1PK8A

Crystal structure of rat synapsin i c domain complexed to ca.atp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords rat synapsin I
total genus 91
structure length 306
sequence length 306
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1pk8A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1pk8A01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pk8A02
2R82A 1M0WA 4MV4A 5J2UF 2R7NA 2FPIB 1B6SA 4MV9A 4EA8A 2PN1A 1VKZA 2DLNA 3N6RA 1GLVA 2YYAA 3RV4A 1EHIA 1GSHA 2PVPA 4WD3A 4M9CA 4FFNA 4ZI7F 1KBLA 2YZMA 2IP4A 3MWDA 1DV2A 1C30A 2VQDA 1KJJA 4GGMX 2YZLA 2CNUA 3G8CA 4L1KA 4O2AF 4RZQA 5LYJF 5BMVF 2CZGA 3VPDA 3GLKA 2R7LA 1M0TA 1PX2A 1SCUB 1T36A 1AUXA 4XYLB 3NUAA 2FPGB 1W93A 4EA7A 3WO1A 3KAKA 2CNVA 5LP6F 2FPPB 3SE7A 3ORRA 2PBZA 5CA1F 2NU9B 4O82A 4EGJA 2YS6A 1C3OA 1VBHA 3WNZA 3K5HA 1KUTA 2W6PA 2ZDHA 4MV8A 4YJ3F 2YWVA 1CE8A 2FB9A 3VMMA 4M98A 2VHEA 4MV3A 3VPCA 2QK4A 2NUAB 4O81A 1A48A 4YB8B 3E5NA 5IYZF 3R9RA 3KALA 4TUYF 4Y8VB 2CQYA 4MAMA 3LWBA 1I7LA 1E4EA 3JRXA 4O4LF 4FFLA 4YBZB 5H80A 5HBRB 2W70A 3BG5A 4O84A 2HJWA 2Z04A 4FGRA 2YRWA 2R7KA 5KKNB 5J2TF 1KJ8A 2YRXA 3R5XA 2I80A 2W6OA 1EZ1A 2GPWA 4MV1A 1Z2PX 2R6FA 4IZOA 2GPSA 2NU7B 3BSSA 2YS7A 2GQSA 4O7RA 2W6MA 1KJIA 1GSOA 5GONF 4MA0A 1JLLB 4HQ6A 4QSHA 2V58A 3DF7A 3HBLA 4FE2A 4HNTA 4I50F 3K3PA 2R84A 3GIDA 3V4ZA 3TINA 3MJFA 4E4TA 1VBGA 1UC8A 5CAEB 1Z2NX 4C5CA 5FNVF 3R23A 4HNUA 4O7WA 1DIKA 1EYZA 3TW6A 3BFPA 4M99A 2P0AA 5JVDF 3U54A 1CQIB 4YAJB 2ZDGA 1WR2A 5HV6A 4J6EA 4O7LA 3OUUA 4HR7A 5JQWA 4O2BF 3LP8A 1JDEA 2YW2A 3VPBA 3BSWA 4FFPA 1JKJB 3MWEA 1GSAA 1E4EB 4O4IF 4O7VA 1KJQA 2SCUB 4C5BA 3OUZA 4EABA 3V4SA 1W96A 2HGSA 4HNVA 5K2MA 1A9XA 3VA7A 5BPFA 4YJ2F 2C00A 2NU8B 4ZHQF 5BPHA 3R5HA 4EG0A 5CA0F 2Z02A 4FFRA 4IIJF 3I12A 2WYOA 1DV1A 4YAKB 1AUVA 2W6ZA 4O7SA 3QFFA 1IOVA 1GGOA 1CS0A 5LOVF 5KX5F 1I7NA 5D8DA 3G8DA 1CQJB 4DLKA 3RUPA 3Q1KA 4O7YA 4DIMA 1BNCA 2GLTA 5CB4F 3TQTA 5JH7F 5I47A 3RFCA 3JZFA 3AW8A 3TIGA 2W6NA 2I8CA 5LXTF 4FFOA 2DIKA 2YZGA 4WBNF 1UC9A 3JRWA 2YZNA 3TIIA 3WO0A 5JQGF 3JZIA 1BXRA 2J9GA 4ZOLF 1EUDB 3Q2OA 2W71A 4FU0A 4TV8F 4C5AA 2ZDQA 4MV7A 5JVLA 1KJ9A 3AX6A 1Z2OX 3KREA 2OLSA 4EGQA 2CNQA 1JDBB 3VOTA 2QF7A 5C1PA 2DZDA 4ME6A 4TV9F 2XD4A 4MV6A 2NPOA 3BSYA 4IWYA 2W6QA 5EZYF 3ETHA 2GQRA 4XYMB 4O4HF 4O7ZA 4I55F 4XX0B 3UFXB 3K5IA 2DWCA 1KEEA 1OBGA 1PK8A 2VPQA 3U55A 5C1OA 4ZQIA 1KC7A 3N8DA 4O86A 2XCLA 3ETJA 4MA5A 2FP4B 3U9TA 3KAJA 3RV3A 4EA9A 5LA6F 1OBDA 1EUCB 2NU6B 2I87A 2YL2A 2V5AA 2X0SA 4IWXA 1B6RA 4O7NA 3U9SA 2VR1A 4IHJF 2R85A 4O4JF 4FFMA 4M9UA 3HB9A 2R7MA 4O83A 1ULZA 1IOWA 3ORQA 3HO8A 2R86A 3R5FA 4NYEA 2V59A 5DMXA 2R87A 4I4TF 1M6VA 4O7TA 4EAAA 5C8YF 4XZ3B
chains in the Genus database with same CATH superfamily
1ZS9A 1CJKC 2DGDA 1A1SA 3IT3A 3DR3A 3ND8A 2R82A 4P6VF 4FYYA 1U4OA 4B5KA 1JKMA 1CY0A 4J0JA 5T4FA 3ZZTA 4CFSA 2Y9MB 1VGQA 3WNDA 1A50B 1PR9A 2A30A 2VNHA 3O26A 4KV9A 2B1IA 4BWYA 4MKGA 4M0JA 2PRZA 2Y1GA 1L7AA 4OA8A 4D3YA 4OQPA 3UO8B 3GEPA 1PTKA 1N8TA 3VKUA 2CD9A 1FCJA 1ZQ9A 4FNMA 5IT9A 4RB3C 2ZK7A 2CJPA 4UNIA 1NMEA 1U90A 4PHFA 1OCEA 4JLNA 1E1RA 1RAEA 1CY4A 1L4MA 4YRQA 1M7JA 1XTBA 1E1QA 2AFHB 1JVSA 1IQRA 1T26A 1KSGA 1ORDA 3HBFA 3UM9A 5G0UA 3IPRA 2P91A 1JPNA 2WA2A 2CCKA 2JFZA 1JIVA 4G8CA 4GKVA 5E1OA 5GY7A 4N47A 3IQIX 3RG2A 3OPYB 5KYNA 2PUCA 5ALHA 5E3JA 4IGEA 1OJLA 3L6DA 4M8IA 3EIQA 1A69A 1Y1VG 1JEEA 1TK2A 3B3JA 3IC5A 3QFCA 2I8LA 5F2EA 1N3YA 3A7EA 4Q7KA 5CFLA 1TD9A 5M5BA 4I1IA 1O4WA 1E3MA 2DRIA 1A4RA 2VYNA 3WYGA 3WYCA 4EFMA 1XF1A 5CRIA 2IXEA 4KXLA 1Y1PA 1P1CA 4YRSA 1TF5A 4O2AF 3JAMW 1GU1A 1ULTA 1H5UA 2BGJA 3QVKA 5EGSA 4CKWA 1FFXB 2J8ZA 4OI4A 4A2WA 5LMNH 3MZ0A 2X2PA 2XUJA 5A9SB 4M38A 2FN4A 4IGKA 4KYVA 2NNLD 4L7QA 3ZDFA 5C8XA 1WAMA 3OPYA 3T3IA 1T2AA 2HSJA 4MRRA 4ENWA 4ED2A 2C4UA 1WZIA 3B9QA 4EEKA 5JJLA 2CN1A 1TUBB 3BK2A 1HOTA 5AKZA 3H86A 2GZAA 4ON9A 4U3JB 3WOVA 3UMVA 5B3KA 4LWPA 3JQFC 2FXIA 3DZ8A 4IV5A 1FLNA 2OD2A 3ZY3A 2WTNA 1CR1A 3E0XA 4AJLA 3M6XA 2XMSA 3M6AA 2Q28A 4BV8A 4O8CA 4C08A 3BHJA 1KMMA 2WZQA 3ORRA 2MU1A 3GWZA 4K0RA 4NNPA 3FMAA 2P7IA 1U0NA 4G5FA 3FUVA 4X0EA 2O3RA 3LQ1A 3P20A 4RIIA 4J3JA 4OX9B 1Q84A 2XVMA 1R0XA 4QKQA 4C89A 2C07A 5CT5A 4ZYTA 3HEAA 2R8BA 4OYHA 5JVDA 2DR0A 2VK1A 5DTEA 4YLEA 3VTZA 3VHQA 3IIIA 1JFLA 4G3IA 1LFDB 1RLUA 1NI4B 3BYZA 3I5XA 3GDFA 2JHCA 2IDKA 2IXTA 3N70A 3TMAA 4Q1BA 3KQTA 4R2KA 5KWEA 5DNUA 3W90A 2Y6VA 1IHDA 1ZYUA 2V0CA 3OFNA 3WICA 4LQDA 4L9AA 2AI3A 4DEVA 4D9NA 1DLIA 5KFGA 1G2PA 4PG7A 4B47A 5CFZA 4YRNA 5FLKA 4UPDA 3ZJYA 4RH1A 2YINC 3H04A 4M4SA 4RD4A 3TB6A 3TR5A 4ZYWA 2X9GA 4WFJA 3P0HA 2CFMA 2ZQYA 1WY5A 3OOYA 2BHNA 4DV3H 5FV7A 1WRVA 3NGDA 3W2EA 3UJAA 1C7ZA 3FNGA 3GTPA 3FX2A 4FKBA 2UZ0A 2J31A 3IVMA 3VYWA 4H77A 2WSBA 4V39A 1G41A 3TLCA 2I4RA 4M87A 5ALKA 3SVLA 2RHLA 3JVEA 2CZQA 4G9EA 1TA8A 3GT4A 4YCBA 5DRYA 4TKVB 4CF3A 5L9XA 3FLMA 2RAUA 4IFTA 3D3NA 1KTVA 5IFKA 1FRNA 1P45A 2VXOA 3CMCO 2WLSA 5CNMA 1E4EA 1I2AA 2WP0A 2D2XA 2BGTA 5F78A 1EDOA 4DLZA 2ALZA 2E7ZA 4XSGA 1PR0A 2VP0A 1XZIA 2YJ3A 4IJ6A 4CC6A 2C82A 4Q1EA 3AR7A 4UVEA 2R7KA 3DZCA 1OSNA 5IYCG 1QIGA 2O1EA 2PGOA 3IGFA 4W7HA 5KKNB 1O5TA 1C4WA 1MEJA 1Y33E 3FMGA 3R5XA 3GOQA 3Q0TA 3NAGA 4TXNA 5LU8A 3UK0A 1EWKA 1UH5A 4FHGA 4GEGA 4KQHA 3JSLA 4M89A 4NDZA 3IHTA 4CM9A 4DADA 1S10A 1OFIA 4E2YA 1NFRA 4N8DA 1PJ8A 4RADA 5IAEA 3BRWA 3NAQA 4JLJA 4UBJA 3AJRA 5IC5A 2ODQA 4JAVC 3OQBA 3ZDEA 4QHTA 4DLVA 4YQWA 5D7NA 3GV7B 1QKIA 4A3FG 3CVWA 3WKAA 3NIDB 3UC5A 1XDSA 4HDQB 1BIFA 2WT8A 3OHPA 1E2FA 3LI2A 3L3BA 4HG2A 3KELA 1RYSA 1E98A 3QJ5A 5E6SA 2X0FA 1ZX1A 1G2WA 3QV2A 5DCUA 1N92A 4RC9A 1GDTA 3JATA 1ZG3A 2BGIA 2EGHA 1YR7A 3KPJA 1VYHA 2SBTA 2X7HA 4G4SP 3V1KA 4D82A 1ADFA 4NJEA 5JZBA 2C22A 1M7BA 1ZIYA 3ISTA 2C9ZA 3DJYA 3PXUA 5EWLB 2BEWB 4I50B 2WTMA 5GZ3A 5AJHA 3VXKA 1YB1A 1K6EA 5FWNA 1ET0A 2WHRA 1REQB 1B04A 1QQ5A 3DEAA 2OLKA 3A6HA 3G79A 3DMGA 4GOND 3UJHA 3BD9A 2YVKA 2R93G 1DDIA 2PX3A 3TW4A 1FP4A 4J1NA 2I67A 4L3WA 1KVSA 1ADGA 5DM60 5K05A 2G7MC 1X7HA 1AHPA 3DMPA 2FXVA 3H4BA 3PNSA 2F9FA 5DQIA 3A4IA 3LT2A 3KJFA 5A6VA 4PYNA 1AURA 3TVYA 4B3CA 2GH1A 4A3MG 2HFJA 3BL5A 5JMTA 5HIIA 4HWKA 2BPOA 3CJRA 5L9AA 1AQLA 1L5KA 1NXSA 4YT8A 5KPDA 2CKZB 4H35A 1LVUA 1Y9ZA 3BFVA 4PHTA 5DBFA 2WIBA 5DYTA 3UV6A 1HE1C 3MT7A 4U7JA 5BSUA 3OM0A 4EJSA 4MKRA 3AFIA 4I50A 3T5PA 5KOIA 1RYRA 1VKRA 2V1UA 1GTG1 3W6OA 1KH3A 4MPPA 4CI0B 3UB3A 4FSDA 2WM3A 4JP2A 1QQ6A 1U0HC 1KU0A 3HDJA 3IE2A 4G0XA 4I3GA 5DGDA 3ZYCA 3ZW8A 5JJBA 1JFSA 5B2FA 4QXAA 4P2BA 4GGOA 2QAGB 3VPXA 3F8TA 2XBMA 3DT6A 5B1IA 3WYFA 4EG4A 1HRDA 3PHIA 3IBYA 4PXSA 5EZYA 1U4SA 1Z6PA 3LC0A 3K0AA 1BMDA 2Y0BA 5AH0A 3U17A 3AKZA 1DZIA 1GU0A 4YRTA 3SKYA 1FXSA 1R6XA 5IWAB 2IOFK 3GVXA 1QX3A 4NV1A 2RHOA 4TS9A 1GTL1 1EZ4A 1SUAA 4ZMRA 1I4OA 4P53A 4KR2A 5EAIA 2TECE 4UNSA 3DCIA 1Z47A 5TQ0B 5K0CA 3I9V1 1WHSB 3C6BA 3EVDA 5H3LA 3P94A 1O6CA 3UJ6A 1Z0UA 1U6KA 3AKCA 3ZDRA 1ZH2A 4G63A 4RLQA 1XU7A 4H9GA 3F7MA 4UMVA 4E3ZA 1UM8A 3U44B 5I9BA 3C45A 1ZITA 1BX0A 3F4KA 4MIOA 1QGOA 5D1OB 1EZZA 1ICIA 2CNLA 4RPLA 4EZEA 4LXUA 4MJXA 1ZGZA 4OB6A 1S3SA 5F1PA 2PD6A 3CVJA 4PBRA 3I2KA 9LDTA 1U65A 4L5JA 4O7VA 4Z0HO 3QOYA 4EMUA 1FQKA 1HG0A 3EY9A 4F4UA 4ZYXA 2G1JA 2PG3A 3QEMA 1MHTA 3Q7RA 1PJCA 4UBMA 4KBYA 2AQ4A 3V3KA 3KTAA 4GBJA 3S2FA 4OIMA 2G1AA 3GWGA 4K3VA 4YO8A 3TLMA 2PIDA 1R0CA 1JHYA 1RJ9B 2YJZA 4ISCA 5FPHA 3FD8A 3ZLTA 4C0XA 5TIIA 5I7UA 2BFMA 1OJ7A 1J07A 2FW9A 3HS3A 3DL0A 2UXCH 3KJQA 4K9KA 5IAOA 4WOJA 3THWA 1XA3A 1AM4D 4P33A 1YJCA 1OHHD 1CRPA 5IM4A 3A9TA 3ND6A 4B6SA 1K5DA 2VF8A 5DT9A 1CE8B 2JFUA 2V7PA 3PS9A 4M9XA 2O8DA 3T5BA 2GA8A 3GW8A 2JA5G 4YAKB 4PEVA 2CHFA 4K6CA 4M86A 1X8XA 4QWWA 1TJ4A 2VJKA 4P34A 4B6EA 2QTZA 2HK6A 1YJQA 4NE2A 4R3UC 5TPWB 3RK4A 4C22A 4JQSA 2I7TA 4HLUA 3WR5A 4IIUA 4GI2A 4IIBA 1U1IA 2DUMA 3IH5A 1V95A 2OHHA 2ZJAA 3GGJA 2DE0X 4XJTA 1MO4A 1DZ3A 4P4TA 2JCBA 1YL6A 2VCHA 3NQ41 4IHQA 5BRAA 3EUWA 3VYTB 4MW2A 1T5OA 2QTTA 3HKCB 3GB8B 2WU0A 3DC7A 1BFKA 4QT4A 2BGMA 3N2NA 3LA8A 1UDRA 3FAZA 1RYZA 3AW8A 5FL7A 1LKZA 1ZVVA 3SBEA 2P9HA 2CJFA 3ZGOA 4R3NA 4Q4HB 4X92A 3P52A 1ZVMA 1TK3A 3HUFA 3D31A 1Y89A 2GRUA 1KKLA 3ZNPA 3F1KA 1O95C 3S7TA 3NC4A 4L6IA 4W5OA 2P69A 3HVIA 3QMVA 4HYYA 4CEJB 1GV0A 2IPAB 2COJA 1JBKA 3IKJA 4CDGA 3CZAA 2UU9H 4BCBA 3DDWA 3OEED 5IULC 1B14A 4MWOA 2E55A 1KMCA 2DKFA 1R0WA 1T24A 2RC6A 5HTOA 1IULA 1R8YA 5I9MA 5IAAA 3ZI7A 4EK9A 5B12A 2H1HA 2HK7A 3GBSA 4N0EA 2O8CB 1N5IA 4DV3B 1UAYA 4UEOA 3K96A 3EDRA 5DTMA 4WZAB 4G01B 3EXHB 2H8GA 3U61B 5CD9A 2TRSB 1HF3A 3DOFA 3KOMA 4HCJA 4GYKA 2ZJFA 4K1LA 4MUGA 3WSTA 1Z4PX 2OEPA 1YJXA 2GAJA 4P35A 1D2RA 5DGTA 4GX0A 4OXYA 2JGNA 5B6IA 1I3QA 3OSZA 4DR1B 821PA 2FK2A 1P3DA 3B6JA 1T9AA 3AR6A 1AKUA 3RTDA 3U3XA 4JLVA 5BV1A 4RTQA 1R9JA 1UMCA 2QZ4A 2OLSA 3NRBA 2BZGA 3FNQA 3HI6A 3ONNA 1A5BB 3QKIA 5KYXA 4HYEA 2QGFA 1IVYA 1PGPA 3QEBZ 4PZDA 2YN0A 1P19A 2GN1A 2AL7A 2BM1A 2J48A 2ZB8A 3LGXA 1VSBA 2GCEA 3PIRA 1E20A 4K7JA 3HN2A 3IHWA 3WV4A 3A6LA 4AJ1A 4BB6A 1XOIA 2AHRA 4IRUB 5K9ZA 3F67A 3Q2IA 4A3GG 1IEWA 1LVGA 1WQ1R 2JLCA 2EFHB 1T29A 1XDGA 2WKWA 1XX6A 1U3FA 2H2AA 3NB0A 1BDJA 3I23A 5KG3A 2EJTA 3CURA 1Z2CA 3PQDA 4GXTA 3NRJA 2ZP1A 4HPJB 1M7GA 4BTEA 4OHMA 3GAFA 3OJ0A 4MVJH 5ENVA 4NPCA 5AYVA 1K68A 2DU8A 4E15A 3GLFA 4D41A 4XR9A 2RK3A 2J9ZB 3PXEA 2WZCA 1QIHA 1NBAA 5AXAA 5IVIA 5BT9A 2PE5A 1Z35A 3AHFA 3FGNA 3RC2A 1U8TA 1XMPA 1BXZA 1IUNA 3H20A 1P6UA 2DY1A 2N46A 3FBGA 5K3SA 2ZYDA 3HVRA 1P17A 3PLNA 2HV9A 5B1HA 3X2FA 1VCMA 1E2LA 2AGOA 1T4CA 1XRLA 4R98A 2EF0A 3DE2X 1IUKA 4NBLA 3EMBA 5DMHA 3JYHA 1FIUA 1O4VA 1E2DA 2WYUA 3RS3A 1UBEA 1KYVA 4MR9A 4MVXA 4Q4JB 1YQQA 4GVPA 4QXQA 1N36B 4J3FA 1PU2A 2QSUA 4OY3A 4AWXA 1BDMA 1ORTA 1P60A 3AI7A 4Y6GB 1Z4MA 2IY7A 3V42A 3L4EA 4G0WA 1C7QA 5JD3A 3AHJA 1PEYA 4RFSB 3Q40A 2XT0A 3F5DA 5K3AA 3ZWOA 4G41A 4NESA 2JA2A 2GD2A 5SY4A 4HZUA 2V3VA 2ODWA 5KBYA 4P3XA 1GYFA 3C98A 1OI7A 5I5WA 2ZSAA 1HDZA 3HB1A 3KUCA 3FHLA 4EA6A 1M1UA 3DOOA 4QLOA 2JARA 2X5RA 2GR9A 2VF4X 4Y0VA 3WL5A 3O4GA 1RTTA 1PR1A 2ZI3A 1XO1A 1L0BA 3ANTA 4UOZA 4RKQA 2JK1A 4TYMA 5IZ4A 1RQPA 2QDKA 3BORA 1M2FA 3FWZA 4FDVA 3SXPA 4F8EA 4WJLA 5CB0A 3AXSA 2FSVA 2K87A 3R5SA 4CTKA 4DMRA 3TCNA 4YP0A 2Q4BA 4E1VA 3F9CA 3CNEA 4PN7A 4IF6A 2QRQA 4QBHA 4RKEA 5L4NA 1EFKA 1DKUA 3ME5A 5D6NA 3GLGA 1U7UA 5C34B 3V7NA 5BT8A 3CR3C 2P67A 4BNIA 2Z58A 1I0IA 1IPEA 3M3DA 3DXFA 1Z06A 4MVJE 1T9HA 4IWXA 5DX8A 4DRYA 5JFTA 4MTDA 5IP7G 4HUQB 3O8NA 1U81A 4MRMB 4NOLA 1NTRA 4U7CA 2EV9A 4KLCA 2YU9A 4TXLA 4EQ6A 3ADCA 3ENVA 4X9XA 1P5JA 1F38A 2CMDA 1XCLA 1PV1A 2CUNA 3PFHA 1U3DA 3ETEA 1P2FA 1NVWQ 4QO8A 4BJ6A 3AM4A 2PL5A 3PKJA 3AR8A 4XWGA 2AMVA 4JU8A 3LQRA 2Q4RA 4FYHA 3FTNA 4G8BA 4QE3A 1MXFA 4EKYA 4JVLA 2O1SA 3PFCA 3L4SO 1VPVA 1ZKMA 2OECA 2B63G 3PL5A 4WOCA 2JA7G 4GECA 3W77A 5DMXA 3N6XA 3O9ZA 3LBHA 2NYAA 2CKMA 2KJQA 4LBYA 1I94H 1CERA 4O7TA 3EXG1 4TM5A 1FSZA 5BSKA 3AETA 3CEAA 1E0DA 4UC0A 4UE2A 4Q9IA 5K3EA 3NHBA 1LF0A 5AJWA 4IZ6A 4LFAB 5I3CA 5CD1A 2QTLA 2BTOA 3BRCA 4LYEA 2B4TO 3DO6A 4AYXA 3BABA 1HYHA 5NLLA 4LHZA 4HQKA 1QSGA 3LNTA 1PQYA 3IAM1 4QGAA 1DEHA 2AB0A 3LDFA 1ODCA 1Q22A 4B3MH 3JQ9C 1MQSA 1KOGA 2VZEA 4B1FA 1F14A 1KI9A 2I7DA 3K1JA 1ZRMA 2OFPA 1T3NA 3KFVA 4NG5A 3UMRA 3RASA 1TYBE 2JBWA 3O8QB 4AULA 1GSHA 1XG5A 2CNWD 5A03A 4HGPA 2CLEB 1PK7A 1OFHA 2HXSA 3FCUB 2F8MA 3L7DA 3V8MA 5KQSA 3C5WP 4KIJA 5IXSA 1GTRA 2G6TA 4QW9A 2P6RA 1K06A 2DR2A 5EJ2A 5LZ5A 4JYBA 4QJIA 2UYQA 2XVZA 3ADPA 4JC8A 5KFKA 3G59A 5HF8A 1CUXA 3W3AD 2Z8YM 1FDOA 4A8JC 4MDFA 1R0ZA 1KO5A 3TEJA 2QTAA 4I36A 5K8IA 1ODSA 2ZUFA 1KK1A 2J3EA 4GGMX 4B3BA 3T0IA 1GPNA 2ZTVA 4PFQA 3T15A 2G9VA 3IPXA 4TYNA 4ILEA 4FONA 2J41A 1V37A 4BS9A 1AKTA 1XQ1A 4E4RA 2E4AA 4BY9E 4D0RA 1NV9A 3ODGA 4JI7B 1IMJA 3BWMA 4EUFA 2DX7A 3NV9A 3FKQA 3LUCA 2CZGA 1RRCA 2O0HA 3GLKA 3L8EA 2OXTA 1E9EA 3GAMA 2JLWA 3LCVB 4S1OA 1TIKA 5CXUA 4ZVMA 1E69A 1CWUA 4UDNA 4RSHA 1Y0BA 4XGNA 3AUKA 1EWTA 4LE0A 3DZHA 4OJNA 2PUBA 3CA8A 2P3LA 5JO9A 4K9MA 1J5EB 1DAHA 1PX2A 1EVQA 1QBKC 5IARA 1SVLA 4CM1A 2ZTSA 4X71A 2I6TA 2XNDD 2R25B 4M9SA 2IOYA 5DM2A 3U16A 2ZE8A 4XVHA 4LXYA 4PICA 3MD0A 3GHYA 4TVKA 3VJMA 2FVYA 4ZK6A 2YXEA 4RY8A 5CH5A 5BN3A 1JXAA 3MQ2A 1SWWA 4DNXA 5CGQB 2B3DA 3N5KA 3EPIA 3G89A 1C9JA 2I03A 3KQQA 2NTVA 3BK7A 2ASDA 4JU9A 1Q3KA 1W5TA 3MCUA 4F45A 1WTCA 3O3OB 1EBBA 2HHHB 1XN1A 4OHPA 3FMIA 2A6PA 1NVKA 2QT1A 4U6PA 2CNNA 5B57C 1XDWA 3QHAA 1Z82A 4I8IA 5C7LO 1QYWA 3KB8A 1NNUA 1E6MA 3K5HA 2RGGA 3DPUA 4IVNA 1W94A 2Q27A 4ITVA 3MR3A 2VIIA 4V38A 3ZTYA 2W9BA 3E1SA 1KDPA 3JALB 4G1UC 5DEIA 3UGKA 5F7XA 1UXIA 5L7YA 3OFND 4IAOA 1NI5A 4JLUA 4APMA 1JHAA 2EFGA 3HUUA 4ZZ2A 1E2JA 2FMHA 4RK6A 1P6QA 4DSOA 2GFQA 3TPZA 1EG7A 4MV3A 4FBGA 3UJCA 3AY7A 3BMCB 1MNAA 5FUXA 4BEWA 1CEYA 2B0CA 3L92A 1F17A 1ONBA 1DAOA 1A9XB 1C3EA 3K9CA 4KK3A 3AESA 4GSKA 5DF1A 4CLRA 3RGZA 3S99A 2Q1TA 4F4WA 2QE6A 1G42A 1T6YA 2VUTA 3COJA 4KMMA 3OICA 4K5QA 1JIUA 1A97A 2X0NA 4J49A 4N40A 3UK1A 4J16C 1V16B 2B25A 1W49A 1SD5A 1Z38A 4F1JA 4OFZA 1XRNA 3VNSA 3EXFA 1JEYB 2PT9A 1EUCA 2UZ1A 1DAIA 1N8SA 3EG9B 3ICCA 3PG5A 4ZI5A 2QUBA 2XRFA 3QUBA 4IJMA 4KYUA 1ZI6A 4OPMA 4ALKA 1F51E 2GAOA 2RAPA 2BR5A 4F4XA 1KPHA 1XLTA 2VH2A 3D6JA 4EKDA 4XB6B 3KFLA 4AQ7A 2A1TR 4YBZB 3DEIA 2XNSA 1DG9A 1T9DA 1PFUA 3OTIA 3Q5DA 4MQEB 3KXDA 3LFUA 4PLYA 2WB1A 3DHWC 4ZOEA 1JL3A 5JVDB 4JEHA 1D09A 3L7MA 1MOQA 4YBZA 3E15A 2FE1A 2KYRA 3QGMA 1E3TA 1V3UA 1YKFA 2EKQA 4DW8A 2CK3A 2QW0X 3EW9A 3OG9A 4X7PA 3WG9A 3LZ6A 1BE6A 5C52B 2OO7A 4HLDA 3RSZA 3HJFA 2CDBA 2XCTB 4O4LA 2VATA 1AXGA 1PD0A 1A4UA 3NV7A 5JADA 1L7PA 2WLTA 1JEYA 4MV1A 4IMPA 2Y66A 4AF7A 4BMVA 5K4HA 2VA9A 3JQGB 4DZRA 3JAMA 1C1YA 4KPGA 4GP9A 1RRFA 5LA6B 1WUKS 4EY4A 4HN4B 1FE8A 2AUNA 3E8SA 1SG0A 2EKDA 5IF9A 3IAFA 1EKVA 4UVHA 5B30A 4O7RA 1FJHA 1JNXX 1IEVA 1M67A 1XZMA 2G0AA 4JBXA 4M0MA 4D4JA 4DBZA 2O0KA 2Z8XA 1N0VC 1FQWA 1SVWA 4OP2A 4ZEXA 5TB5A 4Y2YA 4HI0E 2O1WA 4FQ8A 1N6PA 4O4IA 4UAJA 1JLLB 3SQMA 3K53A 4OJMX 3V4RA 1KWGA 1KZHA 3RSQA 4EHNA 5KC9A 2PZGA 3NX4A 4B6FA 3ONDA 1SHZA 3RFFA 4N12A 4KG7A 1OXSC 4GPEA 1KDRA 1YHNA 3WIOA 1D2AA 2FWPA 1AHHA 4IEEA 3RSSA 4OIFA 1I3OA 3AJEA 3I2JA 3C8HA 1CZNA 2P9QA 2QG4A 4L5BA 2Q3HA 3GMDA 5THQA 4WXYB 3S2ZA 5LWHA 3IBTA 1OXTA 4RVSA 3MERA 3UAWA 1Q91A 1Y4ZA 2VYVA 2MSCB 5MGNA 3OCCA 4J1TA 2Y1OA 4MVCA 1W9MA 5BSWA 1G3MA 1G5RA 1Q7EA 2ZYTX 5DHSA 1WZNA 1U2GC 1XBTA 4UCFA 4PNZA 3GP8A 1VBGA 4HAZA 1IK4A 3UJ8A 4H6PA 4HX9A 1I50A 3A3YA 4QULA 4R40A 3FKIG 4LF7H 3G2PA 1V47A 3R23A 1DMSA 1ETUA 1GG8A 3AWDA 5E6RB 4C1NA 2AA3A 4DV7B 1DWOA 3EZYA 4HDCA 4OV6B 5EWJB 2GSDA 2JCGA 2FEKA 1K6MA 1U7TA 1SO8A 2WAOA 5JFGA 4Z4EA 4FN5A 4UPVA 3COWA 2DG2A 4WNAA 1JG3A 1UWVA 3L6UA 1H6AA 1HZZC 1NOKA 1R2QA 5C32A 2C2DA 4JI4H 1PV2A 3BREA 1U0BB 5AKEA 2XUAA 2CVZA 3DVSX 1E2IA 3AEKB 4S1VA 2NYVA 4ZAGA 3U54A 2AR0A 2I62A 1AN0A 4LQCA 4PIVA 3QYJA 5EKSA 2I33A 2VBFA 1H2FA 5EC8A 1B8PA 4EFDA 3WQSB 2EJCA 1H4TA 5FF9A 3ZQ6A 2F1IA 2IS4A 3R8XA 2ORIA 2PBLA 1D6MA 4O2BF 1CT9A 1FFBA 4OBEA 3SYLA 4DQKA 3PC8C 3C5CA 3TAUA 3FUCA 3TL6A 4GYJA 3WIEA 3VPBA 4M0LA 2KHZA 3MB5A 4ABYA 3P27A 1SGWA 5FDFA 1SRRA 2ZYSA 3FM9A 4CM5A 1S4QA 2BFFB 4DGSA 4O2RA 2VUGA 2EIXA 4TMKA 1I4LD 2BCJQ 2V5VA 4LYGA 1GZVA 3P2JA 4MK4A 1L5QA 1KHHA 4FYIA 4P3OA 4BQQA 1A7AA 3PJFA 4GKJH 4DYHA 1GZ7A 1OFVA 5H81A 3K1AB 3H40A 3EGDB 5C5DA 1J2TA 2X1LA 5DB4A 2H1OA 1MX1A 2IXAA 4XTCS 4MVJD 2BH9A 2IA5A 4PQGA 4RNDB 4Q9LA 5E38A 3VO2A 2W9CB 1GTMA 4Z1MD 3FE2A 5K2MA 2P2DA 1X7ZB 2JGEA 1GG5A 2OGSA 1V3TA 4RD1A 5GV8A 1OX4A 2C00A 4DKXA 2NU8B 3CO5A 2BISA 1QHFA 3ESBA 5JZ9A 4F1WA 5DLDA 1MJGA 4GD3Q 1DSSG 4PZ9A 3OA2A 1IN4A 1W35A 1VRVA 2AXEA 2JKYA 4KZKA 4DIFA 1B0PA 5J2TA 1R7RA 2YJGA 1UBFA 3IAS6 4KO1S 4YPOA 3TSAA 5IK2D 2Y05A 1G8YA 3ENZA 4YP9A 5KT5A 1J0EA 1YB7A 3JALA 5FO0A 4ECEA 4KKVA 1PLJA 3SQXA 2X4LA 4DM4A 4LY6A 4U4AA 4G9GA 1M6WA 4UKDA 3U26A 5CEEA 5F7OA 3T5AA 1OD6A 1LPAB 3E81A 3L7YA 4Z99A 2MCFA 3ZE9A 1G5FA 3H84A 2WSMA 3ZHSA 4KMOA 2YZ2A 3HDGA 5EJIA 1ZWLA 1MNQA 3A7DA 3QTTA 3D02A 3D6TB 4KB5A 5KX5F 3A06A 1U8CB 5IN4A 3HLYA 5HF9A 1A71A 5BWMA 4N0QA 3Q1KA 4DIMA 2RKWA 5TMDA 2JGFA 2FDRA 1QIJA 5CPFA 3GGSA 3WSVA 5JH7F 4ESHA 4RHEA 1YA6A 2Z6QA 3JZFA 1XKTA 3THSA 4RNCA 1D7OA 1X42A 2E2HA 1GA4A 2OQ2A 3L1VA 1Z34A 5LXTF 2ATVA 1ZCZA 3I9KA 2AYXA 1E3SA 2FSHA 2JI4A 2ZKLA 3KYIB 4JP1A 4EELA 1OY1A 3DDOA 1Z4LA 2WQZA 3CF4G 1HORA 3CVZA 3V4VB 3TUIC 2EEZA 2G40A 3EW7A 1SIUA 3D6HA 1IRIA 1JR3D 3JZIA 1EFRA 5K0ZA 1HDOA 1X7YB 1O6FA 4P82A 5CP8A 1M7HA 1Y1LA 2QJTA 3R0IA 3D64A 3DE1X 4II2A 3GFFA 5HVNA 4GYYA 5JAUA 3GLUA 1GPJA 4J03A 4XFJA 3VZPA 3OE1A 4XAQA 2A84A 3SBDA 5J1SB 5AOVA 1FC0A 4GXQA 2QNBA 5JDIA 1NKTA 2QZZA 4TZ6A 3D0RA 2II6A 3VNBA 1CKEA 4IDPA 4UUOA 3A4TA 3TE6A 1RJWA 3UN1A 1YTLA 3O8OA 4BQPA 2PSDA 3VSAA 3A6GA 3OZRA 4XCVA 3QVOA 2YWXA 2IZ6A 4A2CA 2C4TA 1COWD 3DAYA 4A0SA 3B1ZA 1Q83A 4XE5A 2LTAA 5DLYA 4HQFA 3N0TA 5HZHA 1R0LA 2BQRA 3AOEA 1XMIA 3GI1A 3AU9A 3I8XA 3RM3A 2DERA 4D0NA 2JGIA 2PQMA 5IKOA 1GXSB 2HLNA 2JFBA 2ZR8A 3DFFA 4ZMBA 2AIRA 2ATLA 1KOFA 1LK7A 1TQ2A 1XJQA 1P1FA 5DP2A 3T4XA 3JXEA 3LK7A 1Z88A 4PRLA 5EGNA 5C1IA 1RR6A 1Z2DA 2PMKA 3L04A 3EVFA 1T9GR 2A1IA 3HFGA 2OKGA 5C1PA 4I55B 4QTTB 5EP4A 1LVHA 5AJTA 1LDYA 1RI4A 2EBWA 1DG3A 2BEKA 2GOYA 3LOPA 1C1DB 1M2HA 1KYWA 2G9NA 5AUNB 5EIXA 1I5RA 5IHXA 5HFJA 4DHWA 2FK7A 3K0AB 2PKEA 4YUAA 1VKHA 2BYTA 2NPOA 1LRLA 3F6CA 4YHHB 2VRBA 4E1BA 1G63A 4IWYA 3FA2A 4EYSA 4PE5B 5BWVA 3GN2A 2IH5A 1P7PA 1MA3A 2JJYA 4Y67A 1N6NA 2VJYA 2IYXA 1Z4QA 3K9NA 4IXNA 4CTMA 1RM0A 1KOLA 1UMCB 2WE7A 4LJAA 1MUUA 2DPMA 1R9TA 1WDMA 4TTSA 4O7ZA 1XCBA 2HRRA 1X0XA 3GFPA 5G1NA 4M7EA 3E3NA 1M10A 1ZMBA 2JK0A 3RHFA 2DPJA 4I4NA 3E7PA 1KC1A 3HDYA 4JI6B 5KX5A 3TLGB 4X54A 2VXCA 4RK7A 5ICEA 3PX2A 2ZJ3A 3LT5A 4GQIA 3MR2A 1BX3A 3PPWA 4W4TA 4QTZA 3FZQA 2IZ5A 4G0OA 3D6FA 4PTZA 4G0VA 3KXLA 1BH2A 1ADBA 3DL7A 3GF4A 4FXOA 3WMWA 4WN3A 1C0IA 1D5WA 4JJEA 4WZAA 5A4DA 3T7RA 1YCHA 3EPPA 1E1KA 2NQTA 4CLRB 3D7NA 2WM8A 4UCRA 4ZVRA 1IN6A 3KVRA 5AKLA 1QH8B 3H87A 5TMEA 3NTVA 1DUIA 2A57A 4F4DA 5KFNA 1EEXB 1PR2A 5KREA 1BCSA 2NVUA 3A36A 3BHNA 2WABA 3WYNA 1CZHA 1H2XA 3ZKWA 1H3EA 2VXYA 1RRMA 3F8SA 2QM7A 4PF1A 1YZVA 2O7RA 2QAJA 3WC4A 4HTFB 3B3GA 1KSJA 2LE0A 4LSXA 4ZREA 1ECFA 4RDCA 1B4DA 2FCRA 4UUBA 1CEQA 4Q8FA 1LLUA 1B43A 4BTVA 3HGTA 4YP6A 3AR5A 1X1TA 4EHFA 1D8AA 3C24A 4KZPA 2WZDA 2NV2B 3WB1A 1Y5NA 3BTSA 2H0QA 3N2IA 2FF5A 3UWSA 1B3RA 4FNOA 4Q4AB 5F21A 1J1ZA 1V48A 5JSUA 2DFVA 3HI4A 4URWR 2ODAA 4C3UA 4EUNA 1ONPA 4KFRA 5JAHA 3VRHA 3K70C 4NXNH 2VP5A 5K1ZA 1NP3A 4KRYA 3WRVA 1YIAA 2HIMA 1EFPA 5AVVA 3P9NA 2R85A 4L7VA 5KYGA 1LJ8A 3BWCA 2YWRA 5CXXA 4Z49A 3LLUA 3ZCRA 2DHRA 2XPCA 5L3VA 5CTAA 3NATA 7REQB 5EPOA 3PUWA 3QBTA 4NY1A 4IDQA 1JDSA 2VL7A 1M6HA 4MYDA 3DLAA 3IILA 3TUJC 3HBNA 5CFOA 4JSTA 3FNEA 5EMNA 4MUHA 3BXPA 3E84A 2E5LB 4ROSA 3QPAA 2V97A 1RMTA 1EFLA 3PGXA 3CZ4A 2SKDA 5GWXA 1YAHA 721PA 3HM2A 1CEEA 4DLRA 4I2VA 2Q1UA 1NNLA 2GEJA 5FJIA 1J0BA 2O48X 3WGOA 1W7AA 2C35B 1JT9A 5E2BA 5EMKA 3FCCA 5JE8A 3PJEA 3LUHA 1R4MA 1JDTA 4MV5A 5K3BA 4LYFA 1ZH6A 2C2MA 4UW9A 2WU8A 5EXEA 3ZCQA 2A2ZA 3DWFA 2ZTHA 2AJBA 4KJZA 4RJLA 1YV9A 4J7UA 5FUMA 4EA8A 1UFKA 1IPHA 5C44G 3KUUA 2IDZA 3TLKA 2UZ4A 2XZLA 5E2AA 2HJVA 3N6VA 5EOVA 3GIKA 2OZEA 4R1TA 5MFPA 1ZISA 4AZWA 3F5QA 2I91A 1E2KA 3NDRA 1NF8A 4PGAA 2KBFA 2Y92A 2Y1EA 1RSZA 4RYDA 2W58A 3NFRA 4QGSA 1Q0TA 1K6XA 4G5XA 5L51A 3U7QB 1V26A 1KI3A 3O74A 2AK3A 3I0NA 4OHFA 3TLZA 2MINB 1C30A 3H0CA 2VQDA 4EP1A 4ZTUB 1OB2A 1PFQA 1X8KA 2PUFA 3LUBA 1O9BA 3NCHA 3OC0A 4KHZA 4AL4A 4KAFA 1SPXA 2DWUA 4LMBA 4WOPA 5CVCA 3W6NA 1E58A 1VCHA 2XT9A 3UAGA 3K72B 3MG9A 2P6MA 2JEIA 1XKQA 5DLPA 1WCMG 4I6JA 5EKUA 1K5HA 1NXTA 1Y4UA 2ASVA 1XAJA 1XMOB 4FW9A 4X64H 4DTCA 2C61A 2AEJA 2YCLA 3BGDA 4BVLA 1M74A 3KEQA 3OTOB 4JV0A 3TIFA 1SIOA 2YNMD 3QVMA 4GC5A 1YQTA 2IQ5A 4UBLA 1ONSA 5HJ2A 3M2PA 1Q92A 3TQHA 4UUNA 1YMUA 3NHFA 4AZ0A 2C0QA 2WM2A 1SKYE 3H2HA 2Z5FA 4XPIA 2BMVA 5I7RA 5EIHA 2DKNA 3FKSA 2WJVA 4JP3A 4EYIB 4PCLA 2C92A 3OLZA 3DBRB 3N07A 3C5VA 4IG4A 4Q24A 4IH4A 3WRWA 1XCOA 4ND1A 1WUIS 2E0IA 4RY2A 3EEIA 1IOLA 4J0KA 1FZQA 3TIXB 4MGHA 1Q3TA 4XDYA 4AXXA 2Q6OA 5KFYA 3PHCA 4I9GA 3VU1A 5K5EA 1BHJA 2JLXA 2CT8A 4BN0A 1VL2A 1EJ2A 3QE0A 4LDJA 2W2PA 4K9QA 1ZK2A 4BLPA 3WLEA 1XHFA 3MJ4A 3G9QA 2A9QA 1Z6QA 3SSOA 1U9CA 1TK9A 5IASA 4RVHA 3C3PA 1CUFA 4D9JA 3W5UA 3RAXA 4V3CA 5BW6B 3TRJA 3TO5A 1D2EA 4EBDA 1XEXB 1YZYA 1I9GA 2GBLA 3WQRA 1KAHA 3MNFA 2QLNA 2X23A 3IP3A 4QRDA 3L82B 1QIFA 4XM0A 1CE8A 1KK0A 1OZ0A 5IBPA 2BONA 3ETDA 2DTDA 4MEBA 2VYQA 1S2OA 1ENZA 3RVOA 5HHTA 5KMGB 2GK3A 4ZAVA 1U3UA 1KRXA 3E48A 5EZQA 1RIIA 2DECA 1U1DA 4H6WA 4N5HX 4C03A 2LXNA 4HO1X 1VIAA 2FOXA 3CVYA 2FHSA 1R5BA 1HURA 4G65A 4W5JA 2K4MA 1MW8X 3ID6C 2H1RA 4BB0A 1ZK3A 2PO5A 3FDZA 1A76A 1ACLA 1R00A 2RFLA 3C85A 5JXIA 5SYAA 3FWNA 2QEQA 3PWKA 3G8BA 3FNRA 4IGFA 2ZWIA 1QONA 4FPXA 5TPZD 4R05A 3A31A 1I1MA 4MR9B 1VB3A 1S9HA 4V0ME 4C7JA 2XOEA 1FDIA 3PPYA 4RU9A 2BHLA 4UTZA 1W5EA 1P0FA 4ZVSA 3F3YA 1W30A 1YZLA 3JRXA 6NULA 2HVSA 3WV5A 5D1OA 3KU1A 3CUWA 2C7QA 1ARZA 1GUZA 3UAZA 1VPLA 3CINA 4MUKA 4RV5A 4BZXA 1NUUA 2ZBDA 3NC0B 1MO3A 1DC6A 4L07A 4ZJUA 4EZBA 2WMOB 2BP7A 1KZYC 4F4JA 1ULUA 4IQ0A 4TXJA 3QWIA 4UCTA 3RHZA 1T3GA 3F97A 4MGEA 3ZBQA 1TT5B 3GJ5A 4NH0A 4RGVA 2H08A 4RH0A 3NASA 1U63A 4X94A 4NP6A 1YA8A 4GC6A 1Q2XA 3E22B 1A5ZA 3RR5A 4MI3A 4FBUA 2YFHA 4FUTA 4RPIA 4XEHA 1YI0A 3PNPA 5B6PA 3ANLA 1C9EA 4P54A 4HYKA 4LZJA 3HRHA 4DR2H 4BFZA 2OV3A 4YDRA 1N5RA 2D3WA 3T5MA 3O4IA 2QQGA 3RRJA 4FB5A 4W63A 1YQXA 2GTHA 4U2CA 2YVQA 1ODKA 1D1TA 4IV0A 2FJ0A 3U31A 5CBPA 1PJRA 3O2QB 4HVAA 3PHJA 4EKGA 4RTKA 3PVCA 1TC2A 1QZXA 3E3MA 1WXIA 3F7NA 3W05A 4XIGS 5E0OA 5DM0A 1RWOA 1H8HA 4YAOA 1FJGH 1TZBA 1I51A 2ID4A 3OETA 3N74A 3RI3A 4DQVA 4I5GA 4O6VA 3FN4A 4EDHA 5KO2A 3BJMA 3W04A 2GZSA 3N39C 4Q7EA 3ENWA 2CFIA 3GFTA 5TS2A 4D8VA 1BFUA 4RFVA 1FMCA 3PKIA 3HJGA 4ONEA 4Z54A 2IXFA 2NSDA 3QHQA 3W7BA 2A9VA 1E9CA 1HNXH 2P2GA 3M3PA 4MS1B 3S4YA 3E82A 1LSSA 1Z2AA 1X7XB 1N2HA 2HK9A 4FFBA 5DYIA 2NTNA 4PFKA 3SSAA 3AUSA 1ZNZA 1F8YA 2AN3A 1FRQA 1RLOA 2X3YA 1G6KA 3ZI0A 2IJGX 1Z4KA 5ALJA 1FP4B 2PJRA 4JXZA 1JR4A 3WI7A 3K9WA 5TY0A 5TT0A 1QCCA 1J7KA 2OK8A 3PUXA 4RHFA 1QP4A 2QBYA 4B0PA 1EE1A 1M6NA 5BSGA 3C0KA 2B61A 1P8AA 2QUIA 3C4QA 3U4AA 3UK2A 1CC1S 5JNVA 3GVIA 4YCSA 4CDNA 5B7QA 1MJGM 4QPPA 2YMLA 3V4OA 1DHRA 4TL9A 1X2EA 4YROA 2FQWA 3K0SA 5IJXA 3UYYA 2IYYA 4QFCA 1Z5GA 4G97A 2VYVD 2AMFA 4J0EA 1FUUA 4LXGA 2MDTA 3OM9A 2CJYA 3IUEA 2VJNA 4IINA 2GI4A 2C3YA 5EP3A 3TZEA 5BY2A 2NOAA 1YR1A 4JQOA 1YFZA 2EC5A 4MWCA 2WHEA 1IBCA 3BUSA 3HVUA 2OP0A 4PAQA 4B4DA 1WF6A 1T3SA 2JIZA 1H94A 4YWHA 2H11A 2H07A 3VAZA 4BRSA 4B46A 3UPTA 4LF7B 2AJLI 4Q3LA 2O3UA 1J21A 2G82A 4GUDA 2EJUA 1QFMA 1YHYA 2WG1A 3KCQA 3DFIA 4FDMA 1NIPA 3JYLA 3LBAA 3P9KA 1ZEJA 2DFPA 1YJBA 3E18A 1EKXA 1G17A 3E5RA 1P0MA 3OWOA 3X1ZA 2RK4A 1CG6A 3DYIA 3C43A 4IDFA 4J75A 1Z6TA 4A2AA 4G37A 1IM2A 1LI7A 3EC7A 4KXYA 3ZZNA 5HP4A 2KE5A 5GJBA 2FX3A 4F1KA 2QPLA 1DQRA 4C6RA 5F2NA 1RS0A 2B83A 5LMZA 2JLQA 1UNNC 1UBKS 1SAYA 3BT7A 1DEKA 1QS0A 1AGRA 5LZ4A 1M2OA 1YGYA 1E77A 3FOAA 1ZI9A 4DDHA 1THZA 3EEYA 2EKPA 4MCIA 2FK8A 2FX2A 1Z28A 4LOAA 2JGKA 4CFZA 1DKNA 1XRMA 2CMHA 1FFWA 4AROA 5FX2A 4DPMA 4IWNA 4TLLB 2H00A 1QO0A 3EZLA 2COUA 4HHEA 1EX9A 3WIVA 1PL7A 3LUAA 2IH4A 3IRUA 3EAGA 4R8UB 1IWOA 3F71A 1ACMA 2HQBA 1N75A 1BXRB 1M2VB 1L8LA 4QDUA 3IEMA 4C1BA 2YNMC 4F3KA 1AMUA 1SA0B 4TQ9A 2GASA 5FQOA 4A3JG 4XR4A 2H65A 1NU6A 4OH1A 4TKLA 4EJ0A 1XZHA 3VR3A 4QXOA 3OTHA 4QTXA 3IPAA 3WB0A 3B13B 2NV6A 2BUCA 3TE7A 1GKUB 2XMDA 2R9VA 1GGOA 1V9CA 1WHSA 4GBMA 2GAIA 5DCLA 2IYEA 3FCXA 3RJ9A 4EHBA 4D92A 2J0EA 4MA4A 3QG5A 3FPKA 4IZIA 3TTUA 3ZHQA 1EXVA 3SCZA 2F3RA 3MBIA 2WVAA 4U0JA 1Y3HA 3MFQA 4KYIB 3ZNQA 3QX3A 4LRSB 1OXUA 3EXEA 3WYBA 1ES9A 4YAWA 3SHQA 2QR2A 2HA7A 1C41A 4XFKA 4D42A 4RNNA 2H48A 5SZHB 3UHOA 2GLTA 1HPLA 1Z5OA 2ANBA 3QX9A 4JCCA 3TQTA 3RFXA 3W5VA 4EECA 1AO0A 3NEAA 1XHLA 1SOWA 5CURA 2A9RA 5H9VA 5L3QA 3P9SA 5I7FA 4U3JA 4TMXA 1RD4A 5BMVB 1X1CA 2IXGA 3RIGA 5D5PA 1OH8A 3GU3A 3BMCA 2XMBA 2A9OA 1UCFA 1HE4A 3QWAA 4II7A 5K3FB 3U0GA 1YWGO 3H2KA 5JANA 5KG5A 5A9SA 1A9OA 1MJHA 1UAGA 3WBJA 5TT1A 1AKQA 1KO7A 1ZZGA 2WKQA 1V8PA 2WAMA 1EUDB 4GI1A 4GI5A 3B9RA 4KIFA 2Q46A 3I62A 3UWPA 3DZDA 1CQZA 5EPEA 3DVAA 4RVGA 4CTOA 1P81A 4Q1CA 3K4PA 5DBGA 1PV4A 2D7DA 3GA5A 1QGDA 3B6KA 3ZIDA 1HFWA 2R47A 1IY8A 4RZXA 1SXJD 2CGEA 5ENDA 4E07A 1JU9A 1E3JA 1JU3A 1JLKA 3BXZA 3G02A 2G63A 2R2GA 1PGOA 3KJGA 3KJHA 5I9IA 5LFAA 5DK6A 1NQWA 4MV7A 4G56A 2PKRA 1LU9A 3LY5A 2B7BA 1V1MA 4WOBA 3AX6A 2NO9A 2Y8EA 4F6RA 4EKIA 2OZLA 1N2JA 3THXB 4AF8A 3W5IA 4XQ0A 1IN7A 5HJ7A 1BWPA 1JLHA 4D4IA 4OYRA 4OLHA 2RCYA 3IUSA 2FUCA 2I6FA 3IBSA 4A5OA 4MARA 3WGNA 4EH1A 4CBVA 3TW8A 1F60A 3HFJA 2PMFA 2DETA 3VOTA 5COAA 2G1UA 1U0SY 3QSGA 1KR5A 5CW2A 1QCZA 3P9RA 4BV3A 2BCEA 2BBTA 1VL0A 1EP3B 4WH0A 2FU5C 5KWJA 3I6MA 1NI3A 3GTLA 3RQIA 5E95A 3H4MA 2PXXA 3FGOA 3ZEIA 5COBA 3D3KA 2MSNA 3QA9A 4BFUA 4F92B 3FUUA 3M70A 2BMFA 3C2QA 3VAYA 1NW6A 1JP7A 4RBNA 5ALLA 2PXHA 4QYXA 2UVRA 2OTCA 3R3VA 1ENOA 2W6ID 2DPHA 5HXAA 3OZDA 1FP1D 4U9IS 5DG8A 2NV0A 1VFPA 3IVAA 2GQRA 4XYMB 1U2PA 3ECSA 1ETHA 4B8ZA 1GILA 4M1EA 2ZZKA 3SU8A 1YRHA 1ZNXA 5BMOA 2NP7A 3S1AB 3SXUA 5DTIA 2J67A 1RJQA 1R0KA 1I6WA 3UFXB 1MR3F 1WMAA 3GDWA 2ZG6A 4NC9A 3CX8A 1EE9A 5BQOA 1GP2A 2QX9A 3LXRA 3FYHA 3I01M 4RS4A 1AB6A 4WA8A 3A1FA 2B6NA 1WJGA 2Q5EA 1OBGA 3GNSA 3Q8PB 4RZRA 4AQYB 3NHSA 3KEMA 4TQAA 4R5MA 5EI5A 4WLVA 4B3SH 3NKLA 4F72A 2F48A 2O20A 3LPAA 3WLOA 4DIUA 1Z0KA 4YJHA 2UXDB 3KYJB 4I0WB 3MRVA 1P72A 4UXJA 3OOHA 3F78A 5A62A 3K9LA 1NSYA 4R7RA 4QGGA 5KYYA 4ABTA 2VDMB 1R8XA 3G1UA 1A4XA 2JC3A 3CW2A 4R8MA 1GGFA 4D5EA 1QRAA 2FKAA 2XBLA 3KPUA 3OZAA 1MFZA 1CUYA 2J3LA 3OCYA 4ZRMA 2V3WA 1TI7A 5KSZA 5GJCA 3TECE 1QRTA 2GXAA 2QLJA 1B6TA 4DCMA 4M53A 2W2NA 3WBKA 4PVDA 1DCTA 2XB2A 2YIDA 2X9VA 2IQIA 1W4ZA 2FW7A 4DV7H 1CJTC 2VPZA 3R7SA 2OBMA 2WF5A 3GFBA 3L7BA 2B98A 4AN4A 3RV3A 3QWFA 4AWAA 4RV4A 1Z6YA 3UQYS 4UPEA 4UOQA 1VAJA 4JI0H 1RABA 3I58A 4BKMA 4E4YA 5L4SA 3HHEA 3ZDZB 5IJ0B 2CKDA 4EBEA 3GRZA 3U56A 4Q82A 4QOGA 2Z2XA 5EE0A 1P1JA 1B6RA 2PCLA 4QYWA 1Z15A 2PK3A 4TYPA 1JEJA 2OSVA 2P75A 3LK6A 5FBKA 4W5RA 4UCVA 4EJMA 3HA2A 3OIVA 4KLNA 2ZUCA 4ZJPA 3FOFC 1VHQA 2EJVA 2OLJA 4BUZA 2C59A 5CB4B 1W44A 3M5CA 3OWHA 5DWQA 4ZV4A 2D5IA 2O23A 3DKIA 5KSWB 2CVHA 2W8KA 4J2TA 4NBKA 2C54A 4YJ2A 3NIGB 4RHXA 2P6OA 6Q21A 5LMNB 4D4HA 3O84A 4TRJA 3EBPA 4E6EA 2HJHA 5AQ1A 3PDUA 4FEGA 4Q21A 4E94A 2Z6AA 4LZZA 3VKVA 5KQLA 3F98A 3KDAA 5E9AA 2V6BA 1D04A 1Q6ZA 1EKFA 3JVVA 4PV7A 3OFKA 5D3MB 3FYDA 2B82A 5AR1A 3CIFA 1ZJZA 3AY0A 3K0FB 2W9CA 3MGAA 3OU6A 3PB3A 4IICA 3TD6A 4D9FA 3LWDA 1XQ9A 1QVVA 3HU1A 1DP4A 4P83A 1AU9A 4I4TB 4XDHA 2IUUA 4GSYA 4Q9JA 5HKBA 3LT4A 2ZWVA 1SHKA 2ROQA 3GAAA 4H1WA 4CT0A 4X5OA 4CMAA 4S1PA 5HWSA 4JKIA 4LJ5A 3W4KA 5KHLB 4MAAA 3S2EA 2QTNA 3NW9A 1XMOH 3L7OA 1XLUA 1Z6AA 4ND4A 2ETVA 2QQ5A 3NKVA 3KHGA 1OLXB 3O4RA 5KTTA 3HUEA 1VJDA 3RTEA 4AG5A 4KXXA 3TF5A 2AG6A 2ZVQX 1CXZA 3AIKA 2OOKA 3MGKA 4TXMA 1V3VA 1ST2A 1T36B 3MUEA 3L7IA 4P32A 5ESWA 3PYXA 2B1QA 4DDUA 5AVRA 2NX2A 4PQFA 4S12A 2OBFA 4EO7A 2P5SA 1QGZA 2VYFA 1X8JA 4GX1A 4S0ZA 3DPIA 3VHXB 3WL7A 1PS0A 4BLUA 4E88A 4E0BA 5JY6A 3EOAI 1Y42X 3PUJA 3KZNA 5ES4B 4Z3DA 4RZUA 2WG0A 2YFYA 5F35A 2Y4NA 3WWJA 1N0UA 1FFAA 2YIVX 2QHXA 5A71A 2NT3A 4IIGA 4A6DA 5DZSA 4DFDA 5ALRA 4L1KA 2WW8A 4XA8A 5AHXA 3PUZA 1C30B 2VWPA 1NT2A 3LGAA 1T1GA 2IKSA 3TSWA 3HA7A 2O7SA 4XD7A 2PGIA 4E6PA 3J7AK 3LMLA 2W2VA 3IS3A 3K31A 4OD0A 4ACAA 3K15A 5AKHA 5EHNA 4CMIB 4DDWA 2X58A 5IDWA 1DPFA 1SBQA 3R6LA 1KFEB 4O5AA 2CC2A 3DE5X 1GKLA 2G1KA 3L0SA 5B4VA 1S8NA 3CN9A 3R6TA 1VPWA 2ZR7A 2FRDA 1Y8RB 5I45A 1QFSA 2I65A 1G16A 1LPMA 4LOKA 2B8WA 3R8CA 4YXFA 1AV6A 1T36A 3MBKA 3AL0C 4XW2A 4JOQA 4WJKB 1L7MA 5K0TA 4R51A 3ACDA 1XN4A 1TZ2A 4LJRA 1W52X 3AF2A 4NBVA 2D1FA 2GCOB 2V98A 2EARA 2KB0A 4QFDA 3NYWA 2V7TA 5IVPA 1KI6A 1WSWA 3CJTA 5I9NA 4L75A 3ASUA 4NFHA 2PH7A 3AHHA 4PSDA 2DABA 1F4VA 3VNNA 2RGYA 3B9PA 5DSTA 4UQLA 4U6SA 3UTCA 1EUZA 4YUWA 4CODB 3N58A 2C4WA 5DFAA 1KZ4A 1TEHA 5C2JB 4PZLA 4EGJA 1CJUC 4H27A 1PIWA 3GPCA 3UATA 4EKEA 3WQBA 3G2HA 1P1IA 4KMSA 4X8HA 1V7CA 4U02A 1VTKA 3V46A 4QUJA 4WERA 1IG3A 3UAYA 4B6PA 3QVWA 1U0EA 3T9DA 1I2LA 4UCOA 1ICEA 2V5UA 1O6GA 2EZ8A 2HHJA 1XCMA 4KTVE 2OQVA 2G5CA 3C16C 2O0JA 3VAAA 2YMQA 3GFQA 4LDPA 2CB0A 4QNNA 5DTQA 1CJVC 4W82A 2C4HA 5AKJA 5ERGB 3SSMA 4KQJA 4EGAA 5T41A 3FR7A 7MDHA 5JROA 5KFSA 3C6XA 4TZ0A 3VPCA 5EWMB 2NUAB 1NN0A 1QPGA 5CB4A 3FTCA 4H1HA 4Q4HA 3P8ZA 1JTEA 3I01A 4LIPD 4RMIA 5EG5A 3RCBA 3OZTA 1F9AA 4DG9A 4YRGA 3EAFA 1RCTE 3KV3O 4XM1A 4BL5A 2NUTA 5KQMA 2Z5LA 3HVKA 4ARIA 3RFTA 3JQGA 4DS3A 5HRUA 1N6HA 1EM6A 1DL5A 4G36A 1VHWA 2RHDA 1SQ6A 4QX6A 2ZUBA 4YGXB 1Q1EA 2CXHA 3IDSA 1GAEO 4WXRA 3PWZA 2UYOA 1NN5A 3C4VA 1JTFA 3OQIB 3TS1A 3V2IA 4H15A 4O25A 2WYVA 4QDZA 3AVYA 2JEGA 5JPDA 1PWXA 4MVJP 1I6UA 4BVJA 4LV8B 3P0EA 521PA 4DUPA 3VNVA 1VPTA 4R1NA 2GTPA 4N7BA 4D98A 2NVWA 2W70A 3HCEA 3A1WA 3CF2A 2P3QA 2I22A 4QPJC 5D1HA 3WWZA 3O9MA 5LP6C 2VBGA 3JQ8B 5TPWA 1TQDA 4B43A 5HFNA 5A06A 3T7SA 3ND5A 1XRPA 1GVHA 2QN7A 1W76A 3DB1A 4WK2B 1K98A 3C7CB 5J2TF 1JI0A 1EGVB 1QDUA 1RXSA 3GMIA 1P33A 3OPNA 1JMVA 4UARA 3IKMB 5EXDA 3TY8A 3RREA 4CUZA 1VJ1A 1YZKA 3H7AA 3D7RA 1X1BA 2UDPA 3OEHA 4LYDA 4DUYB 5ILGA 4GL2A 3PA6A 4H3SA 1PNVA 4GNRA 1P5HA 5KTRA 3DM5A 1L7XA 2HO5A 1SUSA 2YVAA 3M6UA 3TLGA 1C8VB 3PEEA 3V1LA 4ZIRB 3AR2A 5JQGB 2F1HA 1WXEA 3W5BA 1WWKA 2AUMA 1JLRA 1O75A 2J1LA 5CLHA 4AZVA 4LTMA 1KI1A 5JW6A 3GJSA 3ROMA 1NXOA 3E61A 1EEHA 1TQ8A 2FPOA 4L78A 4HPXB 1W0JD 2G17A 3C97A 2BDTA 4JGBA 2GAAA 4OBBA 5MN6A 1K4YA 1NNI1 1DIGA 3L8HA 4QSHA 2ZJOA 3SBOA 1DIBA 1UXKA 1LX6A 5A2GA 1EXMA 3QE4A 2JKVA 3HBLA 2O8NA 2QTFA 2DT8A 5BUCA 3ZE0B 2W2LA 3BMNA 4L9RA 3OD5A 3AL3A 4UTRA 3A9VA 3OKFA 3QQMA 4WFQA 5EKXA 5G41A 1GAXA 2XGSA 4XWAA 1SEIA 4QPDA 5TQ0A 4BEJA 1HL3A 2I29A 5DRTA 4KN8A 4CQNA 5FL3A 2ZBFA 4MUYA 2P65A 5H4HA 3JQQA 3FAKA 1YS7A 1O0CA 2JFOA 3KYDB 2GZ2A 5GTDA 3M9MB 2GN6A 2XCUA 3T3GA 4YAUA 1TVMA 3DNMA 2ERYA 2ACEA 4H7HA 4P3NA 5H1YA 1O0SA 4GZLA 1HMPA 4MUMA 2VQEB 2ZREA 1BGWA 1AS3A 3SDZA 3KOXA 3OD1A 4P5EA 4M8LA 3FSJX 4LZPA 1FXWA 3FTDA 5EJAA 4B4KA 2OFWA 4H1TA 4NBTA 4X90A 3OJLA 3ZJ5A 2ID9A 4F2PA 1N4AA 3K2BA 3TZ6A 3PXXA 1YVDA 1LDGA 4TPKA 4EZIA 1BWQA 3DMRA 1NVDA 2UUCB 5TF4A 3WIDA 3M4YA 5GZ1A 5KQRA 3H2YA 1ZQ7A 3NHWA 4DWOA 2WA1A 1CS4C 4S2EA 3P2OA 1GQOA 1H65A 1PW7A 5I9SA 3SX2A 1BN6A 2ZWAA 1ZJJA 1GGMA 3ZG6A 1IVNA 2PSJA 3RAJA 5F98A 2C5EA 5B36A 1YQUA 1MIOB 2QN1A 2E6UX 1E6WA 4BE9A 5HJ5A 4F3TA 1RJDA 4NICA 1WR2A 5DULA 4C0LA 4ZYUA 1EFRD 1D3AA 1OROA 1XDBA 1YRLA 2Q1WA 3H11B 1L7VC 4AW9A 4IPTA 4BP9A 1BAPA 1I3NA 1Q2UA 3LHSA 4MH0R 5JISA 4H17A 3LWZA 4O2AB 4YASA 5CDFE 1T1EA 3EWAA 4ALMA 4P3YA 1H1TA 4RB2C 1J8QA 1KYZA 4RD6A 2X3FA 3VC1A 2DH5A 5AK0A 1TKAA 1IBRA 3NS7A 4JCOA 3W9YA 4C2BA 1Q0PA 4YFYA 3FFXA 1MG0A 2RKOA 3L0IB 4RGYA 1B0UA 2I66A 3GIMA 4RA6A 2X6QA 2JGRA 3V00A 2YASA 1WZCA 2XKJE 4FIZA 4D9GA 5F52A 4AG6A 5F9LA 3C1OA 2FF7A 3V4SA 1W96A 1G7CA 5FPQA 2VQ6A 2Q5HA 1XRRA 5EP1A 5J5VA 5AUOB 1VG1A 3KKLA 3ITEA 3BBLA 4KDEA 1R3DA 4KREA 1RU3A 3PNKA 3K1AA 3DBOB 3RJ0A 3W78A 5EHZA 4AMGA 4CM9D 1SKMA 5FFFA 3UOWA 4IV8A 1P6XA 2JVKA 2X0RA 2W0MA 3WHLA 1I7QB 5KG0A 4N8SA 2REXB 3B6EA 4RKWA 5K8LA 4X65H 2PRSA 1HNZH 4HNAA 4R2XA 1DCMA 1JECA 2AVDA 4HGZA 1JJFA 2ZYAA 2P5UA 3UK6A 4IYRA 1K8YB 2HIVA 1J25A 5LOVA 2HV8A 2QPTA 3G9TA 1R27A 4WHMA 2BBSA 4OBWA 3TTVA 5CEFA 5JNLA 4O2BA 4CKEB 2XV1A 3W6UA 1L5VA 4LXXA 1IUOA 2DCUA 2Z9BA 4OFXA 3V8QA 2O2XA 4F12A 1NZFA 3LUKA 3WYEA 1K7EB 1OGYA 2JA6A 3LHKA 2CNOA 3MS2A 3ESCA 2CNDA 4BBAA 3ONEA 4N7JA 2N1BA 5ERYA 1EWYA 5T3UA 2Q62A 3M6MD 1W8IA 3JTMA 3DMNA 1ZN9A 3OT1A 4NCHA 4O7YA 3QBDA 4PTYA 4RQAA 4K9RA 2FZKA 4D9IA 1JZTA 1GNTA 3GLGB 1J22A 1GPAA 2IGBA 3GT7A 3SI7A 5E4TA 2F4VB 4BO1A 5IKEA 4UTPA 1J5XA 3LS2A 2ZUVA 3SPXA 1KZGB 3JYOA 4POAA 2PX2A 3P4YA 1TCAA 2VUMA 1NVFA 4ZJYA 4Y2JA 1HFKA 3CEPB 2QWXA 2G7ZA 4AG3A 1DRJA 1BXGA 1GGKA 4OX9H 2IY8A 4LSMA 3W9UA 4V1CI 1PGNA 3VHLB 5HM8A 5DNDA 2NAPA 5D51S 4G0ZA 4C4AA 3NAMA 3NNDA 4IDNA 4ARAA 3N86A 1XEXA 1B15A 3IQHX 1WXQA 3IA2A 2ACVA 2W93A 1IUPA 3CH6A 2L82A 3SWWA 3GJXB 1HFJA 2EZ9A 4CXMA 2AXNA 4UULA 4DL2A 4Y2TA 1ZC3A 2R11A 4TV8F 2CLHB 4RFSA 1WLSA 4A3LG 1M6YA 2BCGY 2HDOA 4RIFA 4JUDX 2P11A 4YQYA 3AL2A 5J4YA 3M1LA 2Q7DA 3S24A 3MUFA 3VM6A 2FFAA 5KFZA 1IBMB 4K6FA 3GJXC 3S68A 2R6CA 1TUBA 3UTDA 1JAHA 1PP4A 2ALJA 2AW5A 1NN3A 2C3UA 3TLXA 4AKTA 2GM4A 5L1JA 2WYHA 4WW0A 3M83A 1XXLA 3PE3A 5DHRA 4REMA 4EO9A 2GILA 4F2DA 4NYIQ 4D25A 1AX9A 1FYXA 3MMNA 5DI3A 4GOKA 5EEGA 4ENQA 5CIWA 5KNDH 1X13A 3HLTA 4F2WA 3U1BA 1OZHA 1R9NA 4MP3A 1MDFA 5GOZA 3RUFA 2Y4RA 1OQAA 2C78A 2I6XA 4B4WA 4BASA 4YT4A 2H5LA 2VYND 4QFBA 2DZDA 2Q8PA 3NTUA 2ZJ8A 2IYSA 2JLZA 1SPBS 4HEHA 5ESXA 1IBKB 4TV9F 2VCEA 5JXWA 4RVDA 4XB1A 3T34A 1BWSA 3H4TA 3B53X 4I8DA 1FDVA 1Q19A 3FSEA 5KQPA 5D5HA 2JFXA 2PWBA 4RCNA 1HTWA 1OFUX 2OUKA 3DFUA 5KFOA 2PRIA 4Z53A 3ETHA 1PI3A 3ROPA 1IYZA 1E1QD 5KYXB 2QVCA 5HIMA 4X45A 4B7XA 4D0LB 2FYTA 4WZBE 1W5FA 1CRLA 4G07A 3JAWB 2VO1A 2RI6A 4I55F 4BYGA 2ZI4A 1MH1A 2Y0PA 2JGJA 4JBGA 1DXYA 1PLKA 2A0UA 4P84A 2HHHH 5TLSA 2UXBB 5JSKA 3ZHYA 5ALVA 3O93A 4YMUA 1UKEA 2WYWA 2YZ7A 3ACCA 3OJCA 2WD9A 2AH5A 1VRCA 4NPHA 5T6MA 4RNMA 3LU1A 3CUVA 5EE9A 4ESEA 1TYDE 3L6BA 1X1RA 4IJWA 4DPKA 5A3QA 4W5QA 3GJRA 4I6EA 4TYWA 1LDBA 2QLLA 2CHUA 2EX1A 1LEHA 3FF1A 3LKDA 2VQFB 4WDQA 3BE4A 2ONJA 1PN3A 2VRCD 3KYCA 2H31A 2JIPA 1XK7A 3A1EA 4ZT5A 4CN8A 1OREA 1ZHHA 2C99A 1XZGA 1R6VA 1BRMA 4ACBA 1QORA 3DLCA 3K71B 2C03A 2OC4A 3NANA 4UDXX 4HT3B 4ECXA 2ONCA 1EJ0A 3OX4A 3H2IA 3NHZA 3TI7A 1XVIA 2PEYA 4MA5A 3OAAA 4JLDA 4LCBA 1E0KA 2UZ1B 2ODTX 3EG9A 3L0BA 4RYLA 1VL5A 1KMIY 2N1MA 5K0SA 2RMKA 5AKXA 4IIDA 4Y6QA 4N6GA 3UHAA 4S24A 1YSCA 4TL7A 1QKJA 1YB5A 5HW0A 4MKHA 4QYIA 4Y9TA 4OAQA 1O94C 3E27A 2O9JA 1T9ZA 4AMVA 1U8YA 3K0HA 3WHIA 2O52A 2Q5FA 2JPDA 3I4MG 1B41A 1ECCA 1Z4NA 2FWIA 3DEHA 3DQPA 4LNUA 1UC4B 3PFBA 5JNWA 4RA6B 2XIGA 1XZQA 5TR9A 3TOZA 5ALGA 1PLLA 5EPUA 1EVJA 3KC2A 1XYGA 3K8ZA 5EQDA 4IUBS 3F6PA 3KOUA 1Q0ZA 3L8CA 2OHFA 1FP7A 1QIIA 5PGMA 3STVA 5DNCA 1U3CA 3MT0A 1GAQA 2R7MA 4BO3A 4YDSA 2JEJA 1QYCA 2HHFB 1QR6A 4DLLA 3LQYA 3CG0A 4HDRA 3R9XA 3GHHA 5KFJA 5LQAA 4DF3A 4NYEA 2XEXA 2QY9A 3CFYA 3W2TA 1F48A 2HY7A 2ZCJA 4ZVUA 5AKIA 1RFLA 1SQ5A 1CRQA 2I4NA 3MD9A 4ESVA 1RYFA 5CT9A 3MVEA 1Y1WG 4AKHA 3UAOA 4KO3S 3AVTA 3DW3X 3KQLA 4UFPA 2EDCA 1V8FA 4DA0A 2A0YA 1TPZA 4CMJA 2I6QA 1YJ5A 3M9NB 4QU9A 3DYVA 4TQUS 4HB4A 4KXUA 3MFHA 3KEOA 1I7SB 4GMFA 4IOMA 3TTYA 4O3RA 3J81W 3O4HA 4BX3A 1B73A 2DLNA 5J1TB 4KR6A 4ZQCB 1N7HA 2GFHA 2J46A 2G4LA 3FVRA 5E7IA 3TZQA 4Z7OB 2LPMA 4UZFA 3ZE2B 1Z36A 5KKAA 4B17A 4MHTA 3QYPA 3UMMA 3H1AA 1VKOA 2ATXA 3AJ9A 3H16A 2HCRA 4KNVA 3BQ0A 2FCAA 4R2IA 4JI1B 4EATA 2V9PA 4K88A 3RUCA 2E5LH 3MRTA 2NO0A 3WYAA 4QZVA 1TWCA 2PRKA 3WP1B 3VR2A 3IOYA 4HNHA 3T4EA 4YUXA 1L7QA 3AR3A 4K2AA 5CVDA 4QDXA 4EL5A 1U2EA 2VHTA 2GM5A 2J7KA 3TW0A 2YMPA 4X00A 3HCAA 4IO0A 1U0OC 2P6UA 4Q9AA 3QSYA 3REQB 1TX4B 2ZIZA 3V33A 4UTXA 1U1EA 1GUFA 2UUAH 1NRIA 3BMNB 3M9LA 4MEAA 3T3OA 1SY7A 4RAOA 4EQZA 2WIAA 3I4LA 1O9GA 1MORA 2I4TA 5LYJF 3LBYA 3D6UA 1V2HE 3E70C 4MITA 4DRZA 4L0MA 4BQRA 3ZV4A 4DV5B 3HEBA 1P1BA 4CIXA 2A7XA 1M34E 3K2EA 4RCVA 2H17A 1IM5A 1D9ZA 1Y6ZA 2YDXA 2PSSA 2YWGA 4IQ4A 4NKRA 5AXBA 5J5AA 3GZ4A 1L1EA 3FYCA 3VR2D 1Q95A 2ZZNA 4RPJA 4POOA 1IJKA 1Z4JA 2W7TA 1MT3A 1Z0ZA 2QS9A 4QT0A 4V2UA 5CLIA 5IVDA 1BXKA 1DFGA 2IYRA 5CVTA 3RSHA 8ATCA 4XYLB 2WIJA 2Z3ZA 2NZVG 1WQ4A 4EJSB 2KPOA 1UKAA 2W11A 3H1FA 4HOYA 4EG5A 1V71A 2H0RA 4Y1RA 5H83A 5KFHA 2Y2UA 3LUGA 1SYXB 2EOAA 3EDQA 5I4KA 2AQ8A 3TG2A 2UZIR 1JYFA 3QW4B 1F0NA 1RNLA 3KTDA 2FN3A 2NO6A 1YZUA 1Z8HA 2V4MA 2ZE5A 4KI0A 3SHWA 3SMVA 3N2ZB 3WWPA 3B6IA 4XGKA 4IAJA 2ORED 3H4IA 3L0PA 5DNWA 4BLWA 5L8VA 3KT8A 2RAFA 2GEBA 1SXHA 3COYA 4LBVA 5TJHA 1O3YA 4N1AA 1XWIA 2FI1A 3C14C 3NWBA 4QATA 6ADHA 5C80A 4X66B 1LW7A 3A0UA 1VE6A 2C9YA 5LQSA 4E5NA 2X8JB 3KKKA 4EHIA 1BMQA 5EUMA 2PKQO 5A7FA 1R18A 2JKZA 4WY5A 5ILQA 1GU7A 2WJYA 1L4KA 3L0CA 5BV7A 3QPVA 4MRMA 5HGJA 4C4RA 3QP9A 3UPDA 5DOZA 5F4BA 2ZANA 1E2UA 4P3PA 2M98A 3TXYA 1HMYA 4CN9A 3BA9A 4TKUA 2JIOA 1A48A 1FFDA 1YR8A 3A1SA 3EVAA 1BD4A 4J07A 4NEQA 3U7JA 4IEFB 3K9HA 1NYQA 1ZLXA 3FLAA 2AF4C 5A2QW 3K5PA 2Z1NA 5KFMA 1OXKB 2HRCA 3QELA 5G53C 3T1NA 1GNRA 3AWIA 5E1DA 4JIGA 4ZN6A 4IQ8A 2BSXA 1XTRA 3C3XA 1FLDA 1FLVA 1T2DA 3BMOB 3LM8A 3NIFB 4MLDA 5BNTA 3I0ZA 1RJRA 1YKSA 4GR5A 5IN5A 5KWIA 3H99A 2CQYA 3GD5A 1NW3A 1KBZA 2F3SA 3FMPB 3LQ2A 4GLBA 4GT1A 2WWWA 5EZ5A 1TJ3A 3LWBA 3OHAA 4ICIA 3IQEA 1PX0A 1ZR4A 5PNTA 3UAXA 4RVFA 2ZBEA 2QYZA 1BRTA 1FSFA 5CMLA 5HBRB 4BVFA 1L5HB 3CC8A 5A0TA 3HYRA 1CKOA 1NXPA 1QG0A 4G6ZA 5B3AA 1WMDA 4CV3A 3MWLA 1CEXA 1KY4A 3HT5A 4AYBE 2IA6A 5FAXA 1CUAA 3EISA 4Q4CA 1S8FA 1XQWA 4ZCLA 3EEBA 3F4BA 3RIHA 5I48A 4UCQA 3H9BA 4BAUA 4BGEA 2P4HX 4MQFB 5CG1A 4RU1A 3AHDA 4UEKA 3KLMX 5JECA 1RTKA 3DQZA 1CDOA 4PLPA 4OHWA 3SP1A 4IFIA 3C48A 1IG0A 1IXSB 1J5PA 2OBLA 2QNRA 2V45A 2VRCA 3HCWA 3KYCB 4DR4H 4RAQA 4D97A 2QLTA 2W22A 1YZNA 1WP9A 3RPEA 2C96A 4C20A 4F50A 1C50A 4BY7G 1II8B 1OC4A 1S3IA 1TZKA 3O94A 3OA0A 3EVBA 1WH2A 2G83A 3R40A 1FYWA 4GNKA 4UHKA 4X63A 3UFXA 1TMYA 2B94A 4QYIB 1ISJA 2X4IA 1T4CB 5HR5A 1YF3A 3NBZB 1NAIA 1PZFA 5DYWA 2QX8A 4YI3A 1G8AA 1G291 1RJPA 3EZ9A 2ADOA 3C39A 5KFPA 1ADCA 1W47A 1TRHA 2CJWB 4L4YA 4XWYA 4BU1A 2A4KA 2ZYUX 1B1AA 3LW7A 1OTYA 3LY7A 4I19A 1FY2A 3HJAA 1GN8A 2BT4A 4YEDA 2ZYWX 3ON5A 4LF9B 3QXXA 1NBMA 2V58A 1SFRA 1UOPA 3KXYT 3GLSA 3JASA 1IZ9A 4ZC8A 1CF4A 1MU0A 5A3VA 2H1WA 4B0OA 2CYAA 3LKVA 4B71A 2PLFA 2Y9PB 3LHFA 3NBZC 4CM4A 3EXAA 1NDQA 2WU4A 2KWIA 1IC6A 4EGCB 4M7WA 5IXJA 3K3PA 1TJ5A 3VFDA 1V35A 2PL3A 2XF2A 2HHLA 3N8IA 3GLQA 1VHDA 4KYTA 5HUQA 2ILTA 3ZVKA 1OLSB 1JXOA 1MZVA 1V8OA 2R8EA 4BKRA 2XZOA 3DO5A 4G1MB 4XXHA 4RGBA 2UYHA 3WA7A 1JG4A 2BSAA 5M04A 3R0ZA 1ZC4A 4I55A 1DJQA 1B8NA 2PU7A 3GH3A 3HOXG 3EEFA 2YXDA 4KE7A 1NJ1A 3GILA 1Z26A 3AB8A 5EWJA 5SZJA 4F5DA 4FP9A 1Y3FE 2FWJA 3OQ1A 5HEKA 4XIIA 3EUEA 3WE7A 1DAFA 2B92A 1J2RA 2SNIE 4IDEA 2VZ0A 3A4YA 5ARCA 4TWJA 2HMUA 4JI6H 1XTZA 2IYVA 3AFGA 1UKZA 1H05A 4QEDA 3EASA 5KNDD 1X80B 1A27A 3RIMA 1FFXA 2H7VA 4TVOA 4UM7A 4FXPA 2XSZD 4QLAA 3TW6A 1NIJA 3M5PA 1XZDA 5M29A 4S0XA 1L1RA 4Y2QA 4L0QA 5KTSA 4JHXA 2R7ZG 3A3OA 1G3UA 5BWTA 1GZ3A 2VA8A 4G4GA 5H0IA 1EUDA 1XLWA 3DE0X 5CLJA 1GNLA 2OD9A 2BF4A 4ZU6X 1F1JA 3RVJA 4UVIA 3V1NA 3OEEA 2BRUA 2CBGA 2RHWA 4J6EA 3HXTA 4HS9A 4M7RA 1RAAA 5BN4A 3D8HA 1EFHA 1XTVA 1V9SA 1ZVJA 1VLJA 3P97A 1KRHA 1TW2A 4I66A 3LP8A 1U7OA 1E1MA 1E94E 2BEVB 2HSDA 2X6TA 2YWJA 3R77A 3MJSA 1CZOA 3ACBA 3PXBA 4RO0A 3M6VA 1OV4A 2P1DA 1XA4A 2F3QA 2VDVE 1JKJB 3MWEA 4O3SA 3SGIA 1HK7A 3D1VA 3E7XA 3HJUA 1PJTA 4YP3A 2FZCA 3FPBA 5FL7D 5CM0A 3E9CA 4U2GA 3DLBA 4LOHA 3LSTA 2OV8A 2VNKA 5DHFA 1T8RA 4Y2UA 5JSQA 3FPHA 1VIDA 1XMSA 1U2DA 2F3TA 1KIAA 2DR3A 2IHYA 2JI8A 1NRWA 1V5FA 3VNAA 4AJIA 1E9FA 4YA6A 1NR7A 2CBXA 1M73E 1QTIA 5LZ8A 4B5LA 4ND7A 3HXQA 3T3HA 2ZYRA 3QG1A 3R7FA 1WB9A 2IU3A 1G2QA 4WCFA 2NTYC 5SYNA 3ZVLA 5BOSA 3LBFA 5FD6A 3HU2A 8MHTA 1RHQA 4G67A 3KQNA 2VEDA 2VBIA 3VJLA 3VA7A 5BPFA 2AC4A 3OZCA 1NR5A 1EK0A 4F4FA 4ZHQF 1MTOA 4PC2A 1E61A 5IVHA 2R79A 2CYCA 3HMKA 5JAQA 1VMDA 3QFRA 4JYAH 1E3LA 2V7VA 5DU2A 3I92A 1ONOA 2BOVA 3DEZA 1LBQA 4MZXA 3U44A 4NBUA 1QFYA 4HGOA 1ZAKA 4J90A 4EI7A 1NP7A 4CKEA 4O2BB 5HUJA 1VHTA 3OE7D 4Q1AA 1MLDA 3B82A 1SBZA 3STXA 3WBFA 3DXXA 1KAEA 4DV0H 1QR2A 1CS0A 1U04A 1JLMA 1Z33A 1ZWKA 4DLYA 5KVCA 4H0NA 2F9LA 2VT7A 4XYGA 1L4UA 3ASVA 5INTA 3HKEB 3HVHA 1GTZA 2FHPA 4IUDS 2PX4A 4US0R 4BQIA 5ECDA 4BNHA 1BNCA 3HCBA 1I2MA 3RUIA 1HH4A 3FSRA 3I6BA 1DWUA 4KX5A 4N65A 4Y1RB 4F04A 2X5NA 4AS1A 2HGWA 4K0KH 1JTVA 2VT6A 1G8HA 5EUBA 4BKQA 4YS6A 1KFBB 2RF4A 1PSWA 2CFSA 4PZPA 4QOIA 4BO9A 1QK3A 3ZZMA 1RIFA 1PFWA 4TWAA 3I32A 5E9WA 4WAUA 1YDWA 3QA3E 1JVBA 2Z2IA 1Z68A 4WLEA 3TSCA 3B7WA 4DQUA 1U7ZA 2CLIB 2WE8A 1UMDA 2C5BA 1EK1A 1A9QA 2AVNA 3TIIA 1IBMH 1LBTA 1GUBA 1S8AA 2GYUA 3KJEA 5TEWA 1C9MA 4JIMA 1GT91 2REBA 3UUEA 3JPYA 1EVKA 4FLEA 3GDHA 1INLA 4K8OA 3ZCXA 2X13A 3A1UA 4LFBB 3R0VA 4DR4B 5REQB 1ZH4A 1EX7A 4B2YA 2I3DA 3C3JA 1JUDA 3L40A 1J0XO 2Z56A 3RTAA 3BE5A 3A0RB 2GZDA 2WNSA 3DEKA 3KSMA 4TVSA 3GMSA 2X40A 4Z9YA 3C6MA 1DUSA 3GNTA 4C5AA 2CWDA 1TJPB 1Z25A 2ZWMA 3BMQA 1JDBC 1Z22A 3NT2A 4WA7A 2R1TB 3RBXA 1CCWA 1HLPA 1GV1A 2NZWA 3I6YA 4OL0A 1O9HA 2VHZA 2A5DA 4LKRA 3DOUA 1MH9A 1UP7A 2OZLB 3N59A 1ZGBA 4P4SA 3SDBA 3USZA 3ZCUA 3F90A 2Y1WA 1Z2OX 4BMOB 4NZNA 4WZ6A 1FFGA 3KDSE 4FGJA 5HTKA 3RVQA 3ZJUA 2ZJZA 1VI6A 2ZKIA 1H2EA 4IMRA 4Q3AA 1E3WB 1PT8A 4D43A 1AY0A 2GZRA 3GLHA 4NCIA 4PBSA 3ORFA 2G8NA 2ECQA 2DMRA 2GHQA 5EP2A 4NCBA 1M66A 4MUNA 3DAOA 4QU0A 4H31A 4GPAA 1FTGA 1TWHA 3I0MA 3WWCA 1SURA 4IJKA 3MUOA 4CMFA 2IP1A 4DLUA 4YAFA 3PR3A 3REGA 1D6JA 4JSYA 4OQYA 3B48A 4U7FA 3CZCA 3USCS 5BWXA 1RP1A 4CE5A 3VVLA 4ME6A 1ZD5A 1MIOA 3CSSA 3I05A 4DDMA 3NR2A 2I6GA 3G6XA 4L3VA 4C4SA 3NMUF