The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
91
|
sequence length |
306
|
structure length |
306
|
Chain Sequence |
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb |
molecule tags |
Membrane protein
|
source organism |
Rattus norvegicus
|
molecule keywords |
rat synapsin I
|
total genus |
91
|
structure length |
306
|
sequence length |
306
|
chains with identical sequence |
B, C, D, E, F, G, H
|
ec nomenclature | |
pdb deposition date | 2003-06-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02078 | Synapsin | Synapsin, N-terminal domain |
A | PF02750 | Synapsin_C | Synapsin, ATP binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | D-amino Acid Aminotransferase; Chain A, domain 1 | ATP-grasp fold, B domain | ||
Alpha Beta | 2-Layer Sandwich | Dna Ligase; domain 1 | ATP-grasp fold, A domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |