J2A A;  3KKA A;  3CRX A;  2VIX A;  3MGI A;  4C4T A;  4ZH4 A;  2AQ0 A;  2GLE A;  1RXW A;  3HP6 A;  2DGZ A;  2JZB A;  1JIH A;  1KFS A;  3KFU F;  4Z6D A;  3IP4 B;  4LZG A;  2KZ3 A;  3RJI A;  4UBB A;  3OHA A;  2AGO A;  4F4K A;  3SZ2 A;  4EBD A;  2O6K A;  2MRL A;  2W9M A;  4UAS A;  1BPX A;  5KFZ A;  2G07 A;  4QZB A;  3EPI A;  1EXN A;  2VKQ A;  2KIW A;  1XSP A;  5D49 A;  3WKD A;  1XSN A;  2ISO A;  3M9N B;  5J2J A;  9ICP A;  1B0X A;  3TAR A;  5KG3 A;  4QZA A;  4Y2Y A;  2CPR A;  5KFO A;  3THV A;  3ZD8 A;  4BDP A;  1L7M A;  3DEE A;  3PML A;  5DB8 A;  4J9R A;  3L4P A;  4Y2V A;  3BQ7 A;  4FS2 A;  3ZDE A;  3SAH A;  3KZX A;  8ICS A;  1NK5 A;  4DFK A;  2KVC A;  3UMG A;  5AM1 A;  3C28 A;  3PSF A;  3IN5 A;  4RQ6 A;  5J0R A;  3MR5 A;  2K60 A;  3RFA A;  1JMS A;  1N5W A;  4RQ4 A;  3AL0 B;  5ALK A;  1Y88 A;  3AUO A;  2RDJ A;  3B0X A;  4UAZ A;  3GZF A;  4EX7 A;  4DSE A;  3EWA A;  1S0O A;  2WTF A;  1IM4 A;  2BKE A;  5AM2 A;  2W8L A;  4J03 A;  2HDO A;  2OEH A;  2G5H B;  2HHV A;  5KFN A;  1RQL A;  2NRW A;  4QZF A;  1BNP A;  1UHU A;  5DDM A;  4CDG A;  5FP0 A;  4KMO B;  4UB6 U;  4NLK A;  4YXM A;  4I27 A;  2JXJ A;  2OCE A;  5EE3 A;  3RBE A;  4TUS A;  3IHQ B;  4J9L A;  1PK1 A;  2XID A;  1FFU A;  2BCR A;  2W43 A;  3RB6 A;  4EZ6 A;  5KAI U;  3GV7 B;  2ZIW B;  2KG5 A;  5ALX A;  5L1J A;  3LWL A;  2W11 A;  4ECQ A;  5D4B A;  1KEJ A;  5J8Y C;  2BHN A;  3SD7 A;  4F5N A;  3ZI4 A;  2RLT A;  4O3R A;  3M8S A;  2LKY A;  2JMG A;  3M6K A;  1SKR A;  1SKW A;  2QB0 B;  3UXO A;  4NWI A;  4I2H A;  2K89 A;  2BCV A;  3B9J A;  3BDP A;  2VAN A;  1RYU A;  5III A;  3SEI A;  1NK4 A;  3PV8 A;  3H4B A;  1HUO A;  3GIM A;  2KEY A;  4JV0 A;  2LMR A;  2V4R A;  2R8G A;  4EZ9 A;  1WCL A;  4DFD A;  3QNM A;  4UAU A;  4IC9 A;  4DL3 A;  4DF8 A;  4RNO A;  1UT8 A;  4M6W A;  3TAD C;  1XS9 D;  8ICA A;  3V7K A;  1S0V A;  5ALH A;  4ED0 A;  2UVU A;  1ZQN A;  3SV3 A;  1ZXI A;  2XY6 A;  1JN3 A;  2AU0 A;  2XVT A;  5KT2 A;  2BDP A;  1U48 A;  2BQU A;  2WFA A;  1SZH A;  3MDA A;  2EQY A;  1BPB A;  1N62 A;  4B9U A;  2VA3 A;  2W9C B;  3TAN A;  4FZN A;  4J9S A;  1YZ6 A;  4G3I A;  8ICH A;  8ICJ A;  2YB1 A;  3C2L A;  4R65 A;  2UVR A;  4A8E A;  2KZM A;  4B9V A;  4IRK A;  2KV2 A;  3SQI A;  8ICL A;  1BGX T;  4FS1 A;  3ONN A;  3UQ0 A;  1ZQY A;  4DOA A;  3GIJ A;  2HHW A;  2ZJ8 A;  4BXO A;  1FIQ A;  4PL2 A;  4F5Q A;  3H40 A;  1TK5 A;  1ZJN A;  2PI4 A;  2FI1 A;  4ELV A;  3PMN A;  3AQF A;  1NK0 A;  4ECS A;  5KL8 B;  5DB7 A;  1NNL A;  1T8E A;  1MQ3 A;  5EOZ A;  4Y2Q A;  1L7N A;  4PZN A;  3ZDC A;  5T14 A;  1QSY A;  1V38 A;  5HP4 A;  2JZB B;  2JH1 A;  4J9M A;  1H38 A;  2F8K A;  2GH1 A;  4RQ3 A;  9ICC A;  1S5L U;  4QWB A;  3HWT A;  4O3Q A;  5EE1 A;  1FEZ A;  4QW8 A;  4UQG A;  4ECY A;  5AK5 A;  2GWS A;  4YD1 A;  4B9N A;  5J0Q A;  4NXZ A;  4DL4 A;  3M1Y A;  3C23 A;  5ALV A;  3ZDA A;  4DL7 A;  2Z7J A;  4QZC A;  2FPK A;  4EEL A;  3QE9 Y;  3WKE A;  1ZQK A;  5JRT A;  5J0U A;  5EWF A;  1Z1V A;  1XC9 A;  2YQE A;  3GFK B;  2BZF A;  5ALP A;  1A76 A;  2GO7 A;  5KG2 A;  4RT2 A;  4DOC A;  1ZQI A;  4P4M A;  3L5K A;  4MF8 A;  2J6U A;  5ALO A;  3S6J A;  3PR4 A;  1B43 A;  3ZDD A;  3PO5 A;  5J2B A;  4MFF A;  2ZJ5 A;  1URJ A;  5AI6 A;  5KFE A;  4I29 A;  8ICT A;  1CEZ A;  1NZP A;  2ZUC A;  5GTI U;  5KFI A;  3BS5 A;  4F4W A;  5DG7 A;  7ICI A;  3SI8 A;  1T3N A;  3GQC A;  5J0Y A;  3J81 j;  1WWU A;  3QU9 A;  2F8L A;  3HX0 A;  5DQG A;  4XQ8 A;  2WF8 A;  3MR6 A;  2UVW A;  8ICV A;  1QQ5 A;  2LM4 A;  3UXN A;  2HHX A;  2JRZ A;  2Y1J A;  3Q8P B;  3V7L A;  1MA7 A;  1V97 A;  1TK8 A;  3EUB 2;  2KVS A;  5DBB A;  5J2C A;  4Y2S A;  4FE3 A;  2FPL A;  3WK9 A;  7ICN A;  4UAV A;  1SWV A;  3NUQ A;  3V72 A;  1L7P A;  3HJE A;  2JEJ A;  1A0P A;  4DL2 A;  4F50 A;  5AKY A;  5DBA A;  9ICG A;  4C7Y A;  3UXP A;  5KFD A;  4US9 A;  4EBC A;  5DQI A;  5EE0 A;  2R8I A;  1PK1 B;  5HMM A;  4ED3 A;  1S76 D;  5AK6 A;  5AIA A;  5L1K A;  1QSS A;  7ICG A;  2E3T A;  3ORY A;  5EE9 A;  4B9S A;  4RPZ A;  4QWE A;  1RDF A;  3CYM A;  1S10 A;  4ACO A;  2HVH A;  4O3N A;  4KLE A;  3SV4 A;  2F3N A;  2DUY A;  2CRX A;  4IL6 U;  2G06 A;  2BPC A;  9ICM A;  1ZQP A;  9ICQ A;  4IR9 A;  4PGX A;  7ICH A;  2KSO A;  4Y2P A;  4RNM A;  3QUC A;  5IIK A;  2IBK A;  3HW8 A;  5KFX A;  3FAH A;  2BPF A;  4LZD A;  3U26 A;  2HBJ A;  3OJU A;  1Q46 A;  3LK9 A;  3Q8M A;  2HOI A;  1X40 A;  2XCP A;  8ICP A;  5F3X B;  2OHF A;  1ZQQ A;  1DK3 A;  5ALF A;  4R66 A;  4UAR A;  2JGA A;  5KFG A;  7ICM A;  9ICX A;  3O0F A;  3EYZ A;  3RH4 A;  3SMV A;  5IIL A;  5J2G A;  3SYZ A;  1TAU A;  9ICH A;  1QLN A;  4CGZ A;  4IRC A;  2LI6 A;  3RRG A;  4M6W B;  5HNK A;  5CR0 A;  2XI9 A;  2QAR B;  3LVW A;  3NVV A;  3DDH A;  5ALZ A;  4FO6 A;  1XSL A;  3K1R B;  3PW0 A;  3GDX A;  5KFH A;  1MQ2 A;  2PMZ C;  1L7O A;  1ZD5 A;  2ZIU A;  1TE2 A;  5AI0 A;  2DWQ A;  3OJS A;  5KT5 A;  1ZQZ A;  3IM1 A;  5KFU A;  1UT5 A;  2EZZ A;  5KL1 B;  4NLC A;  2FMQ A;  2HCF A;  3TFS A;  3LYS A;  2W8K A;  4IS7 A;  4ECR A;  5J8Y A;  2KIV A;  3HPO A;  2QLT A;  3V7J A;  1ZQF A;  3WKB A;  4O3S A;  1DXS A;  2I1Q A;  3RBD A;  3C21 A;  4Y2J A;  1ZD2 P;  1FO4 A;  1KW4 A;  8ICO A;  5J2K A;  1SWW A;  2CXY A;  4MHV A;  3MDC A;  1Z19 A;  2FE9 A;  5BPC A;  4DOB A;  3OGU A;  3RR7 A;  3H4D A;  4F93 B;  2NRT A;  4F5R A;  5J2H A;  2DL0 A;  3BQT A;  2Y1I A;  4ZOH C;  5ALS A;  2ZTD A;  4K4I A;  3C29 A;  1DK2 A;  2D3D A;  2ESE A;  3IG8 A;  4I2B A;  2ZIX A;  3AQE A;  5J0X A;  3TAD A;  3PW7 A;  3H8J A;  4UAT A;  2W9A A;  4R63 A;  3N97 B;  2WAQ C;  9ICE A;  3T5K A;  2HMX A;  1IV8 A;  2J6T A;  3QU2 A;  2E8O A;  4KLI A;  4DSI A;  1SL1 A;  4YD2 A;  3JPS A;  2IHN A;  3IG5 A;  2HHT A;  2I5H A;  4B9T A;  8ICX A;  1VJ5 A;  4KIT B;  4DSL A;  8ICQ A;  3UQ2 A;  2W7O A;  2CN1 A;  1TFR A;  4M9J A;  5DQH A;  2WF5 A;  1L3U A;  3Q8R B;  5KNI A;  1ZQL A;  2ZUD A;  4Q43 A;  4C7Z A;  4UAW A;  4LVS A;  5KT6 A;  2H3Z A;  3D2Q A;  3H0L B;  4AYB F;  4NLB A;  5HR6 A;  2RHF A;  5C5J A;  5AM0 A;  2ASL A;  5K4L A;  3QU5 A;  1ZQM A;  1DGJ A;  3M6Z A;  1ECW A;  3RJK A;  4KX3 A;  4I2D A;  2BQR A;  1HIW A;  9ICI A;  2NV3 A;  1N2X A;  5KG6 A;  4MF2 A;  1KRP A;  4BGD A;  3VCB A;  3T5L A;  3E58 A;  3NGD A;  5J0O A;  1UQV A;  1MC8 A;  1YT3 A;  2HBL A;  4YQW A;  3BJY A;  5KFA A;  2W9B A;  3ISB A;  2HOF A;  2B6G A;  2ZG6 A;  2KZZ A;  1KN5 A;  4KLH A;  5HR7 A;  4GIB A;  7ICU A;  4DF4 A;  3IRU A;  4F5O A;  2WF7 A;  4TUP A;  2F44 A;  1N56 A;  2HI0 A;  3F5E A;  2D8C A;  2I6X A;  2DPI A;  3H7I A;  1X6I A;  3NRW A;  2MUT A;  2ODG A;  3RAQ A;  1L5U A;  4YFK A;  2HVI A;  5AI5 A;  3QX7 A;  1JXL A;  4AP9 A;  1T7P A;  5L1I A;  2XO7 A;  4NLG A;  5AIC A;  2Q0Z X;  5HHH A;  3PX6 A;  1ZQJ A;  2W7P A;  4MEY A;  5TZV A;  4F8R A;  2KN7 A;  4OJ6 A;  2YB4 A;  1X9W A;  5AKL A;  1NJY A;  1KFD A;  2W04 A;  4Z6F A;  3AU6 A;  2KSO B;  4YMN A;  4RNN A;  4QZG A;  4ED6 A;  2JEG A;  3WK6 A;  3C5G A;  4XRH A;  2QKQ A;  1Z3E B;  4KX5 A;  4B9L A;  2KP7 A;  2A19 A;  9ICW A;  4F4Y A;  4Z6C A;  5AK4 A;  4RQ8 A;  2YN4 A;  2EAN A;  5KT7 A;  2KE7 A;  4KLL A;  1ZRN A;  2KMD A;  1D9F A;  3I76 A;  3QUQ A;  1BVS A;  1U45 A;  4DS5 A;  4JMU A;  1N63 A;  2NO4 A;  3L3F X;  3RJE A;  3GII A;  4HYK A;  2EAP A;  3T5H A;  4ED8 A;  2DPJ A;  3RB0 A;  3Q8L A;  4M9N A;  3OTQ A;  5CJ7 A;  5HML A;  2HBM A;  5ALE A;  5KT3 A;  2ISP A;  3GV5 B;  1LKY B;  2M0N A;  4CRX A;  3KHG A;  4QIW F;  2K4H A;  1QCK A;  4C8K A;  3FC4 A;  2HOQ A;  4M47 A;  1NKE A;  1ZQB A;  5KFJ A;  1KL9 A;  3QZ7 A;  5KFT A;  7ICV A;  1RYR A;  5IIJ A;  4QZH A;  1RXV A;  2K4E A;  4EYI B;  2I9G A;  3Q8Q B;  2BCS A;  1BPD A;  4FFD A;  4YR3 A;  2BGW A;  2H5X A;  4AYB C;  2OM6 A;  5H2F U;  4UB2 A;  3FYH A;  2MSN A;  5J2F A;  1T3Q A;  4DQS A;  3ISC A;  1K1Q A;  2YY6 A;  3G6Y A;  5CWR A;  2ASJ A;  2C2R A;  4DLE A;  1NK6 A;  1PUZ A;  5CB1 A;  2PFO A;  5KFF A;  4P0P A;  4DWI A;  1WWV A;  4RU9 A;  4F92 B;  1MN8 A;  2Y0S F;  4O5K A;  2FDR A;  5KAF U;  2ATL A;  4WJ3 B;  4EX6 A;  1ZET A;  3PO4 A;  2E8M A;  3H8S A;  3GIL A;  1MSW D;  4JV2 A;  5ALW A;  5IIN A;  1NK8 A;  3C1Y A;  5DLG A;  1TV9 A;  2KKV A;  1IIP A;  1Z1B A;  2G08 A;  4Z6E A;  4FZL A;  5DBC A;  2K8A A;  2ZTE A;  4EYH B;  4KN4 A;  4O3P A;  2PXI A;  3KOO A;  4USA A;  3T5J A;  4QZI A;  2XC9 A;  3V6K A;  8ICC A;  4UBC A;  3PST A;  1ZQD A;  4BX9 C;  4ED2 A;  4XA5 A;  4YMM A;  5GTH U;  3RRH A;  2BR0 A;  2KOB A;  3ISD A;  4MEX A;  1VDV A;  1SL0 A;  4BUG A;  2F1I A;  5KFV A;  3QXG A;  1D9D A;  4JK1 A;  4PHE A;  1NJW A;  3WK7 A;  5J0S A;  3ETR A;  1LB2 B;  5ALN A;  4J9O A;  2PFN A;  3AEV A;  5L9X A;  2IOF K;  4NY8 A;  8ICR A;  3TAC B;  1JX4 A;  1HJP A;  4I2G A;  9ICR A;  3ZDB A;  5AKH A;  1UPH A;  4MFA A;  2R8K A;  5CEH A;  4C4R A;  2PMZ F;  2M9N A;  4LJX A;  2PFQ A;  2NO5 A;  4UB8 U;  5L1L A;  4Y2T A;  3HRD D;  2B0C A;  4PGQ A;  4Y2U A;  2FMS A;  3PW4 A;  2D6F C;  4IQW A;  3NVZ A;  2LYH A;  4ECT A;  5ALR A;  2W9B B;  2P6R A;  1JI7 A;  1D8Y A;  1S0N A;  2RDI A;  4ECW A;  1SV0 C;  2RQ5 A;  3EPG A;  3LVV A;  3WK4 A;  3PSP A;  5A0L A;  4PGY A;  4GXJ A;  1S77 D;  3NS1 A;  4QIW C;  1X9S A;  2MU2 A;  2RP5 A;  2ZTC A;  4QWD A;  1KLN A;  3BQ0 A;  1N5X A;  1NJZ A;  3WKC A;  4Q45 A;  5AKX A;  3NTU A;  3NVW A;  4TQS A;  5KFS A;  5KFP A;  5KG5 A;  1ZQO A;  4EEK A;  2EAM A;  4DO9 A;  4K4H A;  1CRX A;  7ICO A;  9ICA A;  4GXK A;  1YZ7 A;  3E0F A;  5DGA A;  1TK0 A;  3F5A A;  1U49 A;  3N28 A;  2V9W A;  2WAQ F;  4QZE A;  4F5P A;  4RT3 A;  4YR0 A;  2YTU A;  1RPL A;  1L8L A;  1K5O A;  3M7D A;  5B5E U;  2Y0S C;  5DG9 A;  4RPX A;  5AI8 A;  9ICN A;  3G6X A;  4DQQ A;  1M6Y A;  1L3V A;  1SZP A;  1S0M A;  4NV0 A;  4PHD A;  3RF9 A;  2N1R A;  3SAF A;  9ICU A;  7ICL A;  3GIK A;  4YVZ A;  3M9O B;  2Q4T A;  1ZQU A;  2LYB A;  4OJP A;  4TUQ A;  3MFH A;  4Y2R A;  1NI3 A;  3WK5 A;  1V9P A;  4M9H A;  1HEK A;  2J6S A;  5ALM A;  5DGB A;  2HHQ A;  1UCV A;  2YML A;  5KG7 A;  4I2E A;  3QU4 A;  4JUZ A;  1Z4O A;  2F76 X;  3PW2 A;  1IG6 A;  2VA8 A;  2AHO B;  2IA6 A;  1OUQ A;  3PZP A;  2UVV A;  4C4S A;  4PL1 A;  3WU2 U;  2DKZ A;  2A1J A;  4I2I A;  4C8O A;  4RQ7 A;  4M0A A;  9ICF A;  2F2A B;  2R8H A;  1ZQE A;  1T4G A;  2E8P A;  3JPP A;  3K4G A;  1P7D A;  3MC1 A;  1ZQC A;  3WK8 A;  3BQ2 A;  7ICT A;  4C8L A;  4CCH A;  3HKZ F;  3UMB A;  1KFT A;  2GOL A;  3RAX A;  2QB0 A;  4NLZ A;  4EEY A;  4P0P B;  4GC7 A;  2VA2 A;  2A3V A;  2MAX A;  4F71 A;  4DS4 A;  3I1Y A;  4UAY A;  4ECX A;  4J9K A;  1U47 A;  3RJH A;  2E1F A;  4Q8E A;  1QSL A;  2W03 A;  4U6P A;  1L6N A;  2ZJA A;  2ZXH A;  3M8R A;  3AN1 A;  3IV6 A;  3RB3 A;  9ICJ A;  4M04 A;  4ED1 A;  2K8B B;  8ICB A;  2ZIV A;  4BXO B;  4R64 A;  2LM1 A;  3ICX A;  1Q3U A;  3TKA A;  5ALD A;  8ICY A;  5ALU A;  4KN7 A;  3C5F A;  4JV1 A;  4CF5 A;  1ZQG A;  4ELT A;  4B6J A;  2E8N A;  2OXO A;  4CE6 A;  4MFC A;  5KFB A;  2Y9T A;  4YXJ A;  3F2B A;  4O0I A;  4IR1 A;  3T3F A;  3OHB A;  3H0R B;  2FLL A;  2JH7 A;  2EH9 A;  1WCN A;  4O5E A;  2AJQ A;  2H3I A;  2ALZ A;  4KLT A;  3K75 D;  1Z00 A;  5ALY A;  1KBU A;  4OD0 A;  4P2H A;  1X66 A;  3IDW A;  5KFW A;  1ZRM A;  2ZUB A;  3H8M A;  1XO0 A;  1SB3 C;  3NVY A;  1X9M A;  5KFY A;  1QQ7 A;  3DV9 A;  2PKE A;  2IOH A;  1SGG A;  3FDS A;  8ICW A;  2WB1 C;  2P35 A;  4OCZ A;  3BZC A;  3LWM A;  1ZQA A;  1ZJM A;  2LPE A;  1IXR A;  4F3O A;  2KD1 A;  4Y2X A;  8ICU A;  2IMW P;  2IHM A;  4M9G A;  2XGQ A;  3EZ5 A;  1BPY A;  5G5G A;  5J2D A;  3RB4 A;  2F1H A;  2BDU A;  3MR2 A;  4GXI A;  2KJ9 A;  1SKS A;  4O3O A;  3BS5 B;  3D2S A;  4C80 A;  5AM3 A;  5AM4 A;  3QUT A;  5CRX A;  4YR2 A;  4QW9 A;  2XGP A;  3PX4 A;  9ICO A;  1ZQ1 C;  3RH5 A;  1PVR A;  4F72 A;  3R9K A;  3PX0 A;  3KZI U;  3WKA A;  2KHV A;  7ICP A;  1B22 A;  4QWA A;  1O08 A;  4FBU A;  4RQ0 A;  2IOF A;  2HBK A;  2EZY A;  1RQN A;  2DKX A;  2W54 A;  4O9M A;  4I2C A;  4YP3 A;  4NJ8 A;  2RRD A;  1Z4N A;  4JWM A;  1HUZ A;  4NM1 A;  2G5I B;  1N60 A;  4RQ5 A;  9ICT A;  1X42 A;  3ZD9 A;  1FFV A;  1WYG A;  2ZXI A;  1UA0 A;  3HKZ C;  4QJF B;  3QYP A;  5J2E A;  3OSN A;  1QH9 A;  4KLQ A;  4OO1 J;  2C2D A;  8ICM A;  4NL9 C;  7ICS A;  2KHQ A;  1ZOL A;  4DQP A;  1Q8K A;  2OYY A;  5BOL A;  5BOM A;  2KJ5 A;  4F4X A;  1KQQ A;  2LYA A;  3ETL A;  3MGH A;  5KT4 A;  4KLM A;  2EDU A;  3K1Z A;  4RQM A;  3MFI A;  5F9N A;  2DQN B;  1CI4 A;  5G5H A;  1NKC A;  1SV4 A;  4KLU A;  2WHE A;  4BWJ A;  2EAO A;  2VJ5 A;  3T79 A;  5J0T A;  5DB9 A;  8ICG A;  1SV0 A;  2HHU A;  4TUR A;  3V6J A;  4YCX A;  2NRV A;  1A6S A;  1JRO A;  1SXD A;  4CF4 A;  5HHI A;  1DOQ A;  4DFJ A;  4O3M A;  4RQN A;  2KTQ A;  4XUS A;  4DCC A;  3F53 A;  3HIL A;  3PW5 A;  3N7S C;  3HT3 A;  4J9Q A;  1AQ6 A;  5AM5 A;  2JEF A;  3MBY A;  3QUB A;  3BS7 A;  4YN4 A;  7ICE A;  1ZD3 A;  1ZYQ A;  3NAS A;  2H3F A;  4KTQ A;  4F91 B;  3A0B U;  2A1J B;  2P6U A;  2R8J A;  4ECZ A;  4KMU A;  2ZIU B;  3TFR A;  4P4P A;  5ALG A;  4DSK A;  2C28 A;  3KHR A;  4KLG A;  2DFL A;  5KFM A;  9ICS A;  2K4P A;  3PY8 A;  4JWN A;  4HAI A;  4ICA A;  4BWM A;  4US8 A;  4C8N A;  1JXE A;  3D2N A;  2F77 X;  3QEB Z;  2G09 A;  9ICB A;  8ICF A;  2A1A A;  1PVQ A;  4ELU A;  1X6J A;  3AM9 A;  7ICQ A;  5L1M A;  1XU4 A;  5ALL A;  9ICL A;  5CHG A;  1TAQ A;  2ASD A;  3C1Z A;  5ALI A;  4R8U A;  4Q8F A;  1D8L A;  2ZIV B;  4DEZ A;  2BPG A;  2AH5 A;  1PK3 A;  2R18 A;  3VC8 A; 
#chains in the Genus database with same CATH homology
 1SV4 A;  2KE7 A;  1X9X A;  1SGG A;  2EAO A;  4IS7 A;  2KMD A;  3SEI A;  2QAR A;  2DKZ A;  5J8Y A;  2KIV A;  3BQ7 A;  3KKA C;  5JTI A;  2E8P A;  4NL9 A;  2LMR A;  3SEN A;  1OXJ A;  1PK1 B;  4PZO A;  2L5Y A;  2EAM A;  1SV0 A;  1B4F A;  2LPE A;  1DXS A;  2F8K A;  2EAP A;  2ES6 A;  2QB0 A;  1KW4 A;  5JRT A;  2K60 A;  1SXD A;  1Z1V A;  1OW5 A;  2F3N A;  4MHV A;  1UQV A;  3TAD C;  2FE9 A;  3BS5 B;  2B6G A;  4RQN A;  1LKY B;  2YTU A;  3KKA A;  2KSO A;  3HIL A;  2DL0 A;  3TAC B;  2F44 A;  3BS7 A;  2GLE A;  5JU5 A;  2D8C A;  2D3D A;  2ESE A;  2QB1 A;  1X40 A;  5F3X B;  2DKX A;  3TAD A;  4NJ8 A;  3BS5 A;  1F0M A;  1V85 A;  2E8N A;  1LKY A;  2E8O A;  1WWU A;  2K4P A;  2Y9T A;  1PK1 A;  2KG5 A;  1SXE A;  2QAR B;  1JI7 A;  5J8Y C;  3K1R B;  4NL9 C;  2KSO B;  1WWV A;  5L1M A;  1COK A;  1SV0 C;  1UCV A;  1B0X A;  2E8M A;  1X66 A;  2QKQ A;  3IDW A;  5KNI A;  2QB0 B;  4PZN A;  3H8M A;  1V38 A;  1PK3 A;  4RQM A;  1RG6 A;  2JV3 A;  2EAN A;  2Y9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...