1PK8A

Crystal structure of rat synapsin i c domain complexed to ca.atp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
b'AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rat synapsin I
molecule tags Membrane protein
source organism Rattus norvegicus
publication title Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb
total genus 91
structure length 306
sequence length 306
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1pk8A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1pk8A01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pk8A02
3KAJA 3BSSA 1C3OA 2FPGB 3Q2OA 4O7YA 3ORRA 2YZMA 1OBGA 2YRXA 4NYEA 2YZGA 3VPBA 3BSWA 4FGRA 1GSAA 3TIGA 2DIKA 2V59A 3DF7A 5CB4F 1JDBB 2W6NA 4MV7A 1EUCB 5HBRB 2W6MA 5D8DA 4GGMX 1IOVA 2R7NA 4I50F 1KJJA 5LOVF 2W6OA 2FB9A 3N6RA 2GQRA 4O4JF 3R5FA 1AUVA 4O4LF 1B6RA 3U9TA 3VA7A 1CQJB 2V5AA 2NPOA 2VHEA 3TW6A 4O81A 1CE8A 1GGOA 2FP4B 3TIIA 1JLLB 3E5NA 3BG5A 2VPQA 3VMMA 2C00A 2YW2A 4FFRA 1I7LA 2OLSA 1Z2NX 3U55A 4MV6A 4MAMA 3V4ZA 4MV1A 2DLNA 5C1PA 3RFCA 1KJQA 5DMXA 5CA1F 4RZQA 1T36A 3U9SA 4MV3A 2R84A 2CNVA 2P0AA 2DWCA 3SE7A 3R9RA 4EGJA 4J6EA 5LA6F 3UFXB 1GSOA 4YAJB 5J2TF 5JVDF 5C1OA 3LWBA 2FPPB 3I12A 2PBZA 3GIDA 1A9XA 4HQ6A 2I8CA 3AX6A 4QSHA 2R82A 3BFPA 4O7WA 2QF7A 2CQYA 2R7KA 3V4SA 4EG0A 4O4IF 4I4TF 2HGSA 1EHIA 1IOWA 3VPDA 1EUDB 4HR7A 4ZOLF 2R7LA 3JRXA 1KUTA 1KJ8A 4O83A 1VBHA 2IP4A 3R23A 4FE2A 1WR2A 2YL2A 5J2UF 5BPHA 4O84A 3MWEA 2R6FA 2I87A 1C30A 3U54A 4C5BA 4ZHQF 2NU9B 2W70A 3ORQA 4TUYF 2YZNA 2YS7A 3JZIA 3G8CA 1DIKA 1CS0A 1EZ1A 4M9CA 2YS6A 4MA0A 2J9GA 2ZDHA 2FPIB 5JH7F 4YAKB 2VQDA 4FFPA 4ME6A 4FFLA 1ULZA 4WD3A 3N8DA 1GSHA 3RUPA 4TV9F 4YJ3F 4O82A 2PN1A 3K5HA 4XYLB 4IZOA 3R5XA 2GQSA 1PX2A 2HJWA 4WBNF 1M0TA 2CZGA 1AUXA 5H80A 1BXRA 1DV2A 2R86A 4XX0B 4TV8F 3TINA 4Y8VB 3OUUA 5JQWA 3QFFA 3MJFA 1BNCA 2R85A 5BPFA 1CQIB 4IIJF 5FNVF 4O86A 2I80A 3K5IA 4EA7A 3TQTA 4ZI7F 5KX5F 5LYJF 4FFMA 5KKNB 1GLVA 2NU7B 1OBDA 2ZDGA 4O2BF 5K2MA 2W6ZA 4O7ZA 1B6SA 4DIMA 3VPCA 4XZ3B 4EA9A 1A48A 2GPWA 2X0SA 1M6VA 4MA5A 4E4TA 4I55F 5GONF 4IWXA 1KC7A 5BMVF 1EYZA 5CA0F 4MV9A 1M0WA 3K3PA 3ETJA 4MV8A 2NU6B 5EZYF 1W93A 3LP8A 4O7RA 2R87A 4C5CA 4L1KA 2DZDA 3MWDA 5JVLA 3VOTA 3NUAA 3WNZA 4HNTA 2R7MA 1KJ9A 4M9UA 3HB9A 2YWVA 2W6PA 2SCUB 3KREA 3HO8A 3GLKA 4IWYA 4EABA 2W71A 4EA8A 2YRWA 3WO0A 2Z02A 4YB8B 5IYZF 1E4EB 1VBGA 3G8DA 2YYAA 3BSYA 4YBZB 5LP6F 3RV4A 4EGQA 5CAEB 4O2AF 3ETHA 3KAKA 4HNVA 5HV6A 1KEEA 2CNUA 1Z2OX 3AW8A 4FFNA 4O7TA 5LXTF 1JDEA 1DV1A 4XYMB 4YJ2F 3WO1A 3KALA 2NUAB 3OUZA 1Z2PX 4IHJF 2GPSA 5JQGF 1E4EA 2VR1A 3Q1KA 2W6QA 5C8YF 4ZQIA 4O7NA 3HBLA 2Z04A 1SCUB 2NU8B 2PVPA 2QK4A 4FFOA 4FU0A 1VKZA 4O7LA 1JKJB 1W96A 4EAAA 1UC9A 4DLKA 5I47A 2WYOA 1I7NA 4M98A 2XCLA 4HNUA 2CNQA 3R5HA 1UC8A 4C5AA 2XD4A 3RV3A 3JRWA 1PK8A 3JZFA 2YZLA 2V58A 1KBLA 4MV4A 4O4HF 4O7VA 2GLTA 1KJIA 4M99A 2ZDQA 4O7SA
chains in the Genus database with same CATH superfamily
1IM8A 4G0XA 1XAGA 1CF4A 4O29A 5T6MA 2FP4A 4M1EA 1NT4A 1GPAA 4CG1A 4Z7JA 5EY5B 2LE0A 3CJTA 1JAIA 1MJ5A 2ALJA 1C9EA 1P4JA 5EWLA 3RUEA 2QMOA 5CD9A 3K9HA 2ILTA 2F90A 4PG7A 1WZ2A 2F3UA 2NSHA 3WMWA 3CKLA 3KZKA 1RYMA 4M0LA 5HEKA 3WLLA 5EHNA 3AK4A 1A98A 1GSAA 4JZYA 4Q19A 1RKUA 1KZ9A 4G5XA 3P52A 1NGSA 1Z22A 2CW7A 3DC2A 3Q3GE 5IAEA 4B6QA 4LKOA 5JJCA 1QPZA 2UXDB 3LBNA 2HNBA 2C59A 4W82A 1U2SA 5KVAA 1ONOA 4EJ6A 2IPXA 3KIPA 3O8BA 4V1CA 13PKA 1JG1A 4UCSA 1A8UA 2VF7A 3EC1A 3OM8A 1I13A 3QLVA 3RHSA 1NI4A 3TFWA 1QCYA 1GLGA 3LVQE 3HBFA 1CKMA 2FKLA 2JA5A 4JMPA 3VAZA 3X1WA 5A4AA 2LNDA 1FNNA 1DJOA 3DT6A 4H4DA 2X0KA 3VNRA 4BVHA 5AO9A 1R0BA 2F62A 1GUDA 1H5UA 3GV0A 4O4JF 4EJMA 1TA0A 5KMGA 1AQNA 2GN8A 1JTEA 4TL6A 3WBBA 3I01A 1G1AA 4KE7A 1WPXA 2B8EA 1G64A 2P9YA 4HF7A 4ZVSA 3ZHXA 2BLLA 2DPXA 2NZ8A 3WRXC 1MOZA 1NJ5A 2Y8EA 3GVPA 4FFDA 1ODKA 1SRRA 3U7JA 5J1TB 4CN9A 4L50A 4GF5A 4F3RA 1R4NB 3VPFA 3H3FA 5B7GA 4U6SA 2B1GA 3F6BX 3TRFA 2GD0A 1ZHSA 1TGVA 1YB5A 4GWGA 1SCDA 2GZMA 1EB9A 3R0XA 2HCFA 3JVVA 1WZIA 1SUBA 5KIAA 4RZ2A 1J5PA 1D2CA 5A7FA 1Q11A 2FN8A 5CE8A 2I4NA 1H1LA 2ZQYA 2RDMA 2M32A 4N8DA 3SK0A 1JPUA 4RJ2A 3MCZA 3QFTA 3SJCA 1R9TA 3RVDA 3SHFA 1XD9A 4BIIA 3HGQA 5TVGA 1SEVA 2JAPA 4Y18A 4DBVO 3PNLA 3KHGA 1FRQA 2BGUA 1CC1S 2FPWA 2QGZA 3AR8A 4ZP1A 5H82A 4CM4B 3UYYA 2OO7A 3EJWA 3S99A 3ZHUA 1DVRA 4D96A 1NMEA 1PFVA 3CSSA 1TEZA 4A5SA 5CDHA 1WUYA 1ZNWA 5EGNA 4AZ0B 1YU6A 1DUVG 3CNOA 4R1UA 3F3MA 3QLUA 5LMNB 3RSSA 2C9YA 2QSUA 2HHFA 4JK3A 2BDTA 4Q9NA 4MQEB 3AH8A 3L4JA 3DKPA 4NI5A 3TCKA 4R7GA 4RPIA 1L5VA 2YVUA 4B2LA 3B1ZA 1RHQA 2HMSA 1WLYA 1NN0A 5F7ZA 5LZ5A 5JHGB 2I62A 1XLUA 3K6SA 4RZQA 2ZXFA 1KYWA 4GL4A 3AKEA 4Z99A 4V24A 4UTVA 4LHEA 5HCIA 1W7AA 4H6WA 1HE4A 2QAGC 5HR5A 3GGPA 5GVRA 3FVWA 5GONA 2XTZA 4CKCB 2Q1SA 3L7KA 4DPLA 4WECA 3TNLA 3CMMA 4WK2B 3ZZTA 2FFJA 4WKCA 4A3JG 3PFGA 4EY4A 3SHTA 4E46A 1J2EA 2FSPA 5EJ4A 3LQFA 1U7OA 1H94A 3EA5A 4W99A 3AIOA 1VLLA 4Q34A 5AK4A 4CV2A 2FV8A 1ZQ9A 2CVFA 1NJSA 1DBSA 1J2TA 1XEXA 2VJYA 3AV3A 4BP3A 2IBMA 4W63A 5AHWA 4HEHA 4A6XA 3MMPA 4C87A 1P8JA 2GVNA 1T5LA 3B48A 4HLDA 2PBZA 2BDUA 5DNVA 3WLQA 1K4KA 3H4DA 4HVTA 4CF4A 4E5UA 2PMDA 3DSRA 1VJCA 3HUFA 2ZXUA 5L3ZA 2PSFA 5B2EA 1AZLA 1JDZA 2X8WA 3NTXA 2COKA 3NTLA 5HF8A 3FKSA 3JD1A 1P1CA 3JQBC 4CQMD 2GPBA 3GNTA 1MJGM 3CX8A 3RF7A 3JTEA 3DP7A 3FHTA 4F3TA 1VI5A 2H59A 3N0VA 3AX6A 1X7DA 2CW5A 1GYFA 4L75A 3HS3A 3OI7A 1MGPA 2ZP1A 4WX2B 3S55A 1UFRA 5ELXA 4CNBA 5FNVB 1NNUA 2AD5A 3DNMA 3LDGA 4GHWA 1KR5A 3KZOA 3VO2A 5JDIA 2HHCA 3SVLA 1JFTA 2JDIA 2XNDA 3GG2A 1E5TA 4JOBA 5IAOA 3QUCA 1ZH4A 1EP1B 2GKOA 4ETMA 1P80A 1SIWA 4F2PA 1MENA 3V8QA 1SA0A 3B1WA 3R7SA 3W05A 5EHZA 1LNSA 2VCEA 3ZK8A 2CK3A 3INRA 2IX3A 4H7PA 1C1XB 2ZVPX 3V97A 1G8MA 1QRTA 2ZJFA 4QUDA 1T3SA 3D5EA 2JATA 4G36A 1X14A 4M7RA 5DN6A 3ROEA 3FOAA 1G55A 2VDKB 2ON6A 4NBVA 3RS5A 2C8LA 2IITA 3ZHTA 2GO1A 1N0HA 3ANMA 4NJEA 4REOA 3ZJ5A 1W34A 2AOTB 4BQIA 2O1WA 2HNKA 4PNPA 3R23A 1Q21A 1ZC3A 3PQFA 3GV8B 2UKDA 3G2JA 2PJUA 1S0UA 1TYZA 3LX8A 5DYTA 3TMAA 5CP8A 3OKFA 3MFQA 4P3PA 4PE5B 4Z1OA 4OHRA 4DLZA 2I34A 4G5YA 4QOIA 3SDBA 1GL9B 4L5AA 4Q05A 3MWEA 1F2UA 1ECPA 1W2GA 2A5JA 3GXOA 2C83A 5FL7A 1NBHA 4IZ6A 4ZZ0A 3O4FA 5JATA 5FPYA 5LXTB 5KQRA 1FP2A 1TTPB 5LP1A 4WZBE 5KG0A 2V65A 4GIBA 3U1BA 1JE1A 2Y77A 3LLUA 2IH5A 4IJ5A 5FPKA 2D74A 4G0OA 4JLSA 4O2BB 1FP6A 3VV3A 2WHPA 1QQ7A 1N2EA 4AKGA 3LT1A 5TEVA 2Q3CA 4HLQB 1UJ2A 1UKAA 4OJNA 5HRCA 2VHCA 3SFTA 1DKUA 3TSAA 1DIKA 3PJGA 2QNBA 2DQ4A 4MCAA 5FPTA 1SG6A 1VECA 4HYEA 3QWHA 2JBAA 4E5VA 5EWEA 3BYZA 5HX7A 8MHTA 3SQMA 4RXUA 1E63A 1MABB 3DV0B 1RQ2A 3OQVA 1MB3A 4J16C 1JDUA 1L6RA 2OM2A 1KMQA 2HIHA 5E9JA 5EKTA 5GWXA 4Z49A 3I5YA 2JA7A 4EW2A 1M2GA 2GS9A 1C8VB 3O3CA 4FDVA 2EW1A 2C0PA 4KG7A 2LIPA 3TSWA 4CMIB 5EDWA 1R8QA 3BWCA 5BWOA 3IOEA 4QRIA 4X7RA 4L5BA 1XK7A 2B61A 4OQQA 4YRBA 4BP1A 2ZI9A 4UBIA 2J3JA 1VLJA 4BV9A 4BWVA 2D0PB 2AG6A 4ZO8A 1ZFNA 4DPMA 2WWYA 4N9WA 2FZWA 4A3BG 2EKLA 2AKYA 2Q5CA 3A9UA 3IAM6 1FL9A 3L05A 3KWLA 5EE9A 1FYWA 1GTZA 3JSAA 4PNZA 3W04A 2RHOA 4UEWA 4YJKA 2CMHA 3F6CA 3OLYA 2R6GA 1PR3A 4TV9F 4X7MA 2FZEA 1YB6A 4AZ3A 4OLBA 4TRMA 4JXXA 2IUFA 4IZOA 2Y0PA 3GO4A 3TQQA 1OH7A 2P1DA 3A3KA 5DM2A 4IMRA 4GBMA 4Z86A 2HJWA 4DJ5X 4OLJA 1XVIA 4WIAA 3PHIA 1GADO 2V7WA 1DAHA 3DE1X 2XV1A 4JLPA 4LF8B 4JXKA 3EN0A 1BXRA 5FI0B 1XQYA 4NLLA 3N74A 5ALOA 3KR9A 2W93A 4WEQA 3LWNA 1DC7A 5FHRA 3NIGB 1H2YA 3W6NA 5IXYA 2GPJA 3NEJA 1E2LA 1QNLA 3VZQA 2QA5A 1OAOA 5ELLA 1V1RA 2C07A 5CXUA 2DR3A 4XDZA 2R85A 5K05A 4L0CA 1QAQA 4DMMA 1VHDA 1Z2DA 5J3JA 3G5TA 3P9IA 1I3NA 2J0EA 2ONYA 4GLOA 3VR5A 2WKRA 4IHQA 4DQVA 4TYNA 1RAHA 3OP4A 4CM6A 4R05A 3AY0A 1I3MA 1LK7A 4EQ6B 4M9SA 1CEQA 5BV2P 3ET4A 1CUVA 2I9PA 3GC6A 1IBKB 2J6UA 4LFCH 2IYYA 1V39A 1GAXA 2VXYA 4QPNA 3MWDB 4CGYA 2ORYA 5BRJA 1OQAA 1ODCA 2NMVA 3UC5A 4ZAXA 3EXEA 2PUDA 2DWOA 3W1BA 5TVKA 2CDBA 1F14A 2R4QA 1FJ2A 3KKOA 1UMCB 1Y6ZA 3M6UA 3OIWA 4BXXG 4A3GG 2PT6A 3MHPA 5ALKA 4ZVPA 5CM0A 5FPHA 4DNQA 4DWWA 3D2AA 3EG5A 2DETA 3SPXA 3HG7A 2ZDGA 3DFZA 2QL7A 2XDWA 2DBVO 3A9TA 2TMDA 1PRYA 2WE8A 5BWWA 3PEUA 2H4JA 3RQSA 5IBQA 4FYPA 3RFFA 4GP7A 4MRNA 4KSBA 5KYYA 2AJ8A 5FWNA 4DR6B 2O59A 4P4SB 2IKSA 2HO5A 4P5EA 3SCZA 5JR3A 2X0SA 4QTUB 4JELA 4UQPA 3RRYA 2QZPA 3H40A 3I0MA 4JEHA 4ZCSA 2HPHA 4BLQA 3AUJB 4W5JA 4EARA 1YS7A 1UINA 2ECOA 3E58A 1TKRA 3NWPA 5KREA 5KFZA 4CEIA 2VHQA 2BPOA 1VP9A 3P9XA 2PUTA 1IWPB 3FLAA 1GGHA 1VLZA 3P97A 3WR5A 4OHYA 4PZ9A 3FKQA 4TPKA 6NULA 1SCNE 1NBME 1M0WA 1L1RA 1PR2A 2C2WA 1I4WA 4JI5B 1K1SA 5B1YA 3D4NA 2ZYIA 3JYOA 2VS1A 1D1QA 2PL5A 3T1OA 3ETJA 3NBYB 2GESA 5ITVA 5AK6A 2MTBA 2ZCJA 5DG7A 2ZJOA 3BTVA 2QWXA 1IJKA 1GV0A 2W8BA 3UWMA 4E07A 3CRMA 4QBKA 2C42A 4KIUA 3ASUA 4RW0A 5K7SA 4DLRA 1FSZA 3IQHX 5MGNA 1E2EA 1VM6A 4B71A 1I2DA 3BM5A 1L5FA 3EPPA 1ZS9A 2D3TA 4HPWA 2C9CA 3U60B 2D5IA 2NO9A 1GGJA 1LI5A 3G6YA 2OTCA 2YASA 4MPPA 2ZS9A 4O5AA 3NBFA 3UB3A 2WQ7A 4BGVA 3EQZA 4KN5A 1LX7A 2R7MA 4RIEA 5KYKA 3ZWAA 3I42A 2G1JA 2TMGA 3F74A 1AB6A 1AUQA 4J16A 1SZCA 5AKHA 4X71A 3ZW9A 2I3AA 4UTRA 1JR2A 1UXJA 2B2NA 2QLMA 5BWLA 4UKDA 2B4TO 4HPJB 5F9MA 4BNDA 4EG6A 2IDJA 1RM5A 1II9A 2AFHB 2Q49A 3N0XA 3OOEA 4N0QA 4JD5A 4W5TA 1HY3A 4XKJA 4UUPA 5EP4A 4ARVA 2P79A 2R8ZA 5KFSA 1MO2A 2JJYA 2X2OA 4KEAA 5LU9A 3KKNA 4FYMA 1JQJC 2EJVA 3GFFA 3U1TA 2J0VA 4Y1FA 1BW9A 5F2KA 2SBTA 5MFPA 4X7PA 2JB9A 2O1XA 5C1DA 5CDYA 1BXRB 1R8XA 1ZNQO 4RJJA 4GD3Q 4ZI2A 5EWFA 1G18A 1NQ5A 4IIUA 3J81A 4FGWA 3DCIA 4G8DA 1BMTA 3GAFA 1A69A 4IG9A 3UK7A 3TZQA 3N70A 3Q8SB 2QZ4A 2RGBA 4G6ZA 4EMTA 2G4VA 5IYZF 1PFUA 2V4MA 2WY2D 1JDTA 1NLUA 1Q1QA 3OQIA 1NM5C 2J46A 3N9IA 2BAGA 5EFZA 2Y4RA 4LN1A 5AT1A 4IFBA 1HEIA 2JDID 2XNDD 1E5QA 3WAKA 1R4ZA 1QFXA 1L4KA 3ND6A 3VVBA 1O57A 1UXOA 2XT6A 4KAAA 2Z2KA 3MWKA 4OB7A 4RDCA 3F4LA 5AVRA 3THXB 2ZITA 1NSYA 2CK3D 3H2IA 3QVMA 5EKUA 1KZHA 3SXPA 3WKAA 5L6LB 3G9ZA 1AK9A 1GFZA 1NI5A 1XD8A 3O47A 1GCUA 2CY0A 3ME5A 2WB1A 5DN6D 1Z5ZA 3M9OB 4LY9A 2W4IA 1KVUA 1QWSA 2IXTA 1Y3DE 1ZUIA 2PGDA 2XZPA 1V16B 3D4LA 4UNQA 5REQB 3FTNA 1E2GA 3Q5DA 3TLBA 2Y1DA 4LBZA 1QRDA 4YP5A 2OH2A 2IQ5A 2HQSA 3S2ZA 3AEKB 3OECA 4IVPA 4QDJA 4WOKA 1NL3A 3ITKA 4OL0A 4R2KA 3MPUA 5AVVA 2GZDA 5JYBA 3GP8A 4WV3A 2HVQA 3NC0B 3EAFA 4RO0A 4ER7A 3O38A 1YGYA 5C8YF 3CY6A 1GGNA 1UXIA 4JBLA 3SZ3A 3RJTA 1U1DA 4O2AA 2ZUWA 1NUUA 4JJKA 4O7NA 2AGQA 3B6ZA 1X42A 1M8KA 2NPIA 4RPLA 1GZ7A 3HBLA 3DMPA 4HZUA 3H13A 5JJ5A 3IQZA 2VQFB 4MDFA 3AINA 4JGBA 1US8B 4G07A 4IJWA 3CLHA 4WW0A 4B84A 4DNXA 5HS4A 1B7GO 2O1EA 2PH7A 1UZAA 3ABSB 1PZHA 3FX2A 4C05A 1VLMA 2GJ9A 2HQRA 3R40A 2FWRA 3PC2A 2FEXA 5LR6A 3PUVA 1VL6A 2V3CC 2WYOA 2DUJA 4PZZA 4AJ1A 3GMSA 3ZWYA 5K0NA 2OHJA 4J7XA 4BMNA 5KYTA 5I7EA 2F3SA 3RAFC 2YFQA 3ZIDA 2FUCA 2ESRA 4C5AA 2XD4A 1I94H 1Y9ZA 2G5CA 2P27A 1LSJA 5G0TA 2QIOA 1FQWA 2CHGA 4NCBA 3OG9A 3OX3A 2POCA 1HQYE 3W1VA 1CJVC 3DP9A 4B4VA 3NONA 1G9XA 1T8PA 4XOUA 1X86B 1A5TA 4W9NC 3LPDA 1JHMA 4FS1A 3KFLA 4QGFA 3IBFA 4NPHA 4CTNA 1NJ1A 1NM5A 1NDUA 3PQCA 4FTWA 2HDWA 1KS9A 2ZDQA 3AU8A 5CVUA 2IGBA 1QB7A 4CCYA 3OD5A 1E0SA 1EFVA 2CJWA 5G1OA 1IBLH 3PI7A 1U8EA 1VA5A 3ET5A 3EBLA 3KD2A 3MTEA 3QELB 4GRDA 3DDNA 3JSNA 1KL7A 4PRLA 2W57A 5B3JA 5A4IS 4GVPA 2VJBA 3V7NA 2ZVDA 3JZAA 1K7YA 3GPCA 5LOVA 4H0CA 4J03A 2Z2YA 3OT4A 3SMVA 3I52A 3QEJA 3THRA 1OE0A 4LYAA 2DT8A 4ETWA 4U8HA 5CVVA 2IKQA 2OBNA 1IL0A 2A67A 1P72A 4PLFA 2VYNA 4QW9A 1ZL2A 1VCHA 3LPNA 3QF7A 2YCBA 4LGYA 1H4SA 1NUTA 5KG7A 3LKDA 2ZBRA 1TM2A 2C9DA 2NU7A 4CKWB 3TI7A 4EHBA 2HHJA 3M89A 3ZNPA 2W58A 2EOAA 2WWHA 4CWAA 1U1EA 3E3AA 4BJ3A 3GFGA 4DQDA 4R8VA 3ABIA 1DKRA 1ZESA 3G5MA 1NMQA 1XD2A 3D81A 4FFVA 5KQGA 2R8OA 1X8JA 2FDXA 3OF2A 5EEGA 4LYJA 3GTJA 1V9PA 3YASA 5L7WA 1OH6A 5TMPA 4ZREA 5CYFA 3A7DA 4RWEA 2UZ4A 4KPYA 3HR8A 4TM7A 2DOKA 5CW2A 2W9AA 1KDOA 1TMGE 5DTMA 3MAGA 5F2OA 2JA7G 5KAPA 1DWPA 3UWPA 2LBPA 2FAXA 3H4VA 2R47A 3WRXA 5JSQA 1FTGA 1UPBA 2C4MA 2OB2A 1BQEA 3MTJA 3N6RA 4YCCA 1Q3TA 1P5JA 2G80A 4Q7JB 5L9XA 1EFCA 1P5HA 2B2XA 1ND5A 4RM3A 2YJNA 1YFLA 1A9OA 2PRIA 3N2GB 4EGSA 4ERXA 4FI3F 3JAMA 2YBEA 3KT8A 3KU4A 1SIUA 4I19A 1VBNA 2W4QA 4RKFA 4K6FA 2PZMA 3B52X 1EWVA 2XVMA 2FR1A 4RE6A 3V6JA 4G1CA 5JDCA 4TT8A 5LA6B 3B8HA 2PZBA 3QVGB 4PBTA 4E5PA 3L0CA 3HCOA 2K87A 2O2ZA 3G02A 4ED8A 2P5TB 5FQOA 3GDGA 4KIFA 2C3UA 2SCUA 3RJ5A 1A0IA 2CLCX 4UMEA 4GPD1 4N0EA 5E25A 2MJLA 5DM1A 4D8WA 2HVSA 1EIWA 4LXGA 1J7JA 2OQVA 1OFGA 1GNSA 4R1SA 4JLUA 2OOSA 3SG0A 4D8XA 1VRVA 2R5FA 4AXXA 1Z0KA 3GOQA 3TNJA 3R7NA 4FKMA 5IPFA 4R9VA 1OWOA 4UE3S 2BRUA 2LZ0A 4IJQA 3PQ8A 1A2KC 2ZUTA 5I7AA 1GQFA 1Y4SA 1JVBA 1OBFO 1SQGA 2CD7A 2PS9A 3CX7A 1E8NA 3L0OA 2BHLA 4F38A 5CPFA 3TLAA 2ZB3A 3I62A 2G70A 2Z2IA 5KNCA 1LTHR 3RS3A 1G21B 4JLKA 2GTPA 3WIBA 5IAAA 4RIHA 5IUNC 1UJCA 2AOXA 3UY4A 2QMEA 2QM7A 3UN1A 4OQDA 2DFPA 2VP3A 3EMVA 1DC8A 2QRVA 4Y2VA 5ARDA 4CDNA 3LQ2A 4MNTA 3ZY4A 2OSBA 5JDCC 2Q4BA 1ZD3A 4H3HB 1WDWB 1XU7A 3ZGLA 1I8TA 4O4HB 4KMOA 3EGWA 5HQ3A 3OLXA 3OCXA 1R9MA 4J91A 5FV7A 3SR0A 2QYTA 4JKYA 5K4AA 5JJLA 4Q9DA 4YRDA 4ZU3A 5LMCA 1GA1A 3L9XA 3PL5A 4RUCA 4B3IA 7YASA 1PU2A 4M89A 5K5EA 2VSXA 4NENA 3BMQB 4ZODA 2EJTA 4Q9HA 1M1XB 1Z0DA 2A2ZA 2JCSA 3FVTA 4URWR 1E1YA 1E2DA 1MAVA 4BRUA 1KFCB 3FBGA 1WE2A 3WYEA 5FBZA 4UOEA 1K27A 1E1RD 5BT9A 2WINI 3JALA 4CM9A 3JX9A 2ZU6A 3DBRB 1E2FA 5T8KC 2KS6A 3I72A 3T4PA 3B6IA 1UPXA 2VSFA 4AY3A 3DTVA 5BVHB 3K0KA 4LF5B 5F3WB 4RLHA 4B2PA 4R0NA 4LGMA 3AVYA 3HOXG 5ALJA 3RUIA 3MIZA 2GVZC 5ALDA 3A58B 4A36A 1ULSA 2AQHA 3WQHA 4ZVQA 3CONA 2ZG6A 2ZJZA 2PX3A 5LA6A 3QOFA 3NIBA 4FQ5A 3LDFA 2SKCA 3UMJA 1UODA 1WDTA 1F4PA 4BWSC 4UUGA 1KZ7B 1PG5A 1Y3BE 2YV4A 3FFXA 1UM9B 4ZEMA 1A8QA 3BAFA 1NW4A 4J29A 4NBNA 3RLFA 3ZW7A 2Y0SE 2ZM6B 1WTCA 3U3MA 2ZZNA 4I4TF 3N2GA 3HP1A 2Q3HA 4IYRA 4UJ5A 4HNQA 1E1DA 3N2KB 5CCDA 1I3LA 1A9RA 2UYQA 2VA8A 1O6GA 5TQ0A 3PEFA 4EDFA 3G13A 3LCVB 3TL6A 3KZVA 4KAXA 1G17A 1YBVA 4N6OA 4QGBA 3S2YA 3JRXA 2WWIA 2XA1A 5DWVA 3HO6A 1YQWA 3PUZA 4XB2A 5A9TA 3CVZA 5KFGA 2H18A 3CJQA 4ARBA 2R6CA 3B1YA 2HIVA 5CTAA 3V3KA 2MSNA 2DPIA 2C04A 4RY2A 2E18A 4PG4A 4TM8A 2ZQ5A 4XIJA 5DNCA 5JALA 1TMYA 4GBED 5I45A 3D7SA 3VYUB 5IVIA 3L8MA 3VR2D 1U0JA 3IAAA 1ZGJA 5IARA 1A1VA 4C3VA 1OW3B 5J2UF 3F6RA 4GX2A 5H9WA 1SQ5A 2XITA 4FBTA 1PSWA 3EG9B 3N76A 3PC3A 2WWVD 5AUNB 4QUBA 4GXNA 1HI9A 4PM4A 3RTGA 5L1KA 2JVJA 1E98A 3WAGA 1I0ZA 4PX3A 4AG6A 1JYFA 3HKZE 3KFVA 3RIYA 3R74A 1TZ2A 2AW5A 5EIBC 1EUDA 5EESA 4B76A 4F45A 1X9GA 4C1BA 1N7IA 1U65A 5BNZA 5K3WA 4ED7A 3B1KA 3OSUA 4PYKA 5CW1A 1TJYA 3E7DA 3OE5A 1KE2A 3K72B 2RSLA 1OIXA 2ZI6A 3Q8QB 3GRVA 4HNRA 1SKAA 1XRRA 3Q10A 3GBSA 5EOYA 2CVHA 4BEVA 4DDKA 1PLKA 1ISSA 3L8GA 3ZWCA 4DR6H 1V1RB 3GRZA 4HP8A 5IM4F 5C8YA 4D25A 1LWOA 2BEWA 2HK8A 1ZD2P 4MEAA 5C34B 3OSZA 1NBIA 4DLWA 2E4WA 1R74A 2H3HA 4KHZA 1SXGA 4H3SA 4QTXA 3U62A 2JGDA 1JQ3A 1JMVA 5TV2A 3U7IA 2FPIB 4KV7A 4L0QA 3IIEA 2QTAA 4TTIA 2GFHA 3BL8A 5I8ZA 3PE3A 4BLVA 2BEKA 2Z57A 5CJ2A 4C3OB 2GN2A 3VJRA 1B23P 3MOIA 2XQFA 1OWNA 1V43A 4OB8A 3AEXA 1J23A 1NZDA 3OMXA 2FN4A 3OWXA 4G41A 4PFSA 5EMJA 4AZWA 1AK1A 1T8WA 5KT3A 3E23A 4MQUA 1PJSA 4ALKA 1YQXA 1T9GR 1Z29A 4YV0A 4XB6B 4FX2A 2C22A 1DMRA 3QUSA 2P4QA 1RQ7A 1ZK4A 4GVXA 2JEGA 3VR2A 1PW7A 4H6PA 2RHBA 4ACBA 5SY6A 1T4CB 3H8VA 1L5QA 3M4NA 3QM1A 4ITRC 4F1WA 2QHXA 4KV9A 3ROMA 2Q1WA 4F4HA 2IA6A 3G1TA 4X20B 1ADJA 4JP3A 4M6WA 3ZE0B 3HCBA 1ABEA 1MU0A 1JDNA 3VTKA 3QVSA 3L6OO 2ZGVA 4YUXA 2F1IA 5ISMA 1D5CA 4ZMSA 2R86A 1XTBA 1ZHFA 1S0MA 1AN0A 2V8OA 1D2GA 2ACVA 3FMVA 3HFSA 3ZG6A 5KYGA 1QHIA 1D8TA 5EXEA 4CDGA 1UK7A 2AX3A 4YR9A 2DQYA 4D44A 5LSAA 1YTUA 1NG1A 2ID9A 2JLSA 4S35A 5DKFA 3TRKA 1T8UA 1E3SA 1T15A 2ICAA 3OE4A 4R8SA 5EWMA 3FNFA 4I1YA 4RU1A 1H2WA 4Y7DA 3TZBA 3W7VA 4UFZA 1DKQA 3V9PA 2UU9B 3QVVA 1VTKA 4QUEA 2H1FA 1WUTA 3WYBA 1WUHS 3FNIA 3LHDA 4AP9A 3K30A 3KB8A 4QDOA 1A7JA 5HW0A 4Y9DA 2AF4C 1WEHA 5LQCA 4DV0H 2VOJA 1OI2A 3D7NA 3DAFA 3LC2O 4NBKA 4RAQA 4EYGA 3REQA 1O54A 1SIBE 3SIXA 3E15A 1KRXA 1P3JA 4TX1A 1AO3A 2VH2A 3ESDA 1KP9A 2JJMA 2EL7A 3AW9A 1XDWA 3OZ7A 1JEEA 3OZSA 4DGQA 4PU0A 1MRNA 3UT5B 5CVJA 1J0EA 1YV9A 2BTQA 3KUUA 1KC1A 4NBSA 4DIDA 3PO3G 1AM4D 4N0PA 1JE0A 1LUAA 3EVBA 4OQPA 5T57A 1IZZA 4AQYH 3GVHA 2PCLA 4L57A 1I4OA 1MO3A 3OEEA 2XE7A 1L7QA 1UPFA 2ADFA 3UK2A 5CCXA 3QU9A 1F0PA 1GNTA 1U7HA 3ICQB 4GYYA 1T9KA 1FVIA 3WP1B 3RO7A 4EPVA 1B8PA 4U7GA 5EQFA 1XQ6A 1PEKE 4FFBB 5IC4A 2Z58A 3EHDA 4X6LA 1UK6A 4BLUA 3PFFA 2JGIA 1EYZA 1XNRH 1TO1E 2MYTA 3UXYA 3FPSA 2AH5A 4JI8B 2WD8A 3PB3A 2TECE 1VCNA 1G7CA 4E2FA 3IR5A 2R66A 1IN8A 1Q83A 1X1EA 4NEQA 5DIZA 3QG1A 3UA3A 1X2BA 5AFSA 3WA7A 2W8BB 4Z3OA 3OAAD 3DVAB 3MXTA 1IN5A 1NNLA 3BMNA 1QS0B 4R2IA 4ZO4A 4DOMA 1U3WA 2HPAA 4C5CA 1U8XX 2HRZA 4FHZA 5CMLA 5L4NA 1VDMA 1KOJA 1OFUX 2GZHA 4WUVA 4Z0HO 3WDMA 2HA2A 2V5UA 3FUWA 2HWXA 4P7GA 4ZQHA 4ZKEA 1ORRA 3V1KA 1QPGA 3ISTA 3DFFA 3P0FA 2IYEA 2PGXA 2HLNA 4NCIA 3AGPA 1R64A 1RP7A 1E4GT 4PXYA 4BNWA 2VOEA 5G3YA 2BQRA 1BJKA 3I09A 4HQKA 4O8CA 1KQ3A 5U4XA 5IJ0B 1XV5A 4NMXB 3V1MA 4B85A 1G41A 1HRDA 1Q1NA 2D1RA 3DULA 4BVGA 3HB9A 3B1JA 3QWBA 4MDYA 4URYR 1N25A 4IDPA 4X60A 4EPYA 3ESQA 3CO5A 6AT1A 3LYLA 2PNJA 2YWGA 4LF7H 1G16A 1ZWKA 3UMVA 1ZD8A 1IBKH 1SKYE 2Q5EA 4Q3OA 2ZTHA 3VFDA 4X85A 3KQWA 1JHYA 2ZUSA 4J0EA 4ZV9A 2CLFB 1NC3A 1TZJA 3ONDA 1IOLA 1ZOLA 4BY7G 3LUJA 3ORSA 4JLDA 1U3DA 1GNLA 3NFYA 5M3BA 2X5NA 1LNQA 1A77A 1N77A 2OXIA 2HF9A 2WAOA 2HJVA 1LH0A 5AESA 3G8DA 1E99A 3TR6A 5K0GA 4P53A 2M6LA 3ITNA 1O8CA 1VKJA 4HS9A 1IQ0A 1RXSA 4HBGA 3V80A 4ZCIA 5K3OA 2WWFA 1XRJA 2C96A 3LT0A 2Z8XA 3RDPA 1P0QA 3VPSA 3H16A 5E6RB 1UT5A 3EWSA 4ZMBA 4JJ8A 1HC7A 4A0HA 3EGDB 2H48A 3NAZA 2WKSA 3WLAA 5C51B 3DCYA 3EH1A 1JUDA 3TMKA 2Q8PA 4MVWA 2W8ZA 5AJUA 4EI7A 5IEJA 2XMPA 4E7OA 3JD2A 1FS5A 3T4UA 3IP7A 3U09A 4PFJA 3EISA 2IXDA 4J4HA 3N6VA 3O84A 5CB8A 1R5BA 1N5IA 2FQ1A 2P7HA 4KYTA 5L1JA 4HX9A 2IEGA 2O2YA 3TY9A 3U2QA 5JPCA 4EZEA 2B7BA 4F0JA 3ZU6A 2PIAA 2JJ2A 4L0MA 2RFLA 2Y2VA 1TZMA 3FUCA 1BCRB 1IY2A 1N2HA 3NP7A 2QD5A 2A1TS 3PJEA 2BMJA 4MR7B 4HYYA 1ZNXA 4CMBA 3HLTA 1OH5A 3OZRA 2WB2A 4F56A 1UMCA 1ZLYA 3C8DA 4JJZA 4D3FA 4Q1BA 2DFKB 2Z6VA 4FGLA 1CUCA 4U00A 3OPVA 1Q6YA 3H1PA 1RE0A 5FAXA 3UEOA 4OV6B 3M0EA 2OZVA 5TJ9A 1AE1A 5LNK6 2RGVA 4B8WA 3C0FB 3ZBUA 4YWJA 3TOVA 2DSNA 1UKVY 2YC4C 2ZUCA 2AFIE 2X4LA 3B60A 1RWOA 5AHOA 5EVJA 4COOA 1RRVA 2ZSJA 1J5XA 4D3YA 1T4GA 3BGIA 4JH0A 2QM3A 3EGXB 3FBTA 4HRYA 5PGMA 1Y1VG 3QKUA 5EUMA 3RBEA 1UH5A 3BCUA 4IKOA 3X0DA 3ZWVA 4ZRDA 5JAPA 1ZJJA 3ZR4B 2AG5A 2HOQA 4QEKA 1KEWA 1BEZA 4R83A 3LP5A 3V4RA 5IASA 2CDRA 2CLSA 2P4EA 4QASA 3UUEA 1WPQA 4IXMA 2I55A 5H3HA 4DB4A 3SZOA 4HS4A 1W29A 4N7BA 4X5OA 4ARZB 3IULA 3AFGA 1D07A 2WKQA 3LUDA 1YJ8A 3UFBA 4BU1A 3HJCA 1PV1A 3AEYA 4C43A 5I01A 5B1DA 4DR5H 1NY5A 4YCNA 4WT7A 3K3VA 1BD4A 4MWSA 1BN6A 4WMLA 1SIOA 3RVOA 5JQGA 2AEMA 1A71A 3AHDA 4AULA 5FBWB 4EYSA 2E89A 3A7EA 3DMTA 3NNSA 4YHHH 1KP3A 4R98A 1Z16A 1IEWA 4LYYA 2WF8A 4ZA2A 3RRBA 1HQKA 2YWJA 4O2BA 4CLOA 2A3NA 1FX0B 1R8JA 1RCFA 2YZMA 4NCKA 3GP3A 4Q3AA 2ZZMA 3ZDYB 2QVBA 4HB4A 1VG0B 3C5WP 3EPRA 3NX4A 4MWEA 4OKSA 1EE9A 4JBWA 2ZJ0A 4JB2A 3QX3A 1TCUA 1XZMA 2J3MA 2OESA 1GR0A 3BSWA 3QENA 4LOIA 4ZDIA 3L92A 3FDXA 3I8XA 1G7RA 4UUQA 3PFHA 4QXOA 5BWMA 1JSCA 3IT0A 3QPVA 3QGMA 4BYMA 2GRAA 1EXVA 4I4IA 4C7BA 4IDGA 4MVJH 1JWLA 1JDBB 5DBEX 7REQA 1RCTE 1OXSC 1VPWA 2HR1A 2Z9BA 1MRSA 1IK4A 3G2HA 4JBHA 2YWBA 3CVVA 3X1ZA 1T2DA 1Z13A 1V7CA 1U8CB 3D43A 4G0MA 4WE3A 4EBCA 2VI5A 4MVJP 5KJ1A 1XAHA 2Y4NA 4E5YA 3RSFA 3D4OA 4QX6A 2ZRGA 2OFWA 4IRUB 2O3TA 3QWAA 3BJIC 4P93A 4YJGA 3ZI4A 3ZGZA 2NX2A 1B93A 2B7LA 2I3ZA 2QU7A 4QD3A 2WABA 3V2UA 2HYDA 3A1TA 1PVDA 1JTFA 3M6MD 4MRRA 3M9MB 1NOKA 1Y6QA 3REQB 2D8AA 4AP5A 4D9IA 4RB3C 1USIA 3MFYA 3I4LA 5B2FA 4RELA 5SYNA 1I1LA 1BE1A 3EEQA 3IUYA 2YH2A 1FB5A 4M7PA 1DIGA 1O8BA 4EECA 2C1EA 2F4VB 4GLFA 2H1VA 4MPTA 2QUKA 3K53A 1PJQA 4QWDA 4C7OB 2VYVD 3ZWWA 1J8DA 2W9BB 2ZBGA 3OPQA 1TX4B 2QQ0A 2Q29A 4J76A 3T0FA 5KWEA 1UWCA 1XNJA 3P9YA 2WTUA 3PS9A 2QX9A 1B8VA 3WADA 3WGJA 4EPXA 3PGLA 4M46A 3G5UA 1ORDA 3PQ4A 2QN1A 5HA5A 3DKVA 3FLBA 3X44A 2CLDX 1E3QA 1W87A 4YIHA 3IA7A 2C00A 1EFDN 3DLIA 3K5PA 3SNKA 1TO6A 1WSBA 1Z73A 4N5IX 4FEGA 5KNBA 4O33A 1WU8A 3WQQA 3ILXA 4NAVA 3JATA 1QTIA 2XMDA 3HYSA 1REQB 4JKIA 5CT8A 2BRUC 5JTTA 2UXBB 1J56A 2WAXA 3UAOA 5ADWA 2Q7OE 3RTEA 4P98A 4BBSG 1HYBA 1HL7A 2BMWA 2BHRA 2BONA 3I34X 3PX3A 2G9UA 4K87A 1X39A 3I9LA 2OE2A 4QA9A 4OJMX 4D8UA 4DT1B 3EGEA 2WQ6A 1Q0UA 3HH8A 4J0JA 3IHWA 3EFHA 4K0RA 4OGKA 4UUAA 4JI6H 1PZXA 1NOIA 1UDXA 1W8DA 2AN5A 1CQXA 2QVYX 1PR1A 3KVYA 2N1BA 4MYDA 4N8EA 1MOSA 4PY2A 3G2NA 5TPWB 1CR6A 2FEAA 4CF7A 3OF3A 4IUCS 1A4UA 5A4FS 3N58A 4EOGA 1L0BA 2DR0A 4PBCA 1HSZA 4HDRB 4IZIA 1ILWA 1ZP6A 1XJQA 1ZRMA 4RADA 4PZCA 4RK7A 2YXEA 3FJOA 3KT6A 4PEVA 3HNRA 1MIOA 1PWHA 1GZ6A 3CEPB 1EGHA 1VP3A 1Y8QB 1MEOA 2VHUA 1XT6A 3D0RA 4QDTA 3N41B 3PR4A 2FR8A 3IXQA 3JQ8A 4CQLA 1JSRA 1Q92A 2XF2A 3G3EA 4G97A 1MT3A 5DK6A 1EJ2A 3HCRA 4IP0A 2OUKA 1UOOA 1QV6A 1H9CA 5KWVA 2JGMA 2PUJA 1XEXB 4IH9A 4OL9A 2J4DA 3WI7A 3KVNA 2IOFA 1P1KA 4Y9SA 5FF9A 3FTFA 1HDYA 3KTAB 3ANYB 2FPPB 4B7AA 4R8LA 5BSHA 1MQ8B 2UDPA 1RRPA 2FX2A 1D9XA 1XZKA 1T5SA 3GEBA 2VN8A 3NV7A 2FP3A 3FDZA 5LOVB 1HNXH 5FJJA 1MNQA 1UFQA 3W06A 4GKKB 4CRWB 2MSDB 3DF9A 4HRXA 4MW7A 4N03A 2I8AA 5ULLA 2GO7A 4Y2HA 4A3DG 1EFVB 2CJWB 2EJUA 1ODSA 5FUXA 3G0HA 4JX9A 2OBXA 1GCGA 3AKCA 1RVDA 1KDPA 4C9BA 1WL8A 3NYWA 4M1SA 4DQUA 4PAGA 3H5AA 2EAUA 2Y05A 3MAJA 1T0IA 2GLXA 1H0SA 3RG8A 2GN9A 2JLAA 3WV4A 1DQRA 1UBOS 2VAMA 4G26A 2II6A 5DH9A 3I05A 1OB5A 5HZKA 4OLFA 4G4JA 2QUJA 4L8FA 1OKKA 1Y1KE 3ZEAA 1I50A 2REXB 4FHCA 2ZIAA 1EUDB 4QWBA 2LKDA 2X3YA 5TT0A 3TIVA 1D2HA 6LDHA 3MJ4A 3GA0A 1OU4A 4TRJA 4DS3A 2VA2A 5ES4B 1BFUA 2Q5HA 5D1HA 1YBMA 2H2AA 2I6GA 4HNSA 2ZR0A 3CH4B 5BV0A 3RTDA 4BMSA 3GRFA 3WSTA 1PFGA 5DXJA 3O3MB 5FH9A 2JKVA 4QWAA 4R68A 1TKBA 2FUG1 2IUSA 3ND7A 1T0PA 4C6TA 5E8JA 4EMBA 1M76A 3P71T 2H8KA 4KMRA 3UAZA 4DA6A 1MPTA 3UV7A 1N0WA 1SBQA 1VBFA 2FMIA 2VPTA 4JP5A 5ICEA 3RAXA 4M0EA 5JTUA 4FLEA 4GM1A 4Q4JA 1KTAA 4ZEOA 1JAHA 1M33A 4NVRA 5FOUA 3GJRA 4IO0A 2OHGA 2NSYA 5C37A 4M0MA 2H1SA 1FJGH 2XTJA 3SLKA 4UBNA 1C30A 3UWOA 4XWKA 6YASA 5LQDA 1K1QA 4EW1A 1FJGB 3LQQA 2E9SA 2IYPA 2E2HA 3QVTA 3G1WA 4XD7D 3UK1A 3COVA 3VPGA 3BEOA 3A70A 2G5PA 2G40A 2HA7A 3COSA 1H6DA 1LKZA 4HAIA 4AJJA 3ZCTA 1QG4A 1CIJA 4D9FA 5JC1A 1PD0A 2QG9A 4D56A 2PLFA 1AIPA 1NJGA 2H1HA 2C7QA 2W6JD 3OZWA 3KHHA 2QV0A 5HFJA 5F1KA 4DC9A 3PLAE 4LWPA 2R97A 1SU6A 4KYUA 4N1AA 2VBCA 3PQ2A 1A27A 1KAGA 2AK3A 4PW0A 3E9YA 1B0AA 5CVTA 3D4PA 2H3EA 3GLFB 3ZDQA 2YS6A 3EAQA 4N48A 1A1SA 1EI9A 1TK9A 1F60A 1MXFA 1Y63A 3EA4A 3HCDA 3II6X 2HU2A 3TZKA 3IVXA 1L2TA 4HH0A 4KQIA 3FROA 4ICIA 4ETNA 2OG2A 4LDZA 5G0VA 3RYIA 3S5UA 1CR4A 2DUUA 3TBFA 2JZOA 2V0CA 4OXXA 1FDRA 3VJMA 1DCTA 2H1OA 2XUDA 4JAVC 3TLYA 5ESRA 4RLSA 4R81A 5L7TA 4M60A 3P9NA 4IM7A 1E79D 5DGBA 2QDKA 5AOCA 5KG1A 3AVXA 5EIAA 2X42A 3K0FB 5K6RA 3UH0A 3WFJA 1XEWY 3IPLA 4YPVA 4MLZA 3LHIA 4O82A 4BXOB 3N5CA 1MR3F 1UBNA 3ZE6A 3ETCA 3T5JA 3EQ7A 5BWUA 4Q4AA 1W9MA 4MV5A 1DTSA 3AF5A 4QTTB 5IEBA 2O2XA 4UTXA 1TUEA 3VU1A 4F06A 5K8VA 2D7CA 1GO3E 1GXSA 4CE5A 1T0JB 1WV0A 2QUAA 4LF6H 3FTDA 3Q98A 1NU6A 3BHIA 3CEHA 3IXMA 4MHSA 3QVGA 2FSVA 3OPYI 5DGHA 1PE0A 3E7FA 1NE2A 4JUIA 1XZ8A 2H5JA 4PHFA 4LF6B 5FEUA 4W9MC 1IB6A 3BSFA 4Y8VB 2JLUA 4QPJC 3QFFA 5BQPA 3DJFA 1YACA 4Y2UA 1LFAA 5K0BA 3AVTA 1J9ZA 1Q16A 4DV4B 2QYZA 1PHPA 3TIXB 2XQGA 3ZWPA 1APBA 5D51S 1QVRA 4KDFA 5FNZA 2FFQA 2BEVA 2PDAA 3AVOA 4UCUA 1MDFA 3CCBA 3TKYA 3RYCA 2HFKA 4C21A 3QNMA 1SBYA 3G6KA 1Z2EA 1EDZA 2EZ4A 3FN4A 3IVAA 4KR6A 2B9VA 1T9ZA 3BCSA 4GU5A 2X5KO 3PHCA 1G9SA 1SU4A 1XVLA 3DHYA 3LIPA 5EIBD 5AW9A 3VYVA 3S24A 3EWIA 2ZE5A 1XMOB 5I5EA 1S96A 5D3MA 3OWOA 3JW8A 3HUTA 3L4SO 4B6OA 4KXWA 5HIIA 5KKNB 4GGOA 3KLOA 2AFIA 1M2HA 1WW8A 3DWEX 1R6TA 2C58A 3EXHC 4NOMA 4PPQA 4WXRA 3VR5H 2DSTA 1YQ9A 4I6JA 5EE3A 1KO5A 2M1ZA 2BBSA 2O4UX 3GFPA 4MW2A 4Q7MB 3WBJA 5DLFA 3C5VA 1IVYA 3SLRA 1R0ZA 4I50A 1E6KA 1RZVA 4S0XA 3WGYA 4EG3A 1R37A 2CXSA 4DVGA 3CB2A 3PNKA 4NIMA 5I51A 2ZYRA 3SGLA 5KDOA 2HPZA 4BBRG 1I4LD 1NJ2A 2AIRA 2ABJA 2YFYA 3FWHA 4R01A 5AWFC 3RVRA 5AVXA 2GM5A 4MP6A 3WAJA 4CQMA 4TLBA 2P9GA 2JGAA 3H9UA 4BE4A 3W1GA 1QC5B 4DY4A 2ZYVX 4TT3D 4QHSA 2VXCA 1DE0A 3GJ6A 4W1RA 5TMEA 3W5HA 3W5BA 1D4OA 3GLQA 4D4IA 3TOZA 4AAYA 2ONZA 1BHJA 4MV8A 2A9PA 3DBOB 1O96B 4K9DA 4C22A 2GEBA 1J8YF 2LDBA 1BA2A 1CDZA 1G5HA 4GC9A 4Q9LA 1P31A 3IE2A 5K0ZA 5BWTA 4Q3KA 2WB1E 3G7NA 3NANA 5AM2A 4DR2B 4RVGA 5CVCA 2R87A 5KSWB 1YJCA 2R2AA 1T0BA 4NCAA 1Z34A 1KZ1A 2CEKA 2ZYDA 2OPBA 2QX7A 5EC8A 2Z2XA 5GY7A 3VOTA 4X6YA 3GLFE 1NFFA 3F6SA 2G0AA 1Z83A 3KT3A 2JFHA 2B99A 3AFHA 1Y4AE 2W00A 4G25A 1RCUA 2ZRAA 4C7KA 2WZDA 2YHAA 4YI3A 3OCJA 4Q4DA 4J9NA 1VXOA 2OLJA 2ZWMA 3ML1A 3OP1A 3D31A 4KK3A 3DFKA 4NE9A 3Q8MA 4U1RA 4EHLA 2AEJA 2I65A 3K4QA 4FPXA 3CTPA 1N0IA 1N9GB 1PEAA 2HHAA 1ZM9A 3OX4A 3IKTA 1ONNA 3CMCO 4BP8A 4UCOA 1AHIA 3SZRA 2F3TA 4OQNA 3SXUB 1A3GA 2O8NA 3AERA 2DJ5A 3QY0A 2O2HA 4CHTA 1BWQA 1XCGB 4LI0A 2AYZA 3EZ6A 1N32B 2OHFA 4IUYA 4Q02A 5CHYA 3SICE 3DZKA 3HMKA 3Q9LA 2X13A 3FD8A 3RRZA 2HWYA 4EW3A 3ZW8A 1P2GA 1OASA 2JHCA 3GRCA 2GK7A 4FOOA 4ECTA 5AM3A 4QM7A 1U2PA 2ZRDA 1WRBA 1HNZH 2QRHA 2W2OA 3OTHA 3PXAA 4ZO9A 1RLOA 2YJ3A 1YE5A 2P6RA 1UKZA 2VBFA 2JGFA 1VLHA 3UV3A 1TWHA 5A1TA 4O3QA 3WB9A 2DAPA 2CNUA 1JFFA 3P9SA 4FEYA 1XXLA 1FVXA 2WI8A 3GAAA 4R1OA 4FFNA 4XAQA 1PWZA 3IMCA 3I01M 4KLZA 1JDEA 2X4GA 3HRIA 5DXFA 3VC1A 1KYYA 3CPHA 2JBAB 4BFSA 2IXGA 4YMHA 3WO1A 5DQHA 3F1LA 4H4CA 1U3CA 1BFKA 4JOSA 2ABWA 1Y9AA 3C7TA 2RGDA 1RD4A 2O52A 2W98A 3EXFB 3OUZA 1Z2PX 4HDCA 2K5UA 4M86A 5AJVB 3HSYA 2JEYA 3UQ8A 4R51A 1U7DA 5JNLA 1A8HA 1V5IA 3QYJA 2AKAB 4JJIA 2FG7C 4MEJA 3DPSA 4RVOA 5DSTA 2M9MA 4CF5A 1Z82A 3DBLA 4NR0A 2EC5A 3IOBA 3TD9A 1OPXA 2WG2A 1FX1A 2VHJA 3ESCA 5TQ2B 3TXXA 3ER9A 1QFZA 5KQPA 4KI7A 4LG1A 3PKJA 1UQRA 1BWSA 4G23A 4JGGA 5DM60 4TMYA 2NU8B 1T36B 1N3IA 1U0EA 1KBQA 1MKYA 1T3HA 2JIDA 3I6YA 1RQLA 2A88A 3OT5A 4JLJA 4NQZA 4BYGA 4UNPA 2QD2A 4MI1A 4R2HA 1P1BA 4GDFA 3PFCA 1T9HA 4MB6A 4PN7A 1G5FA 2HN9A 1VB3A 2JK1A 3AI2A 1UC9A 1QVWA 2YUIA 4BLTA 3HZHA 2BFPA 4JL8A 1QH1B 3B70A 3QMVA 3BWBA 4H6VA 2OZLB 3GG9A 3LUKA 3V5NA 3DAOA 1GRQA 2VSQA 1J39A 3A4LA 3HY3A 3L5KA 4PQRA 5L51A 3R5HA 1A4RA 1OX4B 3D6JA 4YJ3A 5IRCD 3OTIA 1XU4A 5K9ZA 1BMDA 4DCMA 3QVJA 1RADA 1WBDA 5AJYA 4J0GA 2G9ZA 3D3WA 3OEYA 2FW8A 3KTMA 3D0KA 2QP3A 3MA0A 1II8B 4WINA 4H3VA 1MO5A 3LXXA 2H2GA 2VYFA 3GHHA 3Q3EA 4IDHA 4O4HF 4TZ6A 2IUEA 4O7VA 1YS4A 4L6CA 4J9SA 3Q3IA 2COGA 1J2YA 3A3NA 4W1QA 5EP2A 4ZMRA 4K28A 2G8LA 4QU0A 3N8IA 1Y33E 2ODWA 1CU1A 3P2IA 4IDQA 4XFJA 4Y6OA 1BD3A 4D4MA 4D9GA 5IVDA 4CCYB 4UCQA 2IZ6A 4JYCA 1FPQA 3M9LA 4QBFA 4E5KA 4MVCA 5JBNA 4UCTA 1OB2A 4CJXA 2OHHA 3F9IA 1JP7A 2F9FA 4L4YA 5EJ2A 4BY9E 4UVHA 1QCZA 1JIVA 1B8OA 5AP9A 5FUYA 1LZKA 2FEWB 1HNNA 2ZPTX 6CHYA 2ZWIA 1LPOA 3CIFA 4LJ7A 4LRUA 1C4WA 2YRXA 4JU8A 2RJOA 3Q8PB 1LU9A 2B8WA 4C6HA 4OAOA 1SFRA 3P2JA 3BWDD 4P4SA 2JEZA 4A3IG 2KPOA 2ZJ4A 4JI3H 3N44B 1GUBA 1I32A 1R0YA 4RS4A 4BX9A 3PC6A 3H05A 2JIMA 4GZ3A 4DBZA 8OHMA 4LH6A 2WPNA 2XECA 2WWXA 2UVWA 4KXYA 4YMSA 2IELA 1HXHA 3FWYA 4FYKA 5LBIA 5T4FA 4X63A 5EXTA 1GPUA 4G65A 2W6NA 3SFZA 1BS2A 3SY8A 5IH3A 4BLWA 4YRSA 1CRWG 2SNIE 1EP3B 2VRNA 3OEHD 4B8ZA 1J90A 2J5KA 2M98A 4BZPA 4KXXA 1E3WB 1ZIOA 3JAWA 1KDTA 3EW7A 2WHYA 5AW0A 3OT1A 3VR6H 1ZOSA 1NV8A 3QTBA 1RJGA 3GPBA 5LOVF 1MG0A 1SELA 2AQIA 2AZMA 4IR9A 1JZTA 1M74A 1R9NA 2BZSA 3PGVA 4MQBA 4RZXA 3DDZX 4JV1A 5DSXA 5FLXA 1TWAA 3L0BA 3NHAA 3L7LA 1YOBA 3H42B 1PNTA 4DDHA 2F1RA 3BBLA 1QR2A 2C5AA 1MQ9A 3WRYC 1O77A 5TF4A 2D1TA 3FKJA 3I6QA 2ZR8A 3EWNA 4LRWA 4PTLA 3VA7A 2NAFA 2OCKA 3ES9A 3I2IA 4U39A 1D2AA 3NOQA 3VDNB 4ZYWA 1ZC4A 1L4MA 3L3BA 2OFOA 5KS8A 1N32H 1UBKS 3EZ2A 8ATCA 1ZRHA 1M10A 4B2YA 2C94A 2J30A 1RLTA 3RTBA 2WUGA 2OXCA 1L4UA 3D8BA 2PGLA 4NNPA 4S2UA 4BX0A 1Z7WA 2QAGA 4JHLA 4NK4A 3WGUA 4HB0A 1F3OA 2ZLBA 4F9GA 2J3KA 4PGAA 1NUAA 4MGZR 4M8NE 4AYXA 1QVZA 1OT5A 3KKLA 3ZXYA 3B13B 5JVDA 5DGCA 1RYFA 4GPZA 3PCXA 4HTFB 3GTKA 2OC4A 3FWNA 2Y67A 2IYVA 1XNRB 1P8LA 3WIEA 4TMZA 1F2TA 4X1KB 4KC0A 4A3MG 1UBHS 5C3UA 2WU0A 4QGGA 3KJXA 1B4DA 5F77A 2YVLA 2DLNA 1BXGB 1CJSA 2F3PA 3KDSE 4LI3X 5JS7A 4DR4B 3KXIA 2WG1A 4O3NA 5C1PA 1NBOA 3DEAA 3EXIA 5GJVC 2PH3A 5FDFA 3RFCA 3KE8A 2XCUA 1CQIA 3AKYA 3OM1A 2KLHA 4K26A 1I1NA 4RHYA 2YXDA 3WGLA 4KYIB 2CV1A 1C9DB 1ES9A 2FW7A 2CXQA 3CW2A 3WK8A 1SXHA 5MN5A 1JEAA 1PGQA 2NZJA 4OQ4A 1E7MA 1IZ8A 3E7WA 1NYTA 1JQBA 3BFJA 1H5NA 1N2CB 1ZU4A 4O4JB 2XSZD 2YHBA 2P9FA 5E4YA 4M88A 5FR1A 2EZ8A 1Z7GA 2SECE 2B9EA 5A0FA 3PHGA 4MX8A 5JADA 1I14A 4GX0A 3MWLA 2ISSD 1OWMA 2OEPA 1K83A 3AFNA 3AESA 1QG6A 5K6AA 2O03A 2HCTA 1QGYA 3EFOA 2Z9DA 4IEEA 3WOVA 2JA1A 2WHPB 3GIIA 1VHWA 3EDOA 2G5TA 4K6OA 1NQXA 1W47A 4Y6GB 4DZTA 3U0GA 3V42A 5BUSA 5C8ZA 1SHLA 1T26A 3W4KA 5A5GA 5I4IA 1PBNA 4N7JA 2NP7A 1QFMA 2WM9B 2IFTA 2C5GA 2GOYA 3QVUA 1C8BA 2J33A 5FO1A 3QJGA 1H85A 1W8IA 4RHFA 3EUWA 3TD6A 4ZDKA 1ISIA 2CGEA 5GMOA 1L7RA 1DTWB 3GJ3A 1N2XA 3IODA 5J4KA 3C3PA 3MBIA 2N3ZA 3M33A 3PQ6A 4MLDA 1ZONA 2UVDA 4GG1A 4QLAA 3T7IA 4F3KA 2XRMA 2IBSA 4KN6A 1XRQA 4NF2A 2XAUA 2P11A 4TTRA 5D00A 3SSNA 3U4AA 5HXAA 3K70C 1Y3AA 4ABYA 3FTPA 1OREA 1TNDA 3QYFA 4JA0A 2O5VA 1W1WA 1W1IA 2W5UA 3DTVB 3H87A 3ZV7A 1LDYA 1EWTA 5AW3A 3C6YA 2I91A 3KSMA 3UJPA 1ZDMA 2IEBA 1TIBA 3V4LA 2CL6X 4LJ5A 3FZYA 2WT9A 3O94A 4CCSA 4EEXA 1EFRA 5HZMA 4PYOA 2ZIFA 5DYIA 3CKYA 5LUAA 3R09A 5A4KA 3TL2A 3JSXA 2H16A 4CV0A 4O4IF 1M72A 4X20A 3L2OB 2D0DA 4RK0A 4AP6A 4BL5A 5IM4A 1YNOA 1E2QA 3HCFA 3D6NB 4YJ2B 4PYQA 4JUBA 3ILVA 4OUKX 1WA5A 4KVZA 4MIOA 3NT4A 2WDZA 4BCBA 2Y6UA 3ZGXA 4KUEA 4O4HA 2OO5A 2E87A 1ETHA 2Q3LA 3EVEA 3H3JA 1S03G 3O2JA 4H1HA 3EXFA 3FOEC 1TK2A 4TQAA 2CUKA 3ZOZA 4C76A 1CY7A 1SBTA 1JU9A 4JROA 4O83A 3BQ0A 1ZA2A 3Q72A 2V4ZA 1E3WA 4P3YA 2OHXA 5E6UB 5IHPA 4U8GA 2R5WA 3ZVRA 4YMUA 4KHPB 2I6FA 5AHKA 2OT3B 4U0KA 4GNRA 5GZ6A 3ZKWB 3PGMA 1WR2A 2C2HA 5A2QW 1OTYA 2I4RA 1ZKMA 2PKCA 2O9JA 2XE8A 4K05A 4JC4A 5KFCA 1ET0A 4J9MA 5AXDA 1R12A 2XDYA 1DGQA 3CVXA 1O03A 3CZQA 4HJRA 4HJXA 3Q3VA 4I8XA 1EXDA 3RS4A 2F2TA 2WJZB 4LMPA 1YCHA 1JQAA 3RSGA 1T29A 1BYIA 1S7GA 1XDUA 2XMCA 3MQ2A 2OKGA 4ECEA 4F5YA 4HATA 4TTAA 2VATA 4RWZA 4U9HS 1UUFA 1VE9A 5F7XA 1C0IA 1NUPA 1TT5B 3GLHB 1XWFA 3NCTA 1LJLA 2RG1A 3BIWA 4LAFA 1OIVA 2YY5A 3KQHA 3LD9A 1AX9A 1KI8A 1Z4IA 2C9OA 4U9IS 1LBSA 4HK4A 5IKPA 3PTAA 1J1ZA 1MPXA 1XRLA 3AM4A 5JZVA 5AW6A 1XKTA 1GZHB 1Q7GA 1A88A 5I5YA 1A2OA 1V3VA 3C1AA 3QTLA 3UJBA 4KR2A 4J9LA 1SUCA 1FP1D 1WMBA 2AR9A 3CH7A 1DWOA 2BM1A 2M1XA 2YVKA 2G1AA 3HU3A 1NBAA 4YT5A 3MGGA 4I9FA 1BTOA 3QI2A 1YZTA 1FIUA 1H2BA 3KTDA 2PR2A 2ZT6A 2W4MA 4B3DA 2PRKA 3OFND 4RQAA 3NBAA 1OTXA 1GGKA 4D4JA 2Q45A 3P9CA 1JXLA 2PMEA 1E4FT 4EPWA 3NCHA 2Q4RA 3OQBA 4AJ4A 2XT0A 3A6KA 2M6SA 1ZH6A 1UK8A 4IY1A 4ZD6A 4KKXB 1UJ6A 5A5DA 4DR7B 3DTYA 2FSGA 4J07A 4QRHA 3RM3A 4MHTA 4MQEA 4BPRA 5KNBH 1XN1A 3GUUA 4EFDA 4PZAA 4RY8A 2IHUA 3KXDA 4JYAB 4J0IA 4PQFA 5F52A 2H1WA 4AS2A 4JMLA 1GSHA 1VE3A 4F97A 4UFOA 3AIMA 4HGYA 4QHTA 2C2YA 3ZY2A 5EIOA 2OCDA 4KDCA 1BJRE 1OLSB 1XRSB 4YJ3F 2FMAA 3ETDA 4YGYA 4R4JA 4FQ7A 4MQ4A 2JHAA 4Q4AB 4ZAFA 2J6CA 3RS2A 3WWZA 1WDLA 4DUGD 2CT8A 4OATA 1TA8A 2Z95A 1ZSYA 3AB3A 2IUUA 2O14A 3O83A 1Q2XA 3WHKA 4ZCPA 5D3MB 3B2QA 2VZ0A 2AYYA 4WXMA 4D9KA 3WX0A 1D09A 4QPCA 1H0RA 2NZYA 2E4UA 3WNVA 5JAHA 2CWWA 4RB1A 3NT2A 3SDZA 2ID7A 3NT5A 2Z6UA 4TYYA 3KOUA 3LQYA 5FI5A 5KUTA 5JQWA 3GV7B 4QUKA 5K0JA 1LSUA 2CMGA 4U7TB 3GTLA 1HTBA 3USCS 3W4JA 2B0CA 4ZZIA 3JAKA 3GUVA 4MA4A 2WM3A 1L5HB 1BFDA 3MR2A 4JUDX 2RGUA 3EB9A 4WFIA 4YO8A 1VZ3A 1QHHB 4CEJA 1C5KA 3E05A 3VKHA 5D6OA 4LMYA 4V0LA 1OV4A 1RHKA 1W94A 2FSFA 3AEUB 4HVLA 3ED1A 3ZCXA 4DAEA 3RFXA 1IULA 2I7DA 3E2MA 3VOAA 3L06A 1L5GB 1OFTA 5G1NA 2RHCA 4O4IB 4CLHA 4DQ0A 2H29A 4G9GA 2QMZA 3IT3A 2DTDA 1PWYE 2YDYA 5LYJF 5A0VA 4F21A 4R3UC 2D2XA 1JU4A 1V48A 1YA8A 2HK9A 2LVBA 3F47A 3ZQJA 1Y7HA 3WDLA 1M1YB 3BA6A 1ZQ1A 3FETA 4PIPA 2HZ7A 3VU9A 4N8SA 4CMEA 3QXCA 3H3VH 1HNZB 2JH9A 4I99A 3TVTA 1TVCA 2ZB8A 2IEAA 4MK4A 1U04A 4RSMA 2W6ZA 1LBQA 2B3DA 5JO9A 3EPLA 1FSFA 5IUKC 2YYZA 3V6MA 1SA0B 3OCWA 4E4TA 2UXCH 5CYOA 2VEDA 3F71A 1QCCA 2YWRA 1EGMB 4Q4JB 5KCZA 1D9ZA 1SURA 1TECE 2NUAA 3LLCA 4Q21A 2BFMA 5HF9A 5KTSA 3HL0A 1SCBA 2DCUA 4JX8A 1TEVA 3KOMA 4TMFA 2DX7A 4HQFA 4QU5A 4ZTUB 4W9RA 3ZHBA 3NWOA 5CDSA 3RYHA 3IAFA 4F3CA 5LUBA 3DBRA 3IEKA 3HJFA 1GGFA 5A6SB 1R0RE 1Y8CA 4GZLA 1YK1A 2WYVA 3LBAA 5HIJA 2GASA 4DA8A 1CJUC 1DAPA 1W93A 4JUAA 3HXOA 5EXSA 3KUXA 2GCOB 5DNWA 3X2FA 4MKGA 3LP8A 5JROA 4LDPA 1XPJA 4P35A 1Y3CE 2JCGA 1P81A 1Q22A 2P9ZA 3CU5A 2FSUA 3SLGA 5JVLA 2DY1A 3PX7A 1XZIA 2CJFA 2OWDA 3K05A 5AM0A 4NXNH 2FCAA 1Y42X 2ZBUA 4MHOA 2VK2A 4LS3A 1H6CA 3CPJB 1TA9A 4OA5A 1RU3A 4TWAA 4XUCA 4UUNA 4EB0A 3KQKA 3ASVA 2AN3A 3S2IA 4BP9A 4OK5A 5DX8A 4UATA 1D4AA 2PSEA 3I53A 4WKBA 2ZIXA 3EIWA 2AI1A 3DBIA 2GJKA 2QU8A 2LV8A 2BFFA 1JHDA 1XA0A 4BV8A 2R5NA 2SCUB 2VYQA 1FUEA 5SZJA 2CXOA 1X2EA 2I78A 3C7CB 1LB1B 3MUNA 3FWPA 3G2IA 3HCAA 1TVMA 1AGNA 2OCAA 5ICSA 1Y4DE 1A95A 1ZUHA 1QHHA 2WD7A 4J1TC 3OPXA 2ASLA 3Q8LA 1NYLA 4FJ2A 5C35A 1GPH1 2GWHA 5P8WA 4NZOA 1L5LA 5J43A 2OAP1 4FINA 4IBOA 1OF1A 3FOBA 1S3GA 1F4LA 3VSBA 1QYRA 4OQXA 4DIFA 4YLYA 5INTA 4RGVA 1SKYB 4APMA 4YB8B 2EJ3A 1KK1A 2AJTA 3WWJA 2YOFA 3L7DA 3N3AC 4HMQA 4AY6A 2RGYA 4ENQA 4JV0A 3A9WA 2WHRA 4G4IA 4J9VA 4UASA 3C39A 1ENPA 3W3AD 4EUKA 4RUAA 4G85A 5L7YA 2MCFA 4P81A 1TADA 1YBHA 1P75A 1CY0A 3MAAC 2O0KA 4PSAA 1OYVA 2NSLA 3D8RA 3EIQA 1U63A 1L2ZA 4J43A 5K0SA 3CUVA 1GR1A 3LJKA 2VAXA 3MGBA 3T1TA 1F2DA 2E7ZA 1KEEA 4TM5A 4F2WA 4PX5A 1Y6RA 3KZXA 5H4HA 3ON5A 4N40A 5IT0A 5EINA 3BX1A 2Q41A 3ZC3A 3VX4A 3CCFA 4QUGA 5EJ5A 3ZVMA 5DLDA 2PT9A 1POWA 4NONA 4E31A 1E4OA 3QWIA 4H1WA 3FI9A 4ZHQA 1Z08A 4P3XA 2ASEA 2PFSA 3L41A 5FPRA 4L2IA 4BLPA 4O02B 3AKZA 3P2MA 4RENA 1I5EA 2WFAA 3PR1A 3BE5A 3IPYA 5BMVB 4TTQA 4GPIB 1MW8X 4E2YA 1JECA 1EUZA 4FILA 1TE2A 3E9DA 2W6ID 2UZ1B 3OLZA 1JU3A 2XCIA 2YZ7A 3F8SA 5JQGF 2VR1A 1ZHHA 3HJBA 4HG2A 5KG3A 1PDOA 1QIKA 2RONA 3C5HA 3IE1A 1SVUA 1P1FA 5DO9A 3EAGA 4M1TA 2ZJ8A 3DHVA 3EFBA 4L28A 4NJMB 2NPFA 3L4BC 1JQLB 1VIAA 1RYRA 2A14A 4B7ZA 1XZNA 8AT1A 4HGZA 1DAFA 4AY2A 2Q0SA 4FN4A 1WH2A 4A2AA 3C4VA 1QYVA 1SBIA 5EKDA 4ZAYA 1VCOA 3ACDA 3RCBA 3WZMA 4F7DA 5CDTA 3AZQA 1IQUA 1IHOA 2WP8J 3AP1A 2HW8A 3OCYA 2DQKA 4EDHA 3R9XB 4LQDA 4L85A 5FL7D 1EU1A 2HB6A 2V98A 5M7EA 1Z5OA 3IDAA 2BCEA 1F8FA 3OTGA 2O57A 2P4SA 3W2FA 3JV7A 4MO2A 1T0HB 5EVCA 1LNZA 2WUEA 3BBPA 3EGDA 4KODA 4UBKA 1WZEA 3TXYA 4OHXA 1Z0UA 1H6AA 3G7UA 4LE0A 4WDRA 2XYVA 4CM7A 2R93A 2E37A 3GVXA 4YMVA 2PANA 1Z28A 2YNMD 2JEJA 3RV3A 2RF4A 1RPAA 4G86A 4PPNA 4BMVA 2QS9A 3D9QX 3HVHA 3FGPA 3KJGA 1LFDB 3AF6A 5C7OO 4DHWA 3RAGA 2FGKA 3BJZA 3M1IA 4UM9D 4US2R 2G07A 2RARA 4IFEA 2CNOA 2FTKE 3PJDA 3SE0A 2C0QA 2CHFA 1XBTA 4UOQA 5E4TA 4WHMA 3V33A 4NMLA 5AQ1A 5IJZA 4YHHB 2VUMG 3AR5A 3UV6A 3E4DA 1QU2A 3V8VA 1KJIA 2A0YA 4NV3A 4X1OA 1T8SA 1R5NA 4AMZA 2WZQA 5K03A 1N6KA 1JV2B 2C03A 1Q44A 4IXDA 2F6RA 1UIRA 3MCVA 1ZAUA 1UEIA 4MGKR 4QOSA 1JKJA 2OVFA 5ALUA 4LKRA 3TZCA 3WRVA 1FP4B 1RKBA 3TWOA 2XEDA 2EWVA 1S8FA 2WJYA 3BSSA 1TCBA 1W9HA 3JD0A 2FPGB 4FYHA 3ZHYA 2D5AA 1ZM3A 3ROKA 1EWKA 5CXQA 3T52A 1GFSA 4MYTA 5F5NA 2NVXA 3CKMA 4IV0A 5IBCA 4NYEA 2ZRBA 4MULA 3PE4A 3ZLBA 3CVYA 5HILA 1I5OA 1X74A 1LVUA 2X19A 2C5BA 3EVCA 3U3OA 4R8KA 1LLCA 2QG4A 4G5QA 1QAMA 1CCWA 4EY3A 2A5FA 3C8ZA 3F5SA 4OBXA 3QXJA 4ECWA 2ZIVB 4CT0A 2HWWA 4D45A 4B3SB 3R7FA 3CCCA 1QO7A 3DD1A 2AT1A 5LDHA 3LNTA 4B3SH 2GJAA 4QPZA 4UHKA 3IPRA 4BMDA 2Q28A 4MV7A 3GRRA 3UNXA 2BHSA 1Q1EA 2XUJA 1EUCB 3EGVA 2JD0A 2QUZA 2QI9C 2VJOA 3CKKA 5H5JA 1IOVA 5HOEA 3DAGA 1G21E 2JAUA 4BPBA 4BU0A 5BSFA 2REQA 2JIBA 1EKFA 1T4MA 1XTPA 2WUDA 3VNQA 4KPUB 5MN4A 2PNFA 3A6DA 1FU7A 4R31A 3JQGB 5AYVA 1W48A 1ICEA 1G7TA 3OCCA 4XYBA 1OLSA 1KVQA 2PVCA 3GRKA 3PUXA 1N2SA 1L7MA 1RYYA 1X7YB 2IF0A 3ENWA 4J0QA 4A26A 5BT8A 5KU7A 5I9LA 3EXIB 2FR8C 4JZKA 1JEQA 4KUHA 5THQA 1EXWA 5E6SA 1P61B 3S1AB 2YJTD 5HM6A 2XBUA 1KAMA 1DKOA 1O1YA 2Q3MA 3LC7O 3DCNA 3Q7QA 4Y98A 1QMGA 2ZZKA 1HSOA 2PKYX 3T1YB 3H11A 4Q4HA 2IYAA 3FRHA 5JBIA 1PUIA 4CLOB 1E79A 1QH0A 4YUAA 5A9SA 1CY2A 1TCCA 2QJWA 3CW9A 4X84A 3TIIA 2WJVA 4HQLA 2JCVA 1JHPA 5H1YA 1TW2A 4B6RA 4BNVA 4C29A 4YCSA 1JEJA 4F93B 4YUWA 1NVMB 4GYKA 3VMMA 2EDCA 2ZK7A 1S4QA 1TUGA 5JYCA 3GIKA 1MDBA 4YAWA 4EEYA 2X14A 4YV7A 4NAUA 4LE1A 5KQSA 2R1TB 1RJEA 4FJ0A 1PD1A 2H85A 2WYWA 4TWBA 4CMAA 1NNEA 1INLA 3DKKA 2I7VA 2E85A 4MWDA 3H7AA 5TC4A 3F5QA 3WL7A 4D9JA 5EP3A 4F04A 4C0LA 1GTSA 2KWIA 1CNEA 3NOVA 4TN5A 2F59A 2BR0A 5A6VA 2E4XA 5A2GA 1JA0A 5L95A 1H2ZA 4TQRA 3FDSA 2RJ3A 1XDZA 5AJHA 3ETEA 1U9IC 3FKIG 2VTBB 4Y2TA 5KS2A 4F11A 4KO2S 3WNDA 4AKEA 3SF8B 2RAPA 3GT0A 2KM1A 3MQ4A 1K89A 1GO2A 4K3VA 1SOMA 3B38A 2PX2A 3T3IA 2CLLB 5BQOA 2IPNA 3KQLA 3DTFA 1RQGA 4XLLA 1ORTA 3PDUA 4H31A 4CIWA 3WZ2A 4GI1A 5I9BA 2VT7A 3Q7SA 1TTQB 1X9NA 3F90A 1K5DA 3WK4A 3QE4A 4C4OA 1F8YA 4YCLA 3OZDA 3RJ9A 1JEDA 2GRUA 3I8SA 2ZOSA 3FNHA 3NHWA 3PPYA 3A0UA 3QX8A 2X0EA 1Y81A 1CR1A 4EFMA 4ARUA 4FSXA 1U3FA 2FEMA 3CFYA 1O97C 3G6XA 3W5VA 1Z4KA 2QPAA 1I2KA 4FSHA 2EW8A 3D4IA 4YP9A 5KOHB 5DPMA 3R75A 5CK5A 3HDTA 4FGUA 4JA2A 3UXMA 4S2EA 3A6EA 5IJWA 3U4QB 3C5EA 4G1EB 2QR5A 4EQ6A 1KSJA 4UARA 3O2QB 4WGFA 1XZQA 3H5IA 1P9OA 1Z3IX 1S1CA 4ETIA 1RBYA 3AI7A 5AKZA 3RVJA 2OGWA 3IPAA 4FWBA 3R7DA 3RGWS 4ROTA 2A0XA 3QOWA 2CL0X 1YVPA 3OLWA 2GK6A 4QEDA 5FBKA 1NLFA 4Q5IA 5HBGA 3QIVA 4UNRA 5I4CA 2OL4A 1ZAYA 3GLHE 1EFTA 4JLMA 3FR7A 3HJRA 4URHA 1A8SA 4CL0A 3JQEA 4GR9A 4MIKA 1K0UA 1SPBS 4OMFG 3QFSA 1I1MA 4BCCA 1QIDA 4BAZA 5JHHB 1S3FA 1YL6A 3H9GA 5I9NA 8LDHA 3GN1A 2YU9A 2XVXA 1HTWA 3IDZA 3L93A 2UUAH 3IEIA 1MB0A 3S2EA 3FOFC 4EHDA 3UHAA 2IYWA 4Y1GA 4Y7CA 4CMGA 2PUEA 3VPHA 5HZGA 1IOWA 5IK2A 1DBWA 1WCXA 1WP9A 1U0LA 1II8A 1XTVA 4NC9A 2V0GA 4IS3A 4MR8B 3IDFA 4CTJA 2Q2UA 5DISC 2R7LA 1YU9A 3ER6A 3ZH9B 4XQCA 1AQYA 1G20A 2GEFA 3T5CA 3H8SA 3ZLUA 4CKEA 1IBCA 1JVSA 4DQXA 4DXDA 2G04A 2RGEA 2LR0A 5DTEA 1C3XA 3C1OA 4MOWA 2K6GA 3T5AA 2Q8NA 3TAHA 1H4TA 1NNI1 1ZGZA 3NEAA 4V0ME 1SU8A 2WJIA 4N3CA 1JJVA 3UHPA 4D92A 1HFWA 5BPHA 1CE8B 1PZFA 3ENVA 2VZ9A 4CG3A 4DM4A 1V6AA 4FS2A 1CP3A 1GN8A 4WA8A 3M6LA 3HZOA 2AD1A 3GZJA 3U54A 3NHUA 3KYCA 3AR9A 1XMIA 2DHEA 1FUUA 3FPHA 3H99A 1E59A 1FNDA 4OTZA 4U7WA 5LIPA 2DXIA 1E69A 2I2CA 4Q8FA 4ZHQF 1RKXA 4E32A 4KP7A 4FCWA 4ECZA 2GHTA 4Z9AA 3BWMA 3FUXA 1J5EH 1XZJA 3FKSD 3N2KA 3OA0A 2F4VH 3HPQA 2CNWA 1ECCA 2QL6A 2WIAA 2MIIA 1YMUA 4ONEA 4XGIA 3MTDA 3RFVA 5A3RA 4Z4IA 2IWRA 1KZGB 5IANA 2LPMA 3CZAA 1H2HA 1HT2E 4IRXA 3I4CA 3IIJA 4LCEA 3RPEA 3VO9A 1ZGGA 4ND6A 4XRRA 4K6GA 4XJXA 3U7QA 4CU2A 4XYMA 4EVQA 3DZDA 2F8SA 3D6VA 3KR2A 4I9GA 1LQTA 2HLPA 3KE9A 3SEZA 3TLJA 3KEMA 5FBRB 2XYPA 4DMGA 3HYTA 4DV2H 3DBLB 3LQ1A 3JTMA 1N2JA 4HX5A 4IDOA 1ULBA 1IBLB 2J9GA 1ISPA 1OXUA 4KO3S 1P44A 2P0EA 2D54A 3CW8X 4JI2H 1QK3A 3DVRX 3JPWA 3Q6IA 3QXSA 4MKIA 4C20A 4EMUA 1RYDA 1TAHA 3PGKA 1EVYA 1QAOA 1RC0A 3SU8A 1X7WA 4ME6A 1KPHA 2OCIA 1I0IA 1ZJ6A 3JD3A 1B04A 4W5RA 3KPVA 3GDFA 1MUUA 1CQZA 4C2BA 5ICCA 4XYLA 4LK2A 1HFJA 3WDSA 3T12A 4YMIA 1GG2A 1RWNA 3OIVA 2VTEA 3N2LA 3JQ7B 2YWHA 4HWGA 3ZE2B 5FUVA 3GEHA 5B3LA 1EK0A 1NVVR 4EFKA 3NG1A 1L8LA 4ZI5A 4AJEA 4XYLB 2GBPA 3K0BA 2XWSA 1NJ8A 3CGWA 4KRFA 1Z18A 1CB0A 1JLLA 3C3WA 5DBHX 4EITA 3KEGA 3I9V6 4FB4A 2CZGA 2QTGA 2RH9B 1PNVA 2EX0A 3GIPA 1CY8A 4OXIA 1NUSA 3DYIA 1NUQA 1ZSVA 3BDIA 3HACA 1L3IA 2ZPUA 4XWOA 1Z6GA 4LHSA 4E08A 1CB7A 3RHZA 4G84A 4HEJA 3H5WA 3IDOA 3FB1A 3QV2A 2R93G 2LUOA 4TVBA 3EYYA 5KI6A 4I8DA 1TOAA 1P62B 2FLNA 1YJXA 2C95A 2FVYA 4GOJA 1CZKA 4GYJA 4HAZA 4IDBA 3CNEA 4XUDA 1U7XA 5LB4A 1PUXA 4QBTA 4DUZH 4BO8A 1N2ZA 4PXSA 2VHZA 1GTRA 2IU0A 1OU0A 2HIAA 3WLEA 3RB6A 1L1FA 3GQCA 4Q18A 4YRMA 3R3HA 1LQ2A 2GZ2A 1B6GA 3LNCA 5JG7A 2JBWA 4UXJA 2FPUA 1GUAA 5CURA 1ECLA 2VHVA 4O8ZA 3KJEA 1GG8A 4C3UA 4JIGA 3KQTA 3E8SA 3M8KA 1PK9A 1WUJS 3MS4A 4IICA 4B3TH 4XCVA 5HE9A 3RYFB 1J8QA 4NLGA 4ZI7F 1Q19A 5KX5F 1XEFA 3BEDA 1IM5A 5IYBG 4IJUA 4E7PA 4EUFA 5D3QA 1AA6A 3WMXA 3MT8A 4M6WB 5DTQA 4AM8A 1V95A 3QSYA 2W2MA 5HVNA 2CLIB 1Y7PA 2ZIZA 5FTKA 3CR7A 3Q2IA 4ISCA 3GH3A 3NPAA 3HYNA 1IM2A 2XTAA 3VSAA 4ENTA 3O93A 1DKPA 1W6UA 1J2UA 3GBPA 2XWQA 1MFPA 4QXRA 1MHTA 2F8TA 4BZQA 4XI9A 3VYRB 2P69A 2GYVA 3BXXA 1G63A 2HQOA 2ZAIA 2BBTA 3FI0A 2XDQA 3UAXA 3W7BA 4BKQA 3JQPA 4WCFC 5T5QA 1T6XA 4YRQA 4WBNB 3U3XA 2BFBA 2JS7A 3SQXA 1XZDA 3CO0S 2FHSA 3CT4A 2JFVA 3K0AB 4YP1A 1Y3FE 2P6PA 2KQUA 5E4JA 4YDQA 3O4IA 2LCFA 3OZGA 3U7FB 3MJEA 2BZ1A 3IDQA 3KDPA 4BNFA 2WAQE 4D81A 4UM9B 7MHTA 2H1LA 1JA9A 1PCXA 3LH5A 3OQJA 4HGOA 4ZCLA 1SCAA 2G82A 4PPYA 1CZRA 1TJPB 1NN3A 4YJDA 4HUTA 4W5NA 1RBZA 2YHIB 4ECAA 5ABPA 4X66H 1KJNA 1J33A 3ZHVA 2GCOA 4DJAA 3KS9A 1NXQA 2ZYGA 3KLMX 3OEHA 5FWYB 4EKGA 4G5OA 5FRDA 4YQZA 3ESXA 4DUPA 3OQNA 1LPPA 1XAIA 2VHXA 3NWBA 3P32A 4GP6A 2P30A 2KBFA 4PG5A 1XDSA 3KT0A 1WB5A 3QNUA 3COYA 5JCOA 1TC2A 2ZI3A 3HKCA 4MQMA 2X0JA 4QXAA 2OCLA 3DFUA 1OXVA 4L51A 1PVOA 1DDGA 3VKUA 4M22A 5KNCD 1ADGA 2ZXEA 5A9RA 1G0OA 3PXEA 5CLIA 5DISB 1PS0A 1V41E 4RVCA 3OOWA 1OJLA 1GTMA 2TRSB 4LY3A 3K73O 3ZK7A 1ZW6A 1EQUA 1U5BA 1VJ5A 4PLCA 4L2IB 1JLSA 3PNOA 1O95C 3AYHB 2PPLA 2YOHA 1JLKA