1PK6B

Globular head of the complement system protein c1q
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
TQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the globular head of complement protein C1q provides a basis for its versatile recognition properties.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement C1q subcomponent, A chain precursor
total genus 30
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pk6B00
2X29A 4HT1T 4N90A 4QQOA 2HEWF 4QQPA 3ALQA 5BNQA 2Q1MA 1S55A 2RJKA 1A8MA 2WNVA 2Z5WA 4QQLA 4GIQA 2O0OA 3L9JT 4KG8A 5KC5A 1PK6A 1DG6A 2OIIA 4QQHA 3V56A 3TYJA 4MXWB 1RJ8A 4DB5A 4EN0A 1RJ7A 4KGQA 5L36A 2TUNA 4TWTA 2Q8OA 4TSVA 4OULA 1JH5A 1U5ZA 2QE3A 1U5YA 1OQEA 2HEYF 1PK6B 1I9RA 1OSGA 5L19A 2WNVB 3AB0A 1WCKA 2WNUA 1OQDA 4OUMA 5TSWA 2JG9A 2KA3A 4KGGA 1GR3A 2WNVC 1XU1A 2JG8B 5KC6A 2ZPXA 1C28A 3K48A 1KXGA 3IT8A 4MXWA 4G4FA 2JG9C 3FC0A 1TNFA 5KWRA 3QD6A 4QPYA 2RJLA 4QQ2A 4MXVA 3K51A 1IQAA 2R6QA 3WD5A 2QDNA 2ZJCA 4DOUA 1C3HA 2HEVF 3B9IA 3TWIA 2TNFA 3MI8A 1D4VB 2AZ5A 1XU2A 4G3YC 4E4SA 3QBQA 4MSVA 4E4DX 1D2QA 1U5XA 1ALYA 2JG8C 3B94A 1KD7A 2RE9A 4RSUA 3ME2A 2R30A 2JG9B 4D7YA 1O91A 5HBAA 3URFA 5CIRA 4OUSA 2JG8A 2E7AA 1JTZX 1PK6C 1TNRA 4F3JA 2WNUC 3B93A 1DU3D 1D0GA 4J6GA 3LKJA 2R32A 4NN0A 2WNUB
chains in the Genus database with same CATH superfamily
5I0UA 1GQHA 1WMDA 2AUYA 3U14A 3WG2A 4YVWC 1RVF2 4PDWB 1J1TA 1FXZA 3CL1A 1CONA 5I0DA 2A6VA 3ZYJB 4BQ5A 2NPIA 2Q1MA 3LA2A 4MYEA 1N3OA 2G1MA 1ONAA 1ZVFA 4PIXA 4I2OA 3AZVA 1W3XA 1ZREA 3MICA 4Q8LA 4XF4A 1PK6A 1FI2A 1XQNA 2JDHA 4PLNA 4XUTA 4DRVA 2VBBA 1YWKA 1DLLA 5KXBA 1EV12 2XUEA 3UL2A 3V56A 1MZ6A 5C33A 1C1FA 4UFJA 1O5LA 2C24A 1QWRA 2O14A 2O8OA 2BDRA 3HQUA 2VAUA 1NZCA 2YUEA 5T50A 1W6OB 4DINB 1S2KA 3WNOA 2QE3A 4OYUA 1E5SA 3NRUA 4XJAA 1EUTA 4KQ7A 1F35A 3B69A 5JCTA 1URXA 3FBYA 3H50A 4IEYA 1OA3A 1UZVA 2GSYA 4CCEA 2QQUA 3FLRA 4JQTA 4MGYE 5JOZA 4TN7A 1JHNA 4RGGA 1OQDA 3KF3A 4GB32 4L2NA 3N9PA 4TLFA 4ZS3A 2QDRA 4DFSA 5BXXA 3L2HA 3ZKYA 5JXGA 3D0SA 1XU1A 2WABA 5K9YA 4JVAA 1W6OA 1SFYA 2ARBA 1I5ZA 2XJPA 5H9RA 2Q5TA 2AENA 2C9AA 2YGMA 3HNBM 4FTSA 1QXPA 4QB6A 3VV1A 2JD4A 2QQLA 1C4RA 4QHOA 2D6NA 2VR4A 4DUWA 5JR7B 2JDYA 3AKPA 4FOWA 5LBCA 3ZN6B 4Y1VA 2WA4A 2ZZQA 3FWEA 1OOPB 2BOIA 1JYVA 1TNFA 2VNRA 2DCKA 3MPBA 3FUOA 3N4MA 3DECA 2BFUS 3NVCA 5JLVA 4PQ9A 1JYTA 2VZ3A 1C3HA 1CAUA 2PXJA 3R4UA 2FMYA 3BODA 4NAOA 3TN93 5DAPA 3T4HB 1D4VB 1US2A 1PM4A 2BWAA 1MEC2 2A7AA 4I0WB 1PVC3 2DFCA 5T5LA 1I3HA 3AP7A 4NIHA 1REEA 4GH4A 1AF9A 4QM8A 1JYWA 3RZKA 1U5XA 2D7FA 2R042 3MIHA 5FQ0B 5C9AC 1LJ7A 3LWCA 4Y5Z0 2XB6C 2FDKA 1W9YA 3N7JA 4QPGA 1WMXA 5DDJ3 5K8SA 1CVNA 1NYWA 1J1LA 2DBIA 1ZZ8A 2XOMA 3CU7A 3HT2A 3OY8B 2BERA 3POGA 4ZY9A 1PHMA 4A41A 1VBC3 2Y34A 4BQ2A 1UU6A 4NHYA 2BP6A 2KXLA 2R32A 5AFEA 4AI3A 4Y33A 4AR2A 1ZM1A 3WHUA 3OCPA 3OGJA 4HBNA 1ZRFA 3WQ7A 5IVCA 4BU2A 5FPBA 4DIQA 1VAVA 2W5FA 2VMFA 4QQOA 3H3UA 5JOWA 2VXJA 1RUG1 2PHDA 3ZFFA 3VBHC 1A34A 2MHFA 5FYTA 3T2TA 1H4HA 3ZSMA 1TMF1 2Z5WA 5ACA1 3C8XA 4CPBD 1RUF2 2PHLA 3H9AA 3AP6A 1GQPA 2V73A 1DG6A 5DQ0A 3MIDA 2W87A 3K4AA 3C3VA 1V6JA 1GANA 4WZCA 3B9CA 3WG3A 4COVA 4ES8A 1YQ5A 4M4RA 1B35B 4BLIA 4YGDA 1W04A 2XLAA 3ETPA 1Q8SA 4OMDA 3JZVA 3S30A 4AQTA 1W6MA 2I74A 1COV3 3ZLIA 4COUA 2D40A 4XF9A 1OQEA 4HONA 4FPHA 4OHZA 1COV1 2VU9A 1W8ZA 4QHZA 1CAWB 4A42A 2RVAA 4JRAA 4LBLA 4ATEA 4G9SB 4Y5SA 2VL4A 5E1RA 3NNGA 4I01A 4ZU5A 1Z7S3 4ASKA 2RS31 3FHAA 1F8VA 4HPKB 2BTVC 1BEV2 1V6MA 2ZEZA 4Z8BA 1ND3A 1VBD1 3KF5A 1XE8A 3MHZA 4LKFA 5IW0A 1EAH1 2ET7A 3CJXA 5FKBA 1QJEA 3ACLA 1OURA 2JECA 4QX5A 5FOJB 5F37A 1IS5A 1LTEA 2GNBA 3PJYA 1Y43B 4HKWA 1T2XA 2ZX2A 2RS12 5CEHA 2YFZA 1GUIA 2PQSA 2BBAA 4B3NA 2ZEWA 1G9CA 3ILFA 4YG3A 2R0HA 2E33A 2ORXA 4IE5A 4N43B 4HN1A 5FMOS 4AFAA 1LOAA 3J26N 1ND3B 2XVKA 4Q4W1 2EVXA 4YZ1A 4MGZE 1PO13 2RJ2A 2VCAA 1LENA 3G7DA 3AMNA 3PVEA 1O8PA 4AHXA 2ZOEB 3SCHA 1FPN2 5KWRA 2WWUA 2HWE1 2P37A 3AFKA 1RMU2 2MEV3 5D8AB 2ZJCA 3WD5A 1MZ5A 4YNIA 2YBPA 5IJRA 1MEC1 3CIHA 3ZYBA 1REFA 4LO4B 3UKVA 4ARYA 3I49A 5ISLA 3M3OA 1UXXX 3P1IA 2P2KA 4I3PA 4XCBA 4GWIA 4QAWA 1YQ2A 4MSVA 1YI9A 3T2QA 1DYKA 2QQMA 4FFFA 4Q4W2 5T52A 4AVSA 5CADA 5F3CA 3ETQA 3B00A 1AR62 3RJRA 4QB1A 1ALYA 4E8DA 4L92A 1BVVA 4AVTA 4Q4Y1 2RE9A 1NCRC 2WQZC 2AR6A 1XB9A 1AHSA 1YJLA 4DY3A 2WO1A 2D6LX 5D8AC 2DUOA 5FZ6A 4GXLA 4OLLA 4FPGA 1Q43A 3H42B 1QJX3 4QX1A 4RFT0 1TNRA 4AFDA 4N53C 3FL7A 4P9XA 4YW6A 4DEVA 2H6CA 1W3VA 3VBUA 1MS1A 2W1SA 1RUI1 1DU3D 2YBKA 4A7YA 5CFDB 3ZXDA 2HBUA 5LEJA 1NCQB 2XH6A 4YRDA 3JBG1 3LKJA 4CCJA 3PU3A 4P9YA 4XACA 3AJYA 3ON7A 2NQYA 4J25A 4PIYA 4CU8A 4QM9A 3OG2A 1FOD1 1RUE1 1NOVA 2VPVA 1KFUL 3I59B 4R4ZA 2IFWA 4K1YA 3MEPA 2PLV2 2Q4SA 4KU7A 5CB7A 3THCA 4H55A 1JUIA 1VAMA 5FZ8A 1DP0A 1JYNA 1HV0A 4K8FA 1S55A 5JMCA 1UWWA 4CUAA 2X53S 2JWPA 1W8WA 3RZGA 1W8HA 2J7MA 4NIDA 2RS33 2PMWB 1FNZA 2OQ6A 2LROA 3FHQA 3JD72 2O8QA 2GMPA 3LA3A 3MLJA 3QOPA 2GC1A 1NT0A 3ZKUA 4YARA 3VDCA 1IS6A 1YJKA 2ZABA 1H2MA 2PA7A 4FOYA 4IE4A 1GZCA 5L36A 1VB2A 5A1AA 1U12A 1OVSA 1TG7A 3D82A 4WM7B 2RDQA 2YBSA 4MVTA 1DZRA 1N1YA 1SBEA 1U5ZA 3V0AA 1RUD3 4JKKA 1U5YA 1AR91 2WWSA 2XBO2 5C8WA 2OS2A 1NUKA 2QQKA 3LEMA 2JICA 1HXS2 1R092 4AYUA 3VLBB 1TME3 2JDMA 2VZTA 1BEV3 1MQTB 3GXUA 3WDXA 2BUKA 2Z4FA 4Y4YA 3KV5A 4JHZA 1Z7S2 3EO6A 2Q8EA 2VOXA 2YB7A 3CQOA 2FQPA 1XC6A 4PDWC 4UXAA 1UZYA 2VC9A 5FYSA 5ANQA 4AK3A 1NLRA 4XXPA 4QHBA 5EPAA 4Q0VA 5BNPC 4XUPA 2WNVC 3SH3A 5KHGA 4E2GA 2RMU1 2GDFA 2XLGA 1LGNA 4FPOB 5DABA 5LATA 3MIFA 4Q0QA 3BVCA 4GB31 4ONUA 2E63A 3FFZA 1UY3A 1QDOA 1UX6A 4G4FA 3VBOB 1AR93 5ACA3 2OZ6A 1DYPA 1W0PA 3POEA 3SKJE 4RL7A 4K9SA 2A73B 2IUWA 1J59A 1IQAA 1PO23 1H1AA 1OOPA 5FUPA 3WNNA 3TWIA 1UL9A 4AZZA 5FPXA 1NA1C 1YO8A 2EIEA 1ZA4A 2I07B 4M4PA 5EJZB 2J1TA 3RRDA 3N9LA 5FP9A 4YVSC 3VBFA 3WP3A 3OB8A 4GWJA 4KNCA 1ZZCA 4Q4V2 3I2IA 1XXNA 4I0BA 1QXRA 4ZPIA 1SPPA 5IWFA 2IWGB 4AE2A 1Y4WA 2FCTA 2WNOA 1OF3A 4QKBA 1PK6C 4ASLA 1J84A 3WV6A 4AGGA 5HCBA 2A1XA 5D8AA 1DBNA 2GC2A 3HPNA 2YG0A 3PHMA 3ZO0B 3I3BA 3JBG2 4ISRA 4UBHA 1ULOA 4A2UA 4AG4A 1OC1A 4IEXA 1K45A 4NN0A 2XKOA 4KBBA 5BNOA 5IVBA 1BQPA 1W06A 3KCYA 2Y0OA 4C0HA 4JGYC 4PF1A 3TOJA 2NMOA 2WFF1 2XJUA 4KWKA 4F83A 4P9GA 4CUGA 3MW4A 3FUQA 1CX4A 4FPEA 3PTYA 1IS4A 3Q9OA 5FY0A 2HWD2 3ZDVA 5FZ3A 2IXIA 2RJKA 4CDQA 3I2FA 1W2OA 3POJA 2HWD3 4KWUA 3VHOA 2LM3A 1QH6A 3AP9A 5F8PA 3L9JT 2B9UA 4QDQA 4WVVA 4U2AA 3WUCA 3N7LA 4S2GA 4MGTA 2IZWA 2UY9A 4P9WA 2YPDA 3C7EA 5FAXA 1WLDA 2C4XA 1YEWA 2WA3A 4GALA 3DYOA 2OKXA 2ID4A 3I3DA 4MOAA 3INAA 1ULPA 5E89A 3EMRA 2WZEA 1BK0A 1AJOA 3FFQA 4MG2A 2XONA 3FZ3A 1QJFA 3IIAA 3O0XA 5FYUA 5LZ6A 2B7YA 1ZRRA 1JHJA 1ZZBA 2LTNA 2VO5A 3NQHA 4L9BA 4CCCA 4YZ3A 3MYXA 4XQWA 1OUSA 1F15A 4JGZB 4Q1PA 4P02B 4CEYB 5LWBA 5BNOB 5FZGA 1ZZ9A 4Q4V3 4NIGA 5J3UA 2XJTA 5FMDA 1RGSA 4QKNA 3RMXA 4BE3A 4LK6A 5C5TA 2PAEA 4Y24A 1J3QA 5GJ6A 5D1IA 4CSWA 1X36A 1RUD2 2Y64A 2BJSA 3POSA 5GLWA 2IXCA 3OYWB 1PVC2 2ZX0A 1H9PA 2ORZA 1S0CA 4GWMA 2AREA 3A22A 3RSJA 3TNQA 2YU2A 3VDDB 2YC0A 3T08A 4S2DA 4Z92B 3MF9A 1UY4A 4PHZA 1DGWA 2NM1A 4CPBA 1M4WA 4BIFA 1E5IA 3BALA 3PURA 4A4AA 4EYUA 2LS6A 4FP3A 2PHFA 1JZ2A 1W8UA 1YFUA 3AKTA 4IV1B 2RS32 1BBT1 3K2OA 5FZFA 5A7QA 4LORA 1UKGA 4YVSB 3VD5A 4DUVA 2SLIA 3OD4A 4QDRA 4MGKE 3A0KA 1HKDA 2WLPA 3N7KA 1SZBA 5JSPA 3O1MA 4HVRA 4XETA 1MQTA 2W46A 4PQQA 2GP5A 5LA1A 4NHKA 3QBQA 5DUWA 1RITA 1AYM1 2BQPA 1N1VA 4E4DX 1WUVA 4I0AA 1V6NA 1DQ1A 4D6QA 5ACA2 1C57A 3RWKX 1RUH3 4ET7A 1UYZA 4ES9A 1G8WA 3RMYA 5LB6A 3FX3A 1W0NA 2CWMA 3SEEA 1QOTA 2DCTA 2WNEA 4PCRA 1BK1A 1UO9A 4LBOA 2PHXA 1WLWA 3ZIWA 2OYZA 1SEFA 3FLPA 4R9BA 2B46X 1ZNPA 1SQ4A 5DUUA 1JOPA 1RXFA 3M2MA 4H7LA 1VBE2 4RGAA 1NAEA 1D0GA 1GYKA 2VE1A 4UFKA 1OHFA 3BIWE 4K21A 4Q4X1 2X29A 4QPIB 1T6BX 3KT4A 5F5IA 4JQRA 4LQRA 2HYKA 2ZS6B 1X8EA 4JDOA 1FMD3 2BVVA 5A7WB 3RG0A 3H1MA 4YGCA 4B1LA 4A45A 5CVRA 4Q5OA 2AH2A 1DQ4A 4H7MA 5BNQA 3MFCA 1QU0A 3VZOA 1OF4A 1WLCA 5IFPA 5F7UA 3AVSA 3VKOA 3BIEA 1U5IA 4HMZA 2ZMLA 3GCXA 5FO8B 1VBA3 4LBJA 5EYYA 3LOBA 4NOTA 1CAXB 3QH7A 4YM3A 1UZZA 1JBCA 1VBA2 1YYNA 2ARCA 3JBG3 4WVWA 3TYJA 5J36A 5APAA 2E53A 1ND2B 2G9ZA 5KXEA 2KD7A 2VVFA 3WDYA 1V9U1 2VOWA 3PTRB 5CYYA 4FAHA 2ZHLA 4LOTA 1CIYA 5FY8A 1VE0A 2B45X 3I3EA 4NIIA 4ZZ5A 3JD71 3ZPYA 3FMGA 3HMYA 1VBD2 2P4EA 1PX3A 1YFXA 1EAH2 2HEYF 2ZKNA 5A3UA 1YNAA 1CAVB 3WF3A 1CGPA 1N47A 1VPHA 1QJX1 4BHPA 5JWPA 4IGOA 1WCKA 3AM2A 5FYBA 1LODA 2VTXJ 3SH5A 3HEIA 2RR13 1C8M1 3VD9A 1F4HA 4OUMA 5FPLA 3OOXA 1F2NA 4QT6A 5FLJA 2ZHKA 1XNDA 4A6OA 2V5DA 3DUIA 1PVC1 4GA9A 4IE7A 1JYIA 3VBUC 1GZTA 3R4DB 3AYDA 3KM5A 3WSOA 3H1WA 1C28A 1WW7A 1CZSA 3Q8FA 1PNGA 3C7OA 2E51A 3KV6A 4QPGC 3WOGA 4AAPA 2DTWA 3OD0A 5JAXA 1WW4A 3IMMA 5JZGB 1GNHA 3WQBA 1APNA 2XJRA 4C91A 1MZEA 3SMHA 1AR63 3SXWA 2ETEA 4W8JA 1ASJ2 1AYN2 2ZGUA 4Q2FA 2RM22 4IXLA 2WO7A 4QPYA 4MXVA 3K51A 4K20A 4L11A 4IEUA 1SLCA 5GZDA 3V0AB 1QJU1 4WM7C 3FHIB 2ZGMA 4FQZA 3MV11 3O1PA 4DNYA 1H8TA 2ERFA 4LKDA 5J37A 4ZU7A 1K5MB 2D98A 1CJDA 4UFHA 2G9GA 4LIUA 1UNBA 3UJOA 4YG6A 5L9RA 5HI0A 2D5HA 5F32A 2E6VA 4CU6A 3R4SA 1VB4A 2BVBA 3C7HA 1WCSA 3ZOIA 2J1SA 3ME2A 3BUCA 3VKNA 3KWVA 3VHRA 4PF5A 4IEQA 1ND3C 2WO2A 2B5HA 1S0FA 3EBRA 3WZ1A 5BV6A 4XQDA 1X9PA 3LFMA 4FCAA 2XG3A 4RHV1 2FZ1A 1NY71 3MIEA 3ZDSA 4BQ4A 3B93A 3EYPA 1W90A 1WLTA 4JGYA 3RQ0A 3VBOC 3VUOA 3V0BB 2GN7A 2W91A 4YLZA 2X09A 4QGNA 4J6GA 5FZOB 1RUJ1 2RHPA 2VTXA 2WN3A 4FO9A 3KT7A 5LBFA 5GZGA 1AL0G 2WT2A 3HQXA 4FPLA 2WNUB 4FPYA 4HANA 4XW3A 2XJVA 1PMIA 4IEPA 2QQVA 2ZGOA 1Q5OA 3MGUA 3ITQA 4B4RA 3WDWA 4QD2A 1O8SA 3I97A 2A3YA 2QNKA 4XFBA 4CDUC 3P3NA 2N7GA 3WUDA 4XBNA 4IE0A 4O7XA 4Y22A 2RR11 1HJGA 3NKTA 4V2WA 1OMIA 1XYPA 5JI9A 1HRI3 1QDCA 3I2JA 1F31A 2WFF2 3PUQA 2P3YA 1A78A 1X33A 1VBE3 3AZZA 4YM2A 4CCLA 1JZ3A 3HQRA 4S2FA 1RJ8A 4AI9A 4KGQA 2TUNA 3H7YA 3PLQA 4TWTA 2Q8OA 2TBVA 4HVQA 1VBC2 4RS5B 3VBRC 1H8VA 3I2OA 2ZXQA 2C6SA 3ZN4A 3ZYRA 4ZKTB 1PK6B 1GZWA 5I91A 1GWKA 3U75A 2R16A 1VMFA 1DIWA 3IDEA 1H8TB 4N9IA 1W6QB 3VBUB 2ZGSA 4EZHA 1DDLA 2ZAAA 5FZEA 2DV9A 3P3PA 1ZZ7A 4DO0A 1AR81 1WW6A 3ACHA 4CRQA 3O1SA 3RZMA 1YHFA 5B2GB 2ARAA 1ACCA 5KHIA 5A7WA 5B4NA 5C5UA 3KV9A 3LD8A 4Y20B 2VCCA 2R1BA 4HKOA 4HK9A 3ACGA 4IQPA 3KT1A 1ULGA 5LRRA 3I2DA 2ILMA 5IK4A 1PO12 2PHTA 4V2VA 2W68A 1SFNA 2BZDA 4Y1UA 1RUH1 2OPKA 2WAAA 2HWC2 3S6PA 1ZX5A 4OQ8A 2YDEA 5JIUA 3LEIA 4NIAA 1W8OA 2HYXA 2VBPA 4BJ0A 2J1VA 4BPZA 3WR0A 4H3WA 1VRH1 1MEC3 4XE9A 1UPIA 3NNMA 4JX0A 3LQCA 5LK7B 2MEV1 3B9IA 5CU1A 4B29A 5I0RA 1WD3A 5A1LA 4AHYA 3WNPA 2P5BA 4W4ZA 4TTGA 1QIQA 3T1MA 2FCVA 3O12A 5DUXA 1AYN3 3RZJA 2GC0A 4XUNA 3IWZA 1K3IA 2IC1A 1HB1A 1W9FA 4FFIA 1RVF1 4K8RB 1UW8A 1FV2A 3FJSA 3M3EA 2FDHA 2WT0A 5IVJA 5LA2A 1KD7A 1CD3G 2VQUA 4QGLA 3BPZA 1QJY3 2BGCA 2UYAA 4JCKA 4FTEA 1SG3A 4LA3A 1NCRA 1QH7A 5FYYA 5FYMA 3ACFA 2ZGRA 2W39A 5FUNA 1XOYA 4EWEA 5FR3A 3SCFA 4EROA 1IG3A 1SHWB 2XUMA 4M3CF 4AVCA 1DQ6A 1DZTA 4CDWB 3VBRA 2VVDA 3OJBA 5A80A 5FFOC 1HJFA 1QEXA 1QKQA 3RDIA 3CLPA 1OPOA 2V72A 1HW5A 3VBOA 1SLTA 2DVBA 3IN9A 4BDVB 2HKXA 3VHNA 4IDZA 1G7YA 3MZHA 1UOFA 2DUPA 1EV13 4MUVA 5GKAC 1HXS3 1R093 2RG4A 5ANNA 3SEPA 3TEYA 3W5MA 4X6RB 3IBMA 4AEDC 4L97A 4CA9A 2X05A 5HPOA 3CDZB 3BTXA 1NKGA 2F4PA 4X8NA 2WNVA 1RYYA 4QXHA 1CIWA 5GALA 4LUKA 5F5AA 2UURA 1D7PM 3VDAA 5IFTA 3RGBA 4JRLA 4A7KA 3MBWA 4NJ4A 3OPZA 4COWA 5JPNB 1PGL1 2J1RA 1JW6A 1AVBA 3DKQA 4BXSV 1WZXA 1NXMA 2OIIA 4HSJA 5J48A 1CAXA 5KHHA 4CDXC 5HV0A 1YRZA 1XYNA 5FXVA 5GZFA 1RUOA 2CWSA 4IEOA 3WDUA 1POV3 1BCXA 2Z69A 4Z07A 5H9SA 3K75B 1ULDA 3LB9A 2Y6HA 3J7MA 4UT5A 3VL9A 1REDA 2YROA 1S2EA 4A44A 4LK7A 2JX9A 4MO3M 4XPVA 2WYFA 2VCBA 4BWOA 1XNAA 4UI9L 3ZSKA 1AJKA 3VDBA 1DGWX 5EYXA 4DXRA 2TEPA 2VTFA 1SCRA 2Q8CA 4Q4Y2 1GWLA 2L9LA 3M8LA 1OH3A 5AVPA 3OTFA 3POWA 5T5JA 1OA4A 1LGBA 1J83A 5F5CA 2VQAA 1HB2A 3KZ4C 1GMMA 5A3MA 4XYXA 3IPVA 1YFWA 5CFCC 5LA0A 3O1RA 3ZSEA 2VQTA 5GZEA 1QF3A 1QQP3 4CXYA 4D7SA 4FOQA 4AFCA 3BGAA 2EIDA 4ZS2A 1DGRN 2FDFA 1XNKA 1KEXA 1OUXA 2UWCA 4OHVA 4P14A 4PI2A 4CXXA 4Z2AA 1QMJA 1RUG3 5A32A 3FLTA 3ZFGB 5JMOA 1J3RA 1ODNA 1OFSA 1W9TA 2LALA 3DKWA 4GB33 4HL0A 1ZRDA 1UIKA 4AVBA 5L9BA 4CP2A 4Q4Y3 1S0BA 2ZX1A 3AYAA 2RR12 1H2LA 1WD4A 1EPZA 4PT6A 3OBTA 3QD6A 4XZUG 5T55A 3BU7A 5FZDA 3SLIA 3UGFA 1XRUA 4GMP3 1XE7A 3GYDA 2CSGA 2YU1A 5CFCB 3SNMA 1XYOA 4YW5A 4CEWC 2P17A 1DF0A 3NV4A 1N1TA 4Y26A 5FOBB 5GLUA 2VZOA 1NCRB 4Z82A 2G9FA 5I0TA 5DXDA 2X5IB 3HJRA 2XHNA 2YYOA 1FPN3 1FV3A 2VZ1A 1QQP1 3LE0A 4Q0PA 1XJAA 1BXHA 5LK5A 2BOJA 1EPWA 1Q3EA 2PQQA 3J4UH 5A33A 3W9AA 3ZN5A 4DXTA 3SC7X 5A3TA 4GJYA 4NVPA 1ZBE2 1KJLA 2JG9B 4D7YA 1L3JA 1BBT3 1AR83 1Y9QA 3B5LB 5EIYB 4ORFA 4IEVA 2EXHA 1OD3A 1K12A 2ZEXA 3AJZA 1MACA 1UOBA 4NWVA 3PNAA 4KBZA 3WQ0A 3TN92 1WCUA 2W94A 2Z2SB 3NNJA 4K6BA 3IKWA 4N53B 4WVZA 4XHBA 2E26A 5FYZA 5A32B 1ULEA 1ENRA 2AC1A 4W6WA 1O6UA 4MGIE 3CO2A 4QMAA 5ABJB 3WDTA 2HWE2 3RI8A 4UBGA 3EHKA 3D8CA 1BYHA 5FPZA 5T5PA 1R1A2 4HZFA 1JZ8A 5KR7A 4N90A 4XBLA 1H2KA 3NAPA 3PVNA 4AL9A 1PO11 4COZA 1EYBA 1CPNA 3VL8A 1ND2A 4R52A 3OGRA 1W03A 2HWB3 5HXMA 3LZZA 3PL0A 2WZ8A 2WDBA 3O0VA 5FK7A 3CMGA 1JYXA 4E27A 2QQJA 3W20A 3LA7A 1UOGA 4WVMB 3MUZ1 3WP4A 2VG9A 4M3CE 3D0JA 5IVEA 3HR9A 4XC9A 3AMQA 4YZ4A 1PZ7A 5C6CA 1PVXA 3H8UA 1H2NA 3POBA 5AFBA 2FMDA 5C9AB 4CDWC 3N35A 3VZJA 5A7PA 5A6QA 1IHMA 3ZXGA 3AMHA 3VN4A 4NPRA 3B02A 5AVAA 4DRRA 5AC93 4XMAA 4ASMB 3RI9A 1CZTA 2WS93 3MIBA 4XJWA 3LIHA 4AVAA 1DQ2A 3AKQA 5FKCA 4XTPA 5DAVA 3WCRA 3BTZA 4YW2A 2WC2A 2JKXA 2WNVB 5C8CB 4AEDB 1V70A 4NR1A 4DPNA 2ZAHA 1UY2A 1PZ8A 1PO21 4Y4RA 3GZAA 3VDDA 5A6ZA 1HV1A 1GR3A 1H30A 1VBB2 1TVGA 2AACA 4LOSA 4QX8A 3RYRA 4YW3A 1SDWA 4MGSA 3PUIA 3NNLA 2ZGLA 3BN6A 3NWKA 1NQJA 2JKBA 2C1FA 5A3WA 4YSFA 5JOYA 3Q8CA 3K77A 1KDMA 3OUJA 4ZU4A 5EJ1B 2JEMA 1AX1A 3VBRB 2ZGTA 1OFNA 2V09A 1KS4A 2WZR1 2VMHA 3IT8A 2C0ZA 5FY5A 4RA0A 3VD7A 1G9DA 4OI2A 5A33B 4URTA 3U4XA 3I3MA 5CAZA 1NA1A 2WLQA 4JAAA 4LBQD 5J1XA 1CX1A 2BRTA 4XOGA 4IESA 3BOWA 5I93A 4LXLA 4NROA 4XILA 1GP6A 1RTVA 2Y8KA 1TMF2 1RUJ2 1O3SA 4AI1A 4YVSA 2QQIA 1Y3TA 4RS5C 5JXJA 4CU9A 5F6KA 2XLFA 3ZXKA 1G9FA 2F6BA 3QH6A 4DOUA 3D3AA 4OZOA 3RYPA 3LFIA 2H0VA 3W58A 3VKFC 3ATGA 4B7KA 4RGKA 2TNFA 4YFZA 2E7QA 3HNMA 2HWC1 1KRIA 2YPJA 4E4SA 1L7RA 4LR4A 3VBSA 5CG8A 1SBDA 1LU2A 2VZQA 5FZ9A 2C9KA 4HOOA 1CQ9A 1H6XA 1VRH2 4OCTA 4BH9A 1AYM3 4XFCA 4FP2A 3RZLA 1O3TA 3S7IA 2WFF3 1VRBA 1AL23 1GQGA 4WM8B 2R30A 5J09A 5IAXA 1HRI2 2AYHA 5FP3A 3OBRA 4IGQA 3KQRA 5JZGC 3DXTA 3RZHA 3OY8A 4AGVA 1GFF2 2EALA 2VCMA 1KITA 1ENQA 2Y6LA 3M3CA 5A3PA 5I8YA 2YGLA 2QZ2A 5JVVA 1Y9MA 2GMMA 3T3YA 1E5RA 2PELA 3MUY1 4X6QB 5FPUA 1C8NA 1W8FA 1ZA7A 4HETA 2UWAA 3NKGA 3ORJA 3OUHA 5EWSA 4LE3A 4D69A 4L8QA 1MS4A 2RM21 2FD8A 3I59A 3JUUA 5B4XA 4DMIA 3K4DA 4F7ZA 3LIGA 4UFMA 3NMBA 4NRPA 4K40A 3ES4A 2GC3A 4CUBA 5DMYA 2BV4A 3I54A 2ATFA 1QNWA 4CDXA 4BCUA 5JR2A 5KHJA 1W6QA 3ZX7A 3W59A 5FZBA 2DVDA 3GBGA 3ZR5A 4QPWA 1MS3A 1VBC1 2HWE3 1W8TA 4JGZC 4CEYC 1HN1A 1D4M2 4BQ3A 5KXDA 1AZDA 2EA7A 2A70A 1HRV1 4AEJA 2IVJA 1QGLA 1KS5A 1QXJA 4XJZA 3DL3A 4KI5M 2OXBA 5FYHA 2IXHA 1CESA 3EB7A 4CCNA 3JQWA 4XQ4A 5ABJC 2JE9A 3M3QA 5FWJA 4UFLA 4TSVA 2CNAA 2QTWB 4MHRA 2XJSA 1LOGA 3WF0A 1VP6A 2WS92 1Q8OA 5FMBA 3OUIA 1RVF3 3H8OA 5C4WC 4MADA 5F6LB 2QCSB 2AGSA 1NLQA 4LEJA 5L19A 4CZSA 1VAKA 1L7QA 3AB0A 3PU8A 4I3GA 4PBOA 1KGYA 1NX9A 2HWF1 1ZRCA 4CVUA 2Y6KA 3J9SA 2W47A 4UOJA 3O1UA 1Z78A 3CJIC 2JG9A 1V6IA 3MPPG 4IUGA 4CDWA 1X8MA 3PVOA 3WNXA 2FDJA 4M00A 1QHDA 1W2AX 2UU8A 2JG8B 3EQEA 1R1A1 5FO7B 1LOBA 3UGGA 2RS52 2VJXA 3VDDC 1LHNA 4K3UA 3JU9A 1QNYA 3UJQA 5GZCA 5I0SA 1FOD3 1RUE3 3VB9A 3ZFEC 3LDKA 4CCKA 1IKQA 2E32A 5FP7A 3GJBA 3SQOA 3KLSA 1V6KA 4QQ2A 1UMHA 1W6PA 3AYCA 2RDNA 3T2OA 5FZLA 5LBEA 4BLJA 1BLZA 1N3PA 1EAH3 2ZHMA 5CNAA 4FAGA 4Z2WA 1OD5A 2QDNA 4DQAA 3PMSA 1Q8QA 2DCYA 4HG6B 3ILRA 4XUQA 1KDKA 3O14A 4XAEA 2W1QA 1LULA 5M0TA 2XMLA 4LPLA 1CAWA 1K5MA 3MF6A 3T0BA 4AI0A 3AL6A 3E5QA 4B4QA 2QQPA 1SLLA 4K7JA 1W9WA 2EICA 4JTOA 1X50A 4GD4A 1FNYA 3B94A 3KD4A 3JXSA 1SACA 1XSQA 3MIGA 2Q1FA 4AQ2A 1NE6A 4QPIC 3VZNA 5CFCA 2EF6A 3VBSC 1ULCA 4P9IA 4W65A 5C3RA 3O1OA 4IW3A 3X29B 1CR7A 3J7HA 5BNNC 1MS8A 2DU1A 1HQNA 2W0XA 4OUSA 3BB6A 3FBMA 5SV8A 1PZ9A 5FWEA 3ZYHA 1RUI3 2JDKA 5J7MA 1F4AA 2WNUC 1UYPA 5JSRA 5EZWA 2A75A 1VBB1 4JZRA 2VULA 4CCOA 2WRAA 3ZYIB 5BNPB 5F2WA 3HIFA 2FZ2A 1YIPA 2ZMNA 4JTNA 5DAWA 5FZ4A 3WW2A 3TB0A 4FXKB 5JPMB 1MR5A 4B8EA 1OLMA 3HBKA 4HT1T 2D44A 3U11A 2CU5A 4E2QA 3H1YA 1S0EA 2VGDA 2ADEA 2Z79A 4EV0A 3O5SA 4GZ9A 1HQLA 1EP0A 1H4GA 2R063 2ES3A 3BPSA 3DXUA 4GKYA 5FZ0A 5CG9A 1E57A 3BCWA 3IB3A 4KG8A 1FYUA 3HNYM 3AK0A 3IZOA 3LEGA 1U0AA 4F8AA 5K0UB 2HWF3 4CP9B 2W2IA 1LGCA 5C4WB 3VGIA 4RHV3 3HN3A 2K46A 2FDGA 1R64A 2WSUA 4JGZA 5FY4A 4CEYA 1DCSA 1UCXA 3RJ2X 3DYPA 5F5QA 1JYCA 3G6JB 1SLAA 1RL3A 2NYYA 2ZBJA 4LLFA 5BNNA 5FO9B 2VW0A 2VNOA 1JZ6A 1AL22 1UZWA 3WX5A 5FYVA 1SLIA 1W6NB 1UMIA 1B09A 3ECQA 2JB8A 4NAMA 3TNPB 2Y0IA 4QX2A 4LBNA 5JOXA 2WNUA 2CTVA 3PDQA 2WL1A 4Q27A 2D3PA 2QQWA 4L99A 1O4TA 2A5ZA 2W9XA 4TYSA 1NE4A 1D4M3 3POIA 2JE8A 3H3LA 2EIBA 4IV3A 1RMU1 1VBD3 3E6BA 1MVQA 4DEQA 4QPIA 4HN0A 1WA6X 4HK8A 4Y1XA 2GNTA 3M1HA 1HQWA 4O9GA 5A7NA 1BBT2 2P3KA 1VMJA 2YMZA 2B42B 4XZPA 1OXCA 1XBFA 2KR2A 2ZGKA 3I7DA 4GH4C 1XE0A 1S0DA 1QJY1 5FCCA 4LO6B 4OZXA 4FXGB 3ZMNA 4NRMA 2YY1A 4AF9A 5IVVA 3RWNA 2DYCA 1BEV1 1DZQA 1UY0A 5J98B 3ZYGA 4LO7A 3E6DA 4WM7A 3LF7A 3WXPA 1EUUA 2PYTA 3TEZA 5LY1A 3TEXA 1VBB3 4YW1A 2BW8A 3NSTA 1CJPA 1D0HA 2PHUA 4MGQA 4Q8KA 2R072 2XQXA 3KHCA 1AYN1 3A23A 3TEWA 4R9CA 3UNPA 1P8JA 4LE4A 1RUC3 4OI4A 1QJY2 1QJZA 1V9U3 3GBWA 4Z1VA 3VBFB 3RVHA 4XIOA 1MVEA 5C7GA 1K42A 2WT1A 5C8CC 2ZTNA 2JG8C 4BK4A 2BU9A 5L7OA 1FOD2 1RUE2 1LOFC 3JB8A 5EQUA 1LU1A 1IOAA 2C26A 4IV1A 5CZKA 2Y33A 5FLIA 5LY2A 3U1XA 4Y22B 1MS5A 1AXKA 3ZFGC 1W2TA 3KCXA 2FDIA 1T6GC 2P1BA 4AW7A 5DDJ1 5JSOA 3NV3A 5IUQA 1QOOA 3D5OA 1LHOA 2HH9A 1AXZA 1VBA1 4CDXB 4FPJA 4XF3A 2VMGA 1K5JA 5E16A 4BMBA 3BTAA 5FBJA 4BB3A 4FFHA 2CL2A 4QXBA 2RS51 4QU1A 1OH4A 1RUC1 2A3WA 2OT7A 3LPGA 4FPKA 2BGOA 5JDBA 5K7PA 2YXSA 4UW3A 4BM8A 1UYYA 1IPJA 4EZ4A 4CYDA 2WZR3 3ZXJA 2ZMKA 1Y7BA 2GP3A 4CP1A 2DUQA 3N9QA 5DDJ2 3ZSJA 1UQXA 2VMCA 4OFGA 1EY2A 4GMP0 3NNFA 4JV4A 1G9BA 4KL1A 4C0BA 4P9LA 2OVUA 3LDBA 3A7QA 5EV7A 4RR3C 3THTA 1JZ5A 4BQXA 2P6HA 1QJU3 1YI7A 4EN0A 1RJ7A 2XVLA 3WNLA 2F17A 1HDKA 2ZGPA 2WAOA 1DLCA 3CEWA 3DPRC 1GNYA 5FZHA 2KM2A 3H7JA 2R041 2VNGA 1UPSA 5FXZA 4CTEA 2R0FA 1PO22 4JDNA 5GLVA 1OSGA 3DEMA 3V0BA 3U4SA 3RYKA 3IAPA 5KHKA 5DPNA 4QDSA 4A6SA 3V64A 3KCCA 4N7UA 1POV0 2XXZA 1YIFA 1YFYA 3NJVA 4W6XA 1ZYBA 2WYSA 2QKDA 2ZHNA 5TSWA 3SH4A 5JZGA 1DHKB 3ELNA 3SCGA 2RMU3 5FQ0A 2ZEYA 1LHVA 1YQ6A 4OHYA 4NMIA 4HPKA 3VHPA 3ILNA 5FTTC 1ZRIA 2WWJA 2BPA2 2XPJA 5EHDA 3Q8BA 2VNVA 2VVEA 1UKRA 2WS91 4LUMA 4N8MA 4P9JA 4B7EA 2D6KA 4KMQA 4D6RA 4CP0A 4UW5A 1UOJA 3IDCB 3WG4A 4XJUA 2JG9C 1PGSA 1BHGA 1RHI1 1TME1 4Q4V1 5F39A 3UK9A 1S0IA 5A7SA 4CDUA 3THDA 3O7OA 3T0AA 4XMIA 2E9QA 5FREA 3KVBA 5A3LA 4O9EA 4YW7A 5LW9A 5IK5A 1NY72 3M7AA 5J96B 2GN3A 4XURA 5LEKA 1HB3A 3L2YA 1H9WA 2DVGA 4EN9B 2BYVE 5FZ1A 5T3NA 4BQ1A 3FN9A 2W1UA 2WQ4A 3VBHA 4AI8A 5FYIA 2DBNA 3J7NA 3F2ZA 3MFAA 1PGL2 4MLOA 3EJKA 3E1F1 1MPXA 2DCJA 1ZBE3 1W28A 4GQ7A 4QX0A 5DG1A 3OEBA 1AL21 3ROUA 3AX4A 3JD73 4Q26A 1NCQA 1PIV3 2AEYA 4RSUA 2NZ9A 2ZGNA 2Y6FA 3U37A 3UKTA 5F2SA 1WWYA 5FDBA 5JI7A 2QJVA 2BNNA 2CHHA 4UAPA 2A6ZA 2E7AA 5CFDC 3A21A 4XVHA 4ZXEA 5IHRA 3WP6A 2D3SA 5CBLA 2B4KA 3VKMA 1J3PA 1GLHA 2PLV3 3LSDA 4Q0SA 1A6CA 2BFUL 4Q1RA 1CAVA 3WINE 3RS6A 4XAAA 4Q29A 1VBE1 4GULA 5IATA 4YWAA 2EAAA 2RM23 1IZ3A 3N7MA 2E31A 2WBKA 1WBFA 3AXEA 4QPGB 3N9MA 4QU2A 3D6EA 1POV1 1UXZA 3DN7A 4AGRA 1OKQA 3WLUA 4FI9A 3WP5A 2HWF2 1RIRA 2ZX4A 5IYYA 2OQ7A 4YG0A 1N1SA 1ENXA 3ALQA 4QQPA 4LBQB 4MHUA 3CZUA 3IM0A 4D8MA 1HN0A 2GAUA 3BOPA 1PMJX 4LHLA 1ASJ1 1ZBA2 3WDVA 3ZFEA 4D0QA 2A6YA 3N9OA 3KHBA 3ZIXA 2QQNA 1S0GA 4YGBA 2DWRA 1JZ7A 5G04L 3AC0A 4I09A 2GH2A 4X8PA 3HN1A 2DU0A 3WW1A 3ZYFA 4ZZ8A 2BEOA 4JC1A 4AHZA 4CCDA 5FZCA 1LRHA 3OEAA 1A3KA 3E5XA 1BMV2 4DXSA 3C7GA 3GZUC 5DZGA 4XXAA 2CAUA 2OUHA 1JOJA 4TLGA 5IAVA 3J8F1 2GU9A 3WF1A 4GAZA 4LKEA 2XGXA 5FP4A 1RUF1 4CDQB 2HWB2 4RS5A 1YQ8A 5GLZA 5BNNB 5I8TA 2W52A 3GALA 1R082 2B39A 5A7OA 1W9SA 2EXIA 1GZ9A 4INDA 2XHKA 4GKXA 3CKHA 4DUXA 4JKMA 2IVIB 3P5BA 4M0HA 4YFWA 2R7EB 3AMMA 1HIXA 1NLSA 2FBEA 4QGMA 5K0UA 4CE8A 5ERLA 2D93A 2H6BA 1STMA 3NJXA 3OGGA 3UKNA 5F3GA 4ATFA 4CCMA 1W39A 2KA3A 2P3JA 2VBDA 4KGGA 4CDUB 4D3WA 2ZX3A 1NCQC 2OZJA 2W3JA 3H0OA 3HWJA 4FOVA 4YM1A 3ZFFC 5A3OA 3Q8AA 3S57A 1AX0A 5KXCA 2DURA 5CFDA 2ZA9A 2YC2A 3DPRB 1LEMA 2YV8A 2GH8A 2PAKA 3ZVXA 1RC6A 3FC0A 4BA6A 2VZPA 1OOPC 4LHKA 3ZSLA 4AEDA 4LHNA 4CEWA 4PLOA 1GOHA 1R083 1RHI3 2VQ0A 1WGPA 3UETA 3B3QE 2B8MA 3MW2A 2BWCA 1PX4A 3KGZA 2Y26A 3PMEA 2PFWA 5FBZA 4QKDA 4XF1A 1X9TA 3ZFFB 1OLRA 4QX7A 1MS9A 4DY5A 4PIZA 5EFUA 4C1XA 2WR9A 3NV2A 4UW6A 2PN5A 4HVOA 4XTMA 5DN2A 3CJIB 5FY1A 3BTYA 3I2HA 3LGRA 5A1FA 3R05A 4E4ZA 3AZWA 1W2NA 3LSEA 1AR92 2XBO1 3DV8A 1LR5A 3CZJA 3J7LA 4M01A 1HXS1 1R091 5DUVA 5BNPA 2PHWA 1IS3A 3V65A 4A7ZA 1JOBA 2BNMA 3AKSA 3QCWA 5L73A 1RB8G 1Z7S1 5HCAA 1GNZA 4W6YA 5A70A 2BGPA 2V4AA 1JTZX 4O61A 5D2AA 4S2HA 3KGLA 5T5OA 2E7TA 2R062 1AXYA 1IPSA 4F3JA 5BNOC 3I2KA 3A4UA 4YM0A 4TZDA 5GM0A 1O4ZA 4EN7B 1X82A 1WBLA 4ZXKA 4PI0A 2XVGA 4E9KA 4FBFA 3NAPC 5CISA 1OLME 1D2SA 3GNEA 3OBAA 1ULFA 2GNMA 1QOSA 3GDBA 4AQ6A 2ZACA 4IV3B 5F1RA 1GOFA 2WZPP 2IFRA 3USUA 3IDAA 4CXWA 4XFIA 1RUI2 4QXCA 2LUWA 5E88A 4B4PA 5FK8A 2OW4A 4EN8B 2QFEA 2O0OA 3VBFC 4JDMA 4XDQA 4U36A 4COYA 4WVMA 3VD3A 1UU5A 1O4YA 1JMUB 2VXRA 3CHXA 3M4FA 1AUYA 1YC61 1BKZA 2NLRA 4MXWB 4XUOA 1JI6A 2UYBA 3I4IA 4YPJA 3T0DA 2JB4A 3HBZA 3I8TA 4ISQA 4BIOA 3ST7A 1GKBA 4YGEA 1VR3A 1LEDA 2IXJA 4YVWB 2VZVA 3H3ZA 2Y60A 2D5FA 2XQRA 4LO8A 2PTMA 1CZVA 5FJHA 1I9RA 5ABJA 5C3PA 1UD1A 4BK5A 3M70A 4BISA 2VMEA 5BYNA 4AFMA 4N53A 3KSCA 2WFPA 3W21A 3FE5A 3LDRA 1H0BA 2ZGQA 5IT6A 4Y1ZA 1OQ1A 3ZFGA 4M3CB 3GBFA 4EWDA 1SPPB 2VD7A 4SLIA 5AC92 1OKOA 4LT5A 2CGPA 2G19A 4LBKA 3ES1A 4MZUA 1WCQA 1C5HA 5FMOL 4BQYA 5KC6A 1PNFA 2ZPXA 5FZOA 2JENA 2R073 5C8CA 5L7OC 4Y1YA 4D6SA 1PGW1 1Y9GA 3GHMA 1XNBA 2QQOA 4AAXA 2VOKA 2JJ6A 4IV1C 4LJHA 4MXWA 2IXKA 3T1LA 4WV8A 4NPLA 1ZZ6A 4H2AA 1DQ5A 2J1AA 4LTAA 2RJLA 2K0GA 4AFBA 4LITA 1LCLA 3AP4A 3AFGA 4QKFA 4L0PA 3WEZA 3NJYA 4P08A 2YFUA 1S2BA 2D3RA 2EAKA 2HLEA 4AVVA 1SFPA 5FXXA 3MW3A 2VY0A 5C3OA 2PLV1 1JZ4A 3WW3A 1XU2A 4G3YC 1RMU3 2MEV2 2CDPA 2J1UA 4WBBA 2I45A 3BYWA 3LPFA 4XF0A 3MV01 2DCZA 3MDPA 1ENSA 2HWC3 1UX7A 1WCDJ 4HKLA 4J1WA 4UF0B 1SMVA 1ST8A 1D2QA 2WKKA 3ZMOA 1GP4A 4OHWA 3VD4A 3E6CC 1Q56A 1A8DA 1WKYA 3TBDA 5FZAA 3DF0A 1FMD1 2XBO3 3IPVB 1B35A 1DYOA 1W6PB 2K9ZA 4P00B 4HXCA 1VLNA 5C71A 5CIRA 1J58A 5FY7A 4FPCA 4B1MA 4Y20A 2WZR2 5D21A 5FLHA 3SITA 4A3ZA 2VZRA 5L9VA 2XKPA 3PVBB 2JIGA 5FZ7A 5F9TA 3OPWA 2LRPA 1O3QA 1VIWB 2EXJA 2J22A 4AEKA 1Z0HA 5FXWA 1HX6A 2XWBB 2IXLA 4HSLA 5LCWL 4Q0UA 3SKVA 3NV1A 2VZUA 1TZOA 3KS7A 1SLBA 1GU3A 4BYYA 4KU8A 4XJ8A 2JDUA 3M3IA 2A6XA 1VJ2A 3OYWA 2Y6GA 1GV9A 4OI0A 1AR72 5CKMA 5FZKA 5I8SA 3WNMA 2X5IA 1TEIA 2RMU2 2ZKLA 1YQCA 4GMP1 4K1ZA 1LNSA 4QXKA 3ZR6A 4CEWB 4FTBA 1HRI1 3HOBA 4SBVA 1YLLA 5C4WA 1V9U2 3AVRA 4DB5A 1MZFA 3GCWA 2WUHA 2RS53 1LOEA 3S5QA 2A6WA 3KVAA 4XHXA 1QQP2 3W5NA 3JCIA 4W50A 1PIV1 1B35C 2D6PA 4PBPA 3KMHA 1JXNA 1JU3A 1HRV2 2HWD1 3KQ4B 2JDNA 4ITCA 4LO5B 1C8M2 1N3QA 5G05L 2VOVA 2PAMA 3EXUA 4OHXA 3TRSB 1IG0A 3DYMA 4KG0A 1GWMA 4NRQA 3WW4A 4E8CA 5JUVA 1GICA 1F9KA 4IGPA 1SCSA 3TN91 1UU4A 1W8NA 4PDWA 4IEWA 1XNTA 2VUJA 2PHRA 3ASIA 5HCHA 3U10A 4MX3A 2R49A 1RHI2 1OVPA 3IDBB 3OGVA 5GLTA 4OMCA 4QWNA 2J42A 3OF1A 4IL7A 5FZMA 1BJQA 3K48A 4JKLA 1KXGA 4YYOA 5BPXA 3U07A 4EQVA 4BOWA 1RUD1 5A3NA 5FJKA 5JXIA 4EJRA 1GBGA 5FV3A 5IK8A 4UF0A 3RNSA 1DGLA 1MS0A 1G6NA 2R6QA 5EJ3A 4OQ9A 3NO8A 4E2SA 3A0NA 1RUG2 1HRV3 4DS0A 1K5MC 1OI6A 3TAYA 4AQSA 2A71A 3AL5A 4CU7A 2V5YA 4OVEA 2LW8A 2BNOA 4BZ4A 1JUHA 3AMPA 3HD8B 2C5DA 1I1EA 2XWJB 2X5IC 2HJIA 1RXGA 3LAGA 3ZN6A 2D6OX 2O1QA 5FPAA 5SV5A 3PUAA 4NUBA 1UAIA 2GMEA 2Q0AA 1W05A 3GM8A 1I6XA 2DVFA 4Q4W3 2QUOA 4RN5A 5H9QA 3URFA 2YZ4A 4RD7A 2X10A 2JG8A 3MO4A 1RINA 3S0MA 3WHTA 4XABA 5DAQA 1F5JA 4PLMA 1BVP1 2D43A 2R1DA 3ZXFA 4AI2A 3WY6A 2JDAA 2I2SA 4NHLA 3OGSA 2JE7A 4XFHA 4M3CA 3VZKA 4IE6A 3NJZA 4XEZA 4J1XA 5E8AA 5IK7A 2W1WA 1L7LA 5K0UC 1YUDA 4O65A 3UV9A 4C90A 1OLQA 2J1EA 1DQ0A 3IIIA 3HAGA 3GHNA 3QLQA 4FT8A 4I02A 4XDOA 1TME2 4JGYB 1LKNA 2MNGA 2YC4A 4RYDA 3IAQA 3PUSA 1EV11 1S0JA 2HEWF 2VW1A 3NW4A 4YZ5A 4P5HA 4RFRB 4Y5TA 3SISA 2OUJA 3N3HA 4V1PA 3UESA 3ZXEA 1XPWA 4YVWA 1A8MA 2RS13 2VW2A 3OBZA 3PJQA 4RR3B 4GIQA 1YCIA 3B7MA 1LOCA 3WF2A 5FPVA 2P34A 5KC5A 2VUCA 5FIXA 5CKNA 3DCQA 4AXOA 4LKSA 4QQHA 3GZTB 3RFRA 2VM9A 4WM8C 4IERA 4XIKA 5H9PA 1NQDA 3B01A 3ABZA 4XDPA 3OSDA 3F95A 2P6CA 3WCSA 2VMIA 2DF7A 4OULA 4QX3A 4META 1FX5A 1CAUB 4URAA 2V4VA 1XNCA 5CKQA 2QZ3A 4RQPB 4LLOA 2CGNA 3ZXLA 5FMCA 2ET1A 2R043 5C3SA 5T54A 5DZFA 1VALA 5HCFA 3PIGA 4C1WA 3H8XA 4TXWA 2VMDA 4EWAA 3KV4A 1JODA 1ASJ3 2Q8DA 3AKRA 4IV3C 3AYEA 5LA9A 5C3QA 2DFBA 4FPFA 4RHV2 2W95A 3NAPB 1VRH3 4WZFA 2BBVA 3NL1A 4KWJA 5C70A 2NP0A 2W92A 1X7NA 2UY8A 2RV9A 2Y38A 4AWDA 1TQ5A 3LOIA 1SDDB 5FRAA 5FY9A 3K4ZA 2CDOA 1ZBA3 3HVDA 2VOTA 3I3QA 3GF6A 2Z42A 4N9HA 4BXFA 4HFSA 4RQPC 4A3XA 5FZIA 1ZBA1 1E5HA 4GH4B 5LBBA 2P3IA 2ARXA 3AZXA 3J8F3 3S7EA 1RUH2 5FUIA 1W6NA 1S4CA 3THPA 2FCUA 2VUDA 5AC91 4JHTA 1MQTC 1PM7A 1AR71 2EIGA 5A6YA 4R9DA 3C7FA 3PIJA 1H1MA 4R4XA 5JXHA 1AR73 1LHUA 4NE9A 1W0OA 4XBQA 1US3A 2JDZA 3T2PA 4E4HA 1RUNA 4BMEA 2VH9A 1PGW2 1WMEA 4UW4A 3UT0A 4OUEA 2XDVA 5DZEA 3VZLA 2WQ8A 2DDUA 1AX2A 1C1LA 3R0RA 4NWWA 1FPN1 4Y3OA 1R1A3 2X8KA 3VBHB 1Q8PA 2CY6A 3LCPA 1RUJ3 3ENRA 1CWPA 2FHRA 3GJAA 4P5YA 2CV6A 3CBNA 5L7OB 4DXZA 4XJ9A 3LEKA 5CA6A 1NA1B 3T30A 3D4KA 5KBFA 1GSLA 2JIJA 2RDRA 1WA4A 4LULA 1UN1A 4XCAA 2RS11 1I5PA 1O7FA 1O91A 5HBAA 2D6MA 2NMNA 2JDPA 3O1TA 3WNKA 4EE2A 2GALA 3KB5A 1HLCA 2WN2A 3I2GA 3ZYPA 1IQDC 1DFQA 1QJU2 3JQXA 5FYCA 5BY5A 1UZ0A 4GWNA 2EXKA 2QBXA 1H8TC 1LOFA 1O59A 3AXDA 3MLLA 3N36A 4I30A 3ZFEB 3ZM8A 3DGTA 2XL7A 2RDSA 4UYBA 2VECA 2WJSA 2DVAA 4LBQA 3R6SA 4KH9A 5HV4A 3O1VA 3E97A 1IPKA 4C8DA 5EP9A 1M06G 5K4LA 3K3NA 4UFIA 3RPQA 3H8RA 4CDQC 1Q8VA 4PJYA 2R071 5F3EA 5JIAA 1UIJA 3ACIA 3GZEA 2WIIB 2XJQA 1WW5A 3AZYA 2UWBA 3POYA 1COV2 4M0NA 4N7IA 2W08A 2VZSA 3VZMA 2G4IA 2VUAA 4R9AA 1AR61 4QQLA 2AEZA 3QACA 5BUVA 4NHXA 3WT3A 3HT1A 4RQPA 5E6HA 2NN8A 4D7TA 1CN1A 2CYFA 1AYM2 1W2UA 1KJRA 2HBTA 2JD9A 3AP5A 4YZ2A 1ND2C 4KWLA 3VBSB 4GJZA 3ZPOA 1V6LA 1QJX2 2XR4A 1OPMA 3BKZA 3BU0A 1GP5A 1LECA 3PUHA 1FATA 2GNDA 3JB4C 2MPFA 3U78A 1DGRA 1JH5A 4XFAA 4N43C 3APBA 4XFGA 3T4VA 1FT9A 4ARXA 2YHJA 2R061 1BZWA 3WVJA 1YXWA 2D97A 4LBMA 1OBNA 1TMF3 3CF6E 5IVFA 4IETA 3POFA 1HB4A 1PMHX 4FQ4A 2GZWA 4LA2A 1G9AA 1RUC2 3OPTA 1H1IA 4XFFA 5DG2A 4AOCA 4CP9A 4CUCA 1LHWA 3DPRA 4Q4X2 4YW4A 3USSA 4D94A 2ZZJA 1WMFA 4MV2A 4ZHNA 2ZCWA 2CAVA 4LMFA 4WM8A 2Q30A 1GZWB 1H6YA 5EXOA 4IEZA 1ODMA 1NG0A 1OA2A 1CPMA 1W6MB 2Y6JA 1TE1B 3S5AA 1VMHA 1JN2P 5LRSA 1AR82 3CJIA 2QVSB 1C5IA 3BI3A 1PIV2 4FSJA 2K2SA 4ZONA 3RZZA 1JS9A 3UGHA 3WQ1A 1W99A 3C2UA 1V00A 3O0WA 4LNVA 1POQA 1V6OA 4LIVA 1C8M3 3CNAA 3Q8EA 3WF4A 3GGLA 1UF2C 1IGOA 1GOGA 1O5UA 3WG1A 2OX0A 1XSRA 2XL9A 1G86A 2CGOA 2HEVF 2Q1ZB 2B9VA 4H14A 4HLTA 4R8HA 1LB2A 1QY4A 1FMD2 1LESA 3MI8A 5HXVA 2AZ5A 4NPMA 2A3XA 4Q4X3 1LAJA 1UYXA 2JXAA 2F4LA 5C9AA 1OT5A 1S1AA 1IKPA 4NHMA 3SHRA 4FFGA 2WINB 3T09A 3IMNA 5DAXA 5FP8A 3K3OA 2H0BA 2WSVA 4AEMA 1O3RA 1ZBE1 1BMV1 1R1ZA 2ENRA 3E5UA 3USUB 1SBFA 2OA2A 5F3IA 3VKLA 5A6XA 3J8F2 3U0ZA 3ZXAC 5IVYA 1JU4A 2HWB1 4DZGA 4LHSA 1NZIA 3UYJA 4AHWA 4OI1A 3N9NA 4UWDA 3P6BA 4QB2A 4EN6B 4BQWA 2WO3A 2ADDA 2SBAA 2OPWA 4MH0E 1R081 1KQRA 5LASA 1V0AA 2DTYA 4N43A 1UY1A 3MLKA 1KFXL 1UMZA 4FVVA 4NO4A 3K46A 4RR3A 1D4M1 1NXD1 1F5FA 1RUF3 1FAYA
chains in the Genus database with same CATH topology
5I0UA 1GQHA 1WMDA 2AUYA 3WG2A 4YVWC 1RVF2 4PDWB 1J1TA 1FXZA 3CL1A 1CONA 2A6VA 3ZYJB 2NPIA 2Q1MA 3LA2A 4MYEA 1N3OA 1ONAA 1ZVFA 4PIXA 4I2OA 3AZVA 1ZREA 3MICA 4Q8LA 4XF4A 1PK6A 1FI2A 1XQNA 4PLNA 4DRVA 5KXBA 1YWKA 1DLLA 1EV12 3UL2A 3V56A 1MZ6A 5C33A 1C1FA 1O5LA 2O8OA 1QWRA 1NZCA 2YUEA 5T50A 1W6OB 4DINB 1S2KA 2QE3A 4XJAA 4KQ7A 3B69A 5JCTA 1URXA 3FBYA 3H50A 4IEYA 1OA3A 2GSYA 3FLRA 4MGYE 5JOZA 1JHNA 4RGGA 1OQDA 4GB32 4L2NA 4TLFA 2QDRA 4DFSA 5BXXA 3L2HA 3D0SA 1XU1A 5K9YA 4JVAA 1W6OA 1SFYA 2ARBA 1I5ZA 2XJPA 5H9RA 2Q5TA 2AENA 2C9AA 2YGMA 4FTSA 1QXPA 3VV1A 2JD4A 1C4RA 2D6NA 5JR7B 3AKPA 4FOWA 3ZN6B 4Y1VA 2WA4A 2ZZQA 3FWEA 1OOPB 1TNFA 2VNRA 2DCKA 3MPBA 3FUOA 3N4MA 2BFUS 3NVCA 5JLVA 4PQ9A 1C3HA 1CAUA 3R4UA 2FMYA 3BODA 3TN93 1D4VB 2BWAA 1MEC2 2A7AA 4I0WB 1PVC3 2DFCA 5T5LA 1I3HA 3AP7A 1REEA 4GH4A 1AF9A 4QM8A 1U5XA 2D7FA 2R042 3MIHA 5FQ0B 5C9AC 1LJ7A 3LWCA 4Y5Z0 2XB6C 3N7JA 4QPGA 5DDJ3 5K8SA 1CVNA 1NYWA 1J1LA 3OY8B 1ZZ8A 3CU7A 3HT2A 1PHMA 1VBC3 1UU6A 2KXLA 2R32A 5AFEA 4AI3A 1ZM1A 3WHUA 3OCPA 3OGJA 4HBNA 1ZRFA 3WQ7A 1VAVA 4QQOA 3H3UA 5JOWA 1RUG1 2PHDA 3ZFFA 3VBHC 2MHFA 3T2TA 1H4HA 3ZSMA 1TMF1 2Z5WA 5ACA1 1RUF2 2PHLA 3H9AA 3AP6A 2V73A 1DG6A 3MIDA 3C3VA 1V6JA 1GANA 4WZCA 3B9CA 3WG3A 4COVA 4ES8A 1B35B 4BLIA 4YGDA 2XLAA 1Q8SA 3JZVA 3S30A 4AQTA 1W6MA 2I74A 1COV3 4COUA 2D40A 4XF9A 1OQEA 4OHZA 4FPHA 1COV1 2VU9A 1CAWB 4JRAA 4LBLA 4ATEA 4G9SB 5E1RA 4I01A 4ZU5A 1Z7S3 2RS31 1F8VA 4HPKB 2BTVC 1BEV2 1V6MA 4Z8BA 1ND3A 1VBD1 1XE8A 1EAH1 2ET7A 3CJXA 3ACLA 2JECA 4QX5A 5FOJB 1IS5A 1LTEA 2GNBA 3PJYA 1Y43B 4HKWA 2ZX2A 2RS12 4B3NA 3ILFA 4YG3A 2R0HA 4N43B 4HN1A 5FMOS 4AFAA 1LOAA 3J26N 1ND3B 2XVKA 4Q4W1 2EVXA 4YZ1A 4MGZE 1PO13 3G7DA 1LENA 3AMNA 3PVEA 4AHXA 2ZOEB 3SCHA 1FPN2 5KWRA 2HWE1 2P37A 3AFKA 1RMU2 2MEV3 5D8AB 2ZJCA 3WD5A 1MZ5A 4YNIA 1MEC1 1REFA 4LO4B 3UKVA 3M3OA 2P2KA 4I3PA 4MSVA 1YI9A 1DYKA 4Q4W2 5CADA 4AVSA 5T52A 3ETQA 3B00A 1AR62 3RJRA 1ALYA 4L92A 1BVVA 4AVTA 4Q4Y1 2RE9A 1NCRC 2WQZC 2AR6A 1YJLA 1AHSA 4DY3A 5D8AC 2D6LX 2DUOA 4GXLA 4OLLA 4FPGA 1Q43A 4RFT0 1QJX3 1TNRA 4AFDA 4N53C 4P9XA 2H6CA 4A7YA 3VBUA 1MS1A 5CFDB 1RUI1 1DU3D 5LEJA 3ZXDA 1NCQB 2XH6A 4YRDA 3JBG1 3LKJA 4P9YA 3AJYA 2NQYA 4PIYA 4QM9A 1FOD1 1RUE1 1NOVA 2VPVA 1KFUL 3I59B 4R4ZA 2IFWA 4K1YA 3MEPA 2PLV2 2Q4SA 4KU7A 5CB7A 4H55A 1JUIA 1VAMA 1HV0A 4K8FA 1S55A 5JMCA 2X53S 2RS33 1FNZA 3JD72 2O8QA 2GMPA 3LA3A 3MLJA 3QOPA 2GC1A 4YARA 1IS6A 1YJKA 2ZABA 1H2MA 2PA7A 4FOYA 1GZCA 5L36A 1VB2A 1U12A 3D82A 4WM7B 4MVTA 1DZRA 1N1YA 1SBEA 1U5ZA 3V0AA 1RUD3 5C8WA 1U5YA 1AR91 2XBO2 2WWSA 2JICA 1HXS2 1R092 4AYUA 3VLBB 1TME3 5JSPA 3WDXA 1BEV3 1MQTB 2BUKA 4Y4YA 1Z7S2 3EO6A 2VOXA 2FQPA 4PDWC 4UXAA 1UZYA 4AK3A 1NLRA 4XXPA 4QHBA 4Q0VA 5BNPC 2WNVC 3SH3A 5KHGA 4E2GA 2RMU1 2GDFA 2XLGA 1LGNA 4FPOB 3MIFA 4Q0QA 4GB31 4ONUA 2E63A 3FFZA 1QDOA 1UX6A 4G4FA 3VBOB 1AR93 5ACA3 2OZ6A 1DYPA 1W0PA 4RL7A 4K9SA 2A73B 1J59A 1IQAA 1PO23 1H1AA 1OOPA 3TWIA 1UL9A 5FPXA 1NA1C 1YO8A 2I07B 1ZA4A 3RRDA 4YVSC 3VBFA 3WP3A 4KNCA 1ZZCA 4Q4V2 1XXNA 4I0BA 1QXRA 2IWGB 4AE2A 1PK6C 4ASLA 3WV6A 4AGGA 5HCBA 5D8AA 1DBNA 2GC2A 3PHMA 3ZO0B 3JBG2 4ISRA 4UBHA 4A2UA 4AG4A 4IEXA 4NN0A 2XKOA 4KBBA 5BNOA 1BQPA 3KCYA 2Y0OA 4C0HA 4JGYC 3TOJA 2NMOA 2WFF1 2XJUA 4KWKA 4F83A 4P9GA 3MW4A 3FUQA 1CX4A 4FPEA 3PTYA 1IS4A 3Q9OA 2HWD2 2IXIA 2RJKA 4CDQA 2HWD3 3VHOA 2LM3A 1QH6A 3AP9A 3L9JT 2B9UA 4WVVA 4U2AA 3WUCA 3N7LA 4S2GA 2IZWA 2UY9A 4P9WA 5FAXA 1WLDA 4GALA 2WA3A 3INAA 5E89A 1AJOA 3FFQA 3FZ3A 3IIAA 3O0XA 2B7YA 1ZRRA 1ZZBA 2LTNA 4L9BA 4YZ3A 3MYXA 4XQWA 4JGZB 4Q1PA 4CEYB 5BNOB 1ZZ9A 4Q4V3 5J3UA 2XJTA 3RMXA 1RGSA 4BE3A 2PAEA 4Y24A 1J3QA 5GJ6A 5D1IA 1X36A 1RUD2 3POSA 5GLWA 2IXCA 3OYWB 2ZX0A 1PVC2 1H9PA 1S0CA 4GWMA 2AREA 3RSJA 3TNQA 3VDDB 2YC0A 4S2DA 4Z92B 3MF9A 1DGWA 2NM1A 1M4WA 4BIFA 3BALA 4FP3A 2PHFA 1YFUA 3AKTA 4IV1B 2RS32 1BBT1 1UKGA 4YVSB 2SLIA 3OD4A 4MGKE 3A0KA 1HKDA 2WLPA 3N7KA 4HVRA 4XETA 1MQTA 4NHKA 3QBQA 5DUWA 1RITA 1AYM1 2BQPA 1N1VA 4E4DX 1WUVA 4I0AA 1V6NA 1DQ1A 5ACA2 1C57A 1RUH3 4ES9A 1G8WA 3RMYA 3FX3A 2CWMA 1QOTA 2DCTA 2WNEA 4PCRA 1BK1A 4LBOA 2PHXA 1WLWA 3ZIWA 2OYZA 1SEFA 3FLPA 4R9BA 2B46X 1ZNPA 1SQ4A 5DUUA 3M2MA 4H7LA 1VBE2 4RGAA 1D0GA 1GYKA 1OHFA 3BIWE 4K21A 4Q4X1 2X29A 4QPIB 3KT4A 4JQRA 2HYKA 2ZS6B 1X8EA 4JDOA 1FMD3 2BVVA 3RG0A 3H1MA 4YGCA 5CVRA 2AH2A 1DQ4A 4H7MA 5BNQA 3MFCA 1QU0A 3VZOA 1WLCA 3VKOA 1U5IA 4HMZA 2ZMLA 5FO8B 1VBA3 4LBJA 5EYYA 3LOBA 4NOTA 1CAXB 3QH7A 4YM3A 1UZZA 1JBCA 1VBA2 1YYNA 3JBG3 4WVWA 5J36A 3TYJA 2E53A 1ND2B 5KXEA 2VVFA 3WDYA 1V9U1 2VOWA 4FAHA 2ZHLA 2B45X 3JD71 3ZPYA 3FMGA 3HMYA 1VBD2 1YFXA 2ZKNA 1EAH2 2HEYF 1YNAA 1CAVB 1CGPA 1N47A 1QJX1 4BHPA 5JWPA 1WCKA 3AM2A 1LODA 3SH5A 2RR13 1C8M1 4OUMA 4QT6A 1F2NA 5FLJA 2ZHKA 1XNDA 3DUIA 1PVC1 4GA9A 1JYIA 3VBUC 3R4DB 3AYDA 3KM5A 3H1WA 1C28A 1WW7A 4QPGC 1PNGA 3WOGA 2E51A 2DTWA 3OD0A 5JAXA 1WW4A 5JZGB 1GNHA 1APNA 2XJRA 4C91A 1MZEA 3SMHA 1AR63 3SXWA 2ETEA 1ASJ2 1AYN2 2ZGUA 4Q2FA 2RM22 4IXLA 4QPYA 4MXVA 3K51A 4K20A 4L11A 4IEUA 1SLCA 5GZDA 3V0AB 1QJU1 4WM7C 3FHIB 2ZGMA 4FQZA 4DNYA 1H8TA 2ERFA 5J37A 4ZU7A 1K5MB 2D98A 1CJDA 2G9GA 3UJOA 4YG6A 5HI0A 2D5HA 2E6VA 3R4SA 1VB4A 2BVBA 1WCSA 3ME2A 3VKNA 3VHRA 4PF5A 4IEQA 1ND3C 2B5HA 1S0FA 3EBRA 3WZ1A 5BV6A 4XQDA 4FCAA 2XG3A 4RHV1 2FZ1A 1NY71 3MIEA 3ZDSA 3B93A 3VUOA 1WLTA 3VBOC 4JGYA 3RQ0A 3V0BB 2GN7A 4YLZA 5JSRA 4QGNA 4J6GA 1RUJ1 2RHPA 4FO9A 5JOYA 3KT7A 5GZGA 1AL0G 2WT2A 3HQXA 4FPLA 2WNUB 4FPYA 4HANA 4XW3A 2XJVA 1PMIA 4IEPA 2ZGOA 1Q5OA 3MGUA 4B4RA 3WDWA 4QD2A 4XFBA 2A3YA 2QNKA 4CDUC 3P3NA 2N7GA 3WUDA 4XBNA 4Y22A 2RR11 3NKTA 1OMIA 1XYPA 5JI9A 1HRI3 1QDCA 1F31A 2WFF2 1A78A 1X33A 1VBE3 3AZZA 4YM2A 4S2FA 1RJ8A 4KGQA 2TUNA 3H7YA 3PLQA 4TWTA 2Q8OA 2TBVA 4HVQA 1VBC2 4RS5B 3VBRC 1H8VA 3ZN4A 3ZYRA 4ZKTB 1PK6B 1GZWA 5I91A 2R16A 4N9IA 1DIWA 3IDEA 1H8TB 3VBUB 1W6QB 2ZGSA 1DDLA 2ZAAA 2DV9A 3P3PA 1ZZ7A 1AR81 1WW6A 4CRQA 1YHFA 5B2GB 5KHIA 4Y20B 2R1BA 4HKOA 4HK9A 4IQPA 3KT1A 1ULGA 5LRRA 3I2DA 2ILMA 5IK4A 1PO12 2PHTA 2W68A 1SFNA 4Y1UA 1RUH1 2OPKA 2HWC2 3S6PA 1ZX5A 2YDEA 5JIUA 4BPZA 3WR0A 4H3WA 1VRH1 1MEC3 4XE9A 1UPIA 5LK7B 2MEV1 3B9IA 5CU1A 4B29A 5I0RA 1WD3A 4AHYA 3T1MA 3O12A 5DUXA 1AYN3 2GC0A 3IWZA 2IC1A 1RVF1 1UW8A 1FV2A 3FJSA 3M3EA 2WT0A 1KD7A 1CD3G 4QGLA 3BPZA 1QJY3 2BGCA 2UYAA 4JCKA 4FTEA 4LA3A 1NCRA 1QH7A 4EWEA 2ZGRA 2W39A 3SCFA 4EROA 4AVCA 2XUMA 4M3CF 1DQ6A 1DZTA 4CDWB 3VBRA 2VVDA 3OJBA 5FFOC 1QKQA 3RDIA 3CLPA 1OPOA 1HW5A 3VBOA 1SLTA 2DVBA 3IN9A 2HKXA 3VHNA 1G7YA 3MZHA 2DUPA 1EV13 4MUVA 5GKAC 1HXS3 1R093 4X6RB 3IBMA 4AEDC 4L97A 4X8NA 2F4PA 2WNVA 1CIWA 5GALA 4LUKA 2UURA 4JRLA 4A7KA 3OPZA 4COWA 5JPNB 1PGL1 1JW6A 1AVBA 2OIIA 1NXMA 5J48A 4HSJA 1CAXA 5KHHA 4CDXC 1YRZA 1XYNA 5GZFA 1RUOA 2CWSA 4IEOA 3WDUA 1POV3 1BCXA 2Z69A 4Z07A 5H9SA 1ULDA 3LB9A 3VL9A 1REDA 2YROA 2JX9A 4XPVA 4BWOA 3ZSKA 1AJKA 1DGWX 5EYXA 2TEPA 1SCRA 4Q4Y2 3M8LA 5AVPA 3OTFA 3POWA 5T5JA 1OA4A 1LGBA 2VQAA 3KZ4C 5A3MA 4XYXA 3IPVA 1YFWA 5CFCC 3ZSEA 5GZEA 1QF3A 1QQP3 4D7SA 4FOQA 4AFCA 1DGRN 1XNKA 4P14A 2UWCA 4OHVA 1QMJA 1RUG3 5A32A 3FLTA 3ZFGB 1J3RA 1OFSA 2LALA 4GB33 3DKWA 4HL0A 1ZRDA 1UIKA 4AVBA 4CP2A 4Q4Y3 3AYAA 1S0BA 2ZX1A 2RR12 1H2LA 1WD4A 1EPZA 3OBTA 3QD6A 5T55A 3SLIA 3BU7A 1XRUA 4GMP3 1XE7A 3GYDA 3SNMA 1XYOA 4YW5A 4CEWC 2P17A 1DF0A 3NV4A 1N1TA 4Y26A 5FOBB 5GLUA 1NCRB 4Z82A 2G9FA 5I0TA 5DXDA 2X5IB 2YYOA 1FPN3 1FV3A 1QQP1 4Q0PA 1BXHA 5LK5A 1EPWA 1Q3EA 2PQQA 3J4UH 5A33A 3W9AA 3ZN5A 4NVPA 1ZBE2 1KJLA 2JG9B 4D7YA 1L3JA 1BBT3 1AR83 1Y9QA 3B5LB 4ORFA 4IEVA 2EXHA 3AJZA 1MACA 4NWVA 3PNAA 3WQ0A 3TN92 4XHBA 2Z2SB 4K6BA 4N53B 5CFCA 3IKWA 5A32B 4WVZA 1ULEA 1ENRA 4W6WA 4MGIE 3CO2A 4QMAA 5ABJB 3WDTA 2HWE2 3RI8A 4UBGA 3EHKA 3D8CA 1BYHA 5FPZA 5T5PA 1R1A2 4HZFA 4N90A 4XBLA 1H2KA 3NAPA 3PVNA 4COZA 1PO11 1EYBA 1CPNA 3VL8A 1ND2A 4R52A 2HWB3 3LZZA 3O0VA 4E27A 3LA7A 4WVMB 3WP4A 2VG9A 4M3CE 3D0JA 3HR9A 4YZ4A 3AMQA 5C6CA 1PZ7A 1PVXA 3H8UA 1H2NA 5AFBA 2FMDA 5C9AB 4CDWC 3N35A 3VZJA 1IHMA 3ZXGA 3AMHA 3VN4A 4NPRA 3B02A 5AVAA 4DRRA 5AC93 4XMAA 4ASMB 3RI9A 2WS93 3MIBA 4XJWA 4AVAA 1DQ2A 3AKQA 4XTPA 3WCRA 4YW2A 2WC2A 2WNVB 5C8CB 4AEDB 1V70A 4NR1A 4DPNA 2ZAHA 1PZ8A 1PO21 3GZAA 3VDDA 1HV1A 1GR3A 1H30A 1VBB2 3RYRA 4YW3A 1SDWA 4OI0A 2ZGLA 3NWKA 4YSFA 1NQJA 2JKBA 2C1FA 1KDMA 4ZU4A 2JEMA 1AX1A 3VBRB 2ZGTA 1OFNA 2V09A 1KS4A 2WZR1 2VMHA 3IT8A 2C0ZA 1G9DA 4RA0A 4OI2A 5A33B 4URTA 3U4XA 5CAZA 1NA1A 2WLQA 4JAAA 4LBQD 4XOGA 4IESA 3BOWA 5I93A 4XILA 1RTVA 1TMF2 1RUJ2 1O3SA 4AI1A 4YVSA 4RS5C 1Y3TA 5F6KA 2XLFA 3ZXKA 1G9FA 2F6BA 3QH6A 4DOUA 3RYPA 2H0VA 3W58A 3VKFC 3ATGA 4B7KA 2TNFA 4YFZA 2E7QA 2HWC1 1KRIA 2YPJA 4E4SA 4LR4A 3VBSA 5CG8A 1SBDA 1LU2A 4BH9A 1CQ9A 1VRH2 1AYM3 4XFCA 4FP2A 1O3TA 3S7IA 2WFF3 1AL23 1GQGA 4WM8B 2R30A 5J09A 1HRI2 2AYHA 3OBRA 3KQRA 5JZGC 3OY8A 4AGVA 1GFF2 2EALA 1KITA 1ENQA 3M3CA 5I8YA 2YGLA 2QZ2A 5JVVA 2GMMA 2PELA 4X6QB 1C8NA 4HETA 2UWAA 3NKGA 5EWSA 4LE3A 4D69A 4L8QA 1MS4A 2RM21 3I59A 3JUUA 4DMIA 4F7ZA 4K40A 3ES4A 2GC3A 3I54A 2ATFA 1QNWA 4CDXA 4BCUA 5KHJA 1W6QA 3ZX7A 3W59A 2DVDA 3GBGA 1MS3A 1VBC1 2HWE3 4JGZC 4CEYC 1D4M2 5KXDA 1AZDA 2EA7A 2A70A 1HRV1 4AEJA 1QGLA 1KS5A 1QXJA 4XJZA 3DL3A 2IXHA 1CESA 3JQWA 4XQ4A 5ABJC 2JE9A 3M3QA 4TSVA 2CNAA 2XJSA 1LOGA 1VP6A 2WS92 1Q8OA 1RVF3 5C4WC 5F6LB 2QCSB 2AGSA 4LEJA 5L19A 4CZSA 1VAKA 3AB0A 4PBOA 4I3GA 2HWF1 1ZRCA 3J9SA 1Z78A 3CJIC 2JG9A 1V6IA 3MPPG 4CDWA 1X8MA 3PVOA 3WNXA 4M00A 1QHDA 2UU8A 3EQEA 2JG8B 1R1A1 5FO7B 1LOBA 2RS52 3VDDC 1LHNA 4K3UA 3JU9A 1QNYA 3UJQA 5GZCA 5I0SA 1FOD3 1RUE3 3ZFEC 1IKQA 3KLSA 1V6KA 4QQ2A 1W6PA 3AYCA 4BLJA 1N3PA 1EAH3 2ZHMA 5CNAA 4FAGA 4Z2WA 1OD5A 2QDNA 4DQAA 3PMSA 1Q8QA 2DCYA 3ILRA 1KDKA 3O14A 1LULA 1CAWA 1K5MA 3MF6A 4AI0A 3E5QA 4B4QA 2QQPA 1SLLA 4K7JA 4JTOA 1X50A 1FNYA 3B94A 3KD4A 3MIGA 1SACA 4AQ2A 1NE6A 4QPIC 3VZNA 2EF6A 3VBSC 1ULCA 4P9IA 4W65A 3X29B 1CR7A 5BNNC 1MS8A 2DU1A 1HQNA 2W0XA 4OUSA 3BB6A 3FBMA 5SV8A 1PZ9A 1RUI3 5J7MA 2WNUC 5EZWA 2A75A 1VBB1 2VULA 3ZYIB 5BNPB 3HIFA 2FZ2A 1YIPA 2ZMNA 4JTNA 3WW2A 3TB0A 4FXKB 5JPMB 1MR5A 4B8EA 4HT1T 2D44A 3U11A 4E2QA 3H1YA 1S0EA 2VGDA 2Z79A 4EV0A 3O5SA 1HQLA 1EP0A 1H4GA 2R063 2ES3A 5CG9A 4GKYA 1E57A 3BCWA 4KG8A 1FYUA 4F8AA 3AK0A 1U0AA 5K0UB 2HWF3 1LGCA 5C4WB 3VGIA 4RHV3 2WSUA 4JGZA 4CEYA 3RJ2X 1UCXA 5F5QA 1JYCA 3G6JB 1SLAA 1RL3A 2NYYA 2ZBJA 4LLFA 5BNNA 5FO9B 2VW0A 2VNOA 1AL22 3WX5A 1SLIA 1W6NB 1B09A 3ECQA 3TNPB 2Y0IA 4LBNA 5JOXA 2WNUA 2CTVA 4Q27A 2WL1A 2D3PA 4L99A 1O4TA 2A5ZA 4TYSA 1NE4A 1D4M3 4IV3A 1RMU1 1VBD3 3E6BA 1MVQA 4QPIA 4HN0A 4HK8A 4Y1XA 2GNTA 3M1HA 1HQWA 4O9GA 1BBT2 2P3KA 2YMZA 2B42B 4XZPA 2ZGKA 3I7DA 4GH4C 1S0DA 1QJY1 5FCCA 4LO6B 4OZXA 4FXGB 3ZMNA 2YY1A 4AF9A 3RWNA 2DYCA 1BEV1 1DZQA 3ZYGA 5J98B 4LO7A 3E6DA 4WM7A 3WXPA 2PYTA 1VBB3 4YW1A 2BW8A 3NSTA 1CJPA 1D0HA 2PHUA 4Q8KA 2R072 1AYN1 4R9CA 4LE4A 1RUC3 4OI4A 1QJY2 1QJZA 1V9U3 3GBWA 4Z1VA 3VBFB 4XIOA 1MVEA 2WT1A 5C8CC 2ZTNA 2JG8C 5L7OA 1FOD2 1RUE2 1LOFC 3JB8A 1LU1A 1IOAA 4IV1A 5FLIA 4Y22B 1MS5A 1AXKA 3ZFGC 3KCXA 1T6GC 4AW7A 5DDJ1 5JSOA 3NV3A 5IUQA 1QOOA 3D5OA 1LHOA 1VBA1 1AXZA 4CDXB 4FPJA 4XF3A 2VMGA 5E16A 4BMBA 3BTAA 2CL2A 2RS51 1RUC1 2A3WA 4FPKA 5JDBA 5K7PA 2YXSA 4UW3A 4BM8A 1IPJA 4CYDA 2WZR3 3ZXJA 2ZMKA 1Y7BA 4CP1A 2DUQA 5DDJ2 3ZSJA 4OFGA 1EY2A 4GMP0 4JV4A 1G9BA 4KL1A 4C0BA 4P9LA 2OVUA 5EV7A 4RR3C 3THTA 1QJU3 1YI7A 4EN0A 1RJ7A 2XVLA 1HDKA 2ZGPA 3CEWA 3DPRC 2KM2A 3H7JA 2R041 2VNGA 1UPSA 4CTEA 2R0FA 1PO22 4JDNA 5GLVA 1OSGA 3V0BA 3RYKA 5KHKA 3V64A 3KCCA 4N7UA 1POV0 1YIFA 1YFYA 4W6XA 1ZYBA 2ZHNA 2QKDA 3SH4A 5TSWA 5JZGA 1DHKB 3ELNA 3SCGA 2RMU3 5FQ0A 1LHVA 4OHYA 4HPKA 3VHPA 3ILNA 5FTTC 2BPA2 2XPJA 2VVEA 4LUMA 1UKRA 2WS91 4P9JA 4B7EA 2D6KA 4CP0A 4UW5A 3IDCB 3WG4A 4XJUA 2JG9C 1PGSA 1RHI1 4CDUA 1TME1 4Q4V1 3UK9A 1S0IA 3O7OA 4XMIA 2E9QA 5FREA 5A3LA 4O9EA 5IK5A 1NY72 3M7AA 5J96B 2GN3A 5LEKA 3L2YA 1H9WA 2DVGA 4EN9B 2BYVE 5T3NA 4BQ1A 2WQ4A 3VBHA 4AI8A 3MFAA 1PGL2 4MLOA 3EJKA 2DCJA 1ZBE3 4GQ7A 5DG1A 1AL21 3ROUA 3AX4A 3JD73 4Q26A 1NCQA 1PIV3 4RSUA 2NZ9A 2ZGNA 5FDBA 3UKTA 5JI7A 2QJVA 2BNNA 2A6ZA 2E7AA 5CFDC 3WP6A 2D3SA 5CBLA 3VKMA 1J3PA 1GLHA 2PLV3 3LSDA 4Q0SA 1A6CA 2BFUL 4Q1RA 1CAVA 3WINE 3RS6A 4Q29A 1VBE1 4GULA 2EAAA 2RM23 1IZ3A 3N7MA 3AXEA 1WBFA 4QU2A 4QPGB 3D6EA 1POV1 3DN7A 4AGRA 1OKQA 3WLUA 3WP5A 2HWF2 1RIRA 2ZX4A 4YG0A 1N1SA 1ENXA 3ALQA 4QQPA 4LBQB 3IM0A 2GAUA 4LHLA 3BOPA 3WDVA 1ASJ1 1ZBA2 3ZFEA 2A6YA 3ZIXA 1S0GA 4YGBA 2DWRA 4I09A 2GH2A 4X8PA 3HN1A 2DU0A 3WW1A 2BEOA 4JC1A 4AHZA 1LRHA 1A3KA 3E5XA 1BMV2 3GZUC 5DZGA 4XXAA 2CAUA 2OUHA 1JOJA 3J8F1 2GU9A 2XGXA 1RUF1 4CDQB 2HWB2 4RS5A 5GLZA 5BNNB 5I8TA 2W52A 3GALA 1R082 2B39A 2EXIA 1GZ9A 4INDA 2XHKA 4GKXA 4M0HA 4YFWA 3AMMA 1HIXA 1NLSA 2FBEA 4QGMA 5K0UA 2D93A 2H6BA 3OGGA 3UKNA 4ATFA 1W39A 2KA3A 2P3JA 4KGGA 4CDUB 4D3WA 5CFCB 2ZX3A 1NCQC 2OZJA 4YM1A 3H0OA 3HWJA 4FOVA 3ZFFC 1AX0A 5KXCA 2DURA 5CFDA 2ZA9A 3DPRB 1LEMA 2YV8A 2GH8A 2PAKA 3ZVXA 1RC6A 3FC0A 4BA6A 4LHKA 1OOPC 3ZSLA 4AEDA 4LHNA 4CEWA 4PLOA 1R083 1RHI3 2VQ0A 1WGPA 3B3QE 2B8MA 3MW2A 2BWCA 3KGZA 2Y26A 3PMEA 2PFWA 5FBZA 4XF1A 3ZFFB 1OLRA 1MS9A 4DY5A 4PIZA 5EFUA 4C1XA 3NV2A 4UW6A 4XTMA 2PN5A 4HVOA 3CJIB 3LGRA 3R05A 4E4ZA