1PK8A

Crystal structure of rat synapsin i c domain complexed to ca.atp
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
AARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rat synapsin I
publication title Tetramerization and ATP binding by a protein comprising the A, B, and C domains of rat synapsin I.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 91
structure length 306
sequence length 306
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02078 Synapsin Synapsin, N-terminal domain
A PF02750 Synapsin_C Synapsin, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1pk8A03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1pk8A01
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pk8A02
4I50F 2R82A 3GIDA 2J9GA 1VKZA 1KJJA 5D8DA 3K3PA 2YRXA 2PVPA 2W6QA 4EG0A 2PBZA 1Z2PX 2FB9A 2YRWA 2NU8B 3Q1KA 1E4EB 4O4HF 4XYLB 1JDBB 4O4JF 2YS7A 3ETJA 3LWBA 1I7LA 2YWVA 1M6VA 4O7VA 4YJ3F 4O7NA 1C3OA 1M0WA 1A48A 1BNCA 3JRWA 3OUUA 1GLVA 3ORRA 4XX0B 4FFMA 1SCUB 3K5IA 4O84A 1GSOA 4O4IF 1GGOA 2YZMA 4DLKA 5I47A 4IHJF 3U54A 1EUDB 4XYMB 3N6RA 4MV6A 5EZYF 1KC7A 3MJFA 4QSHA 3DF7A 2W6NA 4O86A 2Z04A 2R7LA 4MV7A 4DIMA 4ME6A 3AX6A 3KAKA 4WD3A 4FGRA 5HV6A 4FFNA 2NU7B 4O2AF 2R84A 4I4TF 3ORQA 5H80A 1JLLB 2NU9B 4O82A 5BMVF 2ZDGA 4ZQIA 4O83A 5J2UF 1EUCB 3TW6A 1UC9A 2SCUB 2OLSA 2YYAA 2X0SA 2W6OA 1JDEA 3RUPA 5C1OA 4MAMA 3U9TA 4MV8A 4GGMX 1AUXA 4M99A 2WYOA 4I55F 3U55A 2NPOA 4RZQA 2DZDA 2GQRA 4EABA 5JQGF 4MV4A 1E4EA 1UC8A 1PX2A 1AUVA 1KJ9A 1PK8A 4HNVA 4YB8B 2W6PA 5HBRB 3TIIA 3MWDA 4EA9A 2GPWA 5BPHA 1KEEA 1B6RA 4IWXA 3KREA 2R7KA 2YS6A 4FE2A 1OBGA 2IP4A 3N8DA 2YW2A 4WBNF 3JZFA 1BXRA 5JH7F 1DV1A 4O7LA 2FP4B 2YZNA 2V59A 1Z2NX 4HNTA 4FFPA 1KJ8A 5DMXA 2GPSA 4FFLA 4EA7A 3R23A 3VMMA 1W93A 2W6MA 2CZGA 2HJWA 3HO8A 5BPFA 3BSSA 4O7RA 5CAEB 2ZDQA 3R5FA 4HNUA 3NUAA 2V58A 3JRXA 1I7NA 3G8DA 1EHIA 3OUZA 5C1PA 1C30A 2YZLA 4FU0A 5CA1F 3R5HA 2R85A 4TUYF 4IWYA 1W96A 3RFCA 1IOWA 2HGSA 1B6SA 4YBZB 3V4SA 2DLNA 3R9RA 2CNQA 1GSAA 3AW8A 3WO1A 5JVDF 1KJIA 3VPBA 4Y8VB 3TIGA 2R86A 3Q2OA 4O7TA 3BG5A 4C5AA 4O81A 2XCLA 2P0AA 3ETHA 4YAJB 4TV8F 4M9UA 2I87A 4EGQA 1A9XA 1KJQA 2VR1A 4MV9A 4FFRA 1EYZA 1IOVA 4MA5A 4HQ6A 3HB9A 3E5NA 2Z02A 3VPCA 1KBLA 4J6EA 3I12A 1DV2A 2QK4A 3GLKA 2YZGA 3KAJA 3G8CA 4IIJF 2FPGB 3VA7A 5JQWA 4MV3A 4O2BF 5C8YF 3KALA 1KUTA 2NUAB 2W70A 5CA0F 1CE8A 1CQJB 4ZHQF 5CB4F 3TINA 5LP6F 5LA6F 3JZIA 2W6ZA 2NU6B 2DWCA 2FPIB 2DIKA 1OBDA 4O7ZA 3RV4A 4C5CA 2YL2A 3VPDA 2CNUA 2XD4A 3K5HA 3QFFA 4O7YA 1ULZA 4YAKB 2CNVA 3TQTA 3WNZA 4MA0A 1CQIB 5LXTF 4YJ2F 3LP8A 4XZ3B 4EGJA 3BSWA 1VBGA 4M98A 4O7SA 3HBLA 4FFOA 2W71A 4E4TA 2V5AA 5LYJF 3BFPA 3BSYA 3MWEA 4C5BA 5GONF 2GLTA 3U9SA 5FNVF 2GQSA 1M0TA 2I80A 5K2MA 2VQDA 2R7NA 2ZDHA 5KX5F 3R5XA 4ZOLF 4NYEA 2CQYA 4EA8A 1WR2A 1VBHA 4EAAA 2QF7A 3V4ZA 1T36A 3RV3A 4ZI7F 3UFXB 1JKJB 4L1KA 2VHEA 1GSHA 2I8CA 2R7MA 2FPPB 1Z2OX 3VOTA 4M9CA 3WO0A 5LOVF 1DIKA 2R87A 2C00A 5J2TF 4HR7A 2R6FA 4O7WA 3SE7A 2VPQA 4MV1A 5JVLA 2PN1A 4IZOA 4TV9F 1EZ1A 5KKNB 1CS0A 5IYZF 4O4LF
chains in the Genus database with same CATH superfamily
4RB0A 4PQFA 5FOXA 1KQPA 3UJPA 4BNLA 3NONA 4KXNA 3K9NA 2C3YA 5IKOA 2HWWA 4GFDA 2PSFA 1X77A 4H6PA 5BV2P 4I6GA 5H3HA 2PLWA 2I3BA 4M4SA 2EIYA 3BDAA 4M0FA 4KJZA 1IB6A 4LQLA 5KOYA 2XGPA 1NQXA 3COVA 4FFDA 1VGQA 1JHXA 1Q77A 4M1ZA 1A9ZA 4J9RA 3U54A 1EUDB 3BZUA 4Z6KA 2Z1DA 3SSAA 1HC7A 1NG1A 4EY8A 4K46A 3PI7A 5BORA 2W6NA 4DWOA 1U0NA 1IUKA 4F4XA 2J9FB 1NHWA 4RGBA 1STOA 1FFCA 5ENZA 3LW7A 5K9ZA 2XRZA 1RJFA 4AO6A 4JL5A 1L7PA 4Z4EA 3E2MA 2G9RA 2VNIA 2UVQA 4LJSA 1CUZA 4JJEA 1B6GA 5HIJA 1P9NA 3IR5A 3VYWA 1OA1A 1GVNB 3G6KA 2DZDA 3T3HA 2Q49A 2Z0MA 1P1CA 2I76A 2JA6G 2CW7A 3G5AA 4NARA 2AE2A 1GNPA 1UPTA 3FZGA 3DYBA 4A8PA 2CXQA 4ZQHA 2G82A 3W5IA 3CF6R 2OD9A 2N9UA 1QCDA 3DHNA 1B93A 4I4LA 3BWDD 4BLQA 2JI7A 4UM7A 4ND7A 1A2QA 3SQMA 4QXQA 5IXJA 2W93A 4E1VA 2HNBA 4EGCB 4EHLA 1EVEA 4HQNA 4WXPA 4EA6A 1FU7A 3NHWA 5EJ2A 3R23A 1DQYA 1OZ0A 3C6BA 3J80W 4C06A 3L02A 2ECFA 3FWYA 1SJ9A 1CUCA 5EZYA 5DFAA 3EPJA 3KU4A 3ROMA 1KK2A 4N5NA 4Q12A 4ZREA 3I6BA 3SJAA 2H51A 1M7GA 2O2EA 3DLAA 3M6FA 4AURA 4RJ2A 1ARZA 1DVRA 2A1TR 4CVNA 4DYVA 2WU3A 1PYDA 2BR5A 2F00A 4TN5A 5KWIA 2MINB 2Q9CA 3QJGA 3SK0A 4ED0A 3CEBA 2DU8A 4DPMA 4MQ6A 1A7AA 3NVKI 4ZCLA 4H1VA 1QU2A 2HAEA 1ZH6A 3V1NA 1HKUA 4JI0H 1C2YA 2I6SA 3NVDA 4CNQA 2QN3A 3VUFA 1CRPA 1ZQ7A 1M73E 3TPFA 2WYIA 5CEEA 1XU9A 4CQMD 1EX6A 1IN6A 4DQNA 1G1AA 3IA2A 3KALA 2CXTA 4F4CA 2P90A 2IEZA 2XKBA 1E4FT 4KRGA 2D0PB 4YR0A 4ZXFA 4EM6A 3NHMA 3PBKA 2GEBA 1FZTA 2ARKA 4V0LA 3TFQA 3UG7A 3C5VA 2GJAA 4U7DA 3BE8A 2WDTA 4JI1H 4O7YA 2ATXA 3TIXB 2HLNA 4YAKB 4EHBA 2ZM6B 2CXNA 3GDFA 3WRYA 1EFTA 4U2FA 4ZYVA 4DQUA 4X1KA 4EFEA 5A5VA 2AMYA 4MP8A 1G9XA 1U7WA 2VJQA 4C6TB 1RRFA 4ERXA 3GPBA 1T0PA 4GE3A 4FDUA 1J8MF 3FCYA 3L4JA 3GFOA 3U9SA 4KC0A 2GNPA 4G1MB 3W0LB 2HLPA 1JNYA 2PR7A 4B1FA 2GGSA 3RAEC 5ICCA 3PW0A 3GDHA 5LQMA 3G7SA 2J3HA 4QLBA 5I6DA 5NULA 4BKUA 1G60A 4DSUA 4MHTA 1ESDA 4ILKA 3SHFA 2Z3ZA 3OHMA 1XZNA 5HBRA 4XUCA 3LLSA 1Z4MA 4UU8A 4KYIB 3HXKA 3E9DA 5BWWA 1OH8A 1BX1A 1LBTA 4U0JA 5ICGA 5KYWB 3TRDA 3FVQA 2FR0A 4KQIA 1GR0A 3ITDA 2GBLA 4F6RA 2BPOA 3HCCA 3AU8A 1L5YA 1RYBA 3CX7A 2C4UA 3UYYA 5CAEA 3DQQA 4QOJA 3Q9SA 2ESRA 3GFVA 4Q02A 1WY5A 4CEIA 5A3SA 1UK8A 2AN4A 1W46A 2PCJA 5DM60 1RJ9B 2W98A 3K09A 2QX4A 5LNK6 4LVUA 1M6VA 1SN7A 3BXXA 3KZ1E 5GONA 1Y5NA 1EIWA 4XYBA 2B4YA 3HOXG 1YQEA 2WM8A 3AEUA 3IERA 1Y4SA 4QU9A 4FC7A 3O2NA 2IYYA 1ZK0A 5I7WA 4ZJPA 1M2HA 1OZFA 1OHHD 3CLUD 1XTJA 1ZETA 3NHKA 5ICEA 2H1LA 1WMSA 3RUFA 1RQGA 4MQEB 3L0OA 4JYZA 4FGRA 2R6R1 1NQOA 5LOVA 1G18A 2QS9A 2BISA 4KFUA 1M9NA 1EE9A 4OYHA 4PIPA 2HEIA 3AV0B 3N58A 3FN4A 3VR6D 3AHJA 3NEYA 4RB1A 3H86A 3ZHYA 2FSUA 3T3MB 4M88A 3OJWA 2PMCA 4WX2B 2ZQ5A 1SBNE 1M2VB 5AK3A 3AUAA 2PUVA 5EMMA 1ZNXA 2BE7A 2C5EA 1T94A 1DV1A 1YMUA 4W5TA 3MZ0A 3CUTA 1MO2A 1LPMA 1YQXA 1XD8A 1AXGA 3R0IA 2II6A 1JW9B 2J41A 1CKNB 2AOWA 3P96A 4BOYA 3AP1A 4X85A 4G26A 4NK5A 5CCBA 3ZQ4A 2Q6OA 4X6YA 3TIVA 4D44A 1G291 1X94A 1MPXA 1R8XA 4HLNA 2XGMA 2BM0A 3OUZA 3EG9A 3FDXA 8AT1A 4QYTA 3COWA 1E9FA 2ZPUA 2P6PA 4NG5A 5JNWA 2MWMA 4GPTA 5GOTA 4J9NA 3ZKAA 1NI4B 1QRSA 3R9RA 5A9TA 1DHTA 2JFUA 3Q87B 1XQYA 3IXLA 5FTJA 1UKBA 4DM4A 2DAPA 4A0HA 4ED2A 3RYIA 1EDEA 2Q6LA 3PW5A 3GT0A 5C3EG 4YALA 1U4NA 1JQLB 2ZU0C 2R68A 3UBMA 1DEXA 1A9XA 3UJ8A 2BUBA 5T6MA 2VHUA 3DE7X 2AZDA 4KLAA 4DLXA 3R0XA 4GH5A 4II3A 2O6HA 3AXTA 2QNIA 4DPLA 2TSYB 4WXYB 3EIQA 1CVLA 3IMGA 1G8MA 1KI4A 3JQQA 4CM7A 3I2KA 1R0SA 1VSVA 4EBBA 3VU8A 3BX1A 4TRJA 4LTMA 4V0NA 3CF4A 4RTLA 4BFXA 4MVJM 3LT1A 5ALQA 4O3MA 4O4JB 4FD3A 5EJMA 2A8YA 1QONA 4OHFA 3STYA 3U5ZB 3CIFA 3IEXA 1I1HA 4O7SA 1U7OA 5ITWA 4O4IB 2FKNA 5FNVF 4BBRG 5B57C 5C5IA 1RPJA 5K01A 1SXGA 4ZAZA 1L5QA 2AXNA 3LHFA 3I8XA 5I4CA 2WTAA 2IY8A 1AF4A 4C0WA 4LFCH 2PMKA 2ZJYA 3NHBA 4CZ2A 2YNMC 2DG2A 1WRBA 3VUEA 1W6RA 1EGVB 1K6XA 1GDDA 3OIYA 1IMOA 5EYPB 2ZRIA 3WLQA 4OXYA 4NYMR 3OFJA 2CJWB 4FOLA 1W4ZA 3ZGZA 1TGYA 2C9MA 4OEHA 4IZOA 4AJKA 1JKIA 1VB3A 5J1SB 4BNDB 5DI3B 4X8LA 2WIAA 4CGYA 2IA5A 4JI3B 3AB8A 1QYVA 3BRSA 3U37A 3HHEA 4ZANA 3N2YA 4B75A 3WL6A 2WSLA 1T34A 4C4XA 3ELDA 1I7LA 4QWEA 2EV9A 5FA8A 1LA2A 3ROFA 1QAQA 3ICOA 3IQWA 2OUKA 3VM6A 3Q6NA 2I5PO 4KQ2A 2H2GA 2FPUA 1ZHOA 1ZEJA 5GINE 3UJDA 5JC1A 3A2MA 2G9UA 3MFHA 2ZUVA 4KQGA 2Q99A 3M9NB 2G1KA 1Y6GA 5CDSA 4EYIB 4O2AF 2H2DA 3HO1A 2IZ6A 4FIDA 3LRTA 2WZDA 5KU7A 2Y93A 1VLLA 1E1CA 1IBSA 4W5RA 3IJEB 4MTEA 1IAQA 4Z1MA 4X97A 3AO0B 1EVYA 3P0FA 1KQGA 5HGXA 4JXXA 3OCVA 5KC9A 4EDHA 2IU0A 2G9QA 1USIA 1PWXA 1G0NA 1UOQA 4MR8A 3IAEA 4B3XA 1Z6PA 2WAAA 4YCAA 3AEXA 3INTA 5AM0A 3JAWB 3UHPA 2XZOA 3B36A 2J48A 1V39A 1JHOA 3PXUA 3T5TA 3PNBA 3OU2A 2QQGA 1P0QA 3O8QB 5L53A 1US8B 5CVVA 5FQOA 2F43A 4GKKB 4M87A 4GVLA 2F3SA 4KHPH 2OCDA 4XOIA 3WHPA 3GBPA 4DDTA 2QVZX 1AJEA 1W93A 1YULA 1G8KA 3BSSA 3IAS1 2QTVA 3V9PA 3GMIA 2VPXA 2BEUA 3C8DA 3SZMA 1V4NA 4MDEA 4KQMA 3DL2A 3NHPA 1JQAA 5JAPA 1WXDA 2F1OA 4UE6A 5J2UA 3UK2A 1IN7A 1DUVG 5I7OA 1KBOA 3OU7A 2PV0A 1YRHA 2ONYA 3AZOA 1NG9A 3VPBA 4HP8A 2N47A 3MXOA 1L5FA 3EH1A 3F90A 4FKBA 1DWUA 4QO8A 4O3FA 3HXQA 2XCLA 2KMLA 2O59A 2ZUEA 1KVRA 4J9MA 1RWPA 3TQFA 3LOUA 2GZHA 3ZCQA 3N0XA 1N2SA 3D8UA 5AVQA 3KJIA 2D1SA 5F2KA 3KOUA 3TM5A 2XYVA 4LJYA 3I2JA 4S12A 3DKVA 5HYVA 2J9ZB 2O2YA 3NDPA 3C6KA 1YFZA 1CE8A 1ADYA 5ITZB 2XXAA 4G09A 1Z8FA 4BYGA 2GZDA 3AHGA 4A2AA 2ANCA 3X2FA 4AUEA 5B1SA 1QH9A 3DDHA 1IL0A 4QATA 1BS9A 4PM4A 2QU8A 2BFBB 2EFDB 4AZVA 2HDNB 2PEZA 4YMWA 2O23A 1KEKA 1DLIA 5KNBA 1Q7GA 3SXUB 1ZAKA 4YI5A 2KE5A 5K2OA 4C4OA 1QYXA 3SMVA 3LPNA 1DXYA 3LS2A 2CFMA 1W1IA 3TLGB 1TKBA 4TLMB 3O1HB 4TRNA 2HA5A 1G59A 1FP4B 2GLXA 3TSCA 1RJDA 4Q9NA 3OPQA 1JE1A 3TR0A 2NYUA 3IN5A 5CNJA 3PJRA 4YAJA 2ASDA 3F78A 2QP3A 3BERA 1WA5A 3FBTA 3QBTA 1NPYA 3SEZA 4CPDA 3DE4X 3PFBA 2QAJA 1NHGA 3NI2A 3L8HA 4L57A 2RE8A 4ZI7B 4JLNA 1ODIA 1R88A 1NXWA 3A4IA 1ML4A 2P69A 2FK1A 2F9MA 2OM2A 3M83A 4MUHA 4WQMA 1YZKA 4M9CA 3U44A 3FHJA 5JBQA 4JROA 3VVCA 3NH6A 5CBKA 4HAXA 4WKPA 3RBEA 1H5UA 1E9CA 1E3WB 4LWOA 1Z37A 4UBKA 1Z18A 3RTCA 4MS3B 3V4FA 5FPKA 4JQOA 5FLXA 3LVFO 3JSAA 1N9GA 2QPOA 4CL3A 3I34X 3DDUA 3HJGA 4TLDA 4EL0A 3GIIA 1KZ1A 1YO6A 3OQOA 4R7ZA 2QX9A 2M6SA 2GN8A 2Y0CA 3V1UA 2X3FA 1ST3A 4U7FA 2V0GA 1TAGA 3SKXA 4WKNA 1LFAA 2CCKA 3EIXA 1A96A 1XC7A 3I92A 3SY8A 5GV8A 2IHNA 1OIXA 1UEXC 3QVLA 1EDDA 1PQ4A 1TM5E 4B17A 4HMPA 3DTNA 3U7QA 2E4XA 1CUBA 4DR2H 4B44A 5KQLA 1KAEA 3FNHA 2ONKA 5HVNA 4NYJR 3PWZA 1IHXA 1U9YA 3DZDA 4EENA 1GA1A 5EMHA 1EKVA 2Q1WA 3EULA 4ZVLA 3PLNA 4DMUB 5FWAA 2CV2A 1UAAA 3ILYA 3E22B 3EGOA 1KJ9A 3D6JA 4FT4A 1Q2XA 3QWAA 4MUKA 3AR8A 1OBGA 5ULLA 1XRJA 1K0FA 1PJLA 2FUG6 3G9UA 1GD1O 1P61B 1AMOA 3KUXA 1BU5A 1KYXA 2Q9UA 4UBLA 4A7PA 4JEUA 2P2CA 1L4BA 5JNLA 1P4JA 4U9IS 1JYFA 1X0VA 2ZITA 4RHEA 1V35A 2HDWA 1XTIA 1YE8A 3Q40A 4P93A 1GITA 5F4ZA 1QK3A 1N7HA 5GZ3A 1QQ5A 1TMYA 3WYEA 4AWAA 3CZQA 1JFTA 3NAMA 3IOBA 2C7RA 4E51A 2YY7A 1BC5A 3OM1A 3A9VA 4KSCA 4M89A 3EOBI 5D01A 4G56A 3L93A 5KQSA 3NTXA 3ANSA 4XM1A 3EMVA 1JG4A 3QG1A 4R8UB 2NV0A 3IUSA 1YS6A 1P29A 4M8SA 4YRRA 3PO2G 3FPGA 1Z7BA 1FW8A 4NJEB 4E88A 3UUFA 4AF7A 3O2QB 1E1NA 3ONNA 1A5AB 4IDAA 3CNLA 3ESCA 2O8DB 1X2EA 4EG8A 4EPTA 3IV7A 5IXSA 9GPBA 3V4VB 2YJ4A 3DMRA 3ENKA 4KPUA 4ICIA 4KVZA 4HY3A 4MVJD 5DOVA 2JGRA 1KK0A 4CM9D 1X38A 2ZJ2A 3STXA 3GUVA 2LGJA 1LK7A 1OWLA 3Q3HA 1Q17A 2BOVA 3IFSA 1FJGH 2Q2TA 3VPDA 3O47A 2RGDA 3ME5A 2QPAA 2IMWP 3CKLA 4M36A 3DKIA 5YASA 1YS7A 2E2WA 2P41A 3V4RA 3R3WA 1NQ5A 1GL3A 2NT3A 4U1RA 3P0EA 121PA 4R2WA 3MPUA 3KZKA 3L6RA 2O19A 2QX7A 1UT5A 1MABA 2GFQA 3EDQA 1QO0D 3CEPB 2TMKA 5JAOA 4B09A 4KPYA 5FTKA 5IBQA 3HOWG 1LPSA 3RIYA 1EK2A 3HBJA 3PU6A 1L5MA 1CDOA 3IGFA 5D1OA 3ZHBA 4I1RA 3JYQA 5I8PA 2GJSA 4FBMA 4C0KA 2ZEJA 4AROA 1CZRA 2Q3MA 2ZUUA 2XMCA 3EXHA 2GILA 2BKEA 1SVSA 5KT6A 1AS0A 1C3VA 2I7TA 1YA4A 3W5SA 2Z08A 3QNUA 5UKDA 5B7QA 3ML1A 3TLBA 5DZSA 4P2GA 4RIHA 4N0MA 3MQ2A 2I3GA 3OLCX 3CU5A 3T7RA 1Y5MA 4KMOA 4TXJA 4B6FA 3C3JA 2PXCA 3D4LA 3M9XA 3I5XA 3T4UA 2IOFK 4HXGA 4MS4B 2OBBA 4RELA 1I5OA 2J9RA 1M6HA 4PTZA 1D09A 3USES 3U3DA 3PPXA 4OHUA 5GTDA 2CJYA 2J3JA 2VJLA 3EEOA 1P7CA 1FXWA 1NVXQ 2FZKA 4X64H 4G6ZA 4N3GA 1VHQA 3TD9A 3NASA 4U2CA 5AW2A 3QEMB 2FJZA 4DEVA 3FBWA 2OXRA 1ZN9A 4ITUA 1L7RA 3AERA 2FPSA 5EZYF 3ZY5A 3GJRA 3VR4A 6PFKA 4TUYB 1QDLB 2WAQA 1NT2A 1Z7YA 5DXJA 3UXYA 1YKGA 4Q7EA 2NU9B 1WNFA 1DXHA 2ID8A 3TGLA 4CFSA 4NEHB 2Q1XA 4KSBA 4KQCA 2BSXA 1HETA 4ZK6A 4NYJQ 1I4DD 3U9TA 5A6SA 1QANA 1KO8A 1ZGCA 1RRGA 1BD3A 4BNHA 2D00A 1RC8A 2FPIA 1L1EA 1E4EA 3QEBZ 4QOGA 4IO1A 3MCZA 5K51A 2NW6A 2Z8YA 3MWDA 1XWIA 3S2FA 4NP6A 1C8VB 3D8SA 5THKA 3QU9A 5FDFA 1JLKA 1Z12A 5JATA 4PPNA 2HT1A 4DIUA 3KVOA 5HS6A 1TM1E 1E2LA 5A5DA 4I6JA 1O95A 4HRVA 1GGNA 3THXA 1I2MA 2R60A 3ZCUA 2HIMA 2XE4A 3OE7A 5EJ4A 1WLSA 1D9XA 3WMRA 5FD5A 2Z3WA 1UKAA 3I28A 3B53X 4OGKA 5IJXA 2BGWA 2H00A 1GPJA 4M8KA 3D3EA 2XNJA 5G4KA 5CFOA 1P75A 4H1WA 2R66A 5CP8A 5ERXA 3KIPA 1PN3A 2ILTA 3DDSA 1OPRA 1RLJA 4LOAA 4CETA 1FA9A 3GIQA 2AI1A 1C3OB 1RP1A 1ZSNA 2OHIA 2P1RA 4O0LA 1BEZA 4FCWA 1A5BB 1TL7C 2HRDA 3AYZB 4D9JA 3KV1A 2RAVA 3WWDA 4IXWA 2JIZA 3KJEA 2EKDA 3B1JA 4U7WA 5DXFA 4Q4HB 1Z06A 3RVDA 3HPRA 3TCKA 5CT5A 1I94H 4UHKA 4CLRB 1M54A 4QJ4A 3FB4A 1RZVA 2QV7A 4XYLA 1EJ0A 4CE6A 3FIJA 1JSLA 2ZUSA 5EUQB 3JZ6A 5L4SA 4QEZA 2WINI 1O54A 2J30A 4BKOA 2O3TA 2CHEA 1WEKA 3K0KA 1KGDA 3IE2A 4UM5A 1BZYA 3HKBA 2XXBA 1V8DA 2JIPA 3R5SA 4Y6PA 1W94A 4MINA 3WAKA 1XDZA 2WSYB 5JCJD 5J5AA 3WK8A 2YIJA 3GDGA 3K5HA 3QF4A 1Y8AA 2AQ4A 2Y1EA 2XF2A 1C0EA 4FLEA 5H59A 1JFLA 4YCSA 3A1UA 3AF5A 4BNIA 1WTAA 2DUNA 3D6HA 4H7EA 3UUEA 2O4UX 1GPUA 5K8UA 2RGAA 5F21A 3NJ4A 1PGOA 5GONF 3ICWA 2BFAA 1D2MA 1GQOA 2AI2A 3UHFA 3V2HA 1XZKA 4YO8A 5E6SA 1EFVB 1UDAA 4EJ2A 5B4UA 2ZJ3A 5K3SA 2JRCA 4EFDA 2BMWA 2XE6A 4DR6H 1W76A 4FMPA 4KQ6A 2RHHA 5KYKA 5JARA 1CEXA 4TYWA 5AXDA 5LOVF 3D2BA 2CV0A 3TE7A 3FPHA 4E4YA 3DQZA 3ETGA 2Q3LA 3KXYT 1T9GS 1K8RA 3G13A 1NAHA 3EAGA 3SQXA 1QVZA 1GRCA 1ZD2P 4S1PA 1OLSA 4RC9A 3IKMB 4IDOA 2GWRA 4MUXA 1CDDA 2V6JA 4J76A 3D2AA 1RQLA 3IUPA 1H1LA 3FRJA 3ZWCA 1OZGA 5KJ1A 3B2NA 3NHRA 4AJ4A 3ZHSA 2ZULA 3L7JA 2QORA 4QXOA 3U4QA 4MPRA 3PFKA 4JYCA 2XUJA 5JCOC 5EIBD 3SYMA 3EAQA 4BU0A 1K88A 3CO0S 3AVQA 3CBGA 1XX6A 2HQ1A 1Y89A 1RYEA 1Q22A 1B00A 4N9WA 5BR1A 2WQ6A 3TB4A 5REQB 3SQNA 4Z7QB 1OU0A 1N5RA 2W90A 3EODA 3KVVA 3R3XA 2Y1LA 4A15A 1V7PC 5BWCA 3ZV7A 5AP9A 2WTUA 1T0IA 4WVLA 1CUGA 1RZ3A 2YC4C 5ALYA 3A1WA 5KYUA 1JQ5A 3C1TA 2OGUA 3ZEIA 4DL3A 3UK0A 1UXOA 3ZDZB 4AD8A 5JNTA 4I4TF 1ZLYA 5ICMA 3QE9Y 2ZDGA 5HZGA 5KFRA 2VO1A 2OO3A 4X1YB 1F1JA 1CR1A 2NUAA 1CF9A 5T41A 5B2ZA 4C4TA 1Y9EA 3VI4B 5EWEA 4TTTS 3HUDA 1XTBA 1LTHR 5H1YA 3BGIA 3BJRA 4YIKA 4Q5IA 3DV2A 3O9VA 3ZE2B 5DX0A 2REXB 4RV9A 3TRFA 3QI7A 3LGSA 1YCDA 1L4HA 3UWKA 4DL4A 4MMZB 4M76B 4NCKA 1OWMA 3DZGA 3ZDDA 4JYAB 4AZWA 1ZNZA 1Y6FA 3AKEA 3PRHA 3PNQA 3GLGB 1ITZA 3AV3A 1H2BA 4KPGA 5TXGA 1Z47A 4CF3A 4ECSA 1E6EA 3SQDA 3VDQA 5G53C 5BSRA 3ZDXB 1ZPDA 3QTTA 4OOFA 5ALUA 3UZOA 1VPWA 2Y0DA 2JCGA 3PGXA 1CETA 4RF5A 3PC8A 4Q48A 4A26A 1TWAA 4X65B 1JLLA 2V9WA 4LYHA 5BMVA 1RIFA 3AC0A 4FU0A 4AL4A 4OHKA 3Q0IA 3QLTA 3WWHA 2YJGA 1B6SA 2F3QA 4J2OA 3OMWA 4ZT2A 4MW5A 1YR9A 3FYUC 4I9GA 2XQJA 2VDPB 2I4OA 1G8JA 3GG9A 1ZVVA 5FUWA 1N33B 5E7JA 3L1UA 1CP3A 3PKJA 4ZVPA 3HXLA 3EZ7A 3ENWA 1ZHSA 1S4QA 3ETEA 2C7QA 2WZCA 4IZIA 1JR6A 4ZO7A 4MI1A 2J7PA 1UBSB 4A3DG 2C78A 5C7YA 1DOHA 2F59A 1XWFA 3R0JA 3SSMA 3VQTA 2J7KA 2XCTB 4GDMA 1U2DA 3AF1A 2HTFA 4ZIRB 1JDSA 3ZE9A 2C54A 4TQ9A 1ANKA 1P2GA 2YWCA 3SR3A 4KHZA 2COEA 1EB9A 3RGXA 3KJFA 1NQAO 2Q3CA 4WNYA 1P7YA 5IAJA 3DLBA 3QVMA 5KCZA 2OYCA 5JHGB 1P74A 4KGVA 1L4MA 5LSAA 4WW0A 3HUTA 3G0HA 1G20B 3RGZA 1YQDA 3VOSA 4RX1A 4DL7A 2HGZA 3FY4A 1CFZA 2JA1A 1PAUA 2QRPA 1P73A 1CG6A 1YJBA 4REMA 3DAGA 2CLSA 5CYPA 1YR8A 4YV1A 5KT5A 4C0LA 1S9FA 3TZEA 2ZR0A 5CNIA 3DOIA 3DXYA 2SCUA 4Q9AA 2UZ1B 2ACEA 1ZRMA 1PSDA 5HNEA 4WK6A 2B36A 2DAAA 1NBME 2VF8A 3A25A 4XRRA 1VJCA 3OESA 4B7AA 3N8GA 4POAA 2EZ4A 3T7CA 4CR7A 4FDTA 3R4CA 1OROA 1K5PA 5ALTA 4DJFC 2Z2XA 3LL7A 2IYPA 1V16B 2AXQA 2Q9AA 4LBZA 1KRHA 4KR6A 4RV5A 3LGXA 5AFSA 3OIDA 4N18A 1JLMA 2MR5A 1PTJA 1ZI8A 1ZVQA 4X1IA 3JTEA 2C00A 2RI6A 2HXYA 2BEWA 5DTJA 2XGOA 3G02A 3K0BA 1DT3A 1DQZA 5BW5A 3OOWA 5ALXA 2WT8A 4D9EA 4QPNA 3VXKA 2JAXA 3N40P 2WD9A 3F8SA 2CMHA 4DG9A 4J07A 5D8DA 1T6XA 2CNKA 1C9YA 2IDJA 1BA3A 3HCOA 3P71T 5AWFC 1F8FA 2QRMA 3KTAB 1SB8A 1OXTA 3G2PA 3PP8A 1R9TA 2QMZA 2PWAA 4O7NA 3JRWA 1OB5A 4KAAA 5FEMA 5DH9A 1E94E 5F5NA 3WIOA 3FOZA 4ER0A 2CLIB 3UA3A 1BHO1 3TM4A 3ND9A 4LQDA 4DUYH 2WPDA 5BQ3A 4KIWA 3RF6A 4ESEA 1VC2A 2WYWA 3KOXA 2P65A 4OHYA 4OV6B 2Q27A 2B6HA 4UUGA 5J2UF 3NBKA 1WEHA 2OLSA 5IP9G 3R20A 4TMKA 5JOQA 1S2IA 4EB3A 3UCXA 1UBUS 5AJTA 2I34A 4OD0A 4MGHA 1BN7A 2CLHB 4PPQA 4KXVA 2B63G 4BMPB 2V9ZA 3OM9A 2NU8A 4MQFA 1RWBA 1SQGA 4KZPA 2HM7A 1PW5A 3FYSA 2XD9A 1BX0A 1UJMA 3VO9A 3B3QA 1ZC4A 4IR7A 3JWEA 1V26A 3PHLA 4YASA 1WXHA 1IHYA 2PSHA 4EJMA 3HU5A 2EATA 5A05A 3CLUC 1HNZB 2MIIA 2YWRA 1NNI1 4BASA 3OSUA 4DVJA 5AM2A 4DIFA 4Q8EA 3P2KA 2AEFA 4BLUA 5JS6A 4UU1A 4YQZA 3ANYB 2RSLA 5JISA 2Q29A 3WWCA 1UWLA 4F1JA 2WVJA 1I6KA 3GLIA 3A1EA 1T2DA 2C5FA 1OT5A 1OGYA 1H22A 3A3NA 4U00A 2B1GA 1ZISA 3QKRA 2ABWA 3E03A 3GVPA 2WJJA 4OREX 4N03A 3V4SA 4MITA 3ST7A 5EERA 1PJBA 4FS1A 3ZU3A 4K6KA 2VWHA 3EXEB 1B0ZA 2EDCA 2A9QA 1WXFA 2P0AA 1RRKA 3ETHA 3KRTA 2Q62A 2WM9B 4ZAVA 2XR1A 1WF3A 2CNNA 3IDOA 4XGQA 2QGNA 3TK1A 2CB9A 4BX3A 1HFEL 3VR5H 1YJAA 1TTQB 4AS1A 4CU2A 5L40A 2AG6A 3PC7A 4YUZA 2H3EA 2UZ4A 4AQDA 2OAQ1 3RBAA 5EPEA 1Z39A 4PFSA 3TNYA 3H5LA 3OTOB 2IOQA 1KJWA 1SCDA 1ZHQA 2UXCH 3H17A 2N42A 4P4LA 4I46A 2AZXA 4EPVA 2A2ZA 2WAQE 4D41A 1UZNA 1LXCA 4EBEA 2QXTA 5EXDA 4K86A 1DIOB 4MA0A 3PVXA 4HZUB 4EMSA 4MUNA 2GBIA 4R8KA 5KG4A 3AVTA 3A28A 4B71A 1HT3A 1QTRA 3EPGA 1L4EA 5KNDD 3KS9A 3KTDA 3QLVA 1V43A 4UM9D 1E4VA 4GL4A 5KAMA 1K6JA 3WWPA 3NOXA 3QOFA 4EQ6B 2O48X 4IQFA 2FE1A 4CCYA 1XDSA 3BK1A 1RYRA 5I45A 3ZV6A 1TVMA 4AM8A 1YRAA 1Z2OX 4YVFA 4TZKA 4HDCA 5IULC 2BKXA 2ZYRA 1USGA 3ZQUA 3WYNA 1S97A 2OCPA 5IDQA 1H2HA 2KQUA 3FUTA 4ESVA 1AE1A 2O06A 4Z4GA 5DW0A 3GIDA 3VNBA 3G6VA 3OE5A 3T3NA 4RH3A 3TIFA 4B5KA 5LXTA 4RCZA 2QRHA 3G2KA 4LDQA 4ED1A 3U3RA 3R5TA 1FMTA 5CLLA 4YAEA 2EJCA 1ZAYA 1XK6A 2CVHA 4WN9A 3QEKA 4ZVSA 2RAUA 3MT9A 2UUBB 3O6VA 1F3OA 1TJYA 1OYYA 2YFQA 3EPRA 1FDRA 2VCYA 3KAKA 2JJ1D 1Z6QA 3MD0A 5TPWA 1U1CA 3ZK9A 4O2AB 1VKOA 3UB3A 1CFJA 3SR4A 4F6LA 1ZH0A 3NHZA 4BP9A 5HMMA 2JLSA 3ZE7A 1PUIA 5TQJA 3WE7A 2YVKA 1XPJA 2NPOA 8MHTA 1Z38A 3V6LA 2CXUA 1MA0A 4QXMA 2H48A 4IAJA 1T5TA 1XZPA 2WV9A 4ZU3A 4ER7A 4MKXA 2O3SA 1EXMA 1GZVA 3DBVO 4YA6A 1ZCJA 1UBJS 3Q6MA 4MIYA 3GJXB 4P98A 4HS9A 3LTNC 3I62A 2HU5A 4LSGA 1YK0A 2EP8A 4N6GA 5KYNA 4KIFA 3E3LA 1FNSA 2EJ2A 3BTOA 4B3MH 3T3EA 1Q14A 1EFPB 3BQ0A 2QG4A 4GLWA 3M1AA 3VYTB 2AGPA 3FYDA 5DSTA 4JX8A 1XWWA 1N8NA 2ZYDA 2ASJA 5CXQA 3MCWA 3OOEA 1X8LA 4NSNA 3ZDFA 1ORTA 4PR3A 3EBLA 4IWYA 2N3ZA 4P5EA 4E6NA 4EHHA 4N4AA 5L3ZA 4TS1A 1HDCA 4DWJA 3IP7A 3S7TA 4UCUA 4Y8VB 2C5HA 1LW6E 3C1UA 3FTQA 2QTAA 1T5DX 1MV8A 3IVAA 4KSYA 4X6XA 5CX1B 2MSCB 4XVUA 4P3XA 1FX1A 5EXSA 2AQIA 1LF5A 4V24A 3CRZA 1WE2A 1D4OA 5DHPA 3NWBA 3TY9A 3W4KA 7YASA 1K0UA 4B9AA 4MV5A 4W63A 2BR3A 2O8EB 1LGYA 4PZ9A 3HUFA 2ROQA 4LSAA 1F8UA 1KI2A 1LQUA 1SQSA 3VZQA 3PUJA 1RQPA 5LP1A 3UHJA 3DTVA 2IHVA 1FL9A 3R2JA 3UV6A 2D8MA 1B41A 1CQIB 1WZCA 3GMDA 4OSEA 1KAOA 4R54A 2ZS8A 2AJBA 2Y4RA 4X0EA 4UNIA 5FTWA 1QG4A 3A70A 721PA 4Y1FA 4BO7A 5JTTA 1T9HA 3SDBA 3RU9A 4DCOA 1FXWF 4G5XA 2YJNA 3OCWA 3QA9A 4RZ3A 5HHTA 4XAQA 1E9AA 3K0FA 1TQDA 3VPAA 3RV3A 4R1UA 4BFSA 3V4OA 1VA5A 1I50A 4N0PA 2XNDD 3ANMA 3JQFC 2IIBA 4HDNA 4IYRA 1CUSA 5BRAA 4TWIA 1Z56C 5IZCC 2VYVD 5HDBB 2Q45A 4JGIA 4DV4H 1N5IA 2Q8NA 3VSDA 4UEKA 1R5BA 2Q5JA 4JJFA 3KL4A 1I80A 3VH1A 4XVQA 3DPUA 4JIGA 5JMOA 4H3SA 3QENA 2OHOA 3JQAA 5HGJA 1DIAA 3RAGA 1J33A 2YCLA 3NH9A 4J0GA 3PYMA 2BFNA 4ECZA 1CJUC 1NMYA 2W37A 5HCIA 1R6TA 4IL5A 3KVYA 4AFNA 3WLMA 2OY0A 3V1KA 4RYDA 3ND5A 5C1BA 3C5HA 1G66A 4U7CA 3U9LA 2GH1A 3HDHA 5LIRA 3Q0EA 5ARCA 2OKCA 4Z54A 4H0CA 3PSHA 3F5QA 3T4XA 4R83A 1PBTA 4B7ZA 5J2TA 1XRMA 5DNCA 3LOPA 2HIXA 1RU3A 4QAJA 5KYVA 3K8OE 1IY2A 3DNPA 5BYKA 3TEKA 1YV9A 2ZI3A 5IJ0B 1IM8A 3B5JA 1HLFA 4HYEA 1BFUA 2QENA 3BMNA 5BR4A 1L8LA 2A4MA 5CEFA 4QWCA 4GO1A 2YUIA 1RCFA 2VPZA 4DA9A 4BQQA 3OC0A 1EAMA 4GI7A 4UOEA 4ISBA 2NO0A 4JJAA 4QPDA 2ZLBA 3BMOB 4PC7A 1JH9A 1M5RA 3U39A 4LUCA 1N2JA 1TQ6A 1SKAA 3LVBA 4DLAA 3AYXB 4DFDA 1KDTA 4ZTBA 5K8TA 2ECKA 2AX3A 4ZKEA 4PYKA 2FSFA 5EINA 2AKYA 1XMQB 2XWPA 3T0GA 5EE0A 2PG3A 3MIZA 1J9ZA 2C35B 4Z8YA 5FBZA 3NALA 1QRAA 5TGTA 1E9DA 4OYLA 2Y3IA 5TNXA 4DGQA 3DH0A 1TLLA 1F0PA 4HHEA 2BFOA 1PQYA 3A6ZA 2TYSB 1JQJC 3D31A 2FG7C 3HS3A 5KI6A 4NHOA 1Y9DA 4KN8A 1V6SA 4KKXB 2HJGA 3SZGA 1UL1X 3ZN2A 1G98A 3UV3A 1LW7A 3EZNA 3R09A 1BVHA 1AMNA 3UJ7A 2HHFB 1ZX1A 1U0LA 1W2WB 4PCVA 4ZVUA 2QAGB 4K7JA 2Q3DA 2ZWVA 3KYCB 1X0XA 4EIWA 1P9OA 1SA0B 3EVTA 3NHYA 2O1WA 2V3WA 4CMIB 3VA7A 2G1UA 4J3NA 4AJEA 1U2RA 4AJOA 4F6CA 3H1AA 1LK0A 1HDGO 1ENZA 4PAOA 3CSWA 3JQ8A 1A0OA 1R8JA 3O4FA 5KZMB 1OWTA 5IP5A 2HU8A 4OMUA 2IH5A 4CM8B 1ZGGA 2G8NA 4R1NA 1MG5A 3NNSA 5FJIA 1KOFA 4BFWA 1KS9A 3P45A 2DABA 1PT7A 2ALJA 3TRJA 1X1BA 1AQYA 2QMYA 2IOHA 3M1IA 5EQFA 4RORA 5H68A 5C80A 4MRMA 1QWOA 1UOOA 4NCBA 1Q0UA 4OLAA 4QDXA 2YWDA 1NN1A 2XMPA 1FTWA 3JWIA 3AHCA 5EWJA 5TMBA 3P2EA 5DQGA 4HPWA 3KHUA 4NH0A 5BV7A 4JB2A 4UULA 1UUFA 2ID7A 3D0OA 3RWBA 3GGGA 1QFJA 3VR6H 5TDHA 3WWYA 3HG7A 3D5QA 2WZBA 1AN7A 1BN6A 1N8KA 3IG0A 3K96A 1FFDA 1H9CA 4NRDA 3IESA 1D4ZA 1JX4A 1JHDA 1M2FA 1NZDA 2WR8A 3ABQB 3BD9A 2FFHA 1X74A 1P17A 3I04A 3RYFB 1W44A 1V2HE 1ID1A 4JZYA 2IJGX 5IK2D 3KQUA 1H1DA 5I4KA 5AKHA 4A6EA 4LJLA 1C2TA 5BSTA 3GLIE 3SBEA 3NDBB 1NLFA 4PLTA 3ESRA 4BL5A 4PAMA 3QKWA 3DKKA 1AK2A 2NAFA 4X71A 2ZIWB 3T8YA 1PV2A 4MIEA 3DZIA 2YVUA 4K9DA 4FFMA 1BA2A 3OICA 4RKRA 4YRJA 1XMOB 3COJA 3OFSA 1XPRA 3ORSA 4Y2GA 3LCCA 3HYTA 1MAVA 2XGSA 1WHSA 2DFPA 2XDQA 4EPWA 4PYNA 5EZYB 4UNSA 1C9DB 4AZ0B 3CR8A 2IUYA 2EGUA 4DT1A 4HAYA 1ZGBA 5SZIA 4IRKA 3HFRA 1GKYA 4B5LA 4B83A 5BMVF 3GNSA 1I1OA 1J6UA 4N5IX 2Q4RA 4YAUA 2JGAA 1KZHA 1TXGA 3IMFA 3HYLA 1ODKA 2FK8A 4BJ1A 2P0YA 3VVLA 1RQXA 2R5WA 4UXIA 3HBMA 2X5RA 3NWOA 1XAHA 2ODTX 1R10A 1ZO8A 2WILA 1TWCA 1T2NA 3B60A 3EB9A 4MWOA 5LIPA 1GQYA 1OSNA 4FM9A 4E03A 3LFTA 2VOJA 3AF2A 2J6UA 4QTUB 3MHPA 2WM2A 4Q21A 3OQHA 1JA1A 4ZHQB 1I30A 1H2EA 1OCEA 2PGIA 2V4MA 1NW4A 1C3JA 4UQOA 1HR0B 3Q72A 2ZBEA 2I71A 4ALNA 1E18A 3Q8WA 1NBHA 2G36A 5ADUS 2WF8A 3N8IA 3HKDB 2Z8ZA 3X2EA 1P2SA 4LZNA 1XJ0A 1MEOA 5AHRA 1XRRA 2ZUTA 3S28A 4B32A 3K6RA 3FX2A 3B12A 4PLZA 5DGXA 4BNVA 3DA8A 4P0PB 3OLWA 4KWEA 3O92A 3L1VA 3SNOA 4Q1VA 4X1KB 4BMZA 2PLRA 2E37A 5IAGA 1EQAA 1QGDA 3AQIA 4M0KA 2DFVA 3P9SA 4O81A 1CU1A 3VR2D 4Y18A 3RD5A 4LTNA 2WA2A 5DGDA 3ZDAA 3HYRA 2B25A 4UUNA 2D3WA 2FMIA 2VQEH 3PVCA 2WICA 4HSGA 5DKFA 3BGWA 2I7CA 4U2DA 3EMKA 4Z0NA 5A0VA 4GOXA 4O3RA 4YUXA 5J3JA 1QIJA 3BZBA 3P0JA 3O4IA 3BXOA 3OHBA 1H42A 1E2FA 2HA4A 4BXOB 1IG3A 1MAAA 4QW8A 3LFUA 2FHSA 1DZ3A 4HMQA 2GSDA 1IATA 2HHJA 3FF1A 4Q1FA 4JEIA 4MCAA 4YRAA 3LP6A 2VCHA 2H65A 2CFCA 1DPGA 5KYXB 1I6LA 1U6IA 2O14A 4X66H 2G70A 2CGEA 5AM1A 4OJKA 5BSKA 3R9XA 2ERCA 1T0JB 3STUA 1RYFA 1DPFA 2XUOA 5I5SA 3RT7A 4HNGA 3A6FA 3BEDA 1D8TA 3U48A 1PJSA 1NVBA 4CFZA 1GILA 4RULA 2GLTA 4WJKB 4UMDA 1WSBA 5HMLA 1GPAA 3O3MB 4TS3A 1DBPA 1SIWA 4TPKA 3R7WA 4AX8A 5ES3A 1GAEO 2QRGA 3AEUB 3RHSA 5LD2B 5H83A 5C34B 3IEPA 4DQKA 2JEZA 2VK1A 5EZ6B 1VKHA 3T5AA 5DMHA 1KAQA 1ZL0A 2Z4SA 5KFSA 1WB9A 2C22A 4LF8B 3V8PA 2XMSA 1AGPA 4ZA2A 3TVYA 3DZCA 3KZMA 1Q1AA 3BWVA 1D3AA 3NQ41 2O8CB 1JIIA 1NBMA 2G5TA 4KQKA 4ZOAA 5JI2E 2QQFA 4BQOA 4E46A 1DDGA 2FMFA 3IULA 3DZFA 2HQRA 3O82A 1W2HA 4R4JA 4EPXA 1FB5A 1L6IA 3QU7A 4XD2A 5FCDA 3ZXSA 2N1BA 1I4OA 1R4AA 2FLKA 1GAJA 2V4QA 2JCBA 4A73A 4FYHA 3Q41A 5JUMA 1YMVA 5T7BA 1EIZA 4P32A 1R8QA 4AQYB 1XA4A 5F52A 2XDAA 5FUXA 2IK8A 5LU9A 4CM6A 3IEVA 3FYTA 3Q5GA 3TFOA 2QSJA 2DH5A 2AL7A 1EVLA 2W6JA 1LNZA 2P7HA 4BZQA 1BE0A 4CLXA 3PK0A 1GAWA 3ON5A 2AG5A 4AYBA 1CNFA 4QBHA 4LN1A 1RKQA 1HYGA 1MQSA 3CM0A 3AFNA 2G3YA 1EFKA 3RRXA 1K5DA 2G6TA 4EK9A 4I4TB 1GG8A 1RI2A 3EVGA 5KTRA 3EG9B 5IAEA 4R9UC 3GPCA 3E3NA 4Q0MA 3V3KA 4IGFA 4G07A 5KFHA 1XLTA 5IYZA 3V7FA 3K05A 5G0WA 4Q7JB 4DV7B 3RYIB 1SNYA 2ZPTX 1N0VC 5KG7A 3WK7A 1JDPA 2A0FA 4YHHH 1OIWA 4BY7G 1J5EH 4D79A 4ARBA 3N3AC 3KT3A 1FFEA 4M9XA 1SVOA 3CX4A 2ZB4A 1SCJA 3PCXA 2H5IA 4Z9AA 4GXRA 4WZAB 1ZJJA 4LGVA 2JEYA 2FEPA 2R8BA 4DYHA 3OJEA 4F06A 2C2KA 5KFDA 2FR8A 4B0OA 5GVRA 1ADBA 2QY6A 1E6CA 4FEYA 1F20A 1JKFA 1O77A 1TYBE 5IT5A 4A6DA 1NTRA 1JKJA 4JI6B 3IODA 4B3TH 4EFKA 4GPEA 4RE6A 4J0KA 2ORVA 3STVA 5A6VA 2E4VA 4UU0A 4BEWA 3F8WA 5DCWA 2RHOA 3I1IA 4DCGA 1YQ9A 4TQSA 3TJRA 4PX3A 4LNAA 4R2LA 1BDBA 4K6FA 3DZHA 4MQUA 1X7WB 1XZLA 1ZOLA 2Q41A 1K2WA 1QP8A 1SUAA 4E31A 2SHKA 2GRUA 2VIIA 5HZKA 4LMYA 1YRWA 3GLRA 2PJDA 3UF0A 4I1YA 1N3YA 1XA3A 5F7JA 3CUWA 5EY5B 1S2LA 4BNKA 4A3SA 2JEGA 2R4TA 2A7QA 2QU7A 5A9SA 2ZJ7A 3FCAA 4DA0A 4NBNA 4QRIA 2B4RO 4A27A 4ZO8A 5FWXB 2QE7D 3WKEA 5DHAA 3WC4A 1NQTA 1Q74A 3UTDA 4IMIB 2YZKA 2JD1A 3EZGA 4OBEA 1P60A 5JYEA 1QYWA 3QVOA 2YL2A 1B73A 2WOOA 3VPGA 3DD5A 3DEHA 1XGKA 2VHVA 4Q43A 1OI4A 3TI9A 1CC1S 4BFUA 1V5GA 2B21A 4BCDA 5LXTF 1ZHFA 5C8XA 3OIGA 2GM5A 5CB6A 4PS1A 4QM6A 1TPZA 4OQXA 5E1BA 1SPBS 4NOLA 1XQWA 2XEXA 5JSUA 2GETA 3SFZA 2M2IA 4TMXA 3EQ8A 1RAGA 3EGXA 4IILA 4JU8A 1A8PA 3FNQA 2XOEA 2JAHA 2LCIA 4EY6A 1LWNA 3W2GA 3H2IA 4YC7A 1M1UA 4DIDA 2PD6A 3K70D 4WEQA 1A9OA 1PL7A 3U31A 2VXYA 3QZ7A 3FKSD 1SZPA 5CUQA 1U28C 1DAEA 4D80A 4MKIA 2HLDA 2XUAA 3PGMA 2WC1A 3WI7A 3RJ5A 3SE7A 2J3DA 2VP5A 4LF4H 3GJ3A 1ZW1A 5JQGB 1TDJA 3FMPB 4E2FA 3CUUA 1IBRA 1E1CB 3RANA 3GFPA 2ONCA 5A3RA 3CZRA 4DR5B 5EUMA 4DLTA 5FBVB 3QG5A 4FZ5A 4DB4A 3RIEA 5KG5A 3P0IA 3D54D 3Q1KA 1HXHA 3ZQJA 1AF7A 3E05A 4PYOA 1NPTO 3TD2A 4MR8B 3KB1A 2XGQA 2WJVA 1KYWA 2VJYA 2ZT5A 2O8BA 2GTPA 3DLTA 2GD6A 3FCUB 1NVWQ 1A2BA 4JL6A 2EBWA 5JFTA 3VDNB 2P9EA 3T4PA 4OL0A 4PVCA 1KDPA 1W52X 4E1AA 1ZOOA 1U5AA 2XQKA 3B51X 1FTNA 2QGFA 3OCZA 4XR4A 4E32A 3WNBA 3CW9A 4O86A 1MO5A 7MHTA 1E7RA 2LBPA 1A76A 2C99A 1O4VA 1XTPA 2Q7XA 2BEUB 3FTDA 4C7BA 3P94A 3AI7A 1I4LD 4EYQA 4J9PA 2ZIUB 2R84A 1J21A 1FX0B 4DV6H 2IT1A 1C8LA 4LH7A 3GR6A 4D0RA 4G4JA 4HV4A 3QUQA 1XEWX 1Z6TA 5C4XG 4I3FA 2YOGA 3RRJA 1D2GA 3NIFB 1WJGA 2WYOA 3FNGA 3E7WA 4A3JG 1S1CA 3GA5A 5I7VA 1VECA 2XQVA 1R4MA 2BKLA 1Q1BA 2C4VA 4PG4A 4I1UA 3PNPA 1GFZA 1PNRA 4YMUA 3NOQA 4GYJA 4YN3A 2DFNA 4MVJH 2RJOA 3BQ9A 4R1QA 3OQMA 5J40A 3L1HA 3D5EA 3VNRA 3F4LA 4GZLA 4C0SA 3IP9A 3IKLA 3UMSA 1KJNA 1F2TA 3FR7A 3L8EA 3PNYA 2OBMA 4MUEA 3S2SA 2XXAB 1UWVA 3P9NA 2XYQA 2R00A 1PNTA 4ATNA 3RAQA 3JVIA 4ONEA 2R9VA 3P27A 4DCVA 1W7AA 4L8YA 2UKDA 1CJBA 3G8DA 1U5CA 1YCHA 4I1VA 1BE6A 2PCLA 3J81W 1N2CB 1EK5A 1CUUA 1YDFA 3CVVA 3W2IA 4QIWA 1NJ8A 1P2BA 1FSSA 3GOQA 2G7MC 5DM4A 2WIDA 4QUDA 3U56A 1IYDA 3LX8A 2SNIE 4S0XA 1Q0PA 3W34A 4BWVA 1TO2E 1GG5A 2HMYB 3CJQA 4RH0A 4YAJB 4DCNA 5FR1A 1E79D 1PW7A 3KLNA 2O0JA 3O93A 2FLLA 3N0WA 2P2SA 1LWOA 1D2RA 1NUAA 3JWJA 2IUUA 1SHLA 1BDHA 3PFIA 3TNDA 4OJYA 1VLQA 4GKJH 2FRXA 2KBEA 3HVIA 4AQ7A 3HA2A 1WQ1R 2FWAA 1XNGA 3AIKA 1ZOIA 2E0IA 4MUIA 5ALZA 5F3WB 3U7FB 3K7EA 4QUEA 4PBRA 2UXDH 4IXTA 2BT4A 2ATVA 3NGXA 1T9KA 2JAWA 1QHEA 4MYCA 4HLUA 1PJCA 1N34H 2NZYA 4L16A 1A9SA 1DWPA 3TSZA 3LHIA 3QYFA 3ANXA 2JHFA 3MSXA 4COOA 4ZHSA 4LF5B 4ZICA 5AXAA 2H4ZA 1IZZA 3KKZA 1YSCA 4JOSA 4XD7A 3DPIA 4RSRA 4JGGA 5F5LA 3KLBA 2DWUA 2V1UA 2QTFA 1GO3E 3MEQA 3V7NA 3W7VA 2R62A 3KKQA 5TMPA 1IBLH 4GPBA 2NTVA 4DG5A 1FDOA 2GERA 2BZSA 4PHCA 4IS3A 1YNSA 2ZIZA 2QTTA 1R0WA 3DEAA 1PNOA 4OATA 1VCMA 2BH2A 3E82A 3VOTA 4LRSB 3DZKA 4MP6A 3FNFA 1RE0A 1H85A 3FWZA 5J2TF 4C7JA 3CH5A 1PHRA 2P1DA 4FQ7A 2EYQA 2O2CA 1VSUA 2VPQA 1W19A 1VSTA 3MJ4A 2KW5A 3QEOA 5BRJA 4L0DA 1XU7A 3IMEA 2XC9A 1DEHA 2FW9A 5KO2A 2ACKA 3EFOA 1M33A 3JQ9C 4O1MA 1CHDA 2PVPA 3DM5A 1HPLA 3R5KA 3X1WA 2CY0A 3BGVA 3R7SA 4JVSB 4IRUB 5DNWA 2PTGA 5LYJA 1AQLA 1V45E 1KHTA 5ILGA 9ATCA 3A2LA 1BFKA 1XKQA 3OT1A 4O29A 4FOPA 2BBTA 3F49S 1SD1A 2QL5A 2Z43A 5JDIC 3PE3A 3VYVA 3IOMA 3IKVA 2DTDA 4EYOA 2QEQA 3OJXA 4BKQA 2VI5A 2GM3A 1U90A 3LQKA 3PXXA 4F9GA 5FUVA 1HFKA 3AUSA 1RI3A 2HK9A 1M8GA 3A04A 1UC5B 4B6PA 2QN7A 2WJAA 3FMGA 1WV1A 4ZQIA 5BY2A 3IQEA 4HPJB 1DFIA 3C8HA 3F2VA 1A8IA 4PLYA 3L7CA 1JSCA 1CY8A 2P5TB 4XGIA 2IOYA 3VYUB 1AK1A 4B8ZA 4O4LA 4QECA 2BP7A 2AFHA 2C28A 4Z7JA 1F48A 3ENZA 4MUFA 4WLUA 4YB8B 2IV7A 3Q2IA 1F9AA 1SZCA 2Q3BA 2JS7A 4QT0A 5AOCA 4BCBA 4GP9A 3KREA 3FLAA 4LZZA 3CEHA 3G5MA 4CI9A 3AFHA 1MDFA 1CEYA 2AZMA 1C4KA 3WWIA 4CN8A 1D1PA 1A9YA 3AJAA 3F96A 1LU9A 3PQ4A 3ZBUA 1HOTA 3KQVA 5KQRA 1ACMA 2YWEA 4LH6A 4YP6A 3CWQA 4Q37A 2DBVO 5H81A 4D74A 1EG7A 3T6KA 2KM1A 5G1NA 1R27A 3KYJB 4LOKA 3INGA 5JLAA 1JQBA 3KQYA 1MC1A 5FD6A 4CIWA 2VLIA 4TTVA 3THWA 1IM5A 3HYCA 2O20A 3AVYA 1Y8QB 5A7FA 5BUCA 2XAUA 1QVVA 1IOLA 4EUFA 2ZU6A 3GEHA 2I03A 3CNEA 2HGSA 1C9KA 1RWMA 3QE0A 2OM6A 1Q1NA 3GZJA 3RM3A 3JAKA 4R3UC 4AO7A 3AFIA 2QQ0A 2H63A 3EDRA 4Q01A 2PYZA 3KQSA 4OBBA 2L82A 1Q7CA 5KTYA 2Z5GA 3DNMA 1M76A 1FP7A 1MABB 4LJRA 3ZW7A 5LKAA 2NG1A 5AVVA 3K0EA 4RLFA 2H1CA 1JI3A 4KDEA 3LMKA 5EOVA 4G1FA 3DMFA 2JVIA 3NKVA 3O1LA 5ESDA 2QUIA 5D1OB 2Z4TA 4J9UE 3WQQA 4EQZA 2KB0A 3A14A 2FPOA 1LH0A 3WAJA 1EUZA 4QU0A 1C8BA 4DDWA 2NVWA 5HQTA 5CIWA 2WF9A 2Q0QA 4ZQBA 4DN6A 5JY1A 2MOKA 3PJFA 3PN1A 4AYBE 2WJ3A 3RQIA 2BBOA 1HQDA 4Q9KA 2OBYA 1KI1A 5COAA 2WJZB 1WH2A 1SB9A 3OF2A 4JUZA 1YZ3A 4W8HA 4ID3A 3TI7A 5BXYA 3S5JA 2EF0A 2HQBA 3L79A 3NHAA 3IIIA 4MW7A 3LQ1A 1MDBA 2QGZA 1CYEA 2JGMA 2XX3A 3I0ZA 2JI8A 2AN9A 2X6RA 2AN3A 5B1DA 3LXRA 3CF4G 2PXXA 2DB3A 4KBGA 1DU4A 1Y4ZA 2Q0HA 1JUDA 3GGPA 1SHUX 3GJTA 5AVJA 1H6BA 4I1IA 4JI8B 4F8YA 4QPPA 2XUGA 2X0FA 3FCEA 5JNVA 4FFVA 4XE5A 1T8SA 1OH6A 4HOYA 3DWFA 1NM5C 4NNOA 1YC5A 3AB7A 3T38A 2RK6A 4RPHA 2QIOA 3PFWO 3OTHA 2ZRKA 3RC9A 3FVRA 4MUJA 2CD9A 4X7BA 3MF4A 1TJ3A 1I7PA 4K0KB 1H0KA 1VCNA 1FPMA 3LDGA 3TLZA 3FDZA 2R47A 3F3SA 4EHKA 3KVRA 2FPRA 3GP8A 1KSHA 2X19A 4R1SA 3L4BC 2BHNA 3KEGA 3BAZA 2R1UA 3IS3A 2W6QA 1OAAA 1PGNA 1ISGA 2BFFB 1E4EB 4YJ2A 1OQAA 2YS7A 3LW8A 4UFNA 5J4KA 1ZICA 2WDZA 3M6IA 4R0NA 4J1SA 1XXHA 1XAIA 3SI7A 1B4DA 3AXSA 1CD5A 4FCVA 4BB6A 1XE3A 2AEMA 4MVJP 2FU5C 2EU8A 2BMJA 3OKPA 1OKKA 2VJOA 2LR0A 2OLJA 3V8QA 3HKCA 2FKAA 2H1SA 1KYYA 4RPLA 3WGYA 3M2TA 4CE5A 3P97A 2JHCA 1UMCB 3KWFA 1U0RA 5LQCA 1GVHA 3L46A 4LY9A 3TOVA 2J5BA 1FUIA 4F9EA 2HL6A 1L8QA 3OM8A 2X2FA 5JXHA 2EVWX 4PIVA 4UCXA 1UK9A 1SHTX 3LQ2A 5LLTA 4BLOA 3L18A 4JR0A 4XLLA 4KEAA 4ESOA 2WKWA 3G8AA 4L8FA 1N32B 3F4KA 2AG8A 3QV1A 4PCUA 3LWDA 4RY8A 3F9RA 5EIXA 1IK6A 4RAYA 2NXNA 5MN5A 1JPUA 3CR3C 3EGVA 3IQGX 4X60A 5KOHA 2OQRA 2ZWAA 5FYQA 3M6UA 3O83A 3OX1A 3HKBB 4Z7NB 4QUAA 1QZ3A 3K71B 4C3UA 5C4IA 3BCSA 4ECWA 4BBPA 4LXIA 3H8JA 3TQSA 2D1TA 4QICA 1VYVA 5FFMA 2BQ3A 4IKOA 4HNUA 3N39C 3ZOKA 2VZ8A 2GS9A 2IHTA 1SEIA 1MPTA 1B8NA 1D9ZA 1X7HA 1ECJA 3QF4B 1N5JA 2GD0A 3RW9A 4PRZA 1XDNA 1QTQA 1Y4UA 2C2DA 3G9ZA 3D3WA 1HZZA 3MK31 1CF2O 1N92A 5FNVB 3T99A 4PPFA 4B79A 3HJNA 4WKBA 2Q5CA 5L3QB 1YZVA 1FUKA 2ZTSA 4XDHA 5EIHA 5IDYA 3HWX1 1BH2A 5A4DA 1HURA 2OSVA 3E3MA 4U8HA 2B83A 3QEJA 3TEMA 5EWLB 5FOSA 2QMUA 4TTJA 1QVAA 1WG8A 2MCFA 9ABPA 3DEYX 2TMYA 1XHLA 5BSFA 1ATZA 4KFSA 2Y2VA 4GUDA 2XITA 4YMLA 2QD4A 4BX8A 3THRA 2D0IA 4ZK2A 1JKMA 2CMKA 1IRIA 2HV8A 4PSUA 1QH1A 5FF9A 1NE7A 2ASVA 2XDYA 3JVVA 2HBRA 5E38A 1XFDA 3QPUA 1GYRA 3R8FA 4PQGA 4HEA6 1UKEA 2QX8A 1THMA 1C0KA 3WIBA 3GLSA 4LHVA 1I1MA 1MH1A 4DE5A 1LRLA 1T4MA 2JFYA 2D2XA 3D2LA 1I8TA 1QLHA 3A9SA 1XTQA 3WHIA 4Q3KA 4KTVE 3R7AA 2WIGA 1O0CA 4UHFA 3KFVA 2GBFA 3WGGA 5DNVA 1UK7A 2ZETA 4B0PA 4DQ0A 2NIPA 3KHLA 2FH5B 5AKJA 1MB4A 4L75A 1XKLA 3N5KA 3M4YA 3T1HB 1ZQ1A 1GV0A 4G4IA 3HA3A 5AJYA 4C3ZA 3U81A 4CTKA 2ZDHA 4EJSA 4YJFA 4EA8A 3EOAI 1UDXA 4CMBA 4HAWA 1AB6A 2LP4Y 3V4ZA 3H20A 1H6DA 4DC1A 4MS1B 5EUCA 1RHUA 3MFQA 3WLFA 4TLLB 1ISRA 1Y3DE 5KYUB 1ORHA 5JSZA 5KFVA 4XB1A 2VPPA 4H17A 4LYFA 2FSGA 2YFKA 4HDSB 3O21A 4RSHA 2ZYAA 3PT5A 3CWZA 3T7DA 1J56A 1KETA 2ET6A 2O2IA 5JXWA 3PR2B 4IH1A 4P0TA 1WKBA 3UOAB 4GD3Q 2ZS7A 5IYZF 3JAMW 1SYXB 3EN0A 1Q83A 3IIEA 4R2JA 3KHTA 1DJOA 4F4JA 3C43A 3RTXA 3V00A 5FOTA 1QP0A 4MKGA 1B23P 3OLVA 1YB2A 1R66A 3UPDA 4J0CA 2OBNA 4S04A 1QKJA 4QIWE 5DLGA 1TVKA 2HX1A 4RS3A 3O3NB 1A48A 2DQSA 4NMMA 1RYDA 3GLVA 4JVLA 3TZQA 4MO2A 4YPVA 2OAGA 5K3AA 2AGVA 3DHYA 3T06B 5KBYA 1BRMA 5AM3A 2IXGA 3D0KA 1W85A 4WXEA 3D8NA 2W0MA 3S8EA 2ZT6A 1VQ1A 3GB9A 4P9NA 5T4BA 4MWBA 1E3EA 3B2QA 4J29A 1AUPA 3CC8A 4R3NA 2B98A 1JLLB 2FN4A 5BMVB 4RU1A 3JZMA 4NX2A 3A11A 1DG1G 4PSVA 3AW9A 3HCBA 2EL7A 3QWIA 4FHEA 3PW2A 2G4VA 3A1SA 2MTBA 4IM7A 3R3SA 2Q3FA 2EFHB 5A2QW 5L7TA 4J94A 4BV2A 1PX2A 3ZHVA 5ALVA 4BRUA 2X1LA 2J6SA 4G0WA 1CJVC 4MZDA 1ZVKA 2IPNA 1I3OA 5C5CA 1FLAA 4JD5A 3GAFA 1OAKA 2VF5X 3SHQA 2Y9MB 4CR8A 4GLOA 1MH9A 1JHAA 5TRTA 3R0VA 2YHIB 4EYSA 2ZSBA 3L4KA 4CKYA 3W5JA 1BU8A 2H1OA 4FFLA 1GZSA 2AR7A 3KPYA 3UMJA 1PNQA 1HYHA 3V32A 1Y1QA 5F4BA 4RY0A 4OAPA 4YAOA 5DHUA 1H8HD 4P3KA 1TVEA 4HUTA 5BN4B 5KNDH 4MQ5A 2WAMA 3WJ2A 1GGFA 4M9ZA 3H87A 2CHQA 5ILOA 3NB0A 5JY6A 1GKIA 5ICFA 2CXHA 2CKDA 2HBZA 4FYXA 4EG1A 4KFRA 4OK5A 1QF6A 3AR5A 3K6SA 3NUQA 4HATA 3OWHA 2E9SA 1FQWA 3AR9A 1YMQA 4E5PA 1ZD5A 3HDQA 1J0BA 1QJ4A 1Q7BA 1N0IA 1DRJA 2R4UA 3WDLA 1UCFA 5CHEA 2Y1WA 2YIMA 1S1MA 3DXFA 2NXWA 3LF2A 1NLYA 4OX9B 5I7FA 1GNTA 4X20B 3N2NA 5ADVA 2HQOA 4X92A 1RRPA 2BEWB 1MZVA 3TE6A 1O6BA 5C7OO 1ZD3A 3OT4A 3K15A 5JZMA 2LD4A 3MTAA 3SD7A 3S2ZA 1EEXB 4HZGA 1POWA 5C8DA 1A1SA 3L0PA 4MMYB 3HDJA 1ZGJA 2VA2A 2HDOA 3AEKA 4EHDA 1PR6A 2ZJOA 5JECA 4LBWA 2Q2VA 3AR2A 3KBOA 5H4GA 3FVWA 3RU7A 2O0HA 4RYLA 2FG5A 1Y4DE 4TYPA 3OZAA 2AFHE 1Z6ZA 3KHSA 2BI4A 1NV9A 3MJHA 4RD6A 4F2PA 3K6JA 1E3SA 1T36A 2V96A 3BL5A 3O7MA 4FEEA 4KK4A 3D1VA 1A98A 3GAAA 4TVSA 4J7XA 2YKGA 2M05A 1ZHHA 4O8ZA 4MVCA 1JE0A 1X7YB 3ETCA 2JFNA 3S1LA 2JH8A 2GKGA 4CLOA 3R3ZA 4RH1A 2NQ2C 4RMHA 2HSDA 4I9NA 1EZ1A 3VRHA 4PLWA 3JD1A 4J90A 3PWSA 1DCMA 3NHSA 1KJJA 2WUVA 2NU8B 3QW4B 4MQFB 1GZ6A 4U2GA 5BWRA 4OK6A 2RH9B 3TZHA 4B7XA 2RJ3A 4YMSA 1TMGE 4RTJA 2ZJ0A 3QNWA 4MARA 1HDRA 4BLSA 1UZMA 2DHEA 1J2TA 4JP2A 3SC4A 2DKOA 3IBSA 4EO4A 2ZANA 3MUNA 4E3WA 1Z5OA 2FWRA 3V8BA 3G9TA 4Z9BA 1F17A 3AOEA 2APJA 4XYMB 2CL5A 1IWPB 3NBAA 1RWNA 3LKVA 4F3TA 4TXMA 3DPSA 4DIMA 4F93B 1AZTA 3H9EO 2HPAA 4H35A 4WKCA 3UATA 2H1WA 3ND7A 1DAGA 1A4XA 3K92A 1BG6A 5EP2A 4HF7A 4BN4A 2O8FB 5HRCA 1Z73A 2P5SA 3QKRB 4UOZA 3KQKA 1EFCA 2QAIA 2ZCJA 3X43A 5IMBA 1YZLA 3F3KA 4YROA 3CVZA 1RC0A 4WVFA 3WNDA 4ZV9A 16PKA 3COYA 4EMUA 5EE5B 3RSQA 2WNSA 3GARA 3S1AA 1AUVA 1CJCA 4A8JA 3HKZE 4MLCA 1J5XA 3RVKA 3MELA 3DCJA 2ZBUA 3G0IA 1NULA 1X6VA 3G89A 4TT3A 3VNSA 2CJPA 3HK2A 3NGLA 1JH8A 1PR5A 1IN8A 3OOYA 1J9EA 3MWLA 2YMQA 2ZRCA 4JXUA 1JB9A 2VAXA 2OYRA 1S0MA 5AH0A 2GPSA 3PUVA 2O2DA 3L04A 3CLSD 3KOZA 1M1YE 4P33A 1K7YA 2DH6A 3WL8A 4R71A 4DR3H 4LSZA 2OQIA 2JGDA 3M9WA 5JASA 2FVYA 3D3KA 1YJ5A 1HDZA 2H7VA 2NACA 4KR7A 1IOWA 1GSIA 1WSCA 1C3XA 2Y1XA 1BWSA 1RYYA 5IJAA 3AUJB 1JU9A 1J0AA 4Q3NA 4LF7B 3L5OA 1OASA 2IKQA 2K4MA 4IF6A 2YWFA 2HADA 3HLKA 1YDHA 1YDGA 3G5UA 5CGZA 1VCOA 3CPJB 1GPWB 2JL1A 1Z4IA 2NTJA 4NU0A 1I3KA 2UUCH 2BMFA 2W4MA 1EGHA 1M2EA 5U9CA 2RBKA 2PS9A 2M32A 2FCAA 1IOVA 3MOIA 1QHYA 4WBNA 1ZMRA 1AN9A 2GXUA 9LDTA 3OZWA 4ZARA 4FILA 2IYQA 1XXHE 4LFAB 1T13A 5FBLB 1QE5A 1C9NA 1AKQA 3FBGA 3ZQ6A 1W9HA 5I5TA 2KLBA 3LU1A 1UBKS 1A04A 3A10A 1YHNA 1UNNC 3T7SA 4KH1A 4MB2A 2ZW9A 2BI8A 4YK7A 2DIKA 5K03A 3M3PA 2R48A 1UXIA 1XQ1A 4D8XA 3W8RA 2I55A 2E55A 3OZTA 3MS4A 2WP8J 5IT9A 1LPAB 2BRUA 3NTLA 4IPTA 2R8YA 2PMBA 3T5BA 2X1HA 3DEIA 3ELUA 3HH8A 3IAXA 5AUPB 5DGAA 2F64A 2HMTA 1PGJA 4YLGA 2NQ8A 3HGQA 1YR6A 5LYJF 5DNDA 2XT6A 5L1IA 3ZE6A 4B74A 1RCUA 3PYXA 4NBUA 1EX7A 3OJOA 3KAPA 3VYSB 2LUOA 2UUAB 2F1JA 4X3OA 5G3YA 4Z99A 3UJAA 3GTGA 1OC4A 5JJIA 4QU5A 1L5NA 1P1BA 2UXBB 3ZZ0A 4JS0A 1O2DA 4L5IA 3PB3A 4ER6A 3GOHA 3CEJA 3ZW9A 1HLGA 1C4XA 5TPWB 5KSOA 2BELA 4DLBA 1DKNA 3SJUA 2B7BA 1V7CA 2PX8A 2VTKA 3A6DA 5G0UA 3FWPA 4KO8A 1ABEA 4H4EA 3LCJA 4KFTA 2PEYA 3GYGA 5HM6A 2FJUA 4INOA 2VJCA 1DBQA 2FK3A 4EBFA 4O4LF 2OXIA 4ED9A 1FVXA 3UAWA 4PRYA 4G41A 4BX2A 2GBGA 1SCIA 1CRZA 2PZFA 3OZCA 3EWSA 1JMKC 1DIBA 5DM2A 4DSZA 5JNRA 4BO3A 3NC0C 1BJRE 1NP3A 1UPAA 1ZNYA 4ADSG 1I4EB 1S68A 2FJPA 3FHLA 4EG3A 1PFYA 1R3DA 3K70C 1ULHA 1JG6A 1ZMBA 4I4IA 2PUJA 1TQ4A 4R2IA 1P0IA 4F4UA 3F6SA 4DADA 2B8TA 1KC3A 1Q0LA 3CINA 4Y6LA 3K4PA 2A9PA 3SS8A 1YCGA 3WBJA 3DC7A 4LFBH 1P3JA 4EFLA 3PICA 2PV7A 1LBHA 1GN8A 4NPAA 4K8RB 4GGMX 4G84A 1ICIA 3T0FA 2LRHA 4WIAA 1NC1A 2E4WA 2C9CA 3VVMA 1JRLA 4ETIA 5AR1A 4BKPA 2BUAA 5J4HA 5HBRB 4AIRA 4KV7A 3GYBA 2VPSA 1Z74A 5I3CA 2VRCA 3PQ7A 4C04A 4PYLA 3DOOA 1D04A 3ZWKA 4B6RA 1TW2A 2JKVA 3A9WA 4NBKA 3L40A 3LUDA 5C9ZA 3S5UA 1RI1A 4AMBA 2FQ1A 3I1FA 3WRVA 1V8BA 5BSVA 4F6RB 2IP2A 4MGYR 1DBWA 2RKOA 4PCAA 3L0SA 4S3MA 5CAEB 2JIRA 3SLKA 4JVNA 4AMVA 2H18A 5IH3A 3VTFA 4CEIB 3BWXA 1TIBA 4HH1A 2WWWA 5GQSA 4MNTA 2AK3A 2HHHB 4B40A 5FQNA 1M6VB 1VGVA 3DTVB 3H8WA 5GONB 3H1BA 2A6PA 1G41A 3ZIAA 2WSBA 1F6DA 3AW8A 1P3Y1 1PLLA 4B3RB 3WMGA 3BDVA 3BHNA 1P6XA 1WU7A 4DNOA 4LDAA 3KB6A 2QROA 5AXCA 2XMQA 5CH5A 2VATA 2ZIXA 3WZ2A 1X7DA 2X8JA 3W6UA 4A1OA 4GP7A 3K0FB 4TQAA 1VXRA 5LOVB 3BYZA 1SR8A 3PCTA 3RFUA 2XMZA 1SBQA 4N8SA 3SM9A 4ILEA 4PXSA 3V6HA 4J0JA 3O84A 1W4RA 4D4LA 3OMLA 1YONA 3HEBA 3OAAA 2HF2A 2NXCA 1NSYA 2MDTA 5I4BA 3DFZA 2J6CA 4Q8FA 3BBLA 3KZCA 1OBDA 5A3JA 4AK9A 1TKRA 5I5VA 4Q18A 4ND5A 3ZDYB 5M5BA 1G19A 1A5TA 1KK3A 2ZATA 3ZTTA 2AJCA 4DQVA 2B35A 2X22A 4YJ2F 1NX9A 3AGPA 1QFMA 1KVSA 3NEAA 3ZWXA 4TS9A 4OYRA 3JQAB 3O31A 1YGPA 2F1IA 5DM70 1KI9A 4A3MG 4E21A 4C5BA 5KTOA 2FW1A 2Q07A 4D9NA 2N1MA 2XSZA 2E87A 4JU9A 1GZUA 8LDHA 1C7JA 4V38A 3UHOA 3HJTA 4G5GA 4MQ4A 1E3JA 2Q1UA 1HTWA 4BBSG 1X92A 4IUCS 4LMAA 5DIFA 1DEOA 4TMFA 4UPVA 1EHCA 4WN3A 2J0UA 1ZCBA 1NTOA 1THTA 3T5HA 4XQGA 4PPYA 1OAOA 2GRAA 1GN9A 1Q44A 4YUWA 2XNCA 2UUOA 2Y6UA 2FW8A 5LL6b 1KIAA 4P7JA 4FPXA 3DBHA 2QMOA 4WECA 1YIAA 5J2TB 1NVTA 4Q15A 2YWGA 2ZR7A 1VCIA 3M9LA 3H4DA 4UVHA 4HXYA 1NJFA 5EIBC 3HNPA 1A9XB 1ODCA 3T12A 2X9LA 4WDQA 3JS5A 5MDHA 2YHSA 1ZIXA 1GRQA 3BMNB 1AK9A 2PO7A 1MAUA 3JY6A 3GRVA 4A3KG 3QHPA 2XUZA 5JEEA 2FQYA 5C35A 4DLUA 4OHCA 3H9BA 5HTOA 1YR3A 4W82A 4AIIA 1ZWKA 5DYWA 1ISSA 4BNMA 3NBYB 1L8AA 3F73A 1PG2A 1I4WA 3PQ3A 1AUOA 4R8RA 1HDIA 2QG9A 1HSZA 1M10A 3EZLA 3LUGA 2PL1A 2D7JA 4IOKA 4AKEA 3HWWA 1R9JA 4US1R 3H5TA 4DUGA 2H1VA 1GUFA 3GJZA 3ETNA 4IIEA 3SKVA 3C3AA 3BTUA 4YLYA 3GDWA 2Z2ZA 3E61A 2Q3JA 1S2DA 3SVLA 4P53A 1MT3A 4JFRA 4P82A 3U3OA 2NSHA 3SC2A 2G71A 1KMNA 3LLCA 2FZWA 4EY5A 3PX3A 2VDWA 4F21A 4DV1B 1PT6A 1PR3A 1M7BA 2MCTA 3G59A 3W77A 2AKAB 2OCXA 1KEEA 3UT6A 1X9HA 4IWXA 1REQA 3MRXA 1SXIA 4YRLA 1H3EA 3IQIX 3NRBA 3K2BA 3BHJA 4OXIA 4JBGA 5FLKA 1P8LA 3LUBA 3WICA 4EL5A 5AKIA 2VKTA 2MJLA 2DGDA 4AY4A 4HL6A 1USKA 4XLZA 3ODGA 5D1HA 1G5TA 2QJTA 1EGQA 3ILXA 3QBEA 2PUFA 3BMCA 2RGXA 3Q7SA 2QRVA 2V58A 2E2IA 4I4CA 3I4NG 4BVBA 4ROSA 1T9CA 3AL3A 5LPNA 3R6WA 3S68A 1Z6AA 4KDRA 3UB2A 3OCUA 2PUBA 2EL9A 1DSSG 4B2LA 4C6SA 4C0BA 2XNKA 3BM5A 3EEIA 5TMEA 1G2IA 1OXKB 1ZK1A 3BKWA 1UJ5A 3ACDA 3UAGA 1NNEA 1U1GA 4ZGWA 4CN9A 3EF0A 4D7AA 3P9XA 1ADJA 2ISSD 3WGTA 3B2EA 3I6MA 1MENA 4W99A 3TQRA 2P8SA 1FDSA 1J1ZA 5EWJB 2B37A 2A5GA 4BVFA 1J99A 3ZK7A 1ZJZA 4U6QA 3GRYA 1E5VA 1N2HA 1GYPA 4AO8A 3HWRA 5KVSA 5A03A 1VPVA 2F3UA 3FPLA 3E9QA 2X9QA 5K0JA 2IVFA 3V80A 3ETLA 3VH3A 5FBKA 3ZJ4A 1C7IA 2WTEA 3D6MA 3F6YA 4Y6OA 3DMHA 4B4WA 2W4IA 4JI5B 4RGVA 2DPMA 5DNEA 5ANRB 3WGIA 1JMYA 4C5CA 4LDPA 5D7NA 3OOHA 4NV3A 1IZ7A 3ZKWA 4WGFA 5M29A 3MW8A 5LP6C 4CBVA 3PIRA 4MUYA 1I4TD 1W2GA 4Q9JA 4BU1A 2JA5A 3QU4A 1XFAA 1ONOA 2F43B 4K6GA 4MW2A 3DMTC 2W71A 4Q19A 2XCQA 3R77A 1P0MA 3WL3A 5HK9A 1X1DA 4DNPA 4RACA 5D00A 4UXJA 2R7NA 4JUAA 2QTVB 4TTAA 3E53A 2LKCA 2I22A 4XVHA 5HQ3A 5C0OE 1CEEA 4Z4HA 3TOXA 2CLKB 1GKLA 4NDAA 3ZXUB 3JARA 2WUFA 4JX9A 4B6QA 5J2UB 3FW1A 3L8MA 5ITSA 3ASYA 1OA0A 3G7UA 3BF7A 4OKIA 2GZ3A 3IUNA 3NYIA 2IE8A 4YJGA 1A2OA 4S1OA 1XNRH 5LUAA 2ZZKA 4Z1OA 4EYHB 1U1EA 4ZT5A 3EC1A 4RK1A 4E5KA 5F3RA 2OB1A 4BQRA 3K8YA 4XDYA 5H5JA 1QJCA 2R8ZA 4XKJA 1EBBA 3ZHRA 1P0CA 2K5UA 3GLFE 2FB9A 2QHXA 4JJ7A 1Y3AA 1IQPA 2ZZMA 2P9QA 3GLTA 4A6PA 1NRJB 3JPYA 3LWBA 2JJQA 3K0SA 1UFVA 2GAIA 1U2TA 1KEVA 1PR0A 4PZ6A 4MICA 3MJSA 3C24A 2DECA 1CE8B 1V1JA 4YQFA 1X14A 4LF9H 1L1QA 3BWCA 3ZDQA 1SVUA 1AXRA 1H4TA 1O96A 2IIPA 4M1EA 4A16A 4DLKA 2PSJA 3PRYA 3S99A 2COKA 3PITA 2C2GA 1M8JA 5D3ZA 2WF6A 4MV6A 3PIDA 4P80A 5F23A 3E2IA 2IYFA 5IVPA 3PXBA 1MOSA 2WAYA 1Y1WA 3R0QA 2VBIA 1F5NA 4KCGA 3CW2A 3H2JA 3GLHA 1UANA 4N5DA 4ED7A 3A2KA 5H80A 2JFOA 3KNZA 4WHXA 4RHUA 1J90A 4K0RA 3TRKA 4G81A 4JLMA 2I7DA 2BVNA 3GEIA 2X4LA 4MRNA 2VNAA 1OI2A 1AHNA 2WD7A 3KWJA 4FHCA 1NP6A 2ZUDA 4Y2PA 4X6UA 1ZD1A 4C78A 1K4MA 4PNHA 3BAAA 1VLVA 4Q7MB 3TIIA 5EKTA 5CG1A 1YQGA 4OA8A 1II8A 4KQWA 4NBWA 1I10A 4I6EA 5EQDA 3U44B 3OY2A 2EKLA 2FSSA 3NWJA 3MA0A 1RBZA 4OG2A 3W7AA 3U7EB 1WIWA 5KU1A 3TL2A 2JLRA 5IEBA 4KQHA 4CGZA 2CXSA 2OXTA 1L4UA 4P5PA 3M4JA 3QMVA 5CT9A 2QMEA 2RAPA 5FUYA 2H1IA 1RYMA 5TGDA 3UQYS 2IC5A 1VZ3A 3W79A 1L3IA 1C1HA 4WCFA 4IYJA 3DCIA 1AZLA 3F6EX 3OZDA 4ALJA 3ZGOA 4FZVA 5H7XA 4OQ4A 4DLNA 3AK4A 5F7OA 4YMGA 1SOWA 1D2AA 4BZXA 1N9GB 1CJTC 1V5FA 2BKUA 1KYTA 1G6Q1 3A58B 1P2TA 2YN2A 5JAHA 5JNSA 2G5CA 3IVMA 1G5QA 2C2YA 5DBEX 4KTTE 3GN2A 3PEEA 3I52A 3O8BA 3PQCA 4J03A 3V6KA 4RTRA 2CDRA 3V48A 1RAIA 3R7WB 4ZVNA 2PX3A 2WHPA 4IDPA 2YV1A 2QZ4A 1XZIA 3AMVA 1BE1A 5KNCD 1TECE 3U7QB 1L8XA 3D7MA 5I7SA 1WS6A 5DRTA 2XUHA 4QW9A 4EW6A 3EEFA 2WJ4A 5BYJA 1DXOA 4JLVA 5AVZA 3PQ8A 1V2GA 2XUFA 3D9QX 4NQZA 3PGVA 4PX9A 5LMNB 5FTMA 1VIMA 5EKSA 2H57A 5BW8A 4DYDA 3OH8A 2WG2A 3I37X 1RK6A 3LZ6A 3HY3A 4ECTA 2QLLA 1L9XA 4YXFA 4MROA 5BSHA 4ED8A 2R8RA 1I33A 4RHXA 4P7BA 3FCCA 2ZBPA 3GNLA 1VPDA 2XGJA 4I81A 1E2EA 1QHFA 3BF8A 1CQPA 1QYDA 4QNNA 1RHJA 5T57A 4DF3A 1IVNA 1ZGAA 4FJ1A 2QTLA 1SQ5A 1D2EA 1EUCA 3I3OA 4V2IA 4BKMA 3R3HA 5IHXA 2WD8A 3TOCA 3PUKA 4IXDA 5B58T 4N48A 4D46A 2C7PA 2ZXUA 1E2PA 2Y67A 1WR2A 4QJBA 3ER9A 2A0UA 2AD5A 2CE7A 3E18A 4NJMA 7ABPA 2RGNC 3NGDA 1DO2A 4QD3A 3I9OA 2G07A 3B7GA 4UUBA 1NP7A 1E3IA 4U7JA 3VAZA <