1PKOA

Myelin oligodendrocyte glycoprotein (mog)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
124
Chain Sequence
GQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myelin Oligodendrocyte Glycoprotein
publication title Structural insights into the antigenicity of myelin oligodendrocyte glycoprotein
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 31
structure length 124
sequence length 126
ec nomenclature
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pkoA00
5I2IA 2UZIH 3U36A 3QUML 4OUUB 4C54A 4JG1L 4WFGD 2UYLB 1RZIA 1DN2A 4HJGA 2PXYD 3WSQL 2P8MA 5HDOA 3O4OC 4Y16B 1FO0B 4EVNA 3NAAL 1YECH 3T77A 4PTUA 3OKNB 2EC8A 3IDGB 1BPVA 3WFBH 2O5XH 3WXWL 2AQ3A 1UKSA 1Q8MA 3EYQD 3QIUA 4OM1L 5KSVA 3BUTA 1MUJA 2IAMB 5EU5B 3MRNB 4HIXH 3K4AA 1ORSB 5JLZB 3KPRE 2X4UB 2DL2A 1U8KA 4WW2B 3DLQR 2YPKA 1FVDB 4PP1C 4O2CB 3UJIL 4F80A 4J4PC 5SWSD 4Y2DB 4KK9D 4R4FH 3RVWC 5GGQH 2XICA 2Y7QB 3MRLB 4HPOL 2QQLL 4V1DE 3UROR 1PLGL 2FNBA 3LMJL 1JWSB 1U92A 2R0KL 3CK0H 3ZYZA 4HUVA 3DTXA 4L4TD 4JFED 2AABH 3X14B 3BRDA 4ZUUB 3AY4C 4X8XA 4XWOD 4RGND 1N4XH 1AC6A 1NUNB 3FN9A 1U3HD 3BH8B 4LCWB 4HXBH 5D1ZB 4GG6E 1NFDF 5CWSB 4ELMB 5E8NB 4EDXB 3H0TB 2X4SA 1S9VA 5IMOA 3V7MA 1ZLSH 4OD3H 5HTSA 1AQDB 1CQYA 4JFFD 5E8OB 1BEYL 5EU4A 4WWKD 5IEKB 4GMTH 1MHEB 5EORH 2A38A 5I74B 3M17A 4UQ3B 4OFPA 3PGDB 1RZJL 3GSUA 3IXTA 1MCKA 3O6ML 2D31A 4JQVC 5C92A 2VLLA 3RDTA 4HWEH 3OL2A 2NCMA 5F97E 4ODVH 2BNRB 2ENSA 4Y1AD 3H3BC 1ADQH 1H5BB 2OTWB 3GO1H 5CZVH 4B41A 1KIQB 5CJ5A 2VDNL 5HYJB 2Z31B 1IE5A 4KDTC 1N0XH 5I75B 4OKVA 1WWAX 1CIUA 1OD9A 2EZ0D 4H1LB 1NJ9A 1UGNA 5BVPL 3IDNA 1OAKH 3OAZH 3V4UH 5LGKA 1FAIL 3ARED 2VR5A 5GS3A 2IPUK 2ZUYA 2R56L 3QI9C 2YR3A 3V4VH 3EAKA 3VFPB 1OGTB 2GSGB 1R3LA 3KPOA 3QH3A 3EJZD 3WO4B 1PX4A 3M1BB 1RI8A 1BD2E 1IGFL 1M6OA 1P84J 1I1AC 3HE7A 3DECA 3B9EA 2J4WH 2XFXB 2Q7NA 3IDJB 3C6SB 4QGYA 4BUGA 4DUWA 1IL1B 2K1MA 2DLEA 1E28A 2APBA 2DQDH 4H25B 4QRRE 4OZGE 1OP5H 3UTZB 3VI4F 3SGJC 4Y2OA 2W60B 5D6DC 2RFXB 4JKPH 5F8QC 4MXQD 5K59E 2JKXA 3V5HA 3NA9H 4PBXA 1NDMB 4QTHA 4G8GD 5JHLH 3B6SB 2CLVB 2YC1A 3B8YA 3KPNB 1J8HA 5C0FB 1AXSA 5ERWB 2Z0BA 2WP3O 1BFSA 3KPRB 4P2OB 2ARJA 4RMVA 4M7LT 4YBHA 2F8OA 4U0QB 4YXKH 1WK0A 5DQDH 4HIEB 2ZPKH 2VN7A 4H5SB 3SCMD 4V1DB 4XCFL 2DIAA 3GNML 4FG6C 4G7YL 1UCBH 2AJZB 1MRCH 4P46C 5LG1A 1PEZA 1X5GA 1MPAH 3BMVA 4YHNA 2BCKA 1NFIA 4HH8A 4Z0BL 1QR1A 4O2FA 4UB0L 1JFQH 1N7MH 3WS6A 3DVIA 3EHBD 1RIUL 5CLTA 1WICA 1AY1L 2X4OA 2BRRL 4GG6B 5KAQG 5TE6L 2CKNA 2DQTH 2BDNL 4NSKB 4YZFE 4EI5A 1YN7B 3O3BA 1LO0H 2QQNL 3RL2B 1A0QL 3RU8H 2X89D 3U6RB 2R1XA 4M1DH 2E7LA 2BVQB 3S97C 4ZO7A 4ZUTA 2JF1A 1SM3H 3SKUD 1PZUB 5HVGB 1LK3H 2YUWA 5JZ7D 3W5NA 4QRPB 1KPUB 4I9WE 5HHOE 3ARFA 3KNBA 4BQCA 4F9PC 3HAEB 4PJIF 3KLAA 2YD9A 4YGVA 1U9KA 4U2ZA 3PG2A 4M1GL 4JPVH 5D4QA 1M4KA 2GITB 3HR5B 4K71B 1BF2A 1MIMH 4LU5L 1B4JL 5SWQA 1TZIB 2FZ3A 2VDPH 2A77L 2O5ZH 5CZXD 5L2JB 4NDMB 2IQ9H 3VU2A 3BPOC 5IB3B 3BHBB 4J8RB 4G5ZL 3G9VA 1D9KB 4OLWL 3IS1X 5C0CE 3B9KA 3GSQA 2N1KA 4YHLH 4XPGH 2H9GB 4HUXA 1CVSC 5BMFH 4JGUA 2WWKT 1FORH 4XH2A 4PJGF 3O9WA 4ZXBA 4L29A 4UILH 1BD2B 4GUPB 4LLMB 3BP6B 2E6QA 2VUYA 3SN6N 2Q8AL 3NH7H 4ZPTA 1YMMA 3DNKA 3SJVA 3DRQB 5DXWA 4JN1H 3WFEL 5A3IC 2IF7A 4FQQA 2HP4A 5A16B 2G60H 2ZOKB 4Z7VE 5DSCB 2OJZH 4QRRB 4OZGB 1DBBH 3BXNA 2PR4L 2DJSA 1G7QA 3VFGL 1AXTH 1W0YT 3P30H 4KROB 4R4BB 2NY3C 5ACZB 3QDMB 3CFCH 4ODTH 2DLHA 1DN0A 5FYLD 5KSAC 3U1SH 4DVRH 2FX8L 4GKSA 4OCSH 4I18C 1G9NC 3EYVA 2XY2A 3QUYA 1NBZA 5DJCA 4I3RH 4G8EA 3LKPA 1C5BH 1HWHB 4EQ2A 3BW9A 1F8TH 1H3XA 1UQSA 1ES0A 4OCRH 2O61B 1MFEH 2A0LC 5E95B 3ZTJH 4FP8L 2VUOA 4CKVX 2RGSA 3QIBA 1INDL 3DBXA 2NZIA 4FTVA 1CE6B 2XTJC 3LKOA 4P9MH 1DQMH 1JHLH 1CFTA 1NDGB 1BAFH 5DVNA 4A2MA 1VA9A 4M62H 2Z35A 3C6LA 4RAUA 2M26A 1UWGH 4MJ6B 2C3VA 4WTXA 5MHSE 4XP5H 4G3YH 1OARL 2VLKB 4O5LH 4P23D 4LOUC 4X6FB 2Q76B 4XHJC 3D9AH 5DYOA 1S7RB 4QWWD 3F6LA 1LGVA 3HUJB 4LSRH 3CD4A 5JXEA 3IAPA 1A6VL 3RBSA 3WHXB 3HZVA 1VFOA 3NIFE 2KKQA 4YNYB 1T5WA 2W0KA 4NGHH 4EIGB 2N7BA 1UG9A 1HILA 2B5IC 3MREA 3HC0B 2W9DH 2YPLA 3RZCB 4M6MH 1H3UA 1Q9LA 4MAYD 3CLFH 5HHOB 5E6IB 2B8OT 2UWEF 3MRGB 4QOKB 1MSPA 4U49A 4TVPE 2C7UB 2BJMH 3H6JA 4XNUH 3QO1A 4QLRA 3IJSA 1EXUA 5IVXE 1EAPA 3WYRA 3F8UB 2DIBA 1HKLH 4CMHC 1BOYA 2G5BB 2IADA 4LNRA 2XRAH 3L1OL 4ZFFA 2WLZA 4FQ2H 3HNTH 4PP2B 5GSRA 1YUHB 3S5LG 3TBTA 1NAMA 3B9DA 1I7TA 3VXSA 4AEHL 3OWEA 4WEBL 5C0CB 3RWFB 1A2YB 4RWYL 2AQ2A 1G9EA 3HHRB 4GBXB 2ED7A 3GI8H 3UMTA 4C56D 1MFBL 5AD0B 5ICYB 1Q9OA 4YHYB 5HHXL 4LVOC 3D6GA 3MJ9L 4LP5A 4LGSB 5KVDL 4UV7H 4HMCA 1M05A 5M7QA 1QFUL 4HMEA 1R3KB 3VWJB 3WEXA 4HS6B 4NUJA 1T20B 2R39A 4PBWD 4S1DC 2B1HH 1J1OH 1T1XB 3VRIB 5KVGH 5LGHL 2BXYA 4Z7VB 1YJDL 3H9HA 4YBLC 5F6IB 3FT2A 4UQ2A 1VACB 3QEQE 1Q0XL 3MV7A 1FLRL 4M9PA 4WHTA 3GBML 4IRSA 5L2KD 5ITFA 3QG7L 4F2MA 2WAHA 5FGRA 1I1YA 1QKZL 5L9DH 2BVPA 3P4MB 3MBEB 5HY9A 3IFNH 3ZO0A 5IR1B 3FRPA 4MSWB 1QFWM 3LD8C 1JN6B 4NZUH 5ICXA 3NCBB 3W2DH 2ZUXA 4GO6B 3D0VA 2EDJA 4IDJL 1IAOB 1I1CA 3MJ7A 5EOTA 2CLZA 1KLGA 2I9TA 3GMRB 3GSWB 5IBUB 3HI5L 5I1CL 2XI9A 4TULL 1JYNA 1A6PA 5DHVB 4YDJB 4JGMA 1QD0A 3MLXH 3SQOL 3UZVB 2CDFA 5FCUH 4I0PC 3MRPB 5JTWA 4Z0XB 5CUSL 4O00A 4LCYA 4GAGH 4LVNC 4NQSB 1MLBA 3RIAF 2FBJH 5J89A 3MXWL 3H3KA 4HPOH 3X11B 3FZUD 4FXKA 4P2YA 4Z77B 5IKCA 3TBVB 3H9SA 4DCQA 3I02B 2CK0L 2DQIH 2P5EE 3DVNA 1MHHA 1QRKA 4MCYB 4WW1B 3ZTJG 4MMZC 5MENA 4NNYA 2HH0H 1ZSDB 4WW2F 3NCJH 3STZB 4X5XA 4EBQL 2VQUA 3DX7A 1JGEB 3RJDA 4ZAKA 3KXFA 1N5YH 1MQKH 2A9NL 3HE6D 1MJ8L 4LPTA 5ALBH 5GRZA 4I3SH 4AT6B 3OGCB 1MAJA 4N5EC 3T0DA 2OX5A 5BXFA 4JHZA 3S36L 3WS3B 2VC2L 4JHAH 1AQKL 1RZJH 3DROA 4Y89A 4UBDD 1BVKA 3D39E 5KBNC 4GAFB 3QUXD 4ELMF 4Z7NE 4HJJL 2XA8L 4IRZL 3MOAH 43CAB 1ETZA 2R0WL 3JWDL 5KN5B 5MEQB 2D4DA 5GRJH 3BDYH 1T4KB 5BQ7B 5EO1A 3SGDI 4HC1L 3RNQA 2X1WL 2FBOJ 2R9HD 3CU1A 4X4YA 3VFRA 2HFEA 3CFBB 4DZBB 3LQZB 1D5XB 1MF2H 5I2IB 1PG7W 3U36B 4Y2DC 5SX4I 2Y6SD 4DGIH 1RZIB 2DKSA 4HJGB 4PY7A 5M95B 3UYRH 3LN4A 1DFBH 4LLAA 1A8JH 4GW1A 2P8MB 4EVNB 2J6EH 4LK4A 3T77B 4PTUB 3SKNA 2ESVA 3FN3A 4Q7DA 5F70A 4M3KB 3MLZL 4UINL 2SEBA 3EYUH 3PL6C 3QHFL 1SY6H 5CBEA 1TENA 1BJ8A 2HN7A 5KSVB 5DMKA 1MUJB 2PKDA 3BP4A 1J8HE 5GGSA 4UT9L 3PXHA 1A6AA 5CHNA 4F9LC 2JJVA 2YPKB 4HK3J 4LEOA 5F7WC 4PG2A 1KEGH 1BQHA 4XNXL 1SBSH 1GIGL 1NC4A 5HGDA 4KRPC 4X6CA 2I26N 3SDAA 2MKWA 4WI4A 1U92B 5IGXL 4HUVB 3DTXB 1WFNA 4JFZL 5D1XD 3CMGA 3U4BL 5EH1A 4LSPH 3CX5K 2NLJA 4J3OC 3OR7A 1W72L 2WM0A 4NIKB 5T1LD 4AYFA 3GMOA 3G5ZA 1EDQA 2X4SB 1IFHL 2HWZH 1S9VB 4BH7A 5I75C 4QO1A 4OFVA 2L4OA 3BO8A 1F42A 1UM6H 2DM2A 2LAGB 4KKBC 5IMOB 5JW4M 5EU4B 3WD5L 1NAKH 2NR6D 4TTDC 4PGDA 4XWGH 3G5XA 3M17B 4HKJB 4WFFD 4N8PA 5FGBC 1H3PL 3GSUB 3IXTB 3CDGA 1YJDC 3ZKQD 3DXAA 3TH4T 2D31B 2VLLB 3RDTB 3VXME 3EO0A 1TJIL 4LRNL 4X7DC 1NCDH 3SOBL 3MLSL 2E6PA 4PJCA 1I9IL 3LEYL 4PYGA 2AK4D 2PETA 4QEGA 2FSEA 1U8OA 1Z5LA 1H0DA 3UEZA 1T66C 3DX8A 5SWZA 5FF6A 1GGYA 2PYEE 4OKVB 1MHCA 1NJ9B 2NPLX 1IKNC 3Q6FA 3RQ3A 5HVWA 1LE9A 3IDUA 3IDNB 4DK3A 4H88L 2WINA 4GG6F 5F1IA 4NCC1 3EOTL 1MCHA 4JZNA 1D5ZB 2G75A 3OKLA 3MUZ1 2D7QA 3ULVD 4NT6A 1R3LB 3DMMA 3L3OA 3QH3B 3ZYOA 5ADOH 1REIA 3S34H 1O7VA 3G5YA 1OCWL 4OCYL 1KYOJ 4M03A 1M6OB 2GJ6A 3HE7B 4XXCA 3RHWK 3J8F7 1SJVA 1YMME 5B4MD 2QSTA 3O3AA 3I6KA 4FFYL 4PJ8D 1E28B 2BC4A 2VDQL 4MZ2A 4JO1L 3HCVA 5I6XB 5DJ2A 4LF3A 5JIKA 1L7IH 3KJ6L 3RRQA 4D3CH 3QRFM 2DLGA 4YDLB 5EUOA 1Y6NR 3SKMA 3WUWA 3V5HB 1WV7T 3T4YA 1YA5A 5IWLA 5J6GA 3LDBB 4QTHB 5IHLB 1L0XA 2YC1B 2WP3T 3LQAL 1J8HB 1AXSB 1OY3B 1ZHKB 1IGCL 5ELIA 2H26B 2ARJB 4X4ME 4XVUD 1KACB 4S1SL 4XC1L 4HPYL 5EDXA 1LK2A 2HFTA 4KXZI 3ARQA 2F58H 4L8SB 4AY0A 2PR4H 5FYJH 1GHFH 4HGMA 4XPFH 5DK2A 1TJGH 1HHKA 4FTVE 1A21A 4JQXC 4BZ1H 1CDHA 4HZLA 1QTYT 1MCPL 3RWEA 5EBGA 4YHNB 1BHGA 1HZHH 2BCKB 1NFIB 2Q87A 3JWDC 4O2FB 3WKML 1TZGL 3QQ9C 1JYXA 4OZGF 2VOTA 2DOCA 1A1MA 5CCKH 4ZNEE 2ILLA 1UM4H 3DV6A 2X4OB 1XIWA 3QEUA 3ULUD 4CMMA 2QJDA 4JDTL 1DQTA 4XCEA 5D1QD 3STLA 5K59F 4EI5B 1YEGH 3ARGA 4N0YH 3O3BB 2NY4C 4EDWL 3VGFA 4HIIA 1MWAL 1FIGH 4XNMA 1WVZA 2R1XB 5E4EC 4A6YA 2W0FA 1UYWH 4ZUTB 1MRFL 4OGAC 2AEWA 3KS0J 1Z3GL 3TJEL 4B0MM 2YPLE 4XMKL 4ONFL 4PRBA 3EO1A 1OARH 5D2LA 3HB3C 1NCBH 3ARFB 5TQ2H 3KLAB 3EUUA 1HHHA 5FA4A 1A4KA 3CFIC 3HG1A 1MELA 2ED9A 1DR9A 1LO3H 4YLQT 3P77A 4UTBL 1I9RH 5SWQB 2FZ3B 1T22A 3BIKA 4MA7H 1AHWC 4PJFA 1HKFA 5C09D 1MIEL 3PP4L 2AEIT 2UY6A 4KROC 2EDLA 2PXYA 1T6WA 3MNWA 2CKBA 3HMWL 3RWDA 3B9KB 3GSQB 2ICCA 1XR9A 4NFBA 2VXVL 3HUJF 4YZFF 1YPZA 4HUXB 5DD3L 1T2QL 4MGXA 1EK3A 1SQ2N 4XH2B 2GCYA 3O9WB 4ZXBB 4L29B 4MB5A 4ORZC 4JREB 4LAJH 3PHOA 2EH8L 2HMID 5INCA 4ZPTB 1YMMB 1RULL 1ZV5A 2LTQB 3SJVB 3T0VA 5FOJA 3L9RA 5SX5K 4FQQB 4URTB 1UH2A 4YHIA 1A02N 4XCCL 1A6UL 1CFVL 4ENED 3KLSA 5JOPE 4ORGA 3U0WL 3BXNB 3VXOA 4RMUA 4GXUM 5GGVL 3AM8C 1G7QB 2HKFL 1WQVT 2NY7L 1DN0B 4L4TA 4L5FH 5IP4A 3DI3B 4LLDA 4GKSB 2IMMA 35C8H 1YDPA 5ESQA 3EYVB 1IC7H 3QUYB 4UT7H 3LB6C 1NBZB 2Z8VC 4J23A 3ARDD 4FOMA 4G8EB 1CCZA 4BFGA 3LKPB 3BW9B 2V17L 1AGDA 3Q6GL 2XZQH 1H3WM 3BOVA 5DURB 1ES0B 4PYHA 2O5YL 2ZUUA 1DEEA 4HD9A 1WZKA 4OCWH 4J1UA 3QIBB 5LGJB 4JFFA 3DBXB 5EWIL 2E27L 1JPSL 4FTVB 4WWKA 3LKOB 3C5ZD 1CFTB 5ABDE 1FNAA 2Z35B 3C6LB 4RAUB 4D0CA 2Z92A 2ID5A 3K8MA 4Z7VF 3P40A 5I1EH 2C3VB 2C1PA 3UTSA 4JG0L 5T5NG 1CDUA 3H9SE 5DYOB 4IDJH 3U48A 2IBBA 4XVSL 4Y1AA 3BISA 4V2CB 2FJGB 2YOCA 4M1CC 5D96C 1FZOA 4F3FA 5FAAA 1FZKB 4RX4D 3HZVB 4P99A 5MENE 1W8NA 1I85C 5E2VL 3BZFA 3PF2A 4RMRA 4EOWH 1EGJA 2AJUH 1T5WB 4Q6IA 2BSRA 3DVFA 1E4XI 3KXFE 1HILB 3OXRA 2YPLB 4FA8A 1XFPA 1YQVL 2EDYA 1Q9LB 3LV3A 4LP4A 3C2AL 2ICES 2YHGA 3MLYL 4F15C 5EOCL 4N0RA 4NOFA 2KBGA 3QO1B 3IJSB 1EXUB 5JUEL 4YDKH 1EAPB 3MUY1 1CBVL 2I24N 3U9PH 3AB0C 3F12A 5F6IC 2X10A 1K4CA 3RIFF 4LNRB 1BFVL 2A1WL 1OGAA 4ZFFB 1E6JH 3GHEH 5GSRB 5HPOA 5L6YL 2DBLL 3AMKA 3TBTB 5JOEA 4PTTA 1NAMB 1I7TB 3VXSB 3MGOA 4XNYH 4OGXH 1IC1A 2P8LA 3MO1A 4WDIA 3ARBC 1B9ZA 4G8GA 3D18A 3KYKL 1MEXH 3MZTA 5E8DH 1M05B 1AXIB 2WLYA 3WEXB 4WRLA 4XPAL 4PRHD 5FO7A 5ID0A 4NUJB 2DKMA 4NN5C 1QPXA 4R8WH 4XP1H 3SE3C 1Y6KR 5C7XH 2J5LB 3IDIA 2EYRA 4PLJC 2IEPA 2F54D 3FT2B 5KOMC 2IBZY 3MV7B 4HV8A 1HWGB 4WHTB 5E99H 4IRSB 5BV7H 5IVXF 1JZ2A 2NZ9C 5ITFB 5EC1A 1LD9A 3IU3A 4F2MB 7FABH 3O2DA 1B0GA 1I1YB 1KJ2A 4NQVA 2BVPB 2FEEL 5JPMA 5HY9B 3E0GA 1ZEAL 2WWMD 3TA3C 1RFDL 5ICXB 5C86A 3D0VB 4XVJL 5GGRA 1I1RA 3OPZL 3MJ7B 5EOTB 3EZJB 5K9JL 2CLZB 1KLGB 3DGGA 2I9TB 2E9IA 1Y6MR 3RWJA 2D03H 4I3GA 3LVEA 2X89A 1BQLL 2CDFB 4Y5YC 1F4AA 3OKOA 3QWOA 3GKWL 1UWXK 5I1AA 2VXQL 3WFDL 1KPRA 4FFZH 4LCYB 1WWWX 1FCGA 3LIZL 1EFXD 1MLBB 3MNVA 2OXGA 4NNPL 4TPRL 2MFNA 3HNSL 4FXKB 3MFGB 1UEMA 4PPTA 3O8XC 1JNNL 1JGVH 3H9SB 2F5BL 4DCQB 3UYPA 4R0LC 4RGOL 3DVNB 1MHHB 3EJYD 5DD0H 4S1QL 1GC1H 2Q20A 2HJLA 4NO0D 3QWRD 5MENB 5DDHA 4NNYB 4OFIA 2LU4A 1WIPA 4X5XB 4OSUH 4GLRI 3DX7B 3KYAA 1L6ZA 3O11A 3KXFB 4ZAKB 2VLRA 4NQEA 3BPNC 2V7HA 3HC4L 5DMIL 1FPTH 1NMBL 5D7JD 1INEH 1FG2A 4K55A 2D0HA 5DHYA 1AR1C 4LHUG 5FFLA 5BRZE 1K2DB 3R1GH 2YD5A 5SWZE 2CQVA 1UCTA 3ARYA 1OSPH 2JELL 1U42A 1HXMA 2CDEA 3NA4A 5GS0H 1H3PH 3DROB 4PJAA 1I3RA 1JZ6A 5J1SC 2DQJH 1RV6X 2WUCH 5ACMA 1BVKB 3VD9A 4LSUH 2F5AL 1T6VN 1E27A 3IKKA 4NZRH 4OGYL 1I3UA 2ZJSL 4LRNH 4PGBA 3QIUC 1ETZB 3SE9H 4U6VH 4KUCD 3QIWD 5EO1B 1R24A 2P44B 1I9IH 1JVKA 5F7UA 2AEQL 1RHHA 1ZA6A 43C9A 4LEXL 4LCCA 4X4YB 3VFRB 4L8CA 3JVGA 4YXLH 4ZD3H 4ZS7H 2OBGA 2Y36L 1ROWA 2NX5A 2EDTA 5F9WB 1KIUA 1QFPA 3LN4B 1KCRH 3OKYA 2VDKL 5T3ZL 3CPLA 4XHJD 3GIZL 1RUKL 2MCG1 3SKNB 2ESVB 2FEDC 4KAQL 3FAXA 2H8PA 2YSSA 2SEBB 1KGCD 3LPFA 1HCVA 1NGQH 5CBEB 3QDGE 4H8WL 3TCLA 2HN7B 3NIGE 5DMKB 3BP4B 1FN4A 3VDAA 4HCRA 5GGSB 3WNMA 1A6AB 2W91A 1MH5B 4CRPA 5CHNB 3CUPA 1KJVA 4LEOB 4PGCA 2J8UA 4Z7NF 4TRPH 2C5DC 4DKFL 2AJSL 1BQHB 4R3SA 4U6HA 3KYOA 4P23A 2J1KA 2UV3A 3FO1A 2JE8A 2RCSL 5F1KC 1NC4B 5HGDB 4X6CB 4G7VH 4KGLA 5EOCJ 1MFCL 2BY3A 3LZFL 3QFDA 4WUUD 5CJOL 4R7NA 5ECJE 3ZKND 3STBA 5FO8B 3PHQB 3LQAH 1UM5L 4MD4A 3CVHA 4WO4D 2NLJB 3QCUH 4NCDA 3OR7B 4PLKC 2EEBA 4GJTB 3V7AE 4POUB 1GAFH 4GRLC 4S1SH 5EOQL 5KVEL 3GMOB 3G5ZB 4XAWL 4LCIH 4BK5A 4F7MA 4MAYA 3TBWA 4BH7B 2V9TA 4O51A 4P5TA 4Z7UA 1Z0NA 1ONQA 1AD0B 3BO8B 2FEEI 4M5ZL 3VFUA 2ICWA 1EHLL 3G5VB 3PHSA 4PGDB 1ZKAA 3G5XB 4KK8C 3RVUD 4OZFA 1QQDA 4U3XA 1ZLUK 4LSSH 4MJ2A 3CDGB 1J05A 5ISZD 3GI9H 4MA1B 1ZLWH 3WKMH 1TZGH 5D2LE 5HHPA 5FKPA 3EO0B 3PQYD 5CLWA 4IIQC 4L4VA 5EA0H 3DUUA 3SDYL 3BN9C 1U93A 4NQDE 1S7TA 3UTTA 4PJCB 4BSJA 1UJ3C 3RZWA 1U8OB 1Z5LB 1H0DB 3HG1E 3WL9A 3QPXH 3PWJA 3DX8B 5SWZB 5ALCH 5FF6B 3QFJA 1QYGL 5AUMA 1WF5A 2X7LA 3C09B 4PJFE 5GJTH 2DQUH 1MHCB 1CICC 4WFGE 3Q6FB 2YA0A 1LE9B 3MLPA 3O0RH 3SBWC 3FHQA 5F1IB 1IC4L 1BOGA 2X4QA 5F3BA 1RUQH 2G75B 3EDEA 3OKLB 5DUPH 4RIRA 4O4YL 4YQXH 4NT6B 3DMMB 3L3OB 2FECL 4PRAA 3GSNL 3G5YB 2NXYD 2GJ6B 3HFMH 4K2UH 3QQNA 2BSED 4U1NA 2AJ3A 3JTSA 1VCAA 3UJJL 3CX2A 4DVBA 3DYMA 3N1GC 3O3AB 4N1HB 3I6KB 3DHMA 2BC4B 5DJAA 3WJJC 1VENA 3ARPA 3FQNA 3HCVB 3BDBA 4IHOA 4LF3B 4X9HA 1TZHA 3RPKA 2JB6A 4ETQA 3CIQA 3RY6A 4FQPA 3VGHA 5EUOB 3SKMB 3MRFA 1MHPH 3T4YB 3GUTB 4UDUB 2EIZA 4L4TE 5J6GB 1UZ8A 3PGFH 3WS6C 2ARJQ 2DWDA 4QTIL 5IESH 5DVLA 1MFAL 4G6FD 4W81A 4X5WA 5KSUA 1OPGH 5J12B 1DSFH 1LK2B 1OWWA 2A83A 2E7LC 1WBZA 1RPQA 1S9KC 1IT9H 2V2TA 2HKFH 3OAYH 5DK2B 1HHKB 4M43H 3LS5H 2EDEA 2UUDK 3IB4A 1BVLA 4HZLB 3A0OA 3RWEB 3IRPX 3CXDL 5I30L 2ZP0T 1HNGA 5JHDA 3UTSE 4BZ2H 1F4HA 4Z18A 1A1MB 1NBYA 1LDPH 4OTXL 3DV6B 1T80A 5DC9B 1DTUA 4GXVL 1XIWB 3QEUB 4HWBL 1T0PB 4XPTL 4BFIA 4CMMB 4GOSA 4XCEB 2PTVA 4LLWA 3RTQA 2D7PA 1U8IB 2ADFL 3STLB 3ARGB 4K7PL 3T08A 1IQDA 4QHKI 5T1KD 4XNMB 2VISA 1Q0YL 3W0WD 1MCWM 4A6YB 2W0FB 1MCSA 1C12B 3AXLB 2HLFC 1T83A 4KI5C 2NY5H 2I9LA 4PRBB 5EZOL 3EO1B 5D2LB 5LJYH 3QPQD 4JREC 1A7PL 4H8WC 1FNLA 5E2TH 1HHHB 1KCSL 5FA4B 4Z7QE 2XZZA 2ICEA 2L7JA 4XAKE 3HG1B 3P77B 5IJKC 3QQ4A 4X4XA 4HMDA 4HJ0D 1T22B 1PZ5B 5A2IH 4BM7A 3R8BB 1OGAE 4PJFB 2IAND 1OTSD 2PXYB 2YN3A 1A3LL 3MNWB 2CKBB 4G43A 1M1SA 3RWDB 4U1IA 1TITA 4FQXD 1XR9B 4N5UA 1LO2H 3AS1A 2IPTL 1YPZB 5C0GA 2AV1B 4NJAL 5I1KH 2PYFA 3JZ7A 4DGYH 1KB5H 4G8GE 2GCYB 2X6MA 5C6TL 3K4DA 5DO2C 4DZ8A 3PHOB 4JO4L 3E6FA 5INCB 4FQLL 1L7TH 1ZHNA 4OT1H 2ZCHH 3ZT7A 1QHPA 4YHIB 2DLIA 1GGCH 4XBPA 3S3JA 2FH6A 5B39G 1FL6A 1MLCA 4ORGB 5FEBA 2YRPA 1S3KH 3ALWA 1KXVC 4LFHG 3R0NA 4D0BA 1CF8L 4PR5A 3GJEA 3VXOB 1RJLA 3ZE0E 3T3PF 3RGVD 3BKCL 2P4AB 5JOFB 1FYTD 3DV4A 1UB6A 1BM3L 4XBGA 2OL3A 4L4TB 5DR5L 3DRTA 3V8CA 1A1OB 4LLDB 3P73A 4G42A 5IB4B 1YDPB 4MA3A 5ESQB 5F89A 4WTWA 4RGNB 2P1YA 5DJZA 4BFEA 1A6WL 3DETC 1GGBL 3T4AA 3WIHA 5I8OL 5T1LA 1AGDB 4HDIA 4HS8L 4J1UB 1U8HA 4WWKB 3QZWA 2B2XH 2OR7A 4JHWH 1WISA 2CO7B 5DFVC 2YD3A 1BGXL 1X9QA 3B5GA 4XP6H 3DYOA 4LHUD 4D0CB 2B1AH 4UZGA 2Z92B 1T7XA 4HT1H 3WO3B 2C1PB 1T1WA 3UTSB 3VFMA 4L4JA 1ADQA 4IOFC 1FNEA 2Z91A 4JRWA 5DMJB 1JNLL 1R0AH 3WJLA 5FYJE 4HX1A 4P2QD 4PJ9A 5DRXA 1MCLA 4U1MA 2AK4A 1P9MA 1FZOB 4F3FB 2PCPA 1KFAL 4OI7A 3K80A 3QO0A 1E6OH 1IM9D 3BZFB 1A6TA 5BVJA 1GJIA 3BDXA 2DAVA 5AZ2H 3MCG1 4Q6IB 1I8KA 5F1NA 2VLRE 4NQEE 3OXRB 4XP4H 3M45A 4NC1E 4UIKH 1CLOH 3LV3B 4XC3H 5IB2A 1JYWA 3DPBA 3K2MC 1MI5D 1JZ5A 3B2UD 2IH1A 3B5TA 3GHBL 3GJFA 4UV4H 4M5YH 4PJAE 4EN3A 2XNAA 1CI5A 4G6JH 4IMLA 2OZ4L 3F12B 1K4CB 5E08L 4DAGH 2BNUA 2YMXH 3VGAB 1OGAB 4DW2L 3X13A 4PJ8A 5IFAH 1C5CH 4X7CC 5E1AA 4PTTB 5DHXB 4UOJA 4IRSC 3MGOB 1II4E 1MCOL 1T0NA 1NMBH 2P8LB 5IHUH 4FQJL 3BQUA 5ESVA 3MO1B 1T7VA 4F58L 5FYKL 4WDIB 3CX5J 1MRDL 4MXWL 4UI2A 1VERA 2JELH 5FYLE 4CN6A 1CGSL 4G8GB 4YHPA 1CXFA 3D18B 1VADA 4WEMB 4EXKA 4L3AA 1Q1JH 3S7GA 2NX5E 3FN0L 3VW3L 3WLWC 5FO7B 3BZEA 2OSLA 5C9KA 3H42L 2R4RH 5ILTH 3THMH 1YNLH 2AJYH 3IDIB 2EYRB 4XMPL 1CGTA 2FD6H 3V52L 2YPVL 2GY5A 4L1DA 1I9JH 3LH2H 4ODHH 4QY8A 3C60D 1MREL 3OZ9L 4PJ5D 4NRXA 1KLUA 1YQ2A 3FHAA 1OTTD 4P4KD 3U30C 4HV8B 4CDHA 1LD9B 3IU3B 3NFPA 2VXUL 1B0GB 2G9HA 1LEKA 3L6FA 3CSBA 1KJ2B 4NQVB 3EFDL 1KCVL 2J8UE 4HH9A 4I0KA 1ZA3A 5JPMB 2GT9A 4GSDL 4TSAH 2VDKH 3ZMRA 3GIZH 5I1HL 5GGRB 2B0SH 5IG7A 4D9LL 5D1QA 1AE6L 5CZKA 2F53A 4M7ZB 3DGGB 3OAUL 1M7DA 5J13C 1CFQA 3BZ4A 3RWJB 2K3TA 15C8L 3WNLA 1G9NH 3SDDD 5CMAA 5F7EL 4K8RL 3GMPA 3OKOB 4FQ1L 4OJFL 3QWOB 3REVA 4ZG1A 3FMGL 5I1AB 1DBAL 1JPFA 4OFYD 1A3QA 1FSKB 1KPRB 3TYFA 2HRLA 3T0EC 5E2UL 4ZTPL 1AFVL 4Z7UE 4ZFGH 1MFCH 5I9QB 1Z0MA 2NW2A 3B83A 3HPJA 2R2HA 12E8H 2HJLB 5HD8C 1I8MA 4KTEL 5DDHB 4TNVF 4QHLA 4AJ0A 2QHRL 3BE1L 4L4VE 5EOQH 1X4ZA 3H2WA 3O11B 4PJXA 2VLRB 1F58H 4NQEB 2V7HB 3MV11 4J4PA 4X6CF 3UTTE 3HI6H 2CSPA 1FG2B 3X3GL 5DHYB 4J12A 1G7IA 1OAZL 3BKYL 2W92A 5GS0D 1R5WA 2HT4C 3LKSA 1HXMB 2CDEB 1KXQE 3QFJE 5H35A 5GGTH 4PJAB 1IAIL 5FGSA 1I3RB 2D0GA 4HQQH 3LB6D 1F2XK 3OAZK 4M7KH 1DL7H 4C4KO 2ZUVA 1E27B 4DJMA 4NQXA 4XB8A 1HIMH 2FR4A 4PGBB 3IU4L 3I9GL 3FONA 5H8DA 5J56B 4L1HA 3JUYA 1AO7D 4XXDB 4KJPC 1R24B 8FABA 2OI9C 4UTAL 4DQOH 3ZSTA 2V5TA 1RHHB 4WVRA 1ZA6B 43C9B 5L88L 4LCCB 5KJRL 4L8CB 4X9IA 4YXHL 5BO1L 4GKZA 3L5HA 5DEGA 2Y9RT 3GRWL 2A73A 4UNTA 2NX5B 3IETA 4XNQA 3SDAC 3TEUA 1WAAA 2R4SH 3ARDA 1NCNA 4JQVA 3ALPA 1OP5K 2IMNA 3MBXL 1G6RL 5HVHB 1ZTXL 3CPLB 4J3VA 3REWA 1HXYB 3TO2A 2EDOA 4W68A 4O4YH 1WZ1H 1I75A 2P45B 2H8PB 3V4PL 2YSSB 3VMOA 3TCLB 1CDBA 2BHYA 4GAYA 4GRMA 4KDTA 3C5ZA 3K4ZA 3RAJH 2YKLH 3VG0H 2W59A 2V6HA 4KV5E 3CUPB 4OLEA 1BZQK 1PG7H 1XF4A 1KJVB 3HLAB 4I5BA 2J8UB 4LLYA 4WHYG 3BEVA 3H7LA 4R3SB 3QHZL 4U6HB 3KYOB 3S35L 4OI8A 4P23B 5MEPA 3FO1B 2WBWB 5H2BA 2JJWA 4ODWA 4OB5H 3GSOA 3ARSA 3EBAA 1RUMH 1CR9H 3QFDB 4R7DA 2MCPL 2Y5TA 1CE1H 1WBXB 4XP9H 1CLZH 4MS8C 1I1AA 1MCNA 1HYSD 4RX4A 3Q0HA 4MD4B 5BW7A 4J3SA 3CVHB 3L5XH 5JHDE 3N85L 1GH7A 5BOPA 3SKOB 3EW3B 3E3QE 3HMXL 1A7NH 4F7MB 4MAYB 3SGJA 3TBWB 2COQA 3RX5A 4O51B 1QLEH 4P5TB 3DGCR 4Z7UB 1ONQB 5D6DA 3VFUB 2ICWB 3BGFB 1SYVA 4XPBL 2ZCKH 3NIGF 2W9EH 3AU1A 2ATKA 4HGKC 4OZFB 1QQDB 2HA1A 3O41A 3GBLA 3T09A 3CNKA 5E1HB 4IDLA 1KV3A 4Z8FH 4LKCA 3QCTL 5HHPB 3QEGL 3IAQA 4L4VB 3DUUB 4XXCC 1U93B 3K2UH 3MRHB 4ZFOA 2C26A 1NGZA 1S7TB 3UTTB 2AJVL 1B0RA 5GRVL 4Z78A 3DSNA 2DMCA 3WL9B 3PWJB 3LS4L 1F90H 1G7PB 4LFHD 1JHTA 1VPOL 5D7LA 2NMSA 4Q9RH 4M3JA 3RWCA 4P46A 3WFZA 3QFJB 2DTSA 5AUMB 2X7LB 4OCNC 5KW9H 1T7ZA 4PRHA 2NY0D 2HFFA 4Z95H 4S11A 1KJ3H 3TA3D 1DBKH 1BOGB 3EGSA 4JRXD 2X4QB 4UAOC 5F3BB 4TUOA 3RJQB 4OLXH 1TETH 3BKJL 4RIRB 3IJHA 4PRAB 4K8RC 2DQGL 3G6JA 5LXGL 3W5MA 1UT9A 4U1NB 3UDWA 3IDXL 1ZVSA 2AJ3B 3JTSB 4TN9A 2FJHA 2IWGA 4DVBB 2OP4H 5D2LF 5DJAB 1N8ZA 3FQNB 4U2YA 3MLUH 2DQCL 4W4OC 1TZHB 1ZGLA 2JB6B 2CLRA 4U6XA 4ETQB 1IAII 1P69B 2NY1D 3TO4C 1CQKA 3WMSA 4F9PA 3JWOH 3O8XD 5JO5A 3QYCA 5LVEA 4O02L 3F5WA 3MRFB 4Y5XC 4PJHE 3CCHA 2EIZB 1UZ8B 3AS3A 3DOSA 1KXTB 2DWDB 1BIHA 4AIZA 3S88L 3VDBA 4PJFF 4Q0XH 5FUZL 1MFDL 5KSUB 3W11C 2CJUH 3BJLA 5F96H 3QJHA 3EFFA 4WFEE 2F8XC 2A83B 4HLJA 1QNZH 1SMAA 1DBMH 3WNNA 5JORA 1WBZB 2EXYC 3P4LA 2V2TB 4PGEA 4OF0A 1T5XA 5EU6D 2V7NA 1BVLB 2CIKA 3AMLA 4Z7WA 4WFHD 4U1KB 4NO0A 3QWRA 2H1PL 4FXGA 1U8MA 4Y4KC 1ULVA 1MCQA 5JHDB 2Y72A 5SX4H 2X1XR 1J0JA 3GBNH 1JP5A 1RZKC 1NBYB 4TVPL 1AIFA 3VI3E 5A43C 4BFIB 4FFVC 4OBRA 4LLWB 3RTQB 3MUJA 5CFHA 5HHQA 3ARUA 4YHZL 1IQDB 1CTNA 4NBXB 5K9QG 4YDIH 1P84K 3BI9X 4U1HA 5C0BD 4HXAL 1BWWA 1EBAA 2PXYC 2VISB 2ZNWA 4ELKA 5KSAA 3EIFA 5E9DE 4I18A 1QEWA 2R69H 2I9LB 3ZKSD 1Z9OA 5DWUH 3L5IA 1ACYH 2CRIA 3EYQC 1S5IH 5GIRA 3UJTL 4P3CH 1PBYA 4YHKL 4H1LH 2FEDD 3MRMA 3ULVE 4NN7C 5ANMA 2ICEB 4MHHI 2X70A 4M6NL 3KPSA 3QQ4B 1RZFL 4X4XB 3BKMH 3E6HB 1T3FA 5BCAA 4EQ3A 3VFSA 5EULV 1OAYL 1NFKA 3KAAA 4G43B 4HFWA 1E4JA 2Q3ZA 2WV3A 3JUZA 2X05A 2OM5A 4U1IB 1I7UA 5JW3H 5HDBF 1UH4A 1P4IL 4XWOC 4RGNC 1CZ8H 5C0GB 4MNGE 2PYFB 3UC0H 2DQHH 1U3HC 1G7MA 1P5VA 3S36X 1YEHL 1YEFL 1SMOA 4LNVA 4DZ8B 2BMKA 2XKUA 4PLOB 3E6FB 1EHNA 1LNUB 4ZUVA 1ZHNB 5E08H 3SE8L 4DUXA 4CVUA 2XN9E 4J6RL 1FV1A 1IGYA 4XBPB 4L9LC 3L3KA 2VO5A 1FL6B 1MLCB 4WWKC 4D0BB 1E4WL 5D2NC 3L3HA 4PR5B 3GJEB 5EO0B 1RJLB 1TPXB 4JR9L 5D8JH 2CUIA 2XG4A 1TQBC 4L3EA 3L7FB 4WUUA 1UB6B 2OL3B 1R3IH 4PB9L 4KK8D 2UZXB 3P73B 2CUHA 4G42B 3SE4C 4MA3B 2WQ8A 5F89B 3UPCA 1B2WL 5DJZB 2QQKH 4OLZL 4RNRA 4I77H 4OZHE 2EECA 3T4AB 5DJ8B 5C0AD 3LAFA 1F6AB 4TQEL 1WFUA 1FFPA 5T1LB 4HDIB 5I8KL 4CJ0A 3BN9D 2DI8A 2GK0A 2Y4SA 4X7EC 2F53E 4JRYD 1Z6JT 2FB4H 4NNXA 2EZ0C 1RZGA 2O26U 1EJOH 1U8HB 3QZWB 2WMPA 5CKAA 1KTDA 3OMZA 3MLVL 5DRZA 5EZJA 1U6AH 3AREC 3VA6A 4MCZA 5ISZA 5KS9A 1KCVH 1MAML 3RA7L 4M61A 5JQ6L 1UFUA 1T1WB 3EJZC 3PQYA 3VFMB 3TNNA 3BSZL 2OLDA 1R5IA 2AI0H 3P11L 4OIIL 2IQAA 3ZE0F 4K9EL 4XNZC 4ERSL 3RWGA 4PJ9B 5DRXB 4U1MB 4FZ8H 1PJ9A 4Z7OE 1K3ZA 2PCPB 5GRUL 3QO0B 3ZE1E 4DKEH 3TZVB 1A6TB 5BVJB 3HAEH 2VDML 1WTLA 2XOTA 5E9DB 3VWKD 5A1AA 1I8KB 3FQUA 1OAUL 4CU6A 2N4IA 4JO3H 4PJXE 4MXQC 1J1XL 3KJ4B 3IGAA 4MAUH 1EMTH 1HYRC 5E2UH 1A7RL 1BLNA 5E5RB 1JGLH 4RBPK 2IH1B 1NMCC 1P2CA 3VXRE 1HQ4A 3GJFB 1JF5A 5ICZA 1LP9A 4EN3B 2XNAB 4IMLB 5A2FA 5T1MA 4PS4L 4I0PA 3VXUA 4NZTH 2VLMD 2BNUB 4JM2C 1CGVA 1EH9A 2QHRH 4S1RH 4PV8A 3X13B 4PJ8B 1QFHA 3SCMC 3PWVA 5E1AB 5GJSH 1XT5A 4KVNH 2JB5H 4YHML 1D6EB 1T0NB 1QBAA 3BQUB 5ESVB 5F71A 1QRND 4AEIH 4MNGB 1VHPA 1JPST 2R2EA 3BWAA 4H1LG 4YHPB 3EHBC 2Y23A 1VADB 5MI0C 3NZHH 2VXTL 1T1ZB 3AVEA 3BZEB 2OSLB 5CAYB 1FH5H 1ZLVK 2XN9B 5J1TC 5KTEL 5D72H 1RU9L 4XGZA 4N0UA 2IALA 2OQJA 5ITBL 3IFLH 3QWQB 3MODL 5IW3A 4QY8B 3K3QA 4NRXB 3HPLB 1KLUB 5L0QB 2BNQE 1N64H 2I60H 2PO6D 1PKOA 4O2EA 1D5MA 4YXHH 1MJJB 5JZ7C 5I15H 3MYZA 4PJAF 2GUOB 5DD5L 3N1MC 2QSCL 2G9HB 4RAHA 1LEKB 2HLFD 3L6FB 3T2OA 3S4SA 1YC7A 4HH9B 3U0TA 4HG4K 1ZA3B 1RK0A 1PDKA 2GT9B 5F7NC 1FL5A 4KJQC 2OK0H 5DD1H 2ITDA 4LASL 4L9DA 4YFLF 5IG7B 4KJWC 3CLEL 3H3PL 5TFSH 4NQUA 4TSCH 5D1QB 3Q48A 2F53B 3ME0A 2Z93A 1J0HA 5MERB 3DURA 3VD7A 1M7DB 1IGML 1OTUC 1H15A 1CFQB 3VGEA 2XXMB 1RAMA 3OG6B 3W0WA 3GK8H 2CGRH 5CMAB 3GMPB 3REVB 5D71H 1JPFB 4KUZL 5FYJU 3TYFB 3SDXE 1ZGLP 2H6PA 1FE8H 4R90L 3LY6A 1OOAA 3HNVH 4YHOH 2I5YH 3GEWB 3DUSA 1CS6A 3RBGA 1A3RH 1PKQA 3I3DA 5TPWL 3NIDE 4JCLA 4Q97A 5BS0A 1BIIA 1K8IA 2NW2B 3HPJB 3O4LD 2E9BA 2R2HB 4U05A 5DVOA 3MCLH 5DO2D 1MCRA 5D5MA 1I8MB 2JCCA 1IJ9A 2ITCA 4RMTA 1F6LL 2J88L 3P9LA 2J8UF 1JPTH 2VAJA 3ZDYE 4OD1H 4F9LA 4KJYA 3KLHD 4KTDL 1FDLL 4MNQE 1BZ9A 4AZ8A 4LCCC 4PJXB 1JL8A 2EXWD 4NHCH 1G9ML 1KULA 3JVGC 5CD5D 4FQXA 1G7IB 1IKFH 3FFCD 1R5WB 3LKSB 5CEZE 4XPBH 1HHGA 6FABL 5D7LE 3VXRB 2FGZA 4JPKL 5H35B 3LRHA 5JNYA 3CFDA 4XMLH 4C4KT 3TF7C 3MRCB 3DETD 1BVZA 1QLRA 2X9XA 1OWRM 2APWA 3P9MA 4JN2A 4OV6F 3IFPA 4NQXB 4D9QD 5F7MC 2FR4B 3FONB 2I25N 4Z7UF 4OQ1A 2OMNA 8FABB 2UZIL 4JDZB 3MJ9A 3RGVA 5LWYH 3T8XB 3G6JE 3RY4A 4UT6H 3PDDA 1FYTA 2AW2A 4JANA 3BAEH 4GKZB 3SEPA 5IFJA 5FGBA 2A73B 5E6YA 1YECL 2Q6WA 2GW5A 3IETB 4G6KH 1AKJA 4XNQB 3GIVA 1NCUA 3ARDB 4K9EC 4QWWC 3L3IA 2VKXA 1SJHA 4DKAA 4RA3A 3WFBL 2O5XL 1J18A 5IVOA 2NY6C 3REWB 3EJJX 3TO2B 1HEZA 3S37X 1QFWI 4LARH 3MYJA 1QSED 1URLA 3MGAA 4BQ6A 2MPAH 4HIXL 1Z9LA 4RMSA 5LXGH 4LIQH 3PWPA 4X80H 1FG9C 3C5ZB 4PRPE 1RZ7H 5D7KD 3O3DA 4NFCA 2AEPL 4R4FL 1DCLA 5GGQL 1IKNA 4LLYB 4LMQE 1XF4B 2CDGA 4I5BB 5T33H 1S7XA 2F19L 3BEVB 3MLWH 3CK0L 5DHVH 3GGWA 4HF5H 5MEPB 2HT3D 4Y4FD 5H2BB 5LCVH 3TV3L 2AABL 1G7LA 3GSOB 5LAXA 1N4XL 1QR4A 4R7DB 2Y5TB 4LPUA 2DDQH 4Z7WE 1KB9K 3E2HC 4P48A 1I1AB 4MNHA 2OTPA 2Y5EA 3TFKD 1IM9A 4HXBL 2QEJA 2R23A 4YWGH 5JIPA 3F7QA 5GHWH 2XKNA 1ZLSL 4OD3L 1Y18A 1N6QH 2G2RA 4GMTL 5EORL 2HLAA 4N8VG 4GKNA 1AGCA 1UACH 3BD4A 2X09A 2P43B 5BZWA 2DD8H 3QHTC 1MI5A 1FVEA 5I17A 5E2WH 1TVBA 2WBJC 2NTSP 3AU1B 2ATKB 4HWEL 4ZYKB 4K7FA 3O41B 1BBDH 4ODVL 4KV5F 3S37H 3U9UA 1V3JA 4LKCB 1ADQL 3GO1L 5CZVL 4TVPH 4ALAH 3W39A 4ZFOB 1NGZB 5JIHA 2K7PA 5ANME 4HULB 3UPRA 1B0RB 1N0XL 4N90E 4Z78B 1QVOA 2XTJE 4JQXA 5J0BA 3KPSE 5L8KB 1OAKL 5D7LB 2GAZA 2DICA 3V4UL 3RWCB 4P46B 4MVBC 3U46A 3V4VL 5EU3A 4PRHB 4E5XA 2AK1H 2HFFB 1PYWA 4HC1A 3EGSB 3NTCH 1UC6A 4TUOB 1K6QH 1BBJA 3FOMA 1F4WH 2J4WL 3IJHB 4Y16D 3QUMB 3G6JB 5J4MA 2EKSB 4M6NH 2UZYB 5EZIH 1ZVSB 2DQDL 4JFXA 4NPYA 1NKOA 2FJHB 1FHGA 3BVNA 4Q2ZB 2EE9A 3FZUC 4DN4H 4P9HH 4JKPL 2C3XA 3IJYB 4OCXH 1N8ZB 3NA9L 1TDQA 4GLRH 4QHUA 5EN2B 5E8EA 4BUHA 4P5KA 2CLRB 2EIDA 4U6XB 1A47A 1EVTC 4O9HH 3I50H 3T0ED 4KZEH 5JHLL 2CXKA 5JO5B 4ZOAA 1P4IH 1EEQA 2MNUA 3F5WB 4L3EE 1EAJA 4WUUE 3CCHB 5IQ9A 1HQRA 4KK5C 3D2UA 3GMLA 4P59H 4YXKL 4AIZB 4FABH 2FYYA 3MRBB 3HE6C 1AHWA 5DQDL 3SE8H 2KDGA 2ZPKL 2HVJA 3TNMA 4HBCH 3BPOB 4OFYA 3QJHB 3HZYA 3EFFB 3UBXG 5HHMD 1UCBL 1MRCL 4LCWD 1ED3A 1JI1A 1S78D 4MQSB 5D1ZD 2AJXH 1MPAL 3DIFA 2BXZA 4PGEB 1T03H 2HT4D 4UBDC 5IEHA 1T5XB 2V7NB 2WUBH 3MA7A 2CIKB 1JFQL 1N7ML 1V7MH 3KPPA 3T65A 4Z7WB 3QUXC 3UAJC 1W72A 4NO0B 4PJDA 1VSCA 5KS9E 4FXGB 1U8MB 2EDNA 2DQTL 3L95A 2QL1A 2R9HC 1AIFB 1LO0L 4KC3B 4Y7MA 3DJ9A 4KJPD 3RU8L 5IBUG 4OFKA 5T3XH 5HHQB 4M1DL 3AM8A 4PJHF 3RUGA 2BNRD 4MJID 4U1GB 2EO9A 1KYOK 2Y6SC 1SM3L 1YYMH 5C8JA 2BOCA 1LK3L 4U1HB 3PV6A 5KSAB 1S8DB 4ELKB 3CVIL 4K94H 4I18B 2Z31D 4BSWA 1QEWB 4K23H 5KG9A 3TJHD 1P4BH 3I3EA 3BSZH 1MOEA 3MV9D 2IH3A 3MNZA 4JPVL 4RISH 1H8SA 4ODSH 5CGMA 2X2YA 4KMTL 3MRMB 5ANMB 5L8LB 2VDPL 4ZSOA 2EKJA 1Z2KA 1TXKA 2X70B 4NQCE 4WJ5A 1OP9A 2XTJB 3B43A 3X12A 3KPSB 3I2CH 5JW5A 3VXUE 4YEFA 2VDMH 1HSAA 1T3FB 3KG5A 1TJHH 1TPXC 4UDTA 3VFSB 1C5DA 4XPGL 4YHLL 5HYSG 3VI3F 4HFWB 5BMFL 4XCYA 1G7JB 1FORL 1SEBA 1MY5A 1I7UB 1U3YA 5D1XC 4UILL 5LKNA 3NH7L 1G7MB 4G9FE 4JN1L 5J7CC 2G60L 2VTFA 4NWUH 2BMKB 1I85A 2OJZL 3D69A 3ABZA 4P3DA 1DBBL 3PP3K 1IGYB 1FV1B 1KG0A 3E8UL 4N0UE 3L3KB 2AS5M 1AXTL 2B5IB 3PUCA 4ODTL 3CFCL 3KPRD 2NR6C 5CSBA 3BT2L 3L3HB 1I3GH 3U1SL 1CTOA 3ULVF 4OCSL 1YN6B 4L3EB 4WUUB 5E70A 3SHSA 4WCYH 4I3RL 3OHXA 4L8BA 4RWHA 3MUHL 3P0VH 4V1DD 1C5BL 1KENH 5MEOA 2APXA 1JHKH 3UXFA 1UVQA 4OCRL 2VSCA 1FBIL 1F3JA 1JYVA 1FFPB 3TH3T 1T2JA 5DUMH 4KKAC 4HAGA 5HGBB 1TFHA 2AAVA 2GK0B 1OHQA 1BAFL 2YD8A 1ACZA 4M62L 3S8WA 1QSFA 1RZGB 1KTDB 1H8OA 3W0WE 5DD5H 4LVOB 1JK8A 5DRZB 5EZJB 4XP5L 2MOVA 4G3YL 2UY7A 4O5LL 1B0WA 3VGGA 4AQ1B 4MCZB 5ISZB 4JFYB 5KS9B 3WFCH 4GAJH 3D9AL 4RGMC 3LRSA 4M61B 3VD4A 4HK0A 3PQYB 3TNNB 4LSRL 2ZG1A 1R5IB 4YBLB 1U3JA 3VGDA 5C08D 2IQAB 1PKQE 1MWAA 3RWGB 5BS0E 4AK1A 1QFOA 5B4MC 1HK6A 4K8RD 2HYMA 1GOHA 3MV8A 3TPKA 5D5ME 4NGHL 2VZSA 1JMXA 1X5AA 2W9DL 5M94B 2FLBT 4RA0C 4M6ML 4OZHF 4ACPA 3CLFL 2HT2D 3C87A 1YY8B 2AKRA 3A6CH 3IGAB 1U8QA 3TA3A 3LD8B 4R90H 3ULUF 3T1WA 2BJML 4XNUL 2UVEA 1D9KD 1BLNB 3MA9H 4LL9A 2W65A 3FRUA 1RZ8A 1HKLL 1FYHB 2J3SA 5DJ6A 3LHPH 4Q6YA 1P2CB 1HQ4B 4W6WB 2XRAL 5ICZB 1LP9B 1QHOA 5T1MB 3LEVH 1MJ7H 4I0PB 3VXUB 4Y5YA 1BD2D 1SHMA 4PV8B 3UPAA 5IVZA 3PWVB 3GI8L 4YE4H 5L0QC 3MRKA 2NY2C 5HYJE 5D93C 3VRJA 4LVNB 4KH2A 1G9MH 5JPNA 5DD6A 5B3JE 5D7IA 5IIEA 3O8XA 4QRRD 4UV7L 1MAKA 4Z7OF 4C58B 2GHWB 2E7MA 2X1OA 1J9CT 2BRQA 4R0LA 2R2EB 3ZE1F 3BWAB 1OSZB 4U0RC 2B1HL 1F5WA 4OFDA 3HKFA 1J1OL 5KVGL 5CP3A 5GQBA 1T89C 3ET9F 1HHIA 3ZLQC 5JXAH 1A64A 1T1YA 1HOCA 5HGAA 4G6FB 4WENB 1A4JA 1U58A 4PJXF 4K3DH 4XGZB 4N0UB 2IALB 2R29H 3D3VD 3U7AA 4MXVE 4FFVD 3ZT5A 1NL0H 1QO3A 5E7BA 4C59B 4O2EB 1D5MB 3PWPE 5EU6A 5L9DL 3AS2A 5CSZA 3IFNL 3M07A 4IRJC 3IT8D 2BFVH 1PAMA 5C07E 3DVGA 4L8DA 4NZUL 1N26A 3W2DL 3S4SB 3O3UN 3U0TB 4YUEH 1RK0B 3Q1SH 1FL5B 5C0EA 1KELH 3QCVH 4JB9H 4QRTA 2ITDB 3FO2A 2YUVA 1BREA 1IBGH 1U95A 3MLXL 1YY9C 3NPSC 2Z93B 3DURB 5FCUL 1H15B 2VYRE 1VEPA 4KQ4H 4P2CG 4OGZA 1IAIM 3IDYC 4GQPH 4N0CD 1GXEA 4GAGL 3W0WB 5L7XH 2FBJL 2AEPH 4L3CA 3F58H 4LSVH 5EIIA 1AP2A 3T1FA 2F19H 3CU7A 2H6PB 4KMLB 4KWUA 1FRGH 2DQIL 2EDDA 3V79C 3TV3H 4IMKC 3DUSB 4WI6A 1PKQB 2HMIC 5BS0B 2HH0L 4I9WD 1BIIB 1K8IB 5HHOD 3PL6B 3NCJL 5E6ID 2VERN 1KPVA 5D5MB 4ENEC 1RD6A 2ITCB 2R1WA 3EYOA 1MCCA 1N5YL 1MQKL 1ZLWK 1LE5A 4I2XE 3FQRA 1JI2A 2VE6A 4K3JH 3DX6A 5ALBL 1BZ9B 4I3SL 2YA2A 1Y0LA 4HLZH 1A7QH 3LN9A 2X4TA 1KB5A 4KRPB 4JHAL 4K7PX 1PEWA 4DWHA 4WNQA 5C0CD 1HHGB 1R5VA 3QDHA 3N1QC 1NFDA 3PGCA 4QRPE 3ARDC 1K8DA 2FO1A 3MOAL 5JNYB 1DQQA 4AH2A 3CFDB 5CP7A 3ECBA 5GRJL 1OQOA 1QLRB 3BDYL 1K3IA 3P9MB 4JN2B 4UNUA 4J3UA 3SDXF 3IFPB 5KZCD 4GRLA 3RKPA 1CD0A 2E9WA 4WV1C 4ETYA 2BZDA 3VWJD 3AS0A 3V6OA 2VQ1A 3C5ZC 1MF2L 3OKEA 4APQC 4PV9B 3NIDF 4NFDA 2BVOA 1H3TA 3R0MA 1G1YA 3RGVB 3KPTA 1CG9A 4DGIL 1FYTB 2I07A 3W9DA 1J86A 4JANB 3UYRL 2XYCA 1DFBL 5IFJB 5TF0A 5SV4A 1AGFA 1RIVH 1F3RB 2HAZA 3ARRA 3WN5C 2J6EL 4F7TA 3HN3A 3ZDYF 2Q6WB 1AKJB 2V9QA 3GIVB 3MRQA 4LSQH 5C0AA 3L3IB 2XWJA 3RWIA 3EYUL 1J10A 4IIQA 2Z9TA 1SY6L 4X9GA 3MBED 4UNVA 1HEZB 1JWMB 3KYMA 4P4RA 3MYJB 5GGRY 4X6BA 5BW7C 1UJ3A 4M48H 5EZLA 4MMXC 4ZMAT 3PWPB 2DQFA 1KEGL 1MFNA 5DEZA 2NTFA 3EO9H 3O3DB 5D7SH 1SBSL 4HAFA 5C07B 4EI6A 1CICA 3OKMB 2CDGB 1S7XB 1FFNA 4Q9BA 4YIQB 3SGKA 3SBWA 3QDME 5F8RC 4CJ1A 3GGWB 5K9OA 4BQ9A 5GZND 5B38G 1G7LB 3OAYK 4LSPL 5MHSD 5LAXB 3G6JF 3OGOE 5D6CA 3MJ8A 4R4ND 1DLFH 3R06A 4JAMA 4XTRD 5CGYD 5T1DH 4MNHB 3ETBF 1IM9B 2H32A 5E8PA 2R23B 4JM2D 4CL7A 2NNAA 2HWZL 3ILPA 1UM6L 2XKNB 3WJJA 5GRWA 1Y18B 2G2RB 1NAKL 2HLAB 4XWGL 4GKNB 1AGCB 1RSFA 3RUGE 1E0OB 2ZCLH 3WFHB 1PSKH 1FVEB 5I17B 1TVBB 4XZUA 1P7QD 2VLKE 4K7FB 4NN6C 1NGYA 5IB5A 5B8CC 1NCDL 4TVPD 1TCRB 1EO7A 2CR3A 3U9UB 1IEHA 4I2XB 2B20A 1BJ1H 3HUJE 5C6PB 1FGVH 1UJTA 3BPLB 3W39B 3UDWC 1SJXA 2Z8RA 3UPRB 3D85D 4ZSOE 4LMQI 5FDWA 1QRNA 4Z7WF 4Q9QH 2GAZB 1CIDA 2WWMC 3CVIH 4OKDA 1P5UA 3U46B 2OJEA 1FFOA 5EU3B 4E5XB 5GS1A 4PREA 4QOKE 4KJQD 4NQTA 1PYWB 1GCFA 4MWFA 2R0ZL 5ADOL 1NUFA 3S34L 3IFOA 3FOMB 1HNFA 1H9VA 4JPIA 4KJWD 4KMTH 2DJ4A 1FQ9C 4X7SH 1S9XA 1OTUD 4HLZG 2NY4B 3QXAA 2D9QB 2QR0A 2ZSWB 5FUOH 4HIHA 4ZPVA 3TT1H 4JFXB 4NPYB 3EDKA 3QEQD 5E4EB 3B2VH 5LBSH 1ND0A 3BVNB 1YNKH 3BEWA 2MWCA 3NACH 2AGJL 1L7IL 3QB7C 4D3CL 5EFIA 1S7QB 3OKKA 4QHUB 5E8EB 3EJYC 1XGTA 4P5KB 4E42A 3PWLA 1L9MA 5J11C 5IQ9B 1RURH 1WSST 3TN0C 3SY0A 5GS2H 1HQRB 1IVLA 1RY7B 5IJKA 3D2UB 3GMLB 3QULA 2FYYB 3IKCA 3OXSA 2F58L 1NCAH 1AHWB 1NSNH 1KNOA 5D7JC 2EDFA 3E8UH 3TNMB 5FYJL 3L3GA 4CVZA 5C6WH 1GHFL 5DF0A 2P48B 4N9GA 4U1GC 4XPFL 3D25A 1RZJC 1TJGL 4GH7B 1N6VA 3RVTD 4BZ1L 3BT2H 3PJSA 4JY6A 1QSFE 1FJ1A 3GMMA 3DIFB 3TT3L 2Q86A 1M7XA 5IEHB 1HZHL 1KTLA 1AGBA 4OD2A 3KPPB 3T65B 3O4LA 4LIQE 2HG5A 1W72B 3GM8A 4PJDB 4LRIA 4R96B 5DA4A 5CCKL 2JLLA 1UM4L 3FRPG 2P5ED 3U4EA 3QIWC 4EZMA 2VLJD 1FBIH 3L95B 1YEGL 4N0YL 1KC5H 3RDTD 1FIGL 3LCYA 3K1DA 2WNGA 1J0IA 4B7IA 2DI7A 4K07A 1LO4H 3TP4A 3RUGB 1UYWL 3VA2C 4N68A 3FTGA 5C3TA 3MV8E 1EERB 3IF1A 1X6NA 1FNFA 1VFBA 4ZODA 1TTGA 2BOCB 5C8JB 3PV6B 1LVEA 2VR4A 3VFTA 3VXQA 1NCBL 3HRZA 2VNCA 4AENA 1CLCA 4BSWB 5TQ2L 5KG9B 4K3GA 4R6UA 4MLSA 5HDQH 1U0QA 4N1EA 1R6VA 1WBYA 2IH3B 5I8EA 3MNZB 2NY6D 3D39D 1LO3L 4R26H 1I9RL 2VWEC 4XB7A 4MA7L 4NZDA 4ZSOB 1J5OH 2OR9H 4WJ5B 3X12B 4HG4J 5JW5B 5KS9F 1HSAB 4HWZA 3HE7D 2H41A 3ULSB 4UDTB 1I4FA 1C5DB 1CVRA 2QQQA 3RVVC 4XCYB 1KJMA 5D7IE 1SEBB 1EHAA 1ZVHA 3ZKNC 3GSNA 4IM8A 4U31A 4XI5D 1QBBA 3WE6B 1OAXH 1QACA 4WO4C 2X44D 4PJEA 5D96B 3HR6A 3ARXA 3J7HA 3SKJH 3P9WB 3D69B 2VABA 2EH7L 4P3DB 1VEMA 1EIBA 1CK0H 5EIQA 1KG0B 4XVTH 5D70H 1WLHA 3I3BA 2MSPA 2FLRT 3FT4B 3LPWA 5HDLA 4L5FL 3B3IA 4LGRB 5TGBB 3RVUC 5HYEA 35C8L 1MQ8A 5AZEH 1IC7L 4F15B 5EU6E 2Q7YA 4UT7L 1LP9F 4QXGH 1JCKA 2WBJD 5H94A 4GKOA 4X0KA 3OHXB 1FVCB 4L8BB 3P3YA 2HKHH 5MEOB 1W8OA 3AB0B 2BX5A 2XZQL 4AEFA 1UVQB 4LGPB 3RX8A 1F3JB 4FNLH 4OCWL 4EUPA 1BFTA 1ZT7A 3JV0A 4RRPG 1KN2H 4MA8H 2OCFD 2QSVA 2JJSC 1QSFB 5K33A 3ARBB 1DZBA 4Z9KB 5IQ7H 1AGEA 5I1EL 1JK8B 5FUCC 2E6JA 4MVBD 2X4NA 3PABA 1NCWH 5CJXC 5TE4H 5T5FH 2ARWA 4WY7H 5F7YC 4HWBA 2FIKA 4TYUA 3LRSB 4HK0B 1I7RA 5I0ZA 4NN5B 2Y07H 1XGPA 3S35X 3N9GH 4A6YH 3C08L 2NXYC 5EPMA 4M7LH 3VXMD 1MWAB 1WGOA 2GQHA 5L8JB 5E94A 1RIHH 4PGZA 2VZUA 4QRQA 4EOWL 2AJUL 2VAAA 3MV8B 1CGYA 5I19H 2XQBH 1GYAA 3WDIA 1A7OH 1GL4B 1IGIH 3INUL 2QLVB 1RZKH 5D9SA 2AKRB 2PYED 4CW1A 1U8QB 1P4LA 2PNDA 3TA3B 2H2PC 3FO0H 5IM7A 2X40A 4YDKL 1EZVX 1A1NA 2W65B 1YEDA 5T3XE 1RZ8B 3U9PL 4XHQA 1AD9A 5DJ6B 2IFGA 1N2RB 4ZUSA 1F3DH 2CKBH 1E6JL 3GHEL 4KK5D 2DYPD 3O9WD 4Y5YB 4XNYL 3FOLA 4OGXL 5IVZB 3FFDA 4CU7A 3MRKB 3MRNA 2YUXA 1K4DA 3VRJB 1ORSA 3K0WA 1P6AB 4QXUH 5JPNB 3MROA 5DD6B 4HGWA 5D7IB 3T0EA 5IIEB 1KB9J 1MCJA 3O8XB 2OR8A 3WUZA 4FQCL 1MEXL 3QUZC 5E8DL 5GZOD 1J0YA 3MRLA 4R0LB 5D5MF 3D1MC 5IV2A 5JIIA 3UAJD 4ONOA 4R8WL 1CFNA 4XP1L 1HHIB 5C7XL 3KPMA 1T1YB 2FGWH 3TC9A 1HOCB 5HGAB 1SBBA 1A4JB 2Z4QA 1U58B 3FB6A 1BZ7A 2VDOH 2V9RA 3IYLW 3BPNB 4MQ7A 2VDRH 5E99L 5BV7L 1A5FH 4AIXA 1UWXH 4N1CA 1QO3B 7FABL 2NYYD 3UCRA 5CWSA 2B4CL 2YBRA 5EU6B 5CSZB 5IJVA 4WI8A 4TSBH 3V0WH 3DVGB 3QPQC 4L8DB 2X4RA 3CSGA 1EO8H 2DF3A 4MQXC 3T3ME 2KPNA 2E3VA 4QRTB 1KIRA 2AXFA 3FO2B 1RUPH 5B3JF 3QIUB 1L4IA 2D03L 4GQ9L 4HJ0C 1U95B 4PRIA 3T2NH 5F7HA 4MJIA 3JV4A 1U8KB 3DX9A 4FFZL 4E41D 1FGNH 1OTSC 4W6YB 1IAMA 1KIQA 5TQ0H 5FHBH 4FQXC 4L3CB 4AIOA 1OL0A 5EIIB 1AP2B 3QNYA 1JGVL 3T1FB 3VG9C 3F62A 3QDJD 4LSTH 3HI1A 3MRDA 2H45A 4MXVF 3MV9A 5DD0L 1JBJA 1GC1L 4LQFL 1EGJH 3BZDA 2E8YA 1ZT4A 3C8HA 4K3EH 4QCIA 3HC3L 1WUNT 4OSUL 1IZKA 5MP6L 5F21B 4W70A 2R1WB 3EYOB 4P2RD 3LSOA 4NZJA 1MCWW 1FPTL 3V7AG 1LE5B 3FQRB 2YRZA 1CLYH 1INEL 2VE6B 3DX6B 3BD3A 1B6DA 3RGVC 5DK0A 5DFTA 3R1GL 1OSPL 4Y4HC 3L5JA 4XX1E 2X4TB 5GS0L 3BP5A 3MLRH 4WNQB 2DQJL 1R5VB 2WUCL 2OZ4A 3PGCB 1K8DB 4LSUL 1RK1A 3UTOA 4BA8A 5FM8A 4NZRL 1DQQB 4AH2B 5CP7B 4LLQA 3SE9L 4U6VL 3ECBB 4FMFA 2EYTA 4M4RA 2BP3A 4IOSD 5CJBA 3KPNA 4GRLB 2YK1H 3HRPA 3VXTA 2ZZUT 4RAVA 4KKAD 5B3NA 4YXLL 3OKEB 2J7LA 4ZS7L 4ZD3L 5JOPD 1NMAH 1CG9B 4K3HA 3G04A 2I07B 2EC9U 3W9DB 4CU8A 3RIAK 1KCRL 1AGFB 4HFUH 2YRLA 5T3ZE 4F7TB 3I6LE 5C0IA 2ZKHH 4KI5E 3MRQB 3VXNA 4X98A 3MJ6A 2XWJB 3KPOB 3RWIB 1X5YA 2R0ZH 4IIQB 1NGQL 1CDGA 2Y06H 5DFWH 4ONGH 2VKWA 3KYMB 3O2DH 4P4RB 5C0ND 1G0DA 4JZJC 1CFSA 4X6BB 4KVCH 1KJ2H 1UJ3B 3SJVE 5KVFL 5EZLB 5I66A 3QT2A 2J8OA 2DQFB 1YN7A 4TRPL 2NTFB 2R1YA 3WXVH 1XF2A 2EYSA 1T0MA 1J7VR 4EI6B 1CICB 2AGJH 1ZHBA 1JZ3A 3O6KH 5DS8A 1FFNB 4G7VL 1ZLUH 3B2UC 4YAQA 5K9OB 3ZYIA 4AM0A 3EOBA 1XF5A 5C08A 3L3DA 2P5WA 4XCNA 3DO7A 5D6CB 3MJ8B 3QCUL 3R06B 3H9SD 4JAMB 1FC1A 1GAFL 2R15A 2H32B 5E8PB 3BPLC 4LCIL 1ZAGA 4XPHH 2NNAB 5C0RH 3ILPB 3TYGH 5KANG 5MEND 2D4FA 2NY2D 3RI5F 4PJBA 4W4OA 1U41A 4NO2A 3MR9A 3LN5A 3TO4A 3KXFD 5IBLD 2H2SD 2AXGA 4LSSL 3TT3H 1TTUA 3GI9L 4Y5XA 1QR1B 4XZUB 1QP1A 1NCCH 4M7JH 5EA0L 5IB5B 1MCIA 5I1DA 2VZ1A 2MKLC 3UX9B 5BV7C 3C60C 1I8LC 4JFDD 5CINH 2VL4A 4P4KC 4LPVA 1OTTC 3G08A 3QPXL 3DRQA 3G9AB 1AI1H 5ALCL 3QAZC 5FDWB 4IJ3C 4JCMA 3TH2T 5FHAH 1QRNB 5DQ9A 5GJTL 2DQUL 4JLRA 3TVMD 3O0RL 4IRJD 4HUMB 4F57H 3KNBB 1RUQL 4WI7A 2OJEB 4OLYH 4Y4KA 1FFOB 1GGIH 1X5HA 3CZJA 5AYUH 4PREB 5DUPL 2VJXA 4YQXL 4YGVB 1IEAA 1QBMH 3T3PE 4X9BA 4MWFB 1G0XA 5C2UB 5FYLH 3T04D 3D3VA 3IFOB 1UB5A 3HFML 2D7OA 4JPIB 4K2UL 3RUGF 3V2AR 4PBVC 3MACH 4JKWA 3SDDC 1YY9D 1S9XB 4PJEE 2N56A 3V6ZA 1V8HA 2A9MH 3VH8A 2QR0B 3GRWA 4HIHB 4PD4J 1XZ0A 4ZPVB 3DUHA 4NKDA 1NBVH 3VXSE 2VL5A 4N8VA 5C71A 2E7BA 1ND0B 4IOIA 3BEWB 4JM4H 1G6RA 3O2WH 1NDGA 4M9OA 1GC1C 5EFIB 3VFNA 1MHPL 3OKKB 2JK5A 4RFOH 1KT2A 1XGTB 4E42B 5J6HA 3PGFL 3PWLB 4HCRH 3ARVA 1CGUA 5IESL 2Q76A 1NC4D 2ADIA 3SY0B 2QV2A 1RJZA 3W9EA 3KWWA 3WDJA 4QNPE 2CRZA 1OPGL 2WK2A 2GJZA 3QULB 4NC2B 1DSFL 4KRMB 1Q72L 3ZL4H 3IKCB 1J88A 1NLBH 2EH7H 5SWSA 4H20H 2ENYA 1YC8A 1NEUA 4RZCA 4CVZB 3L3GB 2XQYG 4KI1A 3MV7E 1IT9L 5GS0C 4N9GB 2C4FU 3D25B 5IOPA 4M43L 3LS5L 4JPWH 5E03A 3PJSB 4JFEA 2F74A 4JY6B 3CVHH 3GMMB 1XGQA 2Q86B 1KTLB 1AGBB 4OD2B 5DJCB 1U3HA 1ORQA 1S7VA 4B5EA 3O4LB 5E5MA 2HG5B 3RWHA 4BZ2L 5TF1H 4X99A 5DT1H 1UQSB 1LDPL 4AQOA 1MCDA 3U4EB 5EG6C 3HMXA 5I18H 2W0LA 4L9LA 1RQ5A 2MQCA 1OLLA 2XV6B 4OZFH 5D2NA 4APQD 1YUHA 1OT1A 2XZAH 4X6DA 4M8VA 3FTGB 5F9OH 1QFWH 4YK4C 3IF1B 5IMMA 1VFBB 1A2YA 2LQRA 2NY5L 5F7LB 3VFTB 3SE4A 4OUOA 5BRZD 3VXQB 3HRZB 4AENB 5SWZD 4NP4H 1P7HL 3O2VH 4OF5A 5E2TL 4NUGH 3QEHA 1WBYB 5I8EB 2IBGA 3C08H 3DWTA 5HJ3A 3BJ91 3RVXC 2WBKA 2VH5H 4NKIL 3DMMD 5DRWA 3MREB 3UBXA 1UZ6F 3AREA 4HWZB 5JDSA 1TVHA 3INUH 4GT7A 1LO2L 2CRYA 4GG8A 1L0YA 1I4FB 1UKQA 4NM8H 1HDMA 5I1KL 3LQAC 3T0EE 4DGYL 1A6ZA 1KB5L 3GSNB 4ODXA 1WT5C 1WWCA 1HYSC 3NCYP 4DFIA 1JN6A 1ZT1A 2IADB 1L7TL 4PJEB 1QA9A 2VXSH 1KCUH 2ZCHL 4OT1L 1GGCL 4HUWA 1DDHA 4NC0B 1KTRL 4NOBA 4C83A 2HFGL 2VABB 1S3KL 3QDGD 3PDGA 2XIDA 2CPCA 5TH2A 3FJTA 3K46A 4FQHA 4DOHE 5DC4B 1Q9OB 4KU1A 4OQTL 5HHME 4RDQG 4BYHA 3B3IB 4WWID 3QUKA 4FQCH 3BH9A 2Q7YB 1GGTA 4Z77A 2RHEA 5H94B 4X0KB 4G8FA 3ALXA 3MMEA 1JRHH 5C2BH 1YMHA 3H9HB 4XBEH 5AWNH 3RY5A 2ESVE 1CL7H 4OM0H 4JM2A 1XCTA 4WW1A 5TDOA 2VITA 3VJ6A 3IRZA 4UQ2B 3SCMA 4EUPB 3IDMA 2E8ZA 5D7IF 1ZT7B 3A67H 3UTPD 1FZJA 2ATPA 4JHWL 2B2XL 4HS3A 4PRIE 4U1SA 4XP6L 5CILH 1VFAA 2FATH 3K74B 2B4CH 2B1AL 5HYSA 4RMQA 4DTGH 2NY0C 2DI9A 4HT1L 1AGEB 4GS7B 3OKDA 1P7QA 1BQUA 3D87B 1RVFH 3BX7C 2X4NB 3U7WH 3PABB 5JW4N 4X6CE 1SEQH 1DQDL 2FIKB 3ZDZE 1R0AL 1I7RB 2VN4A 5IVXA 4UU9A 1J1PH 2RB8A 3X3FH 1XGPB 4JQIH 1E6OL 4GQ9H 5IT2H 4PUBH 3D85A 2C1OA 5E94B 5HGHA 4Y8DC 4QRQB 3U30B 4NQDD 3QXTA 2VAAB 4KQ3H 5CIPA 5EU7C 5AZ2L 4F7EA 5BQ7A 1R3JA 5DK3A 1FNGA 4XP4L 3SDCC 3HG1D 3P2TA 4UIKL 3P0YH 1CD8A 1CLOL 1FNSH 2NY1C 4XC3L 5IKCB 5D9SB 4CW1B 1JV5A 1P4LB 5IM7B 3GSVA 4UV4L 4LQFH 4M5YL 1A1NB 1T04A 1YEDB 3WIIH 5I73C 1KN4H 3DXAE 4G6JL 1AD9B 3HC3H 3SO3C 5J13B 4OZFG 4DAGL 1JGUH 2YMXL 5DGRA 4ZUSB 3TN0D 1JNHA 1MCFA 1ZVYA 1EPFA 1WWBX 5IFAL 1C5CL 5MP6H 3Q3GA 1NCTA 3QEQA 1SJEA 1YEIH 3FOLB 4PJCE 4QKXB 3OX8A 5IHUL 1ZGLM 1WITA 3FFDB 5E24E 1WIOA 5FYKE 1K4DB 1DVFC 5BXFB 4PY8J 1J8KA 1AC0A 3MROB 1PQZA 4HGWB 4OBSA 5GRVK 3T0EB 3U0PA 3ZHDA 1Q1JL 5F1OB 1F4YH 1N5AA 2E7CA 5IV2B 4U3CA 2R4RL 5HYFA 1L9NA 5ILTL 4H0HB 1F4XH 3THML 1CFNB 1YNLL 2AJYL 1NGPH 2LU7A 1YEJH 3KPMB 4OZIA 3O6LH 2FD6L 1I9JL 2Z4QB 3LH2L 3FB6B 4ODHL 1J0ZA 4FQIH 3RNQB 3CZFA 1BZ7B 2OL3H 4O58H 5A40E 2VQTA 2GJ6E 4MQ7B 4DOHB 2HFEB 1LHZA 4NJ9H 2VRAA 3G6DH 5HHMB 4IBLT 1B6UA 2NY5C 1JTOA 4KKLC 5DLMH 3WIHH 2YBRB 4PY7B 1A14H 3QXWA 4M6OH 4OF3A 5IJVB 4GW1B 4TSAL 1J0KA 2X4RB 1OW0A 1CDIA 2P5EA 2EIBA 4LSDA 2B0SL 5EUOE 2A6IA 4HKJA 2VLJA 5DGQA 1KIRB 2AXFB 5E0QA 2ADGA 4Y19D 1RJYA 2RJMA 5C08E 5KVMC 1RUAH 2EDBA 2P5WE 5DJDA 3UTSD 2OI9B 1G9NL 3RIFK 5KVFH 4PRIB 4GFTB 4MJIB 3JV4B 4KGJA 3DX9B 4NYLA 1AJ7H 1EUUA 2V2WA 2APTA 3ZTNH 5I8CA 3FO9A 4ZFGL 3CH8A 3QNYB 3SDAB 4QHMA 2FIRT 4PJBE 4HWNA 1NEZA 3RVVD 3HI1B 3MRDB 3MV9B 3O6FD 3D39A 12E8L 3QR2A 3CMOH 4UIMA 1ZT4B 1N3NA 4MD5A 4QCIB 2EEDA 3QDAA 1D5ZA 1SYSA 4W4NA 4Y5VC 3MXVH 5CJQH 3JTTA 5CEYA 2ZUSA 4P49A 1F58L 3LSOB 3V6OC 2E9JA 3HI6L 4XAKD 3NZ8A 4JFHE 1V3LA 3IVKA 3T3MF 4CBPA 3ULVH 3U82B 4RFNC 5DK0B 2FX9H 2L7UA 3GJFH 2FJFA 1OGAD 4WI2A 6CGTA 3L7EA 1CYGA 3VDCA 3WHE0 4M6AA 2DRUA 2DM7A 4HKZA 3BP5B 5GGTL 3D5OF 5ADPH 3DXAB 4NKQB 4HQQL 3LKQA 4M7KL 4F7CA 1DL7L 1A7BA 1RK1B 5J9PA 1HIML 2Z8SA 5EC2A 7CGTA 4Q74A 4LLQB 5F7KC 4KPHH 2EYTB 4DQOL 2FSEB 3VXTB 3D3VE 3NGBC 4C56A 4RAVB 1ZHKA 2H26A 1NLDH 4QHNA 1NUDA 3BPCA 2BSSA 5ETUA 4WUKH 4L8SA 5IFHH 4X8JA 3G04B 2CO6B 3SGKC 2WBJA 2R4SL 4GXUN 1FLTX 1CWVA 2AV7A 2WINB 4JZNB 2D7TH 2NXZD 1GPOH 2FX7L 5C0IB 4XRCA 3PXJA 5E4IA 5HPMA 1YPZE 3VXNB 3WV0A 4X98B 5DMGD 1KEMH 1WZ1L 4HIJA 3CH1A 4DN3H 4IEFB 2XA3A 5L2KA 1CFSB 1EA9C 2YA1A 3RAJL 2GYSA 4POZC 4BKLA 2YKLL 3VG0L 4OF6A 1G0YR 3VWKC 3U7YH 4ESKA 1KIPA 5I66B 5DJ0A 1PG7L 1YYLH 1CU4H 5SWSE 2R1YB 1XF2B 5DJ2B 2EYSB 3ULUH 1T0MB 3PNWA 3ZKXC 3K7UA 1ZHBB 3LKNA 4OB5L 4YPGA 4JO2H 5DS8B 2DLFH 1XGUA 4JFQA 2AQ1A 3WUWB 1RUML 3EYFA 1CR9L 4YAQB 1QSVA 2H2PD 4UAOB 1TNMA 4AM0B 1CE1L 4XP9L 4JFEE 3EOBB 1CLZL 4KZDH 1XF5B 5C08B 4RGNE 3VXMA 3L3DB 5GISH 2P5WB 5HHVH 4XCNB 3DO7B 3L5XL 4WIQA 2OXHA 5FYJD 3UO1H 3L5WA 1Q72H 3OTTA 1WFOA 1LILA 3EDDA 1A7NL 4KI5F 4HKXA 4NO5A 5EBMA 1QLEL 1V3MA 4JFFE 3MZGB 2PYEA 1XGYH 4PJBB 2ZCKL 5D2NE 2EDQA 1NQBA 2W9EL 3MR9B 2HTLD 4NO2B 3LN5B 3TO4B 4X6DE 1KCKA 2VLRD 4NQED 2AXGB 3QZWG 3QUZD 4KRNA 1GZQA 4E9LA 4Y5XB 5GS1C 4Z8FL 3OJDA 1UWEH 4H0GA 3EYSH 5I1DB 3K2UL 2DYPA 3HE6A 4Y1AE 3OJMB 5HDBE 4OAWA 4NM4H 3TBSA 2ADJA 3G08B 4NKOA 2PO6C 5LQBH 4ODUA 2VR9A 4HIIB 4KRLB 4ZS6D 5I1GH 1F90L 1XF1A 1DQLH 4DK6A 3EOYG 1ZOXA 3TLRA 4YC2C 4Q9RL 4JJHA 1W2KT 5DQ9B 2UVFA 2ORBH 4JLRB 5KW9L 5IF0A 3EDJA 5GGUA 4Z95L 4AL8H 1KJ3L 3QUXA 5B38A 4JVWA 1DBKL 5TE7H 3V6FA 4Y4KB 4LPWA 4OLXL 1TETL 2ZUQC 5HYQA 4MQXD 3BP7A 5I16A 1IEAB 1A4KB 3D0LA 3UP1A 25C8H 2NX5D 3D3VB 1UB5B 3W81A 1FO0L 4X4MA 3NFSL 2ZOLA 3BIKB 5DJYA 3V6ZB 1U3ZA 4NKIH 3VH8B 4FZEH 4FXLA 2OP4L 1XZ0B 3MFFA 4ZQKA 4NKDB 4JGJA 3VD3A 1X5KA 2VL5B 4N8VB 3MLUL 5LGJA 3VD5A 4IOIB 1U91A 4PG9A 3GSRA 1G6RB 4DEPC 3JWOL 3B9AA 3VFNB 3V5KA 2X4PA 2JK5B 4OLVH 5J57B 1KT2B 3L3JA 1C1EH 1OVZA 5J6HB 2X9WA 4KY1H 4LRIC 1IQWH 1OAQH 5ESAA 4NN7B 5F9DC 1UH3A 1W0WA 4Q0XL 3KVQA 1WTGT 2ADIB 4ZNEA 2P42B 3L9RB 1RJZB 3W9EB 3KWWB 3KLHC 2GJZB 2CJUL 2FJGA 5F96L 4E41A 9CGTA 2DKUA 2HFGH 3TGXA 5SWSB 2EXWC 1HINH 4LAQH 1FZKA 1QNZL 2OMBA 2DTMH 4RZCB 5CD5C 1DBML 5JDJA 5FOBA 3M8OH 5IOPB 4J3XA 3QDJA 3VMNA 4OQTH 4OLUH 4Y4HD 5D1XA 4JFEB 2Q8BH 2F74B 4PJEF 1XGQB 2FCBA 4KDWA 2JJUA 1U3HB 1ORQB 4P5TD 3R4DA 2FECI 1S7VB 5E5MB 1BX2A 3RWHB 3GBNL 4X99B 1IM3A 1KBGH 1MY7A 3BYTA 4P2RA 1TMCB 1CGWA 1DEEB 4L9LB 1QBLH 2R0LH 4JFFB 4YDIL 1D3CA 2D3VA 2YZ1A 1FZMA 5D2NB 5K9QI 1RMFL 4L4VD 4HSQA 1XAUA 4X6DB 5IMMB