1PK8A

Crystal structure of rat synapsin i c domain complexed to ca.atp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rat synapsin I
publication title Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 91
structure length 306
sequence length 306
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1pk8A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1pk8A01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pk8A02
5KX5F 4I4TF 3G8DA 3MJFA 1VBHA 1KEEA 4DIMA 4ZI7F 4MV7A 1DIKA 4FFNA 1EZ1A 3BSYA 3ORQA 1W93A 2FPPB 4WBNF 2R7NA 1PK8A 3JZFA 4YJ3F 3R9RA 2CNQA 2Z04A 4HNTA 3GIDA 2NU6B 4IZOA 4FFOA 4O4HF 1I7LA 4NYEA 4MAMA 1C30A 2VQDA 2J9GA 5H80A 2GLTA 4EA7A 3TIGA 2PVPA 1CE8A 5BMVF 1E4EB 1OBDA 3UFXB 3AX6A 3TQTA 5LP6F 3V4ZA 4ZOLF 3QFFA 1SCUB 4O7YA 4O7NA 2HGSA 5HV6A 5J2TF 3VA7A 1IOVA 4M9CA 4XYMB 1Z2OX 4FE2A 2ZDQA 3MWEA 3K5HA 2SCUB 2ZDGA 2W6QA 3K5IA 3KAJA 3WO0A 3R5HA 2CNVA 5LOVF 4O7TA 3N8DA 5BPHA 3HBLA 2R86A 2I80A 4EGQA 4GGMX 4IWXA 1JDBB 5JVDF 4MV6A 2R84A 2VHEA 3VOTA 4EA9A 3BSWA 2W71A 4FFLA 3U54A 1M0TA 3E5NA 5JQWA 4YAJB 4WD3A 4C5AA 4MV4A 2NUAB 4MV3A 2VR1A 4L1KA 1AUVA 1KJ8A 1OBGA 4M98A 3LP8A 3R23A 4XX0B 3Q1KA 4O7LA 1UC8A 3HB9A 4M9UA 3BG5A 4HNUA 1GSHA 2R7MA 2V5AA 3VPDA 1A48A 3ETHA 3TIIA 2V58A 4O7SA 2DZDA 4C5CA 4FFPA 2V59A 3BSSA 4C5BA 5CAEB 2YS7A 4O7VA 4O2BF 1KJQA 3I12A 3TINA 5LXTF 4FGRA 1C3OA 1E4EA 3V4SA 4O2AF 4HNVA 1Z2PX 4I55F 3N6RA 4HQ6A 3HO8A 2CQYA 5C1PA 1UC9A 3VMMA 1W96A 5IYZF 3KREA 1GLVA 5CA0F 2W6NA 3ORRA 3RV4A 4MA5A 5BPFA 4YJ2F 1IOWA 5HBRB 4O82A 4FFRA 5EZYF 4ME6A 4XYLB 1BNCA 2PN1A 1GGOA 3JRXA 2YWVA 1DV2A 5LYJF 4MV9A 1WR2A 2NU7B 5LA6F 2GQSA 4O7RA 3VPBA 3RV3A 2DIKA 1VKZA 3Q2OA 1KJJA 2W6OA 5I47A 4TV9F 4O4IF 1M0WA 3NUAA 5CA1F 4EABA 3GLKA 4TUYF 4ZHQF 5J2UF 2XD4A 4YAKB 1JDEA 3WO1A 1EUDB 1KJ9A 4O7WA 2NPOA 5KKNB 1CS0A 4EG0A 2QF7A 4IWYA 2YW2A 2PBZA 3JRWA 1CQIB 3OUUA 4J6EA 4O4LF 2FP4B 5FNVF 1KBLA 3BFPA 3U55A 5JH7F 2YZMA 3MWDA 5C8YF 1EYZA 4QSHA 5JQGF 4O7ZA 4YB8B 2DWCA 2NU8B 1B6RA 5CB4F 2QK4A 4O4JF 4RZQA 3U9TA 5JVLA 1BXRA 2W6MA 2R7KA 1JLLB 1M6VA 2OLSA 4IIJF 2YZNA 2X0SA 4ZQIA 2P0AA 1ULZA 2YZGA 2GPSA 2I8CA 4HR7A 4Y8VB 2C00A 2NU9B 4EAAA 2Z02A 1EUCB 5DMXA 5D8DA 2FPGB 1AUXA 3ETJA 3LWBA 1CQJB 2YL2A 1B6SA 1PX2A 5GONF 3RFCA 3OUZA 2HJWA 4O81A 4IHJF 2VPQA 2YRXA 2CZGA 3RUPA 4E4TA 4MV8A 2R7LA 4I50F 5C1OA 3DF7A 2YZLA 4MA0A 4O84A 2R6FA 1JKJB 2GPWA 2IP4A 2GQRA 3U9SA 3TW6A 3G8CA 1Z2NX 1T36A 4TV8F 4MV1A 2R82A 4O86A 2YRWA 1KJIA 2XCLA 2R87A 2I87A 2DLNA 1EHIA 1I7NA 2FB9A 1KC7A 4DLKA 3K3PA 1DV1A 1GSAA 1VBGA 2YS6A 2W6ZA 5K2MA 2WYOA 3R5XA 4YBZB 1KUTA 2ZDHA 3VPCA 3AW8A 3JZIA 3KALA 4XZ3B 2YYAA 2W70A 3KAKA 4FFMA 2CNUA 4FU0A 3SE7A 4O83A 2FPIB 2R85A 2W6PA 3R5FA 1A9XA 1GSOA 4M99A 4EGJA 4EA8A 3WNZA
chains in the Genus database with same CATH superfamily
6REQA 3KR9A 3EIHA 1XQYA 3CRMA 5AUOB 1NUQA 3VHRA 3O38A 4QX6A 2GCEA 2QP3A 5C0OE 1J0XO 4DARA 2GAJA 4JI3H 2UZ4A 3J7AK 1SWVA 2DOKA 4OAQA 2ZR8A 4NAVA 2QX9A 1G4UR 1XZBA 2ZJ3A 2R6DA 5A06A 3PFKA 4PR3A 1H23A 4DQNA 3LKDA 4PTZA 1MG0A 3PDUA 3SC4A 4YMGA 3PE3A 1VQ1A 3NUGA 2OFWA 1XZMA 2J6UA 4NXMB 3ZDXB 4N3GA 2N42A 1M5RA 5E25A 3NAMA 1U0HC 5E95A 1Z38A 1PL6A 5IWCA 2DFVA 2RH4A 1H6CA 2XKJE 5HDQA 4BV8A 5B3JC 4CKWB 2O7RA 4M37A 3V7NA 4BNTA 3P9YA 3F3KA 4AICA 1I2CA 2XW6A 4WLUA 4PLZA 4MS1B 3E4DA 2DJ5A 1SC6A 4YT5A 4B0OA 1U0RA 4ZVTA 3LLUA 4N0QA 1VL0A 3DHWC 1SD5A 3FZYA 4UCOA 3Q87B 3WADA 3DJFA 3ZVRA 3LCRA 4FCWA 2K6GA 4PHTA 1XTVA 4DSAA 2XITA 2YW9A 4XM2A 3TKYA 2Z30A 3M83A 5EJFA 3O8QA 4PG6A 4LECA 9ATCA 3OKFA 1HA3A 4N9WA 4NZ9A 1SCDA 4UE2A 5GY7A 1MABA 5ADWA 3T7AA 4C6RA 1XMIA 4JLMA 4RJ2A 1R4MA 3AEKB 4HGQA 3AEQA 4OD0A 3VVLA 4BP9A 1V1RA 3WGNA 1QKIA 4FFRA 1M34A 4UBOA 1WSDA 4LZAA 3GZNB 1EWTA 2CLMB 3N3AC 4ND4A 4HH0A 2BBTA 1A69A 3F96A 5LL6P 2R25B 5HF5A 3U0BA 3KHKA 3O93A 5K05A 3HYCA 4UTPA 2N46A 3FVRA 3E61A 3SS8A 1Z06A 1CRPA 3K1AB 3QE9Y 2KB0A 4PSKA 3RTCA 2D5BA 4MW9A 1F9AA 4NXNB 4J0KA 4IZIA 5BWWA 4MPRA 3PFWO 5KX5A 4R8KA 2JPDA 3N0TA 2CLOB 2Z5FA 4JU9A 5E4FA 2LXNA 2JCYA 4NK4A 4PQRA 2QRGA 1NF2A 3B6EA 1ES9A 2VOJA 2D3WA 4DUGA 1OIVA 2HA7A 4BN5A 4BFXA 3SMVA 1A8SA 4FD2A 2BFOA 1ISGA 3ZNNA 2VBFA 1ESMA 1YS6A 1V7QA 5FP0A 3WIUA 5BR8H 2P2NA 2WIDA 2W2NA 3ZD6A 3CSSA 4M9SA 16PKA 1XIVA 4C7XA 3S1SA 4OBXA 3LYAA 3IPLA 1P2GA 1KKUA 3BE8A 4NAHA 3H86A 1NRWA 3G8BA 1TRHA 2UZIR 3QY9A 4BJ5A 5HKKD 5SICE 3RKRA 1YS4A 1VGQA 3Q11A 3SKXA 2YYZA 3I9KA 1VBNA 3EXAA 4JJIA 3K35A 3L4SO 1UZLA 1VI2A 3DKVA 3ONDA 4NMXB 2TS1A 4F3RA 1Y3DE 1L8XA 4H3VA 2GBLA 1M1YA 2XZTA 4DYHA 3O2SB 3W2HA 1YS9A 4IXMA 1RJWA 3JCZA 1EFPB 5K2MA 3COJA 1ULBA 2AZMA 1AGXA 2E4XA 3JASA 1EG7A 1XI2A 1E1LA 1EXVA 1GUAA 1DUIA 1W8DA 3PUVA 3H11A 5ALKA 1KDZA 3K0KA 3T1YB 4KN8A 1UDCA 3GVIA 4BQFA 3MS7A 4CTJA 1JSRA 5L95A 4C87A 2Q2UA 3GDFA 2O8VA 2O7NA 3HO6A 3W34A 1U6JA 3WYNA 2ZUBA 1E8NA 4U5XA 4G85A 3BA8A 4A3SA 3K2IA 2PJZA 3V1TC 4CFZA 3OF3A 5EP1A 4X62B 3JTMA 3A36A 1YZFA 4YY3H 1I6UA 2WF8A 2GEUA 4D9JA 3L2PA 1E3DA 2GILA 2WG0A 1GPH1 3N2ZB 3CVWA 1NVVQ 3L1JA 4UPEA 5JDCA 4N6GA 4JKIA 4ASUD 2YY6A 3O1HB 2XUZA 4FMDB 1A50B 4TQSA 1W7AA 4Q1CA 5FA8A 3V7UA 2QJFA 2XXAA 1AS0A 3OC0A 1USVA 4LF4B 2UVDA 3IMFA 4MV4A 1XCMA 1WKCA 1L8OA 3IO5A 4DL4A 4C0WA 3N2YA 4LFAB 1OX6A 5HQTA 3B6MA 1UBSB 3SVZA 1KI1A 2C8JA 3HB9A 1RWNA 4PVCA 3GK3A 1QF6A 2WU4A 1Z47A 2XSZD 2QL5A 1EG2A 2JLQA 3VR5D 2VPPA 4G6ZA 2M05A 3VVMA 3E82A 4QRHA 4W8OA 4KH1A 3GWGA 2P77A 1E2LA 2J1LA 3L43A 1I2MA 2P2ZA 1XXLA 3FOCA 3KKQA 3P9CA 4Q1EA 3WDSA 2VF4X 4G1BA 2VDLB 4P5PA 5KO2A 4LMAA 1KI2A 3CNEA 5EPOA 4ZU6X 4RD6A 5I7UA 5F21A 3PEEA 3BHJA 4B6FA 2HH9A 2WTUA 2IPAB 1TZKA 2P68A 5C18A 4ND8B 4OHXA 1QK3A 2GESA 2B6NA 1T35A 4AK9A 4CFSA 3CUKA 3KTOA 4JI0H 4K81B 3VR3A 3RV3A 5FUBA 3RUEA 1CQIA 4ZYZA 3OPVA 4M9QA 2Z6QA 1B0UA 1SIOA 3A0RB 2L17A 1FLNA 3EIQA 1D03A 3R09A 1JMYA 2QIOA 4XQCA 4OUDB 4DR4B 3BXGA 4H1UA 5CVDA 5A3RA 1GY8A 1KYTA 3UF0A 3M4YA 3D8TA 5K3AA 4REQA 4M0LA 2ZYDA 1KORA 1KSHA 3HYLA 1OBOA 2HA0A 1YR8A 1COZA 3ECCA 2NQTA 1AURA 3DPUA 1CD5A 4V24A 4K6FA 1IY1A 3RU7A 5AVZA 2VI5A 1NV9A 1Z8FA 5IJXA 3CQ9A 3DMTC 3WGIA 4UEOA 4LRQA 2QRMA 3GUVA 1UC5B 5KPJA 5KG2A 2R44A 3KVOA 4B4OA 4FGWA 1CRLA 2JGDB 3EG9A 5L40A 3HZRA 3Q6MA 3PRKE 2IGTA 2YV5A 1B0ZA 2ZIVB 2ZCVA 4RDHA 5L4NA 2OZKA 2JKYA 5AWFC 1SD2A 3CU5A 3DF7A 4RVHA 5CFMA 4G89A 3U7IA 2Y2UA 4N82A 3B6JA 4UVHA 4DMMA 3VV3A 2J5BA 2NXNA 2JFOA 2DQSA 4J1QA 3J81A 3PNBA 2E3JA 1GDTA 1ELOA 1E20A 1I5RA 3TRFA 5DQHA 3C45A 1GSAA 2W2XA 3U0GA 4Q01A 3C3AA 3Q9LA 1G21A 5T8KA 5EMNA 4LKOA 2ANBA 1JH8A 3GROA 2R85A 1MRNA 2ZS8A 3A6ZA 1NVWQ 2CXOA 4I4TF 4HQLA 1P1CA 3C6ZA 3S29A 3KIPA 2Q27A 4KXXA 2WHPA 2R7ZG 1I3LA 5C8XA 4CCSA 2W2OA 5ALFA 2BSXA 5EQDA 3RPEA 3HM9A 1NC1A 4LH7A 3DOOA 3NTOA 4Q4AA 5ER9A 1BW9A 2A30A 2FSGA 5CHEA 3MCWA 3G2MA 4B6EA 4CM7A 1XZJA 1GAWA 2KJQA 2PRSA 4JJGA 5I9IA 3DOJA 4QOHA 2FPWA 1ULTA 3DL2A 5F2NA 3OFVA 5ESXA 5JAOA 3TLEA 2XDYA 4HB2A 2Q2NA 3URKA 1G38A 1AN0A 1E2EA 3QIAA 4M7OA 4LFCH 4YRAA 3ZIAA 2CJPA 2X7JA 2UZ1A 4KGVA 4JXKA 2OXEA 3SC3A 3FFAA 2NSHA 1ZONA 1XDZA 4WBSA 1FXUA 4YXWA 1JQLB 2SBTA 1UDBA 4WJLA 3L77A 3PHGA 3UT6A 5HUJA 4R2HA 1UBJS 2Z4SA 4JT2A 1HL3A 2WOJA 3LGXA 2IH2A 3OM0A 4M8LA 1RKVA 1SUEA 5D5PA 3QVJA 2MR6A 3BF8A 4XX0A 3RC1A 4AO7A 2GPNA 2NUAB 3KVRA 3OCZA 2VF7A 2AXEA 3G0GA 2PX5A 2UVPB 4PNHA 3V1UA 1K6EA 4RKFA 2PEZA 4HOYA 1EKPA 1ONNA 3N6VA 4MI3A 3CE6A 5L8VA 3AIIA 1G0OA 3S70A 1T8YA 1QPGA 4KXWA 3TQQA 1L7VC 1KOLA 1Y80A 4DLSA 2PL1A 2V6IA 1XCJA 4OGLA 4DF3A 2J4DA 2KM1A 2I2XB 2F2TA 4AYBE 2VSNA 5A5GA 3I2IA 3G02A 3K2EA 1FBNA 3UHAA 3N6RA 1YS2X 3DGEC 3HUUA 1XTIA 5FRDA 3FJ1A 4WK4B 2OPHA 3N44B 1ONPA 2JIBA 2MJLA 2HRQA 5A7FA 1F48A 1H1LB 2BP7A 1LH0A 2PR7A 1O89A 3QHAA 2PTGA 3RTEA 3PZPA 5KNCD 1E5QA 3A58B 3GZTB 2XECA 4C0HA 2JRLA 5CTAA 4J9SA 4GL2A 2REOA 2X0JA 4WKPA 4J9PA 3OFKA 3PRJA 4I5EA 3ESAA 4OB7A 1Y4UA 1N5RA 1E6MA 4TXJA 5CDTA 4Q43A 5CB8A 5LP1A 3VTKA 2ZWIA 4CQLA 4ND3A 3CLKA 5KWJA 1U5CA 4AWAA 5CUQA 1VBMA 1Z4QA 3I4LA 1AMOA 5KSYA 1QH1B 3KYDB 3OJFA 5FBWB 2DPYA 2DBVO 2OLJA 5JBIA 4NLLA 8AT1A 2W6MA 2WBLC 2OAP1 4AMBA 2OLSA 2YY7A 2O7QA 4MYDA 2PT7A 3UK7A 1XEAA 1N75A 4L57A 1EJBA 2COUA 1UBGA 2WPNA 4GWLA 2PUHA 1T4CB 2JLAA 4XSVA 3NP9A 3MWGA 1KGSA 3BN3A 1S0NA 1TTHA 4EVIA 3R3WA 1PX2A 1E59A 3L1VA 1MQ8B 1DT3A 3HEBA 1IZ0A 2WSMA 5KQMA 3RI3A 1BXGB 3MFQA 3QOWA 4BMNA 1O3YA 1XRRA 4ARZA 3WIBA 3E2IA 3UUWA 1S7CA 3LPMA 3K4QA 2B4RO 2ADMA 3IKJA 5J47A 3X3HA 4F50A 1XDBA 1WEKA 5HILA 5DLYA 2B8EA 3ZJVA 1TZMA 2JFGA 1M83A 1NQTA 3C6QA 3AR5A 5LQAA 5JFGA 3I76A 3LWDA 3T1NA 1QIFA 2A3RA 2O2DA 4JV1A 5AI6A 5JRDS 4BLRA 2J5XA 3JZIA 4MQ5A 5CNMA 3KJNA 1JEJA 2CNWD 1PLJA 1VE6A 5GMOA 4WFJA 1A95A 3BJRA 1KEUA 1Z17A 4ACBA 3WDKA 3H1GA 1FYFA 1PFYA 1RPTA 2ZLBA 4P1ZA 3ELUA 4JFRA 2F1OA 4E51A 2AEEA 5FOXA 2Q3JA 3EA5A 1EK1A 5BN5A 3DMNA 4M86A 2G1AA 2FR8A 4N49A 1KSGA 3NCHA 4ED7A 1Y89A 4DKXA 4LSGA 3KPJA 1QYRA 4B3BA 4YJ2A 3F98A 4KCGA 4IOJA 3KFXA 1PNOA 1NU6A 1YOVB 5JJ5A 2E21A 3UT5B 3ABQB 3RFUA 4IXNA 4X84A 4N5MA 4CQJA 3MEQA 2ZUWA 4GSKA 1GRNA 4CPDA 5KFMA 4X1KB 5L1KA 2XAAA 3MD9A 3UAXA 3E7FA 4BS9A 3TVYA 2RD2A 2XMQA 5IAJA 4ZXFA 3LQQA 2GD1O 4MPJA 2E6UX 4AKTA 4DL3A 2H2AA 1US8A 3OHSX 2IU6A 3H5OA 1K6XA 3E5NA 3KWMA 3HJRA 2EL9A 1N3LA 5DYIA 3F47A 5AMXA 1GNRA 1ZJYA 4WZBA 1XYGA 2AKAB 1SBHA 4PRZA 2R3SA 2PA0A 3BMNB 4WV3A 1RXCA 2V03A 4IR9A 3TXYA 3KJGA 2BIFA 4UFPA 1W59A 1HSZA 1CWUA 4ZQCB 1N77A 4KDFA 4W82A 4ZGWA 2WLTA 4BRZA 4NV3A 4U0KA 5K0CA 3M5PA 5CAEB 1FDSA 4EPYA 4BB6A 1A5SB 1R9MA 4CV1A 4ZVSA 1Y1QA 3WK6A 1YIOA 5EIEA 5E6RA 3ZK7A 3S44A 1W1UA 5AP9A 3GZNA 3KZMA 3DP9A 4M1EA 2PJUA 1CDOA 2BEWB 2XODA 1KJNA 1JWBB 4X24A 5BWMA 2BFEB 3LQKA 3QPUA 1QFZA 2R96A 1WPRA 1BE6A 1I8TA 1H3FA 1MGOA 1J5EH 1T5OA 1Y7LA 1TU0A 2V54A 5E0OA 3L0OA 4W9NA 3STWA 4CMGA 2PO5A 2IDKA 3PPXA 1WXHA 1O96B 1KJJA 2YOFA 1AKQA 2HIXA 3UMJA 3G9TA 4YPOA 2X0DA 2VTEA 4LNUA 2GF9A 3VHQA 5FOWA 2D7DA 2HLNA 4EMBA 1RQPA 3USES 3GLKA 3UW3A 1QDEA 4LWQA 1RJGA 2CDCA 3F9RA 2XQKA 2RJ3A 1Y1RA 3GVHA 2XNCA 4G0YA 3O4GA 2AFRA 4XD7A 1G7SA 3CVXA 2BI7A 1Q2XA 1ORVA 2FQXA 2G36A 4I9GA 4OM8A 3L0YA 1ZJWA 3FPAA 3RB8A 4DV3B 1QYCA 4YUZA 3QQ5A 3N59A 3RR5A 5K0EA 3H83A 1PZXA 4N6NA 2ANCA 3GJZA 3FCOA 3T3IA 4U9IS 2PMEA 4NMLA 2A5DA 2ZE8A 2I55A 4XWKA 3THYA 5KOHB 1RKBA 2HTEA 3LX4A 3Q3EA 4NU8X 2A67A 4X3CA 2OFOA 4LKRA 4INAA 4DG8A 2PPLA 2LIPA 2P9GA 2A5LA 3LBIA 5KSOA 1FFWA 4TSRA 4RIGA 1EVIA 4BKMA 5DNEA 3N0VA 1JDJA 3FYTA 1MKYA 5LJIA 5BNZA 1U2RA 3RVKA 4PLFA 2OBBA 5ALNA 5BSMA 2X1VA 1EFPA 2IKQA 1YR9A 5EXEA 5IJ9B 3PIRA 3DLAA 3TZHA 5E1DA 1UK7A 5HCIA 2ENUA 1UK8A 2AU0A 3MMZA 4RWZA 3U40A 2R6ZA 1FFSA 2XE4A 3IIEA 4BKPA 2PGAA 1V8PA 2C7VA 5AXAA 3GFPA 2W2VA 1UWVA 4KIGA 4IQ8A 4AYBA 3DLCA 4MV7A 4NS4A 2UUAB 4I55A 4R5HA 1S2LA 3MRXA 3TLMA 4B32A 1OT5A 3ZE1B 1A9XB 3HKZE 1I51A 4TS1A 1W5BA 1YGPA 2XUPA 3MK31 2WKRA 3LBHA 1QTQA 4KQ2A 3WTBA 4NYEA 4XVUA 4G26A 4IW3B 4W7SA 1V3VA 1MOPA 4EYGA 3GH1A 4ZO4A 3IERA 4B79A 4U7DA 3V4ZA 3O8QB 2GJKA 2ALZA 2ZM5A 3MJTA 4KLAA 4UVDA 3ZHTA 3D5TA 3HQ4O 1A8UA 421PA 3C8HA 5JD5A 5LVAA 4EF6A 3WL6A 1HDGO 4GPBA 1R4MB 3L1HA 1I94H 2UVVA 3B7PA 4F5EA 2ZTLA 1OXMA 1V1RB 3K1JA 1M34B 2ZI9A 1JDBB 2RGAA 5CT5A 2DUMA 2OCDA 2PD3A 3BXEA 1AXEA 3ABSB 5AKYA 1EVJA 3L6UA 2RGNC 3ZVMA 4R9VA 3NKLA 3SU8A 4URYR 2XD9A 1P81A 1DJMA 2QSZA 2IU3A 1UIMA 2VNSA 1DAMA 5LZ8A 4D4HA 5ALTA 1JF8A 2YHUA 2B2NA 4M9UA 3ROEA 4KQ1A 2QX7A 4MWTA 5K0SA 3HA3A 4KO3S 1I6LA 2WAQE 1SXQA 3HOXG 2YTZA 3RAJA 2VDPB 3TAXA 4R9RA 4UVEA 5KX5B 3I64A 1H3EA 2Z0MA 1X13A 1JDZA 1BWSA 5DK4A 3UEOA 4JK3A 4ENPA 3D6NB 3O84A 1J09A 4A9AA 2YQ5A 2X15A 2PRIA 3FAKA 3VU1A 1RM3A 3NBYB 4MA5A 2RDIA 5G0VA 1W5EA 3GRKA 4QPNA 3BVPA 4F2HA 3TD2A 5CW2A 1E6LA 1U6KA 1YTUA 2AXPA 2Q6TA 3AGPA 4TV8A 3Q2IA 3W8NA 3M9WA 4AUMA 1TA8A 1S2IA 2X9GA 1P0FA 4JEMA 1EA5A 3LUFA 4JC0A 1YCDA 3ADBA 3DC7A 3Q7RA 3EXEA 3I53A 4I0WB 2HVQA 3JQ9A 3U7FB 4FIZA 5IH7A 3WGVA 2FZLA 2IHKA 5BQXA 2P35A 1ANKA 1L7NA 3JS5A 5BNTA 4EBFA 3ADPA 1ZH6A 1CLUA 1ZM7A 2Y1EA 2R7ZA 3BXPA 2WFLB 2VYVD 3AHIA 4UMDA 5CXSA 5FBZA 4YHBA 5FL7A 4KE8A 4HEJA 1SVLA 1AIPA 4PYLA 3HV2A 1OW3B 3RSSA 1XDUA 4TS3A 4C01A 4ILKA 2PA3A 3G9ZA 2JGDA 2I8CA 2ORVA 1C7RA 5AKKA 2Q0HA 1MVLA 2YHBA 1AF4A 2I7VA 3UQZA 3NEPX 5BMVA 4R0MA 3IEMA 2JLUA 1UXJA 3SS7X 3BAAA 1L6RA 2OILA 3PEVA 3T5GA 3OY7A 1P7PA 4MCAA 4NYIR 4CTKA 4MV8A 3RLFA 4ECTA 3RG8A 3X1KA 3ZY2A 2ARKA 3OO1A 4JV2A 5JJIA 1G2QA 4TSFA 1AGYA 2KQUA 1DUVG 4F96A 2XB8A 3CRZA 2C59A 1IDN1 3U17A 3H65A 1Q1NA 2HYDA 1JR3D 5T3YA 2P41A 2P5YA 1O7JA 4ZC1A 3U1TA 1XYVA 1H0SA 3VPSA 5I9LA 3H2JA 1T5LA 3H2YA 3TYXA 2WWFA 3D6FA 3CNHA 4QYSA 2NVXA 2A35A 4FKBA 3H1PA 3C6MA 1PQWA 2ZDHA 1E1KA 3RB0A 2NPIA 1SK8A 1T2CA 1NONA 4FU0A 3IOBA 3V55A 2WV9A 3B12A 2GYYA 5CYGA 4O2LA 3Q7TA 1GNQA 2VK8A 3ZU6A 4EKDA 3C15C 2EIXA 4D74A 3NNNA 4EX6A 2GZ2A 3BD6A 4FLEA 4WNAA 1WDKA 4B87A 4URFA 2I62A 3SQXA 4X66H 2ZTSA 2H5EA 2PX8A 1OB2A 4DYDA 2BBSA 5HOEA 2C2HA 1W94A 2GUGA 1OAOC 4KSBA 3GB8B 5HCNA 4X8MA 1ULSA 5G1PA 3HVUA 3VR1A 3S6JA 5EQFA 1P2SA 1VLQA 4ZU1X 3KUXA 4J9UE 3E0XA 1BGWA 3FHOA 5AK4A 3U7GA 3E70C 1E2UA 3ADDA 3DA8A 4EDHA 3I5MA 1Z12A 5I3ZA 4I1IA 4D96A 1N7IA 3WO0A 4UAVA 3R5HA 4GMHA 1BQ3A 2ETVA 3MGKA 2NUAA 1X0XA 5BYJA 1SPBS 3BIJA 2UVPA 1MO4A 1NGSA 1AUOA 3H9CA 2AC2A 4YGXB 3ZDBA 4YRGA 4E2WA 1NJFA 3IUEA 5HQJA 4HWOA 3QVLA 4EELA 4ZQFA 4BYMA 4JWTA 3V7YA 2HUNA 3FKIG 2H1LA 3R23A 2HWUA 4QEDA 4Q19A 4BQRA 4B6PA 3IUMA 4A73A 3UJHA 3LYUA 3CY6A 2PANA 5IVHA 1JILA 3K15A 2PQ6A 1T9GR 3EUWA 3DQPA 1CHNA 1NA5A 3W5DA 5CT9A 1I1MA 3JQQA 1H1LA 3WDMA 1DIGA 4BUZA 4J3JA 2FPUA 2GD2A 4DV4H 3QG5A 3OTQA 1XPRA 2JGNA 1IBMB 3O2JA 4DR6H 4BJ6A 1X1BA 3EDMA 2L18A 2QQEA 5IKMA 1D07A 2PMWB 5G0TA 1VE3A 2JD1A 1VSTA 5CVUA 2VT6A 2AEMA 2OO5C 2RH8A 4Y3UA 2AOUA 2W9XA 3B1YA 1NW9B 3IBYA 4GICA 5ES4B 1M34E 2ZR0A 5KG3A 2AOVA 1X7GA 3EG9B 4C0XA 3VJLA 4EHHA 3KHLA 3U4HA 2KE5A 1IY0A 1E6CA 3D7LA 2D1FA 5COQA 4G67A 3F5DA 5CA1F 5AVQA 3KYDA 4O25A 1GRVA 2XH8A 3V8EA 1U80A 3UUFA 3G0CA 5CJPA 4ED6A 3RREA 3WJ2A 2DUWA 1RACA 1ZH4A 3B7WA 4IJKA 4JLBA 2RK6A 1EIWA 5DXAA 4BLVA 2E48A 1Z0SA 3VHLB 3C8ZA 5ALUA 5IWAH 2XNHA 1J8YF 1KNXA 1TIPA 2CMKA 2V7TA 3HKZA 3T7IA 4KBYA 3HVHA 4BWSC 2ICAA 1A3GA 2GEJA 3VC7A 4CKCB 1FTGA 3CGGA 1T4CA 2Q4BA 2HL6A 1KOFA 5B1DA 4P3NA 2VWHA 1G21B 3OCUA 1AO3A 3QNMA 2IW1A 5TLSA 4GOMD 2VZLA 3ZOZA 1NUAA 5HBGA 1BXGA 1JG2A 3AT1A 5BWVA 1I01A 3ZE9A 1E9RA 4QW8A 3H2ZA 5I7FA 4EOGA 3FMFA 2YASA 1O0SA 4TMWA 2DQYA 1WRVA 1U1EA 4DMLA 1BW9B 2H1VA 5KYTA 3SIPA 3BORA 4Q02A 1XK7A 4FNAA 4MI9A 1DIAA 1LK7A 4MO9A 2CLKB 4CMEC 3HH8A 5SV2A 4CU2A 1UBHS 2YZLA 4PANA 3TTTA 1SZJG 1UBUS 5EWMB 4FSXA 3E05A 3NLLA 4XQGA 2DQKA 2Y1XA 3PYXA 1XDSA 4UKDA 4LDJA 3DLBA 2UZ1B 2JB9A 2Q3EA 1RPNA 4A3JG 4NOLA 1GU7A 3PLAE 1N2SA 4HAZA 3Q8RB 1KC1A 3PW2A 1N0HA 1UZUA 3I72A 1T1RA 2EKDA 2WAQA 1YFZA 5A3QA 3FVTA 3JV7A 2C2MA 3TNJA 4RD4A 3I3SR 3NHLA 1MHPA 1AKWA 4TM8A 5B55A 1I2BA 2AZXA 1FVXA 3GMTA 3BQNB 3TVDA 5IC4A 4CM8B 5TNXA 2JH9A 4B83A 5EQTA 3IXMA 1V5WA 3QXSA 3DYVA 4QGFA 1U3CA 5BQFA 3UT5A 5ERXA 4X1KA 4EFLA 2JHAA 5IJAA 4AUEA 4IXDA 1KH1A 2OHXA 4CWAA 3CX8A 3WRYA 1N36B 1KC3A 4WN9A 4WEQA 2I4RA 4UM9B 3TSCA 3TZ6A 3TQFA 1JR6A 4BP8A 2TRSB 4I1OA 2BP7B 1P31A 3C3WA 3BH6A 3SF0A 3CH4B 2V9WA 1BG6A 2CJYA 3JQRA 3WGMA 3RGGA 1HTTA 1CIJA 1E1QD 4B3IA 4UQOA 5JSUA 2VRBA 3B3GA 3BMNA 1VTKA 1MW8X 4WD3A 3QTLA 2VNIA 3CYFA 3RB3A 4K40A 2ZBPA 4DDKA 3KQOA 2CXQA 1RAGA 3H9GA 1G2PA 1VFPA 1N9GB 4OQNA 5CAEA 4BFSA 4G5HA 1RRGA 2QL7A 4YMVA 4ZZ2A 2W93A 1IHPA 2HM7A 2ZVQX 2HGXA 1RKXA 4Y2RA 4F4ZA 2DB3A 1KSFX 4GSYA 3IMGA 3SXPA 2VRCD 4TWIA 4RACA 1JT2A 1I1QB 2QHXA 2BFEA 2YWEA 2WM9B 1FS4A 4JXZA 4Q6BA 4MI6A 5AJXA 2VDMB 5B3KA 5AVXA 1Y6ZA 3CVZA 2PMFA 4GS5A 5CH8A 3WKBA 3PCTA 1M54A 4FS8A 5AFSA 1X92A 4QVKA 2PGNA 1O96A 4I9NA 2PN1A 4J2TA 1EDDA 1WB4A 4OAOA 3MLEA 4LRSB 2YH2A 3JAKA 4EKYA 3IR5A 4AS3A 3H4IA 1MJNA 5JXGA 1EXMA 3W9BA 2GO7A 3TQRA 3NHSA 1ITZA 3SOZA 1WETA 2ZYAA 3GJYA 3M3HA 2WD9A 3E2PA 2QYSA 4TV9F 4ARZB 4Q9JA 5AKHA 4MV0A 4KL8S 1T9BA 3PT9A 3WMGA 3D6VA 3MUEA 1YHZA 2RHGB 3H87A 1YR1A 1R0XA 5AVKA 2BTQA 3OO0A 4UEWA 1ZZEA 2DAAA 3PRYA 4GPZA 4AWXA 5DCUA 1X1EA 1E8MA 4FYMA 1YB6A 4AURA 3LUBA 1PS9A 1VE5A 4FYJA 1JXMA 3FTFA 2HJHA 2QA5A 2ZSEA 1ENOA 3F71A 3HR4A 3PU6A 2XF2A 1I3QA 2JZOA 5ICMA 3FMVA 4J9MA 2BF4A 4M1QA 2G9ZA 4IIJF 3OM9A 5KOHA 3UGQA 3JYHA 4MKHA 1U9IC 4FGJA 2HT6A 4U1RA 3OAAA 5EUQB 4ZALA 1P39A 1Q95A 4Z0HO 1GCGA 4ERNA 2Q5EA 3RFFA 1M9NA 5BN5B 1E3LA 4LBWA 4PXYA 2EEZA 2ZVDA 2JFYA 2W9AA 2HJ9A 4DR2B 1DKUA 4YJ2B 4ZEVA 2B4AA 5IJ9A 4P81A 5AUQA 1Y5IA 1UOQA 3R8CA 2UAGA 1CY0A 1ZQ7A 3AJ8A 3GJXC 3BD7A 2ZUEA 4JV5H 4P5DA 4IFBA 3SSOA 1EK6A 1P75A 3BD9A 2JGEA 2RCYA 2Q8NA 4BEVA 2GBPA 2CNKA 1H93A 2ZE5A 1NVVR 3AHJA 3IL2A 3EBOA 2WYOA 1US8B 3R6DA 1QX4A 4XUGB 1S8AA 4GOJA 5IMBA 2VG8A 1A9XA 2RHOA 5IUJC 3A70A 3KZVA 3G8DA 1B3RA 2QGZA 2G1KA 4ZCLA 4V0KA 4WZBB 1G21E 3P0HA 4TXLA 3VDMA 5CCBA 2AMYA 2OMKA 3VSEA 3O8DA 1YQ9A 2HO5A 2IE8A 1GXSB 1YCGA 4B44A 2WJHA 3OQHA 3G6YA 4V0LA 5EHQA 4D8TA 1ORTA 3OHPA 5ILOA 4M8KA 2Q3CA 3C4QA 1DDIA 4JYCA 3TBHA 4PYRA 5E6RB 4PIPA 3BD8A 3RYTC 4BLWA 4DMRA 2HCJB 5LWHA 1K7XB 4DIDA 4IIVA 5HA5A 4JB8A 3QEKA 3VNBA 2FMUA 3OEHA 4B3RH 4GM0A 3T4PA 5DGDA 5LA6B 4DV7B 4N7MA 2G25A 2GA9A 2B3TA 3W2IA 4BCCA 3P2JA 1GPUA 3TDKA 3L4BA 1AKUA 4OF4A 2VYFA 3IUJA 2NNLD 4LHXA 2B1GA 1IK6A 1YU6A 2YWBA 4LNUB 2QAGB 5IF9A 2G09A 3IVXA 3AVOA 2L2QA 2PL5A 5KFBA 4WKOA 2H7YA 2SNIE 4Y9TA 1YQWA 2WOOA 1KEZA 2EJTA 2WKSA 1HZJA 4Q4CA 4JJFA 1TMYA 4Z1MA 3K2QA 2DLCX 5GJWC 1C8LA 2FHSA 5FA5A 3COWA 4YA6A 5CBKA 3ELDA 4R2KA 1JGTA 1VPTA 1CLEA 4Q03A 4BQQA 3LHSA 1E1MA 4EFEA 2FUEA 2J6HA 3HG7A 5ELLA 4WKCA 1V4YA 2IU0A 4TZTA 2Q3DA 2CFTA 4BLQA 3A6LA 4QNMA 2FN9A 3THYB 4Q7KA 1RMYA 2ZW9A 3BRWA 4DQXA 4TSKA 1XLTA 2AH5A 4G24A 4K88A 5IVPA 3ESQA 3EOAI 2HBQA 2ZIUB 2OV1A 1ZVQA 1AY0A 2H7XA 2XB4A 1YRYE 2F3UA 2ZRCA 3KEGA 3D0KA 4TMTA 4JJZA 1FUYB 3VMFA 2WFLA 3GXBA 4MZDA 4IWYA 1RK6A 5CFLA 1Y3AA 3OPYB 1VSBA 2XCRB 2OCGA 1VRVA 3VR4D 1DZIA 3BFJA 2EL7A 4P5EA 4Y6SA 4ECUA 4IKEA 4CIVA 5K3OA 3E23A 1KH2A 4TYQA 3FRIA 4AJIA 2ACKA 1OGIA 4TXHA 2QLFA 4JI2B 2DWOA 2ILTA 2QLJA 4GYWA 1XDWA 4QW9A 4YRIA 1H85A 2C00A 3UMFA 1FTQA 3H1FA 2E4UA 4TXMA 5DMXA 4NOJA 1NN0A 1BU8A 1BJTA 5DW0A 1JXLA 4OBBA 1KVSA 2G3YA 4I55B 4PZ7A 4BUCA 4UBLA 2HJWA 5DLQC 5D00A 4PG8A 3AP1A 2I4OA 3WL3A 2IH4A 1J2TA 4IGIA 4J9QA 1FJGB 1JI0A 3EUAA 2CLEB 1SYXB 3KEQA 3KXYT 1NOIA 4N0DA 3IEVA 1BRMA 2WD7B 3SICE 1IEQA 4RNNA 1D6JA 1XZPA 3OIGA 3KJHA 1IRIA 2ODAA 1FVIA 2IDMA 3KKMA 4MAAA 1E5VA 2G83A 1M7GA 3SQLA 4WWHA 2PGIA 1YBHA 5F3WB 1PV4A 3SHTA 1FTYA 1LBQA 3STTA 1FYDA 5JY6A 3FKIA 3AHGA 1OH8A 2YXDA 3EMVA 3AW8A 2YWXA 3PNYA 2J9XB 4RK5A 1DQZA 4JH0A 5I8ZA 2X0NA 521PA 2O3QA 1C7ZA 4EFNA 4AG6A 1RBQA 4I36A 3WSTA 1C29B 2IIBA 2WAOA 2WRZA 4HNTA 3QVWA 1QAOA 2X19A 3CUSA 3TG2A 5LP6C 1X94A 3I4CA 4TYPA 1JL3A 2WJZB 1JHDA 2W4IA 1FXSA 1UBNA 1A9OA 3HCOA 1I2AA 3SN6A 3MYRA 5LMNB 4JYZA 1N9ZA 4M55A 1LSUA 2IFTA 1SXHA 2ZI3A 2OA0A 3CH7A 2XR1A 3NDBB 5DNYB 1KI8A 4EI2A 3AJ9A 3OG9A 3TCXB 2XA1A 2D0OB 1XQWA 1PYDA 4EGFA 3FJOA 1PGPA 2Z4RA 1FJXA 1TC2A 4YGYA 4Z8YA 1KAGA 1G2WA 3FWYA 4U6QA 2XBUA 3KUDA 4LDPA 4RTQA 3GBSA 2POCA 4TV8B 5FTMA 4ARIA 4OMFG 2GAOA 1L3IA 1U4NA 2ZYSA 4B4UA 3PA6A 4DM4A 3RCBA 3DUWA 2JZNA 4NU6A 5DX8A 3EXEB 1G5QA 1WCXA 4BFWA 2WJPA 3EF0A 5GJCA 1Z74A 3E9RA 3BB4A 4WZBE 2BFFB 1ZJJA 1IH8A 1OTXA 4BVHA 4KYUA 1V6AA 1VZ3A 2PKXA 5F35A 4EFDA 2XB9A 1E3EA 4KYIB 2BHLA 4EY5A 3WLSA 3I34X 3EN0A 2PUJA 4F8EA 1W19A 4ZA2A 221PA 2PFSA 2BM0A 4HFNA 4OQDA 4J0FA 4CHIA 4RDCA 1EQUA 2A59A 4PN7A 4UASA 1GLVA 2VIIA 1JHRA 1YZ3A 2IYYA 4OB8A 1KBQA 4F11A 3CW9A 5JADA 1ZRHA 1VE1A 4PWZA 5AW5A 1BROA 2I4MA 2F4NA 3EARA 2WVJA 3B52X 1GGOA 4HK4A 2PJRA 4QXAA 5BMVB 6ADHA 5I7RA 2YJ6A 2H57A 4L28A 1JAHA 4X7RA 1SVNA 4HB0A 3RSHA 2CLFB 3EPRA 2RHMA 2HEIA 4Q3AA 3ZTWA 1S2GA 1TIBA 1OOEA 1LTKA 1IZ7A 1U9JA 3QLVA 3K32A 1W85A 1GZSA 4YQWA 2WZBA 4K9PA 4CKCA 2YZMA 3WWHA 3L7OA 1T8UA 3CV3A 3VOBA 2IZ6A 3WQSB 1NI3A 2WVAA 1AD2A 2D1SA 5JVLA 1VCNA 1JFSA 1GCIA 3FUVA 1WCYA 5AJTA 2HDWA 4NZOA 1E2KA 3IALA 1XTZA 2EZUA 1LLCA 2UUBB 4JD5A 2ETXA 2VYNA 2R8BA 4MGKR 5HHTA 4J1NA 1T9HA 5DM70 2FSVA 5KDDA 4WNAB 1KIFA 4Y9SA 1C5KA 2EQ5A 2VJKA 2J5KA 5EWMA 4D7AA 2XRMA 2XVMA 4J0CA 5DM0A 3SKYA 5KT6A 2W57A 2QZZA 4M46A 4OSOA 3I6ZA 4RHTA 4IDNA 1MTOA 5LN1A 1Z62A 5K6TA 1DO2A 3HN6A 4WVLA 1VB5A 5LIPA 4R9SA 4PNZA 2C1EA 4BASA 4UOZA 2ZJOA 3AY7A 1M2KA 2XKKA 5JVDB 3H0CA 1RC1A 1OLXA 4DLKA 5IAEA 3OEEA 2IYQA 3MIZA 1RWQA 3KM0A 1T0IA 4RMNA 1TDJA 1IM5A 1ZMBA 2R8EA 4RKQA 3VR2A 4CM8A 1QRRA 2QTHA 3PW4A 2FMKA 1JEYB 5AM4A 1JEQB 3OY2A 1FXWF 1VXRA 5GINE 1UM8A 1KMNA 4HDKA 1GZVA 2XE8A 1ZHSA 2O5EA 3TECE 1T2VA 4RJLA 4GLOA 1NUSA 2XBLA 4KK4A 4X65B 1DG3A 2QYTA 3QMMA 1E1RD 3LY8A 3BA6A 3G2LA 2WHQA 2ZRLA 3PQ8A 3RIGA 1PF7E 5BSRA 1YZLA 3QKIA 4RY8A 3NTRA 3W2TA 2RHBA 2G5GX 1T24A 3DZIA 5F77A 3LWZA 1GTRA 4V3BA 1HNZH 2IUTA 3PXXA 4W63A 4QPZA 1B8VA 2UZAA 3LU1A 3CUYA 2IEYA 1TVEA 1UFRA 2AFVA 2CMFA 1EESA 3R41A 3BIFA 2VQFB 1U3WA 3WSWA 3LRXA 3TIFA 2JAUA 3W5IA 1C2TA 2CVZA 5BUCA 2HR1A 1FTWA 1LNZA 1VL1A 1C0IA 5BPHA 1FSFA 3ZV7A 4TMZA 1SKMA 4QM7A 1WOMA 2RK4A 3NALA 3QSYA 4QO8A 3LI2A 2E1PA 2PQMA 4BLUA 5EWGA 3GFOA 4EEXA 1N9GA 5JH7A 2AOUB 4QTYA 3AG5A 3KS9A 1XCGB 4YP9A 1CVLA 4G5SA 3G0OA 1IM8A 1JS1X 4EFMA 2GEBA 2C61A 3C24A 3S2GA 3BTVA 1XZLA 2IXGA 4EHDA 4TQUS 1S0OA 2BFWA 5A9RA 1V9LA 2BEJA 4TT3D 1YQXA 4M8NE 1R8JA 5IBPA 4NJMA 4A10A 1YB1A 3I23A 4CKBB 3PQCA 1TYZA 5B1SA 3IXLA 3PXGA 1L3CA 1NLMA 4DIBA 4NCBA 1BZYA 1QO9A 1DGSA 3K96A 3IAM1 5F7XA 1B8NA 3L6CA 4W5QA 2WNIA 3V5NA 4EJSB 1KAOA 1XAIA 3R1IA 4P4NA 1YZGA 4LAFA 3ZH2A 5E0KB 3K05A 3DDNA 4KRXA 4M0DA 4RTOA 3FTDA 1T26A 1K98A 1U2DA 4DJAA 3MUOA 1NY5A 2ZCJA 4RM3A 4GZ3A 2PT5A 3DONA 1KA9H 5JEEA 5K0ZA 3IQFA 2LUOA 1Y63A 2R6CA 3T9CA 4KZPA 2FK7A 3CCFA 4NCAA 4UFNA 4L8VA 4OPMA 4GP6A 2XD4A 3K0AB 1ZJ4A 3N8IA 4TMXA 1EGAA 4WACA 4YYEA 4U7CA 2Y76A 1F7UA 2IF2A 3ZI0A 1UOOA 5ALLA 1WVMA 3HB1A 3PYMA 1ID1A 5FBQB 5ULLA 3WJ1A 1TAHA 4MJ3A 2FWBA 4K28A 3PGMA 3HXMA 5C8YF 1KI7A 4W7IA 2CFRA 2JCSA 5EGSA 1SRRA 3IIIA 4EUSA 2HV8A 4LVUA 3D7KA 4LHYA 2OLKA 1UZNA 4YMWA 3GUUA 1GA6A 3T1OA 2E0IA 1W8IA 1Y8QA 5JCOA 5FOQA 4AIRA 4FYPA 3CIFA 4JVMA 3PWZA 1LPNA 3FKSA 3TRHA 4K6MA 2A84A 5C9ZA 3P9NA 4A8JC 2RHLA 2D5IA 4KPYA 2RGBA 1ISHA 1TM2A 4BMCA 3SDBA 3O75A 5MHTA 4IHJF 1HSOA 5TGZA 2VRNA 1WABA 1PEKE 4DYVA 1YDHA 4PXAA 2YC4C 2D62A 1P7YA 4M49A 4B4DA 1EUDA 4DRFA 3DKRA 1CUBA 4IDQA 1L7EA 5KJCA 2P3LA 4WN9B 3N40P 1X19A 5DYGA 5AK0A 4KOAA 3S8EA 3K0EA 4E07A 2QYHA 4Q3EA 1RP7A 4BAZA 2IWRA 3NHYA 3WMRA 4IGAA 1B43A 3CRQA 1K0FA 3WK8A 1T36B 3DMDA 3T1VA 2C95A 1DBSA 3TY9A 1FP6A 4BNUA 3G5AA 2W6JD 1MQSA 1P1RA 1LNQA 2QRJA 4IINA 3GFFA 4UTVA 2OV4A 3MQ2A 1CYEA 3SKVA 3UWPA 1W4CA 4J16C 4IRCA 1GXSA 3RU2A 1CZNA 3QPAA 1MHTA 1DKLA 1NKTA 4G09A 2CFOA 2PSHA 5IM4A 2GFIA 5JMOA 1DFGA 2O6LA 1RVV1 1QGZA 5L1JA 2MYPA 4CYMA 3OJEA 2H5LA 3BHNA 2QWXA 5FI5A 4QYMA 2C1ZA 2OAQ1 4C4XA 2D74A 1PVDA 3SHQA 4IXTA 3HEAA 5LA6A 1SURA 2HK9A 1Y9AA 2EJBA 4ZT7A 3KZ1E 1MNAA 1EUYA 2JARA 1OD6A 3LQRA 3GELA 1HR0B 3MJEA 5AK3A 3HUDA 2OXRA 1OI3A 4Y2JA 4HDSB 2VYVA 1B23P 3DG9A 4ODIA 1JG3A 3EDOA 4S1PA 1N5MA 4XIIA 4DRXB 2QAGA 3JAKB 2A7XA 1QFSA 4RZUA 3QLUC 1UQUA 5ARBA 2XV1A 1XDDA 3O03A 2AG0A 5BWNA 2PMKA 4DIKA 5JI3E 5H16A 2E49A 3P20A 2C9OA 3ACBA 3I62A 3F5MA 4OJTA 2KX7A 1B33N 3K9FC 2BTQB 3R3VA 1YUBA 4S12A 1IHUA 5ED4A 4AYXA 1Y7HA 3FSRA 3IHTA 4PLTA 1HT2E 1DWOA 3N05A 1MV5A 4XDHA 4UCRA 4FM9A 3NRCA 3DXYA 4ND2A 4RZRA 2ZT7A 1VLHA 2M2IA 3BKWA 3QUSA 2A9JA 2LP4Y 2FFBA 1G4HA 1Y9ZA 3BYZA 1QDUA 3ETEA 4UAGA 5ICCA 4AS1A 2J46A 3RUFA 2PX4A 2I1LA 1GYRA 3F6RA 4ND1A 2CXNA 3E7PA 4TTPA 2FCRA 1QH8A 3LUHA 3OQJA 3ZLBA 4JI6B 4WK2B 3QVXA 1QGAA 1EK0A 1J0DA 3R7NA 1G19A 3OPYA 3GEMA 1VMDA 4JHXA 4GMGA 1J2RA 3IVCA 3ZHCA 3KCQA 1Z8HA 4QJIA 2Q9BA 4HAVA 5CFOA 1IONA 1HQDA 1QGOA 1JECA 3BGVA 1BMTA 1Z75A 5B6PA 1XJWA 2WF7A 1KAQA 4YNBA 4ZI7A 3E9CA 4R83A 1IEVA 3WAJA 2H4JA 2CMHA 4YRRA 2YN4A 4HGYA 5EQJB 1U0TA 1BXRA 2A0XA 2MYUA 4I3GA 1Z39A 4FHGA 5K4AA 2AI1A 4C88A 2FSHA 1EX1A 2Q0SA 3MMPA 4IFEA 2QN3A 4C4PA 2CHQA 4YDSA 3WFIA 2BD0A 1HT1E 4C0BA 4LOHA 1FNBA 3RIXA 3JYNA 4DMFA 3GB9A 3KXPA 4BOYA 3HCBA 1VBFA 1OLOA 2VBIA 2I03A 2RGRA 3FOFC 3ASUA 1U9ZA 1EUQA 2NO7A 3ZUPA 2WD7A 1P44A 2B2XA 3V7WA 2JI7A 4GKJH 4E08A 4LXUA 4MVJD 1L1RA 4PYIA 2QVLA 4CETA 3OZUA 5D84A 1A9YA 4RLHA 4CL8A 2HMWA 1DSSG 1EGQA 1LZKA 3W6PA 2JA1A 2O2SA 4CL3A 3RVQA 1U8FO 1EFUA 3LX5A 1O4VA 3EEQA 2PGDA 3PDIB 3VVBA 1SKAA 4B7XA 3WHIA 1XFDA 1DJQA 2P11A 3WI7A 2ZETA 4IDGA 1AOXA 1YACA 4DJFC 1FDOA 2O2YA 5LB4A 1AC5A 4LC1A 3TNFA 4BQSA 4BBSG 3E03A 3DWGA 4LHVA 3G5MA 2O4CA 3W6OA 1E2MA 3RRNA 1FJHA 4KWCA 4X7MA 3EYWA 1QONA 1ACMA 2DQ4A 3RROA 1GYPA 5C1DA 2I7CA 3D1LA 2AWOA 1AKMA 3WGKA 5FLXW 2E1RA 2QUZA 3MSCA 3OJOA 4NR0A 3JZMA 4H18A 1I3NA 1QP4A 1MIHA 2JLZA 2Q21A 3M9OB 2GZAA 4GR5A 2XC9A 1Z0UA 4LZNA 2GR9A 3HBAA 3NEYA 2BMAA 4N39A 1OTYA 3F3MA 1UZAA 2Y1FA 3M82A 1L5YA 3DE5X 1RHJA 2PEYA 2G1UA 1DAKA 3N07A 3UXEA 2H1FA 4NPCA 3F9CA 1CUGA 3IV7A 1IBCA 3TVTA 4C7OB 1DXHA 4QUEA 1Z7GA 3AVPA 4KQIA 2V7QD 3L0PA 4DL7A 4JKOA 4R98A 4YCDA 1H5NA 3G6VA 1LBIA 3OSZA 1QG4A 1MLDA 1OREA 2IUEA 5DBIA 1KOJA 2BFCA 3KTDA 3U61B 4DGSA 1U0EA 3HCFA 2XYHA 4J07A 2BFFA 2G4LA 4DRYA 4H4CA 3SOPA 3AP2A 2GOYA 4B75A 3T7CA 5ETJA 5KSZA 2F7SA 3KPUA 4D8XA 1F0PA 2GYVA 1L0BA 3KDAA 1QZZA 3AYHB 3VUFA 2RKOA 3RIMA 5DKFA 4DWJA 3GNLA 1PZHA 1LW6E 4NS1A 1E3TA 1V25A 4HWKA 1E4EA 1LFAA 1TLFA 3NC4A 1EKVA 1M2GA 1IB6A 1HX7A 3DAPA 5DSZA 5KWVA 1MZVA 1V47A 1DWQA 1FFBA 3CTPA 1SCJA 2QGNA 1RAIA 2DT8A 3U19A 4LF6B 3W8RA 1YB2A 5DCYA 3O26A 4AZSA 2XUQA 3FKJA 3ZNOA 4PPFA 1QZTA 1MBZA 4GP7A 1K7FB 4UXJA 1N7HA 2VP9A 2GQSA 4H3KB 6NULA 4QSMA 2C2OA 4H0CA 3TW0A 3BGOS 3KSAC 4YDHB 4QBHA 4YWHA 4US0R 3PFGA 4YAOA 2VSXA 3DDCA 4XQEA 2WU0A 1RCUA 4P3KA 5JWHA 4FMPA 2WIFA 4AAYA 1NQOA 3KT8A 3JD3A 1T5HX 1WZ2A 2XGMA 2NZXA 1F1JA 1NP7A 5DBEX 1JA1A 2EHDA 5SY4A 1YUMA 2JF0A 3ZJUA 5JBNA 3RQSA 2HQRA 1FYXA 4O1HA 4RY0A 4ZDKA 4ZT5A 4XJVA 2WICA 2XPCA 1A7UA 5DN9A 3SXJA 1Z2DA 2WE8A 2OYRA 4DUZH 1M8PA 2FPMA 1XE3A 3QKTA 3KB6A 3L1IA 2YL2A 4W5NA 5CM0A 4AJHA 3SYNA 4XB2A 4F3KA 2BMVA 1CUAA 3CVYA 4YQZA 4QREA 2FR0A 5CJ2A 5FTLA 3H5RA 4B3TB 5G2OA 3QV1A 4LVCA 3KWJA 1RYYA 2AOXA 5AVVA 1R1DA 5JVDA 4OQMA 1GPBA 1UPTA 3IFSA 3JQDA 4QDKA 2YV2A 4LF9H 3ZLUA 1R6TA 2EBHX 2PUWA 1SCNE 1JEYA 1W581 1KIMA 3HJAA 1RRCA 3FB4A 4UQLA 3TXAA 3EQ9A 4HDMB 1JEQA 2OZVA 5DIZA 2HHJA 4B34A 3U4QB 5FEUA 1OWNA 1F14A 1JDPA 3SZMA 1BRTA 1QH0A 2XT0A 4C2UA 3PC8A 4Y2UA 4WFKA 2WABA 3HLKA 3R7LA 1H2YA 3ZDEA 4QPDA 1DEAA 2C83A 2VUGA 3ND9A 2PKWA 5I5TA 2YNMA 4M7RA 3TTVA 1DQRA 1DIKA 2IK8A 2Z6UA 3QJGA 3ZW8A 1L2ZA 3CX3A 3ZWXA 1E4GT 5EVCA 5JISA 2V3CC 1R88A 1R8XA 5GWXA 4EG8A 1CUSA 1UEIA 4KAAA 2GK6A 4I9FA 1P74A 1PR2A 4ML3A 5MFZA 2ZKLA 1AHPA 1BH6A 5CXUA 3GCXA 2A9OA 4CUZA 3ZZNA 4H6PA 1VPEA 2J0QA 2IXBA 2B1RA 5DNDA 3JYQA 1B1CA 1B76A 1RXUA 3CZQA 4PX3A 3ESXA 2XGQA 3WLQA 4K9QA 4JNKA 1UJMA 3UW1A 4P58A 1O6ZA 5FBVB 1V2GA 3GHYA 3OETA 5JWRA 1FU7A 4MB0A 2JIZD 1RBMA 2JAXA 4XW2A 1Z29A 1YRHA 2AMVA 3DMFA 2Q3FA 4OQQA 4A5OA 5LCXA 4DJEC 3MWLA 4CMBA 5EC8A 4P3YA 3RSFA 2ZP1A 3HR8A 3ZC3A 5F9NA 5CPFA 2Y67A 1JEEA 1V8OA 4RH0A 1P3Y1 3HP1A 4K8OA 4PONA 4P92A 3U4DA 1CUEA 4CKBA 5JD3A 1W85B 1ZH2A 4CKZA 1E32A 4FEYA 3H2SA 3QWBA 4EHLA 2VNAA 1QJ4A 3VU3A 4EJSA 4E33A 4U7JA 1TAEA 3RH0A 3TD6A 4LF8H 2Z1MA 2YU9A 2YCBA 4MGEA 3OKPA 4I9HA 5DN6D 1NX9A 4K9LA 3GTLA 5IASA 3HVRA 3GJ3A 3ZWBA 2PAAA 4LFBB 5CA0F 4FKMA 4FR2A 3KE9A 1JQKA 4NEHB 1NL3A 4U2EA 4G63A 4PYJA 3TTSA 3BGSA 1T1EA 4KX5A 2W5UA 4BO3A 3GLGB 1EB8A 4MV9A 1F0KA 4OGKA 4NE2A 2QI9C 4LSZA 3K0AA 3UG7A 1YCHA 4WXHA 3W5OA 2ATLA 1GV1A 1FFDA 1HWYA 1T1SA 4K3UA 2YXLA 3GRFA 2G5CA 1K92A 3DL7A 4N3BA 2C5FA 3L06A 4WTOA 2EW2A 4X5OA 2CFIA 3OUUA 1QRDA 4P08A 3ZR4B 4JBNA 4NI5A 2OV6A 4IBOA 1RU3A 1HQKA 1RHKA 2WF5A 4DCCA 1NMQA 2W8KA 2FN8A 3AF5A 1OLXB 1XOIA 1KQNA 3FW1A 3M2PA 1FMFA 2QT0A 3E3NA 2OG1A 2QSJA 2C2YA 1SXPA 5FBLB 2F4VB 1FUKA 3O8RA 2Q4EA 2X22A 1T5BA 1CCWA 2PG3A 4KNWA 4I4LA 5AM2A 1C3XA 1JSLA 3EAFA 3AQ4A 3QXCA 1Y6JA 4PZAA 1GTJ1 4HDKB 3UV7A 3TGLA 3ZU3A 3MWJA 2CDAA 1E5LA 3AB7A 1QQBA 3OTOB 4FFDA 4ZAVA 2QM0A 1KEVA 5KT3A 1ZHHA 1YQDA 5EIAA 2R1VB 1JB1A 2QQFA 3PUWA 4OJKA 3ELBA 3IA2A 4DMCA 2FP4A 4URWR 1T36A 3OHBA 2ID4A 4KLCA 5LOVB 2PWAA 1ZKMA 4MDFA 3BH0A 3FRJA 4MRSA 3QQMA 1JB9A 4LZWA 2O3UA 3VBEA 3K0SA 1L4MA 3M5CA 4PLCA 2BEVA 4EMSA 4OREX 5KFUA 2YIMA 2Z83A 4IGFA 3JSNA 3RRXA 2D3TA 3G2QA 2FNAA 2E2HA 4EGJA 1A2OA 5CIYA 4ED8A 3IDOA 5BSFA 5JH7B 2QN9A 5F52A 1MX3A 1K6IA 2NZ2A 3NO4A 1FW8A 2QW8A 2OHGA 2BFMA 4WBNF 5CB4B 2PD6A 2R7NA 4P6VF 2JFFA 3NIDB 5I7AA 3IOCA 2QMZA 1F17A 3TOXA 4NQZA 4OHCA 4FOTA 5HKKA 4D2IA 2IT1A 5C8VA 3WR5A 3RJ9A 1FFXA 3GQCA 5D6NA 1DPFA 1LI4A 2FLNA 2IYNA 1QG0A 3H6HA 4TZKA 1NPDA 1ZGAA 4NJMB 4G0NA 2I1VB 1TK9A 5D3QA 2FLPA 3C8UA 4JBLA 5LYJA 3II6X 3LOUA 4EO9A 3CH5A 2LKDA 3A1EA 4HDSA 2N3ZA 3JU3A 4ZVPA 1N2GA 4DRXA 5K0FA 1YFJA 1G59A 4BV9A 1Z0ZA 2X2EA 1PK7A 3ZKWA 1K9VF 1TWCA 1NW3A 3PE6A 3MUNA 3LS2A 2I1QA 2BRUA 2IEDA 1XAJA 4FR0A 4I19A 4K26A 4NPHA 1BOOA 4YRSA 5DBHX 4TKZA 1ZP6A 2MSEB 2J41A 2EAUA 3EW7A 4UMFA 5DHQA 4F5YA 2A9QA 2WHYA 3ZX4A 5I4IA 2PX6A 2WSBA 3O90A 1Y81A 2C2GA 1CR1A 3WGZA 2BFPA 3U3DA 1N0UA 4YCJA 3RBXA 5K0JA 2JI4A 2FPSA 1U8ZA 1II9A 4ZEOA 2PX0A 1EPUA 4LXYA 2DZDA 4MP6A 2XADA 4LJYA 2WT8A 4IIHA 4H1WA 1GU0A 3DGFC 3HKDB 5K8IA 3AUSA 4I1SA 3FPGA 3WVNA 1STOA 2AG6A 4RTPA 3TRIA 5JSKA 1QGYA 3HB0A 1GGKA 1N6KA 3E9DA 4FSHA 3FDJA 4GLXA 4ASUA 5AK5A 1Y8QB 1RVDA 1PGNA 2VDUE 2VA8A 2VDNB 4MUJA 3D4LA 1FS6A 4KIUA 2AN1A 5AOBA 4D81A 5DSXA 1Q6YA 5JIBA 2BBWA 4FP9A 3ICVA 3LHFA 1URPA 5DHRA 2REQA 3A8TA 2I9PA 4D98A 5DTRA 1AT1A 4KPGA 1VOTA 3D43A 3E8SA 1FX1A 1LF5A 1V7CA 1EUDB 4O7WA 2ORYA 2XSZA 4CLXA 1CJMA 3GBPA 1ZNXA 4UU8A 3VR5A 4ZN6A 3DEKA 2FMAA 1NAIA 1JJFA 3R7SA 2QD1A 5DIFA 4ETIA 2C92A 2FEWB 3BMOA 4HWGA 1MAWA 4DR7B 3BFVA 2H92A 1E1CA 3Q15C 4XA8A 4NF2A 5HS6A 1KY4A 2WSLA 3ROMA 2ZU6A 5GJBA 3STUA 1B42A 3W9YA 3UCEA 1KT8A 1SFOA 4X41A 3ZE0B 4AF8A 1X3LA 2L19A 1HE8B 4MW5A 3BDIA 4DG5A 1KYZA 3U60B 4NCJA 1D9ZA 5I5SA 3RSQA 3COYA 4WOJA 4B71A 2HLHA 2PXXA 2XQIA 4KXNA 4LRWA 2X7HA 2IV3A 2VSQA 3L79A 3WS7A 5HRCA 2IEZA 4BNGA 2BTOA 3GLGE 2EKPA 2B37A 4QYXA 4QA9A 3PSAA 1XA3A 2B0CA 1EJ2A 3SHWA 3CSDA 4LI0A 3PDIA 2DEUA 5I9NA 4J29A 2G7MC 3UZOA 3MWYW 2JEYA 2OFXA 3A28A 2IX3A 1CZLA 5GADl 3TW6A 1HNXB 2XMPA 2GEFA 1SEIA 5EE9A 1Q1BA 3FOAA 1WCMG 3L8MA 5KOJB 4UBMA 5JAMA 4HMPA 1TMKA 3CX4A 1GG8A 5DM1A 1EX6A 1Q21A 2I91A 3L7BA 1GTSA 2AJ8A 3PQ2A 4NABA 5HFJA 3PGJA 3H8SA 4YROA 4DDHA 4B3MB 3DM9B 1UC4B 5UKDA 5AVWA 3O47A 1VAJA 1ORIA 3L41A 2BF7A 4J9KA 1HE5A 3NIGB 2BT4A 4E2XA 5CNIA 3KKZA 3ZD8A 1K3TA 3LDGA 3DYBA 4C7OA 5AXCA 1JDSA 4LYAA 1IWPB 3D54D 3DXZA 4M1SA 4DR5H 4RLSA 4TYWA 3EWIA 2JKVA 5CEEA 2NG1A 4JQCA 1OMOA 3EBLA 4ER0A 3VC3A 3WIVA 2FSFA 5IAOA 4FN5A 3CR3C 1ODIA 2CNVA 1KVRA 3BL6A 3HBLA 5I5UA 3JAMW 3CC8A 4K0KB 3KUCA 4BVAA 2FPIA 4L5IA 2YZKA 2Z1NA 4FNMA 1QH8B 1KH3A 1MR3F 2IYVA 1G8MA 3MJCA 3V4PB 1KJ8A 3MRSA 3JQFC 3GFTA 2I8LA 4OTZA 1JLMA 3CN9A 3A6DA 1QYXA 1JP7A 2CYBA 3VH1A 1C3VA 4W7HA 1SU6A 4RBNA 1GNLA 5KFEA 2Z9DA 2NACA 1D7AA 2IS4A 1WF3A 5C4IA 3A6PC 1QQAA 4MIEA 5ALQA 4ZI7B 3GJ7A 2X14A 3CPSA 4OKSA 1V4BA 4PYMA 3V9PA 2J0EA 5GZ6A 4FBMA 1BXRB 3ZGLA 2ZUUA 2D8AA 3E48A 4UUBA 3U1BA 2II6A 1FZQA 1RI4A 3QFCA 3D1JA 1OI4A 5AXDA 2Z2YA 4QARA 4V38A 3UZUA 3S2IA 2JC3A 4DCGA 1LBHA 1XEFA 2PZBA 4OHRA 1DELA 1T6BY 2OCBA 2C8VA 4UE3S 4HQKA 2VP4A 2QQGA 2JA5G 2N9UA 1UK9A 3HDTA 3RUDA 4ETNA 6YASA 2C5BA 2IYWA 3VYUB 1UBCA 3A2KA 5CXQA 3IC5A 4DV2H 1C3LA 5B3JA 2JASA 2PS9A 2VEOA 4Q7JB 4LYFA 4L0DA 1HYBA 3DAGA 3DPSA 1CQZA 1SHUX 2V1XA 1WVGA 1YA8A 3ZX5A 2CL5A 4MKZA 2Y0DA 1ZWKA 3UMCA 5JD4A 5J58A 2DHRA 1NDHA 5DVZA 1ISRA 2OCPA 3HFGA 5HKAA 5KNCA 2AWNA 4NYJQ 3HRIA 3DB2A 1C4KA 3FFTA 4IQ0A 2OAEA 3LWBA 2VPXA 4IQ4A 3GTMA 1E6EA 3OUZA 4DVGA 4ZEXA 3S8MA 1I0ZA 5CMLA 2P9JA 1ZGBA 4YHHB 4AP5A 3SX4A 1H69A 4ZAZA 2B92A 3VQTA 1M1NA 4LMRA 2NTYC 3T5BA 4G5XA 3L05A 3P2YA 4Q4JA 5KVQA 4DXHA 2PL3A 1W25A 2G17A 1FMJA 4WLOA 1KMIY 4HDMA 4IDEA 4RHXA 3RAFC 3U4QA 2NTEA 4RZHA 1KP2A 1XC7A 4DSTA 5GM1A 3L8ZA 4Y1RB 3R74A 2HMYB 1UT5A 2W2KB 2W6ZA 4U0JA 4A6DA 4LQ4A 5EJ6A 5IARA 3FTNA 4JYAB 1XU9A 4BKQA 5BR4A 2BFCB 5CLJA 2VJBA 1ZMRA 3ZY6A 3KFVA 3O8LA 4KNYA 1ZIOA 3QHPA 1FRFS 3VU0A 3RC8A 4P32A 4YI3A 4LWOA 2IWHA 3LUJA 3OPMA 2QU7A 2VP0A 4EBBA 1HQYE 2QLTA 1Y3FE 3CUUA 3V48A 1ZD4A 3UYYA 5JZMA 4M53A 4Z6KA 3HYRA 4II2A 4FHFA 2FX2A 5BYBA 1LVUA 4O3NA 1Y3CE 5FF9A 1Q5PA 6CHYA 2VAWA 3OZ7A 3A05A 2RH5A 4MQUA 1E4EB 2XVZA 1T3HA 3L4KA 4XSHA 4Y2XA 1VI5A 5CCEA 3U6BA 1X87A 3AVTA 2C9YA 4U3JA 4N5NA 1QUEA 1IQPA 5ALEA 2I7TA 3HY3A 4FUTA 4D3XA 3D3NA 2X3YA 2COGA 3ZY4A 4D02A 4RV4A 1P19A 2ZBVA 3PNSA 2CNWA 5KYKA 2QDKA 4PYNA 4S1VA 4ECEA 2OSBA 1CBUA 1LX7A 3WLIA 1T5IA 2PRJA 2P6MA 3EGEA 3CF4G 1QGDA 5I5GA 3GDGA 1FMLA 3H7AA 4HNUA 2TMGA 3TDMA 3K9BA 1VPDA 3DE7X 3QZ8A 4MEAA 1BJKA 3HJNA 1JTFA 3TB6A 1IJEA 1MOZA 2FZKA 4BNZA 4B2LA 4QLAA 3L7KA 4R2XA 1HGXA 1P33A 4R31A 1FRQA 1JLKA 5EN4A 4DHEA 1ZD3A 4BV2A 4ZEWA 5A2GA 3F7TA 4ILEA 3GLGA 3N0RA 4CLOA 4RMJA 2WFZA 4YJKA 4ROTA 2XCAA 4BC1A 3CF6R 1M8GA 3QUQA 1QK5A 121PA 2GUWA 4GLLA 5F1YA 3DAFA 4DV3H 4IDCA 1VG8A 5BV1A 4WCFC 4KFCA 3I32A 4E88A 4FK8A 4O0LA 3R0QA 4QNRA 1JR3E 4ZQEA 2ADOA 2IITA 4RQAA 1HF3A 3LG2A 2JLWA 5TMBA 2JJ8A 3EUEA 3QVGB 5I5XA 2VA2A 1V8ZA 2B1IA 5JO9A 2E2WA 4MI1A 2W2MA 3KB2A 3ZCQA 4OK6A 2UUCB 1OLSA 3MGAA 1FDTA 4AJPA 2B2CA 2V4ZA 1CV2A 2VUIB 5C1BA 1S9HA 1U7ZA 3T9DA 4XJXA 1U8TA 3LUCA 1FIUA 3ZEAA 1JG4A 2P2YA 5F4ZA 1XKLA 4HH3C 2IZ7A 4GWKA 4W5JA 1HDZA 2CHEA 1IMJA 4RS4A 5HR5A 3FTQA 1W48A 3FLAA 3PQ3A 4G0WA 1QHHA 4UM8B 1LLDA 4EQ6A 4XDGA 4P4TA 4ZCIA 1OXUA 3SJ7A 4HWRA 3TL3A 1Z5ZA 2XKAA 1OXSC 2XGPA 1VA4A 2FPGB 5ARDA 2HRZA 1XMOB 2BCJQ 1VCHA 1S10A 5LP6A 3LT0A 2YCLA 2F67A 2QUJA 4DA0A 2IYOA 2OBFA 1NW6A 1QHXA 2R1VA 3D31A 1XTRA 3ZN2A 5KTOA 4HDQB 2DCUA 1RMQA 4CM9D 5LOVA 3G6KA 5ITSA 1J8DA 1YJQA 2FW0A 3V33A 3F7MA 4EEQA 1FNCA 4MICA 4PCAA 2Z08A 3L0CA 3LMKA 3ZHRA 4BIIA 1RWKA 4FYKA 4G0XA 4EW3A 2YMPA 4PPNA 4HGNA 5FPSA 4BO1A 1BMDA 3B8EA 1PR4A 1J56A 5FEMA 2XWJI 1QV9A 2H1HA 1OX5A 3U3KA 1QX3A 1SU4A 1PI3A 1F60A 4BU1A 1F38A 2AW5A 2XQFA 1Y7TA 7REQA 3KEMA 5CB4A 3VO9A 5FO1A 5EMHA 5AT1A 1JX4A 4C76A 2JFNA 5T6BA 2D0IA 3ZQ4A 1YB7A 2O2JA 2H17A 5TE9A 4BTVA 1RBYA 2C99A 2CNQA 1MAVA 3OF2A 3CEHA 4G2NA 4UQPA 1L4NA 1K7YA 3TQIA 1UPUA 1WL8A 1IY8A 2FSSA 2AN3A 3C7AA 2OTCA 1TO2E 3O31A 1TA0A 3AM4A 3G1UA 5J59A 3DMTA 4Y6GB 1M5TA 4RTNA 3SXUB 1LQTA 2HSGA 3ZU2A 3PEUA 3LHIA 5LDGA 3UPUA 3EFBA 3BRSA 1YZTA 2E5FA 3K72B 1ZITA 2Y0EA 3KQNA 3QE2A 9LDTA 5IJ0A 4O4IA 4HEQA 1A7JA 3MT8A 2B8TA 5ESRA 4ZHQA 4MYRA 3E9YA 2P2SA 2YKGA 3HOYG 1GZ3A 4G4SP 3DE4X 2BCGY 4KAXA 1DCTA 1TAQA 3W7VA 1OI7A 2FK3A 4UAJA 4P8RA 1FLAA 2CHVA 4DIEA 2X8LA 4O4JA 1NVMB 3GWZA 4ARSA 2PYIA 4H31A 2H1OA 2KYRA 5FULA 4LDQA 3HKDA 5DI3B 1OBVA 2HF2A 1U2QA 5KDOA 2QRVA 3NONA 1W4RA 3W8FA 2B20A 1YDFA 3SF8B 3LE8A 2X13A 2I6FA 1KETA 4BVGA 3LNTA 4DAEA 4GHWA 3UJ7A 3M6LA 3KVVA 3IAS1 3ABIA 2CEAA 4LGMA 1ZIDA 1F6DA 3IOYA 1IMOA 1M8JA 1A96A 3ZDCA 4BVEA 4RNMA 1GPNA 1WR2A 3ZQUA 1WIWA 4XDZA 2B83A 5KTKA 5L3VA 5U4QA 4PZYA 2W6OA 3I6MA 1WCMA 4AUNA 5JXWA 1H5QA 2EJ2A 1KYVA 1TUGA 3IVAA 3LA6A 4C04A 1E77A 4LIPD 2FY8A 2H85A 5J3JA 2FP4B 4EZIA 5IZ4A 2DTXA 2V8BA 3ZZTA 3UJPA 3Q0EA 4C6SA 3G68A 2DWCA 3MS4A 2A94A 2VO1A 1IWOA 4B48A 4HQRA 2P1RA 3U9TA 2XGSA 2AVDA 1L5GB 1MB2A 2BEVB 3KJQA 4ESOA 5FIUA 3FR7A 5BV7A 4BE7B 5KVSA 1BXKA 1O1YA 4XGQA 3ZZUA 2F64A 3KQWA 3M2TA 2YWGA 1GCUA 3L8GA 1JFVA 4A3BG 3GD7A 1G8FA 2G7ZA 1R27A 3M6WA 1Q15A 2X8WA 3O3MB 1P7WA 2HSJA 5FOTA 2EARA 5D87A 3N2KB 5HDBB 4IF6A 4N18A 2EFHB 3HDQA 3EPJA 3BT7A 4ADSG 1FFXB 5TMDA 3P0EA 1NPYA 2QSUA 2Z2JA 4EB6B 5KOJA 1PQPA 1OZGA 2H1CA 4NDZA 3A3KA 4YRZA 5LYJB 2R60A 2CLDX 2WU3A 1XZ8A 2D2IA 3P2KA 1YC5A 3IOEA 2J31A 1GR0A 4JI8B 4NOMA 4K6HA 1Q20A 5HF6A 4Q00A 1ATIA 2ABWA 4UNPA 3B36A 3E5RA 1KGDA 3S4YA 3ZKWB 5J2UB 3GAAA 5JECA 5DDIP 4DQKA 5I9TA 2VH1A 5K8UA 5CDGA 4BX8A 1QTNA 5MN4A 2LV8A 3PA8A 1WUHS 1AGRA 4L4RA 2RB5A 4UEJA 1AX9A 5DNUA 3QEBZ 4PFJA 4QJBA 3WC4A 4CQNA 2LDBA 3LC2O 1DT5A 4JI4H 1GGFA 3QYAA 3E22B 2COEA 5TPWA 1U7TA 1UXKA 3JQ8B 4IEFB 4D97A 4O4HF 1L5QA 2R8KA 3C7KA 4GBMA 2YVKA 4IGKA 4UXIA 4MOWA 2CF6A 2VYCA 5ITVA 4Y7DA 4BQNA 2BHNA 2CVOA 1JR3A 4R5MA 1NWHA 1BN7A 3UIEA 1HO3A 4OHZA 3D2BA 2FZEA 5I5EA 1T9CA 4LNAA 2JA5A 1FDUA 3FPJA 1PW7A 4OSPA 3K5HA 1B04A 3KT3A 2X3FA 1OH5A 2VZ9A 4RY2A 1CB7A 2VYQA 4HG2A 2C3MA 1WVIA 3S5UA 4R7TA 5E6UB 1TVMA 3AFGA 1ZCZA 1OZHA 4ZVRA 3U3ZA 5THQA 3AI7A 1USUA 4EWLA 4L7QA 5SZHB 4ZI5A 2FF7A 1ZISA 2X0RA 3TPFA 1TWAA 3CUEF 2ODBA 1DAOA 4GLWA 1XXHA 2REQB 4G4SO 4EG4A 5JTUA 1ENYA 1VDZA 2QTFA 4ZV9A 5I4KA 4OXIA 4CRWB 1YQTA 3PC6A 4OI4A 3DC2A 1SKQA 3GP3A 3ZOKA 4FNOA 3TRDA 4HT3B 3RJMA 3KR0A 4XDYA 5GGYA 4UM7A 3VKVA 1GZUA 4KQJA 4FGRA 5CLIA 3I61A 3BMOB 1SXGA 5FOVA 4I5IA 3MFIA 3M4JA 4HSGA 4W5HA 1E1CB 4PYOA 4UZSA 1Z7WA 3UANA 1PS0A 4JX9A 5HE9A 1FYEA 5TQVA 3FBGA 3OECA 3HADA 5LWQA 1NXWA 1K6JA 5B5SA 2O9JA 4YAWA 4PLVA 3L0ZA 4RMHA 1P91A 4REOA 1N92A 1NVUQ 1O95C 1RC8A 4H17A 2GM3A 1R6AA 1W2GA 2Y3IA 2WHXA 2VA9A 2G4CA 4F9GA 2GJ8A 4ZYUA 4O7RA 4MKFA 1KAHA 2F3QA 1P45A 1BFDA 4MV5A 1DO8A 1CX9B 1HRKA 5LUAA 4I1RA 1VBKA 1FY2A 2A1UB 2X4GA 2Q6LA 5DLDA 4BAUA 4JCOA 1G7TA 5CDFE 1LZLA 2XTJA 5A7GA 1Z4KA 2LE0A 4IVRA 2WM3A 3HYTA 1PQUA 2OBNA 4HWPA 2PYDA 2GWRA 4GIBA 5LU8A 1UDWA 4M7EA 1B16A 2QJRA 1KZ4A 3F6BX 3LLCA 5CDSA 2CDNA 3RGXA 1OXXK 4E13A 1KJYA 3K8ZA 1U11A 1ZXBA 1Q84A 4G8BA 4U2CA 3MPUA 3A9WA 3LFTA 3ICCA 1HOXA 1KK1A 1H8ED 4XVCA 1UWKA 5HIMA 2EFYA 2JEIA 4INZA 2I65A 3GUHA 3RVBA 2ECPA 2ENWA 3EDQA 4JI7B 3FPHA 1ACLA 3Q6NA 4Z9FA 2H7CA 4HZUA 2C7QA 2XZPA 3TM5A 4BQOA 2IC5A 2QRZA 4UEQA 1PJLA 2F9LA 1Q77A 4IDDA 1EJ6A 2R7LA 1BD4A 3OQ1A 3HFRA 2IXEA 1TMGE 1Z28A 4J0GA 3P9PA 2GXAA 4KQEA 2E5WA 4YJFB 4Y1RA 3QPBA 3WKEA 2W2KA 1SUBA 1APBA 3DFIA 1NNUA 1RJEA 3IR7A 3BCSA 1TZCA 4UUAA 2Z2IA 1W49A 5CDUA 1R0BA 2W4MA 1V5IA 1NE2A 3IRVA 3RRJA 4L02A 4MVYA 5DHFA 3CF4A 3ZJYA 4MWCA 2OHFA 1N36H 1Z7BA 3H2GA 1FLDA 2J9RA 2WB2A 1PT6A 4Q15A 3UAGA 3ZHBA 5AO9A 3UJBA 2FPIB 3EXFA 3E27A 3VDRA 5B64A 2O0KA 2D1TA 4EGSA 4COOA 3U0VA 1XZCA 3OX2A 1ZUD1 4FFNA 2BHTA 1T9DA 5TQ2B 3LO8A 4F84A 4RO0A 3A6GA 4DLZA 3V80A 3R3HA 1R0RE 1G7CA 4K05A 3PLRA 4W5WA 2QPAA 2BE7A 4IOKA 1M2OB 3LAWA 2UU9H 1N3YA 2C28A 4OEHA 5FAXA 4U2KA 5JU6A 4QGAA 1UH5A 2G1JA 1ZA2A 3LY5A 1UPXA 4J1SA 4DJJA 1O77A 4JXXA 3M6IA 1IXKA 1BE1A 2GVNA 1Z2CA 1QIIA 5KU1A 5DHUA 4ECYA 3MQ4A 3DNFA 3TIXB 1NR7A 3EOZA 5AIBA 1S2MA 1CNEA 4G4JA 5JZVA 4KW7A 1OXVA 4R3NA 3H99A 1KXJA 3X1MA 2JGLA 3DHEA 3QKSB 3A4TA 2EX0A 4ENQA 2WSSD 2B4KA 3QUTA 7ADHA 2I6GA 1U7HA 5KFDA 2RONA 2B25A 2JI9A 4JQYA 4BYGA 4HGZA 2CXPA 3TOCA 1I0LA 4L3WA 2PJDA 4B33A 2NU6A 1N4DA 3GJXB 3B78A 4NATA 4YCNA 1KO7A 3OZDA 2O8CA 3HA2A 4TRNA 5IJZA 2QVBA 1MO2A 4NVRA 4AS2A 1QAQA 1W34A 5MFPA 1S4MA 4HY3A 1MIOB 2HK8A 3D7MA 2YFHA 1OY1A 3PNQA 1GSIA 4YPFA 2EJUA 3I9V6 3NDPA 4Q3BA 4WXRA 1NBOA 1U04A 1YKFA 3ZDZB 4OQ4A 4X00A 5CRIA 5TEVA 1E1QA 1U3DA 3QVGA 4EUKA 3TR6A 3ETDA 2CN1A 3H2BA 4D9FA 1X14A 3VFDA 3IUSA 1DKMA 1N2BA 2D2FA 2OFFA 1E58A 1TCUA 4QTUB 1HFEL 2P3SA 1UEJA 2BQ3A 3WK4A 5J2TB 5J5AA 3Q8KA 5I9SA 1XAHA 3RD5A 2AQKA 2VHVA 5JYCA 3GFRA 2OQVA 4F4UA 4FWBA 1OH7A 5E8RA 4KVGA 5IF3A 3CJRA 3N2EA 4MHSA 4HQ0A 2PAFA 1M1NB 3HB5X 1K06A 4X92A 4Q4JB 4YQYA 3H0GG 1TCBA 1IZ9A 2B7LA 2ES4A 3TFOA 2D2EA 3TD9A 4JC8A 5AJHA 1RHQA 1HLDA 1B74A 3ZWAA 2VRCA 4GBJA 5JMTA 1G2IA 2RGNA 1OFTA 4DNOA 1NT2A 3I09A 4ONEA 4R1LA 1OGJA 4KSCA 2AR7A 4FQ5A 2AL7A 2M98A 4JLNA 4NXMH 1OFVA 1ENPA 2FPGA 2G04A 4GRIA 5ALDA 4GX1A 3T15A 3L40A 3JZDA 4II3A 4YCMA 2ZTUA 1UBKS 3EWSA 3RTDA 4EAAA 1P61B 3DBRB 4EJMA 3G5LA 3R3UA 3WGOA 4OHYA 4RIEA 3I5XA 1EE1A 1CIVA 1CY4A 1TO1E 3C48A 1Z5NA 3SYTA 3RARA 4LBZA 5J4YA 4L95C 2HQSA 2H4XA 3HOZG 1C9MA 1OASA 3IE0A 1RP1A 3RR2A 4Z4IA 1ABBA 2NV2B 1MC5A 3ENNA 3QOXA 1W6UA 3H5IA 5DQIA 2JLBA 4MAFA 1H2EA 1JJIA 3KZCA 1CQXA 4GH5A 2XNDD 4D0LB 2YICA 1CFJA 4R40A 2O52A 2QX8A 1E0KA 4MQEB 3PIDA 1I4OA 3B1XA 3TR0A 4U3JB 4CLHA 1QPZA 1SVMA 1SJ9A 3ITNA 4F04A 2OG2A 4R1NA 2O0MA 1OFIA 3AM1A 4KPUB 2OQIA 5CNKA 3WSVA 1FDWA 4CKYA 3LM8A 4AL4A 2AJCA 4D8VA 4WE3A 1ECGA 2IXFA 1UT6A 3MT0A 5CT8A 3PXAA 2V4UA 5K09A 5KG1A 1AQLA 1SC3A 1FP7A 2B6HA 1XJCA 4WECA 4EPWA 4G5QA 1NVFA 4DR3B 3E18A 2ZYRA 1GLGA 5E7JA 5BSVA 5HF8A 3W5SA 5BSTA 3SXUA 4G0ZA 4QATA 4ETSA 2JH8A 3GX1A 4WLNA 2ONYA 2OHOA 1P77A 3DV9A 4AI6A 2PHZA 1JLRA 5KVAA 3C3BA 1ECCA 4NXNH 3GV7B 5SYAA 4RPLA 1SHLA 3VZRA 2V96A 2YZ7A 2CCKA 2A9PA 1NW8A 3W78A 1FP2A 3PL1A 3RIZA 1SG9A 4BWVA 3WL8A 3QMPA 1GVNB 1KE2A 3SC2B 4AJEA 4CLOB 1GL9B 1GJRA 1J6UA 3CUTA 4MIOA 4GECA 2PZFA 2ESRA 3HA5A 2UYCA 2HNKA 5CDFA 1JU4A 3QGMA 4FTWA 4Y6LA 1LLQA 2LD4A 3VH2A 3RYFB 3WICA 3W5AA 1YZNA 5GPBA 2FEXA 1IBLB 3OIVA 2HPHA 5DI3A 3COSA 1Y6RA 1DRUA 5JXJA 2WUWE 4HRAA 2ZRAA 1G4AE 4AJ2A 1MZPA 2FG5A 1OLSB 2ZAMA 3SF8A 3RJTA 5T4HA 3L6BA 3G2PA 4C0AC 4HJRA 3E58A 4OFWA 2BGMA 2WEKA 1HI9A 1JJ7A 3ME5A 1HG0A 3CT4A 3LLSA 4C0QC 4FOLA 3IKTA 1XWIA 4CM1A 1IEWA 1AKVA 1UC9A 1HE3A 2GHIA 3IEIA 3GG9A 3BJYA 4FKZA 4NZZA 5ELXA 1QHHB <