1PKOA

Myelin oligodendrocyte glycoprotein (mog)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
124
Chain Sequence
GQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDHSYQEEAAVELKVEDPFYWINPGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the antigenicity of myelin oligodendrocyte glycoprotein
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
molecule keywords Myelin Oligodendrocyte Glycoprotein
total genus 31
structure length 124
sequence length 126
ec nomenclature
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pkoA00
4BELD 1MLBB 4LVHB 3RUGB 4NO2B 4QRTA 5DJ2A 3T0ED 1CFNB 4CN4A 4PREA 4K8RL 2DBJA 5LG1A 3HR6A 2FWOA 2XTJD 4Q58C 3I02A 2Q76A 5FKPB 3AS3A 5ANME 3V6OA 1IILE 3ULUE 4JR9H 3K74B 1MFAH 1MCQA 1U3ZA 2GJJA 1T7ZA 2CLRA 2IANB 3BXNB 3GBML 4MD0B 5IB5A 1HSBA 1CU4H 3JV5A 4N9OB 1FNLA 3TPKA 5DXWA 3CSGA 1I7RB 5EBWB 1BQSA 4LIQH 1MFBL 1KCRH 3DSFL 5JR1H 2DN7A 3FQNB 3NAAH 4ZFOL 3VGEA 2JJTA 4M4PA 4JQVC 2KL6A 4P2YA 4RMSA 3ECBA 3WHXB 2NNAA 3QEQE 4U1KB 5TDOA 43C9A 2XKNB 3WXWH 3ZTNL 4MXWL 8CGTA 3D39E 5E99H 2P24A 2QADB 2CMRH 2VIRB 2YD8A 3FT2B 2YK1H 3TBYA 1MWAL 3INUL 1CYGA 3JVGC 1T1YA 1EXUA 3NFNB 3JTSA 5ETUB 4NQCE 5I1LA 2BP3A 4NC1E 1Q8MA 1KCUH 3D2UB 4IRJB 5FYJL 4I18B 5EIVA 4HC1H 2B4CC 1FN4B 3UBXI 1K6QL 3LKOB 4JKKA 3BH8B 5LJYH 3K8LA 1KJ3L 3EDDA 3HC0A 5JNYB 3GHEH 5CAYB 4Y19E 1V3KA 1JZ6A 3SQOH 3HC3L 1KOAA 2H6PB 4Z0BL 3RWJA 3N85L 3U0WL 3QDGB 5D7KD 4R7DB 2FIKA 4PRPB 5KN5B 2AJYL 1MCSA 4K3EL 5E6ID 2CK0H 4WDIA 2APTA 4H1LB 1S7QA 1D6EA 4LCUB 4G6AC 2QJDA 4NHUB 3UAJD 3TVMD 4R2GD 3DROA 1KGCE 4MJ5B 4ISVB 4WUKH 1QEWB 1EO8H 1B6DA 2HWZL 2PXYB 1P7QD 4L8CB 2XG4A 3OG6B 2PXYA 4M02A 4Y16C 4Z6AT 4WJ5B 1YN6B 4OZIF 2FO4B 1BQHG 1C5BL 4MCYA 3V4UH 4F3FA 1HQ4A 4LVHC 4WFED 3R06B 1FYTB 1YEDB 5HHOB 2F53E 4P57A 2E6PA 3QUZD 3QIUD 1MI5D 1ZK9A 4JFQB 2AK1L 4M43L 5ESQA 5IROA 1JYNA 1J8HA 3REVB 3O0RL 1FH5L 3QNYA 4JM4H 5FA4B 5MEOB 2CLVB 4XNUH 4D9RE 4YHZL 5C6WH 1MHHB 2P8LA 4UTBH 2R2HB 4S1DD 1GIGL 1G9ML 1MQ8A 5I1CH 1FZKA 1QVOA 4NO0D 4J6RL 4LSPH 2Y36L 2AV1A 2Y72A 4MA8H 4JE4B 4OLEA 2M8XA 4POZC 4ZPVB 1GIGH 4PLJD 5F1SA 2EDBA 4HUUA 5IW1B 1N3NA 1WIPA 3LKPA 4XWOC 1ZGLB 3TT3H 4XNUL 1MCEA 2ATPA 2Y5TB 4RNRB 4U6HA 2HT4C 2X7LA 4YDVA 2R39A 4YDLB 3FJTA 2HKHH 5I75C 3WV0A 4YR6A 1EFXD 3B6SA 1JRHI 4JHAH 4QYOA 2X44D 3VG9B 1I8MB 3BVNB 4K94L 1I1FA 2FEEI 4I5BA 1T0MB 3RDTD 3UTZA 1IFHL 2EEDA 4GMSH 4XPAH 1QBML 3T2NH 4KI1A 3GIVB 4MNHB 1RJYA 2KKQA 3EYUH 5HHVL 2APWA 4I48B 4C58B 3ZE0E 4GRWE 3TNMA 4L29B 2B2XH 2HFFB 5AYUH 1LO4H 3RKPA 1CG9B 4UT6H 1TPXC 3WEXB 5HHXL 4EI6A 2RJMA 1NUGA 2X10A 5LGHH 3UYRH 2YPKB 4DVBB 4JY6A 4YUEH 2I24N 5C0EA 5I8KH 2IG2H 4DK6A 2EDOA 3TPUB 4KZDH 4Q6IB 5ENWA 2CIIA 2OCFD 2P43B 1JZ3A 1RPQA 3PHQA 3GMNA 3T0WA 2J6EH 2WP3O 4HV8B 1RZFL 3QDMD 4QTHB 2YMXL 4E42B 5EUKB 1SMAA 2NW3B 3QIUC 5HDQH 1U36A 4BQBA 1WFOA 3BYTA 3VXRB 1CGWA 3MBEB 1ZLVH 1F97A 5ID1A 2YS4A 4GRMA 2ZCKL 5A2IH 5E08H 4OM0L 3GSUA 1XF2A 2EDEA 5DQ9B 1DQDL 3L5WB 1IGYB 5HI5D 1S7XB 2EYSB 5ITBL 3HAEG 4NRZA 5EZOH 4FQXD 4JVPA 2EEAA 2CLZA 5ITBH 4WI8A 4X7CC 1T1ZB 4EJ1C 3L3JA 1FV1B 2BY0A 4YHLL 3L3IB 4K7PL 1B0WA 3VFPB 2QSQA 1F11A 5DMKA 4JKLA 1RHHA 4OCNC 43CAA 5IMKA 4G9DA 4MJIA 1KXQE 3G6JA 4HW6A 4LPTA 3SPVA 2E8ZA 4PS4H 1JN6A 3I6GB 3G04A 5ALBL 5BRZA 3LB6C 4LRIA 5E5MA 2HYMA 3FOMB 1RI8A 3EYFA 1RD6A 5K93A 1F00I 4I2XE 4FQ2L 3UDWA 4TNWK 4ZO6A 3BH9A 1BWWA 5KN5A 2WWMC 2X5PA 2R1WB 4PRDA 1T21B 3GI9L 2ERJB 3L3KB 4H25B 2FECI 3O6ML 4YIQB 5EC2B 3HZMB 2W1NA 5AZEH 1NBQA 3GNMH 3MRDB 1WBZA 2DQJH 4RCAA 5C0CD 3IF1B 2ESVD 3DVFA 3MLRL 4JAMA 1FDLH 4FQ1L 4AT6A 2YMXH 2A1WH 3IETB 3BE1L 4AT6B 2J6EA 1CWVA 2HRPH 1DFBH 1K8IA 2HT3D 4CU8A 1LK3H 3VGGA 4KAQH 3U9PL 1MJJA 3IGAA 5C6TL 5C0AE 1J05A 4LGSB 4OF6A 2FNBA 5BXFA 4J2XA 2D7TH 3RFZC 5BV7B 4PJ8C 1C12B 4HS6A 1MI5E 4KHTH 3QDME 3C6LC 1AQKL 1F4XH 1P7QB 3G9VA 3MV8D 4P4RB 3NPSB 4NQDB 3VJ6A 1B2WH 1I9EA 5TDNA 1W0WA 4LLMB 3VMNA 1ZHBA 2I26N 4XPFH 5E5MB 3T0EC 3KYOA 2EDTA 3I6GA 3GSOB 5JXAH 3EYUL 2NY0B 5T3ZH 4ZUUB 1MRFL 3LH2H 3ZSSA 2YUXA 2C4FT 3ROLA 1CD9B 4U1GB 1BP3B 2CO6B 3HI1B 3S88L 2KPNA 5FKPA 4KRPC 5FXCH 1ZLUK 3MLSH 3DX9A 3C5SA 1HNGA 2VLRE 5D2NE 4G8EA 3T8XB 3DX8A 2ADIA 3QULA 5EIIA 4FFZL 3ZMRA 5ADOL 4ETQA 2ICWI 2P5WB 4OGAD 3TNNA 4LBEB 1KENL 3CMGA 4H5SA 4IRJD 3D87B 4HC1A 3L5WA 4X4YA 1MFDL 2AXFA 1YN7A 4JFEB 3K4AA 4L9LC 5F7DB 5IEKA 4D3CL 3C2SA 2XRAH 5IFHL 1IMHC 5KSUA 1CF8H 2Q1EA 4JFPB 2DBLL 4MNHA 2VABB 3MUGB 1W72L 2F5AH 1E0OB 5HYIA 2H32H 3VXPA 1PKOA 4QHKJ 3CU1A 3GBLA 5HBBA 3QO1B 2XIDA 1KYOJ 3PDDA 1GYAA 3ARBA 3X13B 4HZLA 3VXUE 3SO5A 5I1EL 3I9GH 3VFNB 4JKPH 2O26U 3PV6B 4JKPL 2WUCH 3IAQA 4JG0L 5A2KH 4LIQL 5CGTA 4JGMA 3RL1A 1OWWA 5DJAA 4F9PA 4F37K 5D6CA 5E94A 1LILA 2W9DH 1FZOA 2HA1A 3UTZB 3GMQB 3CFEB 4LEXL 2P8LB 2RB8A 1KTKE 1Q94A 3D0LB 3W39A 3MLSL 3C9NB 4RA0C 1EMTL 4EDWH 4WFFD 1CT8A 2DQEL 2AVGA 4RAVB 5DRXA 2IPTH 5J9PB 2GI7A 1JGUL 3IDUA 1OF2A 3KLAA 4MNQE 5ICYB 4OIBA 1KCSH 5C0FB 1IM3B 5D1QC 5GS0C 2DF3A 2EDXA 3QSKB 4G7VL 3RIFF 2UUDK 5ABDE 5HVGB 5F93C 4TUJB 4ODXB 1CFVH 4YXLH 3OTTA 3ARZA 1T1WA 2I5YL 5HDBE 3QO0B 2BXYA 1RUQH 4YO0A 1MH5A 4IOIB 3X11A 3LMJH 1TZGH 5GSRA 4L8CA 2DI7A 1VSCA 3ULVH 5C2UB 4ENEC 4P5KB 1NKOA 4H1LG 5D9SA 3DXAB 2X4TA 3HC4L 4QEGA 4NUGH 4GFTB 1S7RA 4KXZI 1FJ1A 2DLFL 4M7ZB 1I75A 3EYOA 4H1LA 4RX4D 1HZHL 2Z31A 4NKIH 5E7BA 5F9DC 4ZUSB 3BX7C 5DZNA 5ICZB 2DWDA 2W9EH 4TN9A 3KPLA 3MLWL 1IC5H 5EBLB 4UOW1 4I9WE 4HUXA 4AYFA 4MAUH 2DQDL 3C60C 3Q1SH 1B90A 2BRRH 4P5KA 5JHLL 3HC0B 4CVZA 2FDBP 1FIGH 2DAVA 1S9WB 3EYQC 1A21A 1EEUA 5EPMB 3IFPB 4NUJB 3PWJB 1UVQB 4LEXH 4P2QA 1YNKH 4PY8I 4GRLC 1U8QA 5GRZA 1IGTB 1OGAB 5C08A 3QT2A 4MQXD 1CD8A 5C0FA 1G6RL 4DUWA 3O11B 3MACL 5DFVD 4ZAKA 3QDJD 1U41A 4JFHE 2KQNA 3VFVB 4IHOB 4Z7NE 1JVKA 1JWUA 3BP4A 4NQVA 2G5RA 1NSNL 3O9WD 1T4KB 2RCSH 3OKMB 3QDJB 1CGXA 4GG8A 4RAUA 1SM3H 3T77B 4X9GA 5IIEA 4G9FA 4NT6A 5BJTA 5I1LB 3TV3L 3RY6C 2VZSA 4ZS6D 4WWKA 2VZ1A 2OYPA 5A43C 5L8LB 2GQHA 3GSNB 3WNLA 4NO0B 2NZIA 3P2TA 5TPWL 1UC6A 3WHE1 5EU3A 5CEXA 3EOTH 4BSWB 3QXVA 3SQOL 5F6IB 3D48R 2BVUA 3S3JA 3C87A 4OTXL 5SWSE 1RSFA 2HFTA 4PTTB 2IFFH 3DBXB 1F3DJ 2Z91B 3TBTA 4PJXE 4WEBH 1UKTA 1KPVB 4KRLB 3CAFA 5L2KE 3OF6A 4Q9QL 4H88H 5CWSB 5DURB 4PRPD 5DRZA 3QHFH 5IR1B 2VWEE 4H26B 3U82B 3TVMA 2VQ1B 1UWGL 1NAKH 3GRWL 5D71H 2C3VA 4XC3L 1MCCA 4NO5B 2IAMA 1CBVH 1DN0B 2V9TA 5EWIH 5KG9B 4X4ZA 1NCBL 3TO4D 1H3WM 2BSSB 1ACYH 3BT2H 3P11H 4Y4HB 4GT7A 2L7JA 5C07B 1J1XL 4IMKC 3V95A 4P2RB 5TFSL 4N0RA 3PL6C 3CFKA 3RJQB 3KR3L 1NBVL 5CP3H 5K9KB 1T5XA 2X4NA 1KCKA 1BVLA 3SJVD 5ISZD 5IROC 1KN2H 2VH5H 5IBUB 4IMLB 3SE4C 3RVXD 5KTEH 1NGYB 3DURA 3PQYE 3S34L 1MHPL 5IF0A 2BVYA 2Z9TA 2Q87A 4TSAH 4XGZA 1S7UB 3MA9H 4XPHL 2CKBH 1MVUB 2DQJL 2FX8H 2C3GA 4C56E 1TXKA 4P3CL 5L88H 5CEZD 4WWKB 2D7PA 1VGKB 4NDMB 1UJ3A 4JZJA 4AK1A 4GW4A 4PJGE 1FQ9C 3PP4L 5GQBA 4UTAL 1KB5H 4JZOB 5ECJE 3IGAB 5FCUH 5JPNB 2A74A 4X6EB 3LY6A 1NEZG 3N50A 4JAMB 5DQDL 1LO0H 3MREA 1WFTA 3QH3A 2M2DA 2X6MA 1RV6X 3SDAC 4IHOA 3O3UN 1T04B 3MGAA 2UUDH 2D7MA 2XV6B 1RVFL 5CD5C 4HXBL 3FFCB 2YA1A 1G9MH 2V5TA 1Q72H 4AEHL 4ZTPL 3EYSL 1GCFA 1P5UA 3WXVL 4DK3A 4Z8FH 1HYSD 1IC7H 3I75B 4XPGL 4NN7C 1XT5A 3MFFB 2AK4E 2G2RB 3MYJB 1O0VA 1A6UH 4NQEE 3NCFB 1QLRB 1N0XH 1DCLA 1ES0A 3V6FA 4YBLB 5DJCA 1KG0A 1J0KA 4PJHB 4QOKB 2V2WA 4FQXB 4MB4A 1QR4A 4JFFE 2ICCA 4GAGH 1J8KA 4Y5XC 2DM7A 1HSAA 5GGTH 1OTSD 2W92A 3G08A 1DUZB 4I2XA 2NLJA 5B39A 5IFJA 3L3IA 3I6KB 5DUBA 3F7QA 4QHLA 3TH4T 1FVCA 1ZHLA 5B4MD 4D0DB 2XFXA 4PUBH 4DN4H 3S3PA 3FQTB 1BAFL 4OZGF 1F3JB 1S7SB 4KKCC 2XNAB 3MRFB 1R3JB 3IKKA 3ILPB 4GRWF 1INDL 1CTOA 4NQED 3ARFD 4MB5A 5I8KL 4JGUA 2H45A 5JLZA 4Y4KB 4I1NB 1KPUB 1AR1D 2XOTA 2XA3A 1RK1B 2DI9A 2ZCHH 4MA3B 1ZLWK 5DLML 4HPYH 1K4DA 2XWTB 1NCBH 3O6FC 3VCLB 2AJSH 4Z7WF 4PJBA 4BFEA 3HC3H 4TSAL 3TZVB 3OJDA 5D1ZB 3RKDC 3TF7C 5JTWA 2WUBH 4PJ5A 2J3SA 1BZ7A 2EDHA 1C1EL 2PETA 4YDIH 4Y4FA 2XA8H 4HUVB 4K71C 1A7OL 2YPKA 5DK0B 1DBJL 3C5JB 2OL3B 1DQJA 1K5NA 1SEBB 4K7FB 4NZTL 2FH6A 2HTLC 4L3AA 1MIML 4OZIE 2HKHL 5HHPA 3PUCA 1ETZA 5JO5A 3BGFB 3IDJB 1MCKA 5KJRH 3SDCB 5E94B 1WAAA 3O8XD 3IDXH 2IAMD 4B50A 2XQYK 4PG2A 1C16B 3DECA 1Z3GL 5TGBA 2UWEE 1XGUB 4ZO7A 2GK2A 3U7YH 3F6IA 2XQBH 1YNTA 5IJVA 4KVCL 5CZVL 1ED3B 5D2NC 2OBGA 4F37F 2PW2B 2VLKA 4O51B 2IH1A 4JZJC 4DZ8B 4PJDE 4BQ9A 1AGDA 5JOPE 1F4WL 3GSVB 5D7LD 3OB8A 4DW2L 4U2ZA 2OL3A 4U1SB 4JRXD 4YHZH 1MIEL 4NO3A 2FB4L 1HIML 2J5LB 2ARWA 2E27H 3HS0A 4NBXB 3P9LB 3UJIL 3VH8A 1CFQB 3MUGA 3ZL4L 4OZHF 5HSFA 2WLZA 4PGBA 1XGUA 3MODH 1H3GA 5EA0L 2X9YA 2CXKA 4TUKL 2APVA 3MV8A 5BCAA 4Q9BA 4HK3N 4X6CF 1KN4L 1HHJB 4O5LH 3GSNH 3OX8A 1J0HA 5HGDB 3BW9B 1YMHB 2V9RA 4FQCH 1DBAH 3L1OL 3HAEH 5DHXB 1KJ2H 2HP4A 2CR6A 3WN5B 3DO7A 1WICA 1YEDA 3ZYJA 4G9FD 3IJHA 2C7UB 5I19L 1FNAA 4TSCH 3V8OA 2E6QA 5KSAC 2X4UA 4C83B 3OJDB 3SE8H 4IRZL 4LHUA 4NRXB 4Y5YB 5JQ6H 3RL2A 5CJXA 3P73B 3KLDA 5JDSB 4G6FD 2J7LA 1HILB 1B4JH 5GHWH 1V7MH 5KS9A 3U79A 4D0CB 2G5BA 4YE4L 5FCUL 3UTSE 1Y0LB 1DUYB 1UM5L 4LCUA 5TDNB 2IPUG 4UT9L 5CEZL 5FECB 3ULVL 1J0YA 4OV6F 4LLAA 2V17H 2JK5B 4P3DB 4BZYA 1JZ8A 3HMXH 3NIFE 4QTIL 4JFHD 3EOAA 4JLRA 1G0YR 4OCRL 5E2WL 3RY6A 4W70A 4PG9B 1JPGA 2JIXB 3MLWH 3O41B 3SGEH 4KMTL 5TQ2L 4ERSH 4WGWB 4ETYA 1CGTA 4F9PC 1ZLVK 5L2JA 2BFVL 2Q3AA 2Z35B 5JR1L 3ILQC 3LQZA 2DM2A 2H1PH 5CINL 1T89A 2BXZA 2XZQH 3V5HB 1QR1A 1KLFA 4ODHL 4TOYL 3RY5A 2HFEA 4HH9A 2H1PL 3ESUF 3ZE2F 3FOMA 4PUBL 3BISA 2BNRD 2NQCA 2I9LA 5JHDE 3P9WB 2UZYB 1JFQH 4JQXA 5TE7H 3CXHJ 2Q8AL 2Q7YB 3W0WB 5F9OH 3WNPA 5FYLD 4UQ3A 4L9LA 4EZMA 1F11B 4PJBF 4M6MH 3LRSB 2F54B 2V17L 4ZOBA 1HXMB 4I0PB 3O8XA 4MDJA 4YEEA 1CR9H 3EJYC 3BPLB 1EIBA 1DN0A 4Y19A 1NEZA 4XGZB 4AL8H 1WZLA 1NFIB 2C3VB 4KTDH 5E8OB 4X5XB 3U46B 3LKQA 3G5XA 5DMGC 4OM1L 3HMXA 3JZ7A 4V2CB 3PJSA 4XMLL 2ZUWA 3J8F7 2B1AH 3OGCA 2MTPA 3G5YA 5I1EH 5K9KA 1U8MA 5E8NB 2XICA 3QG7H 1IKFL 3HZKB 4OLWL 2NX5A 4XCCL 3QIWB 4KJWD 1NFKA 4KWUA 4GQPH 1SY6L 5D4QA 1AKJB 3TEUA 4OLZH 1I8KB 5MEND 4MVBD 3OXRB 4PJIE 5FKAA 2Y06H 1JI2A 4U1GC 4APQC 3MCKB 3FT3A 1CLYL 4YE4H 1H8NA 3BGMB 3VRIA 1FFPA 4L8SB 2HFFA 3DUUA 1M6OB 1T2JA 4HWBH 4KXZH 3WFEH 3WS6C 2WIMA 4L29A 3I2CL 5DGQA 2DI8A 3AREB 3VI3F 1BJ8A 1MHPH 2X4QB 3P77A 2HLFC 4NQSB 4ODVH 2EXYC 3C8KA 1U95A 3UO1H 3CDGB 4CADB 4NQDD 2N1KA 1BQHB 3PNWB 1KJ2A 4XAWL 3RVVC 3BGFC 4QGTA 2C26A 2B4CL 3CFJB 2OXHA 3BUTA 1FFRA 5HHPB 4UQ2B 3VG0L 1I8LA 1LO5A 5IW3A 4F33B 5CBAA 4S2SA 4ODTH 3ZT7A 1INEH 1R5IB 1S9YB 4ZYKB 3O2DL 4MNGA 1UM4H 1SJEB 1R3LB 1BX2A 3ME0A 4YHKH 4WENB 1T22B 3BZFB 4S1SH 1A6TB 1KLGB 5DD5H 5I1JL 2GITA 5MP6H 5IV2B 2BVTA 4YWGH 5I1AA 3GSNA 3OKEB 3L5XL 1Y6MR 2ZCLL 1LO0L 2COQA 4GLRI 3MBXH 3S4SB 1OOAA 4QHMB 1DE4B 1IC4H 4OCXL 4MQXC 2YWZA 1N6UA 1PW3A 4Y2OA 2HJKB 4QRPE 3O9WC 1JPTH 1JWUB 5CJQL 3DVGA 4P23D 2FBJL 4KRPB 1DANT 3AMKA 4U6YA 4O58L 4OAWB 4UOJA 1NDMA 4HKZA 4XPBH 4ZUWB 3TM6A 4LCYB 3CNKA 3CFBA 1GC1H 4QHLB 4Y8AA 1GC1L 3DUHA 3QIBA 5HI3D 3W2DL 4IM8A 4NPYB 4LSTH 3QG6A 5HVWA 5BVJB 1TJHH 4FP8H 1HEZA 3O2DH 5H94A 1GAFL 1HILA 4NN6B 4QXUL 5GS0L 5IG7A 1QBLL 3FB5A 3SCMA 4HBCH 1WCBB 4MD5B 4M43H 3V5DA 2B4CH 4RMRA 4TYUA 4HIJA 4J4PA 1MCRA 4JO1H 5JHDB 1INDH 4NZRH 1QLRA 2VKXA 1VGEL 1DQDH 3ARSA 3T0EA 2G2RA 3OKLB 5IBLC 5DK2A 3C5ZC 4RFOH 5SV3A 2AXHA 3CDCA 4J8RA 4JPKL 5DD6A 4UUJA 4YBQC 3LEXA 4G8GE 1RZFH 4MHHI 4KFZC 1ZT7B 5J11C 3C08H 1YMMD 3QHFL 1MCIA 3RTQD 4G3YH 3QH3B 2J6EL 2CDGB 2ESVE 2E9JA 2BY1A 4X80H 4Z7WA 3BESR 3ULUL 1DVFD 1G7MB 1GGIH 4JN1H 2GYSA 2CK0L 3VDBA 2B5IC 2KUTA 1ZVHA 4HX1A 5TJWK 4D8PA 1CL7L 4NM8H 4GBXD 2UWEB 1GGTA 3BAEH 3HI5H 4UNTA 5GGQL 5I1AB 3WDJA 2ENYA 5E00B 5KSBE 4O4YL 4N0FA 1X5KA 3RNQA 4JO2L 1YPZE 4L1DA 2NNAB 3WFEL 1S9YA 3MCG1 1UB6A 1LO5B 1EHLH 5HD8C 4J12A 5I8OH 2ARJQ 1I3UA 2WW8A 4XPAL 4B41A 1M05A 4PJDF 1E4JA 3TFKC 4NKOA 1JHKL 3UTSB 5JXED 3LKRB 1E28A 4XPTH 4Z7OE 5HPMB 3QQ9D 2B8OT 5BS0B 4NQUA 5HYJE 2NXYC 3C8KB 3RZCB 1KB9K 3CC5B 5GXBB 3W5NA 3HNSL 4KV5E 3ZTJH 3IS0X 3P4MA 3PL6A 4OD1L 2Y1VA 1LP9F 2RIKA 3D18A 4GMTH 1OAKH 5SWQA 4P23B 4LSTL 1N26A 1B3JA 3VE0A 4XH2A 2GFBA 3G6AA 5I1CL 1B2WL 3A6BL 5EC1B 5M95B 1I8KA 2HMID 1QBMH 1YEJL 5E03A 2DQEH 3T8XA 4EUPG 4HJGB 3NCMA 3MRMA 2RHEA 2VLJD 1LMKA 3NCYP 5DUMH 4UQ3B 4EUPA 3Q5OA 5CJOH 1SJVA 3OKOB 1U8MB 4P0DA 5E8NA 2BSTA 3O4OC 1EUUA 1ZVYA 1UENA 3QIUA 4KAQL 3U9PH 4F9LC 1J1XH 3ARTA 2VB5A 4NZTH 1F3DH 5EBMA 2K9UA 4FZEH 5F88B 2D9CA 3NACL 1YQVL 4Y4KA 1F3RB 2XQBL 4NKDB 3DO3A 2OTWB 2VN4A 4Q9RL 4ZFGH 1U58B 4LKCA 2YKLL 4FXGA 3CSBA 4LMQE 3D0VA 4X7SL 2BX5A 1KXVC 5FGBC 1MFEH 2PYEE 3U36B 4AJ0A 4KPHL 2BDNH 5E8EA 1NFDA 3OGOE 1UZ6F 1QFUL 1ZA3B 1UYWL 3U4BL 3W81A 3EYVB 1D9KB 2P45B 4C56B 2W0FA 2DMCA 2D03L 3QCTL 1MHCB 2DOCA 5ALBH 3RGHA 4U1NA 4PG9A 1HWGB 4ZSOA 3B9KD 4NC2B 5I8EA 1CBVL 3UTOA 3VH8G 4AM0B 5T1DH 4ZFZA 3TH2T 3ZKQD 1OB1A 3IFOA 1EERB 1WF5A 3A6BH 4YIQA 4LASL 1S9VA 1JZ2A 2BOCA 4OCSH 1SQ2N 2A6IA 3NPZB 3AU1A 2GCYA 4EQ2A 1BPVA 3D2UD 1JNLH 5BVPL 3WYRA 4TULL 1H3PH 1T1XB 4LFHD 4CVWA 3ES6B 4IMKA 4Z9KB 1W72H 4KTEL 3MUZ1 3DYOA 3C8HA 1EZVY 4R0LC 3TGXA 3VRLF 3WJLC 1CDCA 1DBAL 4PV9A 4L3CB 4HIXH 1S3KH 1I7TB 4GKSB 4PJ8B 4JPIB 5EB9A 3U4EB 1BHGA 1J5OH 1R5VA 3B9DA 3IDIA 4JLRB 3ZKMC 3WLBB 4G8FB 4XPFL 1AI1L 3L3KA 1NFDB 2DLTA 3HPJA 5LBSL 4IRSC 4IIQB 2CKBB 5MHSE 4UZGA 1CGSL 2EYTB 4KRNA 2D03H 1PG7L 3UPRA 3Q6FA 4U1HA 1VEMA 3D1MC 4MA7H 2WBWB 2OTWA 2QQNL 1YMHA 1D5MB 2P49B 5CP3A 5ICXB 1AR1C 4IOFD 4D0CA 3JWDL 5BRZB 5FM8A 4DW2H 3VXMD 3QDAA 4PJ9A 2EEBA 1RIVL 3VW3H 5I6XB 1MH5B 3J7HA 2R2EA 1MRFH 3QP3A 3CXDH 4QTHA 5C0ND 3CFKB 2X4UB 1ZXQA 4C83A 2BJML 3F8UB 12E8L 2JTDA 4NGHH 1MVFA 4WHCA 5E4EB 3T1FA 1EEZA 2FJGA 4MDIB 4HJGA 1A9BB 3ALXA 4LLDA 4Z7OF 1YECL 2Z92B 1XF1A 3EO9L 4QNPE 1MUJB 2R8SL 3V4PH 2VISA 3SE3C 5ADOH 5J9PA 5IK3B 2P5EE 2W9LA 4ZFFA 3QCUH 5HHQB 1P7KB 1XIWC 3AGVA 5KW9H 1F13A 1HHKA 3BPNC 3EGSA 4X9IA 4ODHH 4PRAA 2I25N 1CS6A 2FYYA 2J88L 4FNLH 4OFVA 4HULB 5H37H 4QRSB 1HWHB 4OGZA 5D6CB 3KNBA 2EC8A 4ZS7H 2V7HB 3RVXC 4ONFH 4RSVA 4ACPA 4PGBB 1IAIL 3WFZA 3V79C 1AGFB 2W59A 2JB5L 3K4DA 2VC2L 3DUSA 2GTZB 1XCTB 1A7RL 1Q38A 4BFGA 2CIIB 4ORGB 4LKXB 3GGWA 2IBZX 1ZA6A 4WFHE 4XZUB 5LQBL 4JY5H 4XBGB 4ONFL 3CVHH 4HT1L 4RNRA 4YHPB 3WLWC 3DJ9A 2V2XA 5BO1L 4G6FB 5T3ZD 1J11A 1J0IA 3ILQD 4QRQA 2ATKB 1MEXH 3MR9A 1RZ7L 2G75B 4J4PD 5DS8A 2J5LC 1XCQA 3OMZA 1XCTA 1WSST 3RBGA 2CR3A 5IJVB 5BZDB 2FEDD 1P4BH 3B5GA 2IFFL 2BK8A 3MJ6A 3T0EE 1QVOB 2AK4A 3MRNB 4XNMB 1RFDL 2CQVA 2AXGB 3OG4B 4X4XB 3TO4C 5ERWB 4TVPD 3JSSA 3SGDH 4BFBD 1PLGL 4X4YB 4YWGL 4PJXF 4K23H 4U6HB 4OCWH 5D7KE 3LRGA 1L6XA 4OCWL 3MXVL 1HNFA 3DRQA 4NM4L 3KAAA 4ODTL 2XFXB 4RGOH 5C7XL 5ESAB 3RI5K 5D5MA 1BZ7B 3QI9A 3HZYA 5IFJB 3F12B 4M61A 4PGEB 2Q86B 2XN9B 4JCMA 4G6KH 1J9CT 5DUPH 3GSQA 3DMMC 3IFPA 1T5WB 1REIA 2R56L 4UINH 4YPJA 1NBZB 5C0BE 3B8YA 4UAOC 4PLNC 4CDGC 3R1GL 1DDHA 5HY9A 2BSED 2D3VA 5CKAA 3ZTJG 2R2CA 5TQ0H 3OKDA 5JW5B 4FTVA 2EDFA 5FA4A 1KCUL 3IT8D 4FQLH 4HHAA 4RWYL 3CMOH 1J8HB 3REVA 5D5ME 1YYMH 4PB9L 2XNAA 4UB0L 3I75A 1T66C 1GL4B 2DQHH 4WUUD 1GAFH 1C5DA 2FB4H 4OLZL 3TA3C 1G7LB 5EO0B 1GZPA 2V2TA 4F3FB 5BXFB 3H9ZA 5EN2B 1RZKH 4IDLA 5BRZE 1H5BC 3NAAL 4I9WD 5D1XD 1U91B 4MNQD 4OJFL 3IETA 4WFGE 4M7KH 5C0AA 1G6RH 1NFDF 2E5EA 5C2BH 1S5IH 2DQFB 3QJHB 1WBZB 4NKIL 3TVMC 4JFYA 3SBWA 2AQ3A 2QHRH 1NH6A 2EO1A 1ZLUH 1SJHA 4XP1H 1OTTD 4JGJA 4HIIA 3MGOB 4O2CA 2MOVA 3BRGC 1UM6H 5TDOB 4OCXH 5F9JA 5F7UA 4POYA 1TQCB 2VKWA 3P11L 3BI9X 2NY6D 1FNFA 4KVNL 4X6FA 1K8DB 4KROC 3RA7L 3UX9B 1UCBL 4U1NB 4LSSH 4RX4A 4Y4KD 4K8RC 4Z7UF 4CMMA 5CS7A 1AO7B 3PWLB 4YAQB 4FOMA 5CBEB 5F1IB 2DLFH 3BZEB 2HH0L 3RL1B 2HWZH 1R3HB 5CMAA 4QF1A 3SKMA 3PXJA 4HFUH 1VGKA 1SBSH 3C60B 3M17B 3VG0H 5HYJA 2A9ML 3PIQB 2GUOA 4Y4HA 3U36A 2NY2D 3QCVH 3GIZH 3QIWD 5FYJD 4FXGB 4M7JL 3TYGL 1H5BA 1BFOA 4LSQH 4KUZH 4F7EA 2HT4D 4YDJB 5LWYH 2NW2B 2RAMA 4L4TD 4P5TA 5DA4A 2W9DL 1N64H 1B0GB 3HG1D 2ORBL 4PY7A 2NMSA 1P2CB 4M6AA 1RUKH 4GRMB 2OTUB 5F7NC 5IR1A 2Y7QA 2IH3A 1NLDH 3Q48A 3MLVH 1EDQA 3ZKXB 2VABA 2ZUTA 2Y07H 1JF6A 1EHNA 4JFPA 2EDJA 4FQHB 4G6JL 4ONGH 1GJIA 3E3QE 5FO9A 1GOFA 3VXME 4XRCA 3SDXB 3HKFA 1MLBA 1YEIL 2QL1A 4ENED 5DZOA 3WUWG 3Q0HA 5DI8A 1GGUA 1FFQA 3PWVB 1NSNH 1N0XL 4L3EA 4MNQB 4HFWA 5GJSL 2B7DT 4P9HC 5EULV 2PTUA 2VQ1A 4Y4HC 1CLOH 2AEWA 4X9HA 2VDMH 2HTLD 3C60A 1Q9WA 1JTOA 3GJEA 2OK0H 4WUUB 3X12A 2FHBA 3R0NA 2VDML 4MJ4A 2APXA 3T3ME 5JOEA 3ROLB 1QRNA 2EKSA 4ZFOB 1NGWA 1NC4B 1AP2B 4DGYL 5F3BB 2DD8H 3WFCL 1FGVL 3VGFA 4P5TC 1U3HB 1LEIA 3X14A 3PP4H 4LAQL 5IM7A 1BZQK 4OZGB 5ALCL 1I7ZB 3O9WA 2VL5A 4XCNB 1P7QA 4OF8A 5DVNA 2FL5B 4Z95H 7FABH 1A3RL 3L7EA 1F42A 4D0BB 1TJGL 1SJHB 4ZUVA 3HNVH 5IW6A 4G6MH 4IJ3C 3K2UH 3C08L 3TBVB 3ARQA 1R3HA 2P7TA 5CMAB 1OAXL 2AV1B 4OQTA 2KQMA 1J05B 2DKSA 2HVJB 1T4KA 3MODL 3DMMB 4HDIB 1HOCB 5KOMC 4M7JH 3TYGH 2BNRA 5DYOB 3ZKSD 4BUGA 5LGHL 4OZHA 2V5RA 1I8LC 1LE5A 1U9KA 3NN8B 5TFSH 3U30B 2IQAA 3NFSH 4UUJB 4P3DA 4L4VB 4ZUSA 1V3LA 4EVNA 3PXHA 3VXOA 4HS8H 2Z4QA 4HS8L 4KU1A 5SX4I 5CJ8A 2ZSVA 4ZS7L 1G1YA 1T7YA 5F44A 5C71A 2FO4A 4DGVH 5GGVL 2D7QA 5D1QB 3OQ3B 4ODWB 2R0LH 4NUJA 4KGLA 5IG7B 2DIBA 4APQA 5GSRB 5GRUL 2VDNL 5FUCE 1LEKA 3BPCA 1D5BB 4JFDD 5HGBB 3STBA 1I1RA 2NXYD 3ZHDA 2JCCB 5KSAA 1RZGB 3T4AA 3AMLA 5GS1A 5DVMA 2V6HA 1KC5H 1KFAL 3M07A 5F8QC 3I50L 1BFVH 5I15H 5DRXB 5SWZA 2PCPB 1F90L 2H6PA 1S7XA 2WWMD 3LSOB 1JGLL 1IKNA 2ZCLH 4YNYB 5I19H 3KPRB 2E7MA 1JPFB 3QJFB 2P1YA 4Y89A 3KPOB 1J12A 4XBEH 4WV1A 4JN1L 5EO9B 1TNMA 4K7PH 4HPYL 2XZAH 3LB6D 5DWUH 5DJAB 3UJTL 4N0YH 5E4IA 5IEHA 5DWUL 5MEPB 3TC9A 4LSVL 2AJUH 3TBYB 2AK1H 5B3NA 2DBLH 1J1PL 5GGTA 3V7AG 3QYCA 3IU3B 3WD5H 2GITB 4R4NC 5C8JA 4PGCA 5CZXD 5IWLA 3ELAT 4K8RD 2VOTA 1OHQA 1D9KC 2MHAB 3SO3B 3ZYZA 1I1AD 3O3AA 1MCBA 3QB7C 4YHLH 1BBJB 2UY7A 4PR5B 5IJKA 3SJVE 5ISZE 4EUPH 2PW2A 3WSQH 5EIQA 2IPUK 2F8XC 3PDOB 4J1UA 2EKJA 4O02H 2AXGA 2JJSC 3IU4H 2D2OA 4MSWA 1U8JA 3FFDB 5IVZB 1F4WH 3DIFB 1NMAL 3QWQB 1YEFL 4PREB 3FB6A 5F7DA 5CIPH 3DTXB 4WI9A 3BGMA 5L9DH 1U93A 1MPAH 3PHOA 5BW7A 3L7FA 5D7SL 2ZUQC 4YEFA 2I07A 1FLRH 3BO8A 3OF6D 3SGKA 1F90H 2ZG1A 3BPLC 5FOJA 4HWZB 4HUVA 3P4OB 2AGJH 3B9EA 1ZVSB 2IEPA 5F7FA 5T1LA 1ADQH 2FHFA 3D25A 1KENH 1DBMH 4PJCA 2YRLA 1AXSA 1OTTC 1AGFA 4NUGL 5EOCH 3HZKA 1RJLB 4AIZA 3DGGB 4XMPL 4P5MA 4PJXB 5IB2B 4KUCD 4FQXC 5AYUL 3H9HA 2VYRE 4N0UA 3TYFB 3QDJE 2OJZL 3UYPA 1HHHA 1KTLB 1U3HD 5J57B 3LH2L 4XT1C 2J8UE 4JJHA 2HFGL 1MOEA 4KDTA 4KZEH 4AQOA 3SCMD 4XCYA 1R3JA 3OAUL 4P4RA 3QZWB 1X3DA 2N7AA 4PB0L 1KTRL 1H3UA 2DQCL 5GS2D 4V1DE 2JCCF 3HPJB 2YC1B 5GGUB 1JZ7A 1KEGH 3K8KA 5C08D 1JYWA 3BKYH 1I7TA 4PJ8A 4U1MB 1KJVB 3NIDF 4MA7L 1VERA 5ID0A 3V4VH 5IBLD 1VDGA 2JJTC 2HN7B 2XQYG 3MJ8A 4K2UH 3LN4A 3VG9C 1LO3H 3IFNL 3CLFH 5L2KA 3VWKC 2HFEB 3VXOB 3WMSA 5CZXC 4DVRH 1QHOA 1Q0XH 2FZ3B 2NY5C 1P4IH 3WNNA 5AZEL 4OI7A 3RWJB 4CN1A 3BEWA 1IM9B 4HPOH 5E9DA 4M8QA 1CIDA 3LS5L 4IS6A 5F7WC 3ARGD 3AC0A 3G6DL 3CLEH 4RMVA 3CFCL 2O93L 5FYKD 1ZHNB 2E9BA 4JFFA 4KKBD 4L4TB 1FZJA 2F54E 3ZE2E 1UM5H 3O3DA 3JWOL 4NHCH 3V0VA 1A0QL 1SHMA 4CNIA 4R8WH 1C5BH 1ZA3A 4KUCF 1EHAA 4NWTH 4EI5B 2FEDC 2ED7A 1B88A 4JRYA 5I1KL 2YC1A 4WU7B 4AL8L 1QA9B 1CL7H 4NM8L 1U8NA 1FC1A 2VLRA 3ETBF 4X6DE 5TPWH 3QHZH 5E5RB 1EHXA 1S7VA 1PG7W 1IGYA 5I71C 5SWSD 4ZSOB 3BMVA 3GKWL 3OKDB 5JW5A 1FL6A 5FYJH 3PGDB 1HH9B 3FQXB 4WFGD 3PWPD 4GG6A 1TVHA 1CFTA 2DS4A 4XB8A 4IRSA 5IB3A 3VD5A 4AEIH 1P84K 1OAYL 4PTUB 1RHHB 1WZKA 43CAB 1KB9J 3MRMB 5GGUA 4N8PA 4F7PA 2ITCA 5IFAH 1WIUA 1GGCL 3D25B 1I3GH 1P4IL 4Q6IA 3QXAB 5C3TA 5HYSB 3P30H 1W2KT 3K8MA 1JWMA 5KG9A 4U33A 4K94H 1KPRB 2DYPD 5DJZA 4X7EC 1T2QL 2ZPKL 3LEVL 4YPGB 3GSUB 4XNZB 5DD3H 1XF2B 2YUZA 4HD9A 1WAAF 4QXUH 5DDHA 1V3MA 5ID1B 4G80A 4GAFB 5D96B 2ADGA 4MX7B 1ACYL 5C0RL 5KW9L 4X98A 2HRLA 4N8VG 2XTLA 4UU9B 2NY1C 1MHEA 2AI0L 5JHDD 3T4YA 2WBJC 3DBXA 1TCMA 3BKCL 1TDQA 5EUOE 3TPUA 4B0MM 2AI0H 1I1AC 4QRQB 2B5IB 4HQQH 1RJCA 4PJIB 4YHPA 2IALA 2YPLD 4YHIA 3SGJA 4TTDD 3LCYA 4K7PX 1MJ7H 5TE6H 3E8UH 1G7PA 1XZ0B 1G7QA 4KK6D 2VDKH 2SEBA 3MTRA 3IU3A 2WLYA 5D2NA 3M17A 3D9AL 5LGKA 1MREL 4LSUL 2P5ED 3OR6A 3VGAC 1MJ7L 1Z9OA 1FGVH 4NJ9H 4BH8B 4MSWB 3B2UD 5HXMA 1L0XA 3IXAB 1YEJH 3C5ZB 3HB3C 4X6CA 2XT1B 2J8UF 2QV2A 3X3GH 4N8CL 1YUHA 1FO0H 3RVVD 4YLQT 3MV7B 3BP4B 3GSWB 5DSCA 5T5FH 2R1YA 3ARGA 5I1JH 4NKMA 2R56H 5FA3A 1A6VH 3MRCB 1XR8A 3MX0A 5INDB 3RZCC 1K5NB 1FLTX 4X6BB 2ATPB 4KK9D 1OAZH 2P8MB 3KJ4B 3RUGF 4UB0H 4D8PB 4ZXBA 2OL3L 4QXTB 2ICWJ 1OP3H 1W0VB 1T3FB 1TVBB 3JTTA 4MCYB 2WBJA 3S96B 4P2QB 4OCYL 4R4ND 1IQWH 3FB5B 2IAMC 5C0AB 1YZZA 3GMOB 4APQB 1DBBL 5I1HL 4U7MA 1X6LA 1A7QL 1JK8B 5GJTL 5E9DD 3DROB 1IGJB 5FO8B 1UEYA 1MY5A 3ILPA 1S7QB 1AJ7L 3UPRB 1VFBA 4QHUA 4BK5A 4EVNB 2OTPA 3KS0H 1X7QB 3N0PB 4YUEL 5D2LE 4NQCA 4ZQKB 3LPWA 5IHUH 1I9RH 4A6YL 2E8YA 2BRRL 1ZAGA 3G08B 4LPCA 1GVIA 1NEUA 2O5YH 2GTWB 2X42A 1HOCA 2R0KL 2B39A 4Z7VB 5HI4C 4BSJA 3HE7B 4Z8FL 2X4OA 3MQIA 1I85A 4YFEA 5DQJA 4YHOH 5E2TL 3LS4L 4G8IA 3OJVC 1F4HA 4NOBA 5BVJA 5T5FL 4IRJC 4CRPA 2XY1A 2ZSVB 2GJ6E 4QXTA 1YQVH 3HZYB 4ZUVB 3T2NL 5DQDH 1MAJA 3TIEB 5BZWA 4LEOB 5DT1L 3D69A 5C86A 1MQKL 4KI5E 3U4AA 1IGML 1U92B 2X4PB 3BOVA 4NFCA 3LMJL 3SDCC 5AAWA 2XKNA 3U2SA 5MI0C 4RAVA 4HIEB 2XA8L 4NNXA 5INDA 1LEIB 4B53A 1DJSA 1U3HA 4UV7H 3VXUB 4GSDH 1IM9D 3CDFA 4DJMA 3ULSA 1BWMA 1BJMA 1I7RA 4PJGA 1RULL 5DSCB 3H42L 5I1GL 2GJ6A 2DMBA 5GGVH 5D7LA 2O5ZL 3BKCH 4MZ3A 4BH8A 4NSKB 3QUYC 1UCBH 3ZDZE 1UZ6E 1JF1A 5GRJL 5D2NB 3BPNB 2VITA 3ROOB 4HJ0C 1G7HB 1QSEB 3O4LB 1XF5A 1WZ1L 3GMRB 3OBAA 1CQKA 3IDYB 3UXFA 3VXSB 5T33L 1QO3B 4XCEB 1I7ZA 2FX9L 1GOHA 4HFWB 1R3LA 4BM7A 1SJEA 4EQ3A 3CZFB 1BAFH 2IALB 3X14B 4S2SB 3OR7B 4HUKB 1GPOL 1ZA6B 3TCXA 4J3UA 4PJFB 3MXWL 5H2BA 3EO9H 2FD6H 5C09E 4JFED 4HK0A 5B8CA 2H32A 3ZE1E 4ALAH 1NC4A 4NJAL 4WW2F 3QIWA 5EU6B 2CLRB 1KUMA 1BQHA 3VFOA 4M7KL 4OGXL 3OKOA 1DBKH 3DYPA 4WO4B 4P5TD 1MPAL 1S3KL 2AKRB 5JIKA 1TJGH 1A3RH 1SBBA 1E6OL 4MS8D 4OSUL 4S0TD 2P5EA 4GAJH 2WWKT 3HE7D 2FX7L 1OP5K 3EYSH 2C3HA 2NY3B 1KJMB 4AEHH 1QKZH 4JFFD 3PL6B 3BUYB 3T0AA 4JO4H 2VE6B 1PYWB 2VR4A 2BSRA 4P59L 5D7JB 4HKBB 1K4CB 3K80A 1JUFB 2DKUA 2MQCA 4X7TB 1EVUA 2VSDA 4P59H 3P9MA 2AJVL 1JBJA 1U2HA 4NWTL 5EOTB 4HMCA 4PLJC 3D5OF 2I9LB 4TTGA 3G5XB 2GEEA 1IGFL 1P4BL 1K8DA 2CJUL 5H2BB 4PY7B 1X5JA 3HRPA 2R2BA 5IMLA 3S37L 4NKQB 4P5TB 6FABH 1FORH 5B8CC 1D5XA 5I16A 2X09A 1AE6H 5D2LA 4U1IA 2EYTA 4MDJB 5JUEL 4RMQA 1QR1B 3GSNL 2CKBA 3L5HA 4UNUA 5I1DA 4WI4A 5EZJA 2OP4H 2F15A 4F58L 1NAMB 2P47B 3IDNA 2F74A 1I1AB 3N1QC 4EIGB 4NSKA 1F02I 4RAUB 2GT9B 5DR5L 1KC5L 1QZ1A 4WI3A 4GUPA 4QCIB 2AEQL 2ZZUT 4EXPX 3TIDA 4NQXB 1G9NC 3EFFB 3TLRA 1NMBH 1KCVL 4R0LB 5HHME 1MIEH 3RNKA 5FUOH 4P46C 4U4BA 4Y0GA 1T1XA 4XHJC 5EC2A 4HH9B 2DL9A 2XZAL 4AENA 4XBEL 2YSSA 5EZIL 2ZOKB 5JW3H 1IAKA 1UJTA 1IGTA 3HTLX 3O3BA 4LDLB 3H42H 1Y0LA 4P46D 5JHDA 3PGCB 1M7DA 4OKVB 2OQJA 3R8BB 2JB5H 3HUJA 3NVQA 4PJEE 3TJEL 4HWBA 3RA7H 1KT2A 5MERB 4WV1C 1KLUB 2R4RH 4PJHF 4KK8C 4R4FH 4LHUB 4MJIB 2BVPB 5IKCA 4K3JL 4MA1C 4D94A 4F7MA 2EDNA 3OL2A 3UMTA 4GRLB 2VJXA 4QHKI 2Z31C 2JELL 5ESVB 3RGVB 5IQ7L 4AQ1B 3SEPA 1CI5A 5FECA 1WWWX 1CGSH 3DARA 5GISL 3BZ4B 3RVTD 1B4JL 2NX5D 2N4IA 3WDHA 3HNVL 3MV11 1CXEA 1JGEA 1L0QA 4IRZH 5B4MC 5FEBA 1FPTL 1J5OL 2ZCHL 4JHWH 4PJGF 2VDPL 3VGHA 1BM3H 4P5MB 5IB2A 1T1WB 5JW4M 3L3GB 4PJEB 5F96L 2Q86A 3ARDB 2A9NL 4FA8A 5E2UL 2AJZB 4JREC 3V6ZB 2K3TA 3STZA 4HKJB 3PHQB 4HEPG 3S9DB 1JHLH 5GGRB 3S6CA 4XTRD 5BW7C 3KLAB 1YYML 1KLGA 4PB9H 1K3ZA 2LAAA 2NR6C 4QRPD 1BX2B 5E5UB 5L8JB 2GK0B 3QQ4B 4PJDA 3UC0H 4MS8C 3T0DA 2GAZA 4JANA 4XP9L 3UPAA 5B39G 4TSCL 2W07A 4JB9L 3GRWA 5B22A 3JV4A 3KVQA 4R90L 1SY6H 4X0KB 5BV7L 4W4OC 3QI9D 4EIZC 2P44B 3FQUB 1MJ8L 1SMOA 4OIIL 1N59A 1S5HA 1JGVL 4MNGE 3VRIB 2E7HA 3RWCB 3UTPE 1WLHA 1NAMH 3K4ZA 1TITA 8FABB 1XMWA 2XKSA 4YHNB 4UOW0 2FO1A 1XF4A 5TE7L 2Q8AH 4TVPL 1VFAA 3FO1B 4UIMA 5DEGA 1OAQH 3BDXA 1TIUA 3BQUB 1YNLL 4UU9A 4KQ3L 4FQJL 5CIPB 4XP4H 5IEHB 1F6AB 1PEWA 3BFOA 4MXVE 3B8SA 1D6VL 3SHSA 3VCLA 3G5YB 4KJPD 3FRUA 1D6VH 4QRSA 4PJ9B 1QBAA 1NJ9B 3FAWA 3KYMA 4KQ3H 5FM5O 4TULH 3UTQB 4ONGL 1HHKB 3MJ9A 2DICA 2MQ0A 5CHNA 4PJFF 4Y19B 3BRFA 1XGPA 5HGGS 1QQDA 3IKCA 2V5SA 2B0SL 4ETQB 3CVHA 5D7IE 2H9GB 4RBPK 4LQ1A 4IRSD 5FDYA 3R06A 4JY4B 5GZOC 1IEBA 2R0KH 3W9DB 1BOGA 3OB0H 4KVNH 1IAIH 1V3JA 1OCWL 1BBDL 3MA7B 3S4SG 1CXLA 2R2EB 3VI4E 2ZPKH 1AGEA 3LAFA 5DD1L 4L3CA 1EO7A 1JGDB 3RX8A 4EBQL 4JR9L 4NN6C 3P4NA 2GIYA 4XP1L 2J1KA 4XNYL 1KPUA 4HFUL 5C0NC 2WIIB 2ICES 3RHWK 1N6QH 5H35B 3NBNA 3VFSA 1FO0B 2VLRB 2GCYB 2MJWA 4M1DL 2AABH 1NUNB 3F7RA 3EJJX 2BOCB 1LNUA 2YSSB 4P2CG 3PG2A 3CU7A 3T2QA 5JQ6L 1YEGH 4U6YB 4Y4HD 4U1LB 1X5ZA 3IDIB 4RISL 1U8OA 1NMCC 3LQAC 3SKUD 2HLFD 2QSCL 5I66B 2ICEA 3DVNA 1OQOA 1YEHL 4CL7A 5J1SC 2EC9T 3FB8B 3QUXA 2LU7A 3MOAH 1MHCA 3LKOA 2JJUA 4DEPC 2YN3A 2ZUUA 4N8VA 1H0DA 1S78C 1K85A 4JZOA 5CP7A 2G60L 1YY9D 3D2UA 4NFDA 3WFCH 2NZ9C 4HUWA 3EOAB 1I1AA 4XHQA 5I1KH 4Z76A 3NIDE 3H7BB 5K9OA 5MI0B 3O6FA 2ZOKA 2IFGA 4KGJA 1S9VB 2UVFA 1VCAA 4ZO9A 3TH3T 4LKCB 4BKLA 5C0CB 4EN3C 3L3HA 2NTSP 3TP4A 1INQA 1KB5L 3P4NB 3X3FL 5BV7H 1BQUA 4XCFH 1RURH 4KJYA 1A5FL 2A74B 1CGUA 5IB5B 4QRRE 1KJ2B 1U8LB 5EOQH 2V7NB 1U95B 3RWHB 2XACC 4C4KO 2YBRA 1V8HA 3WS3A 5FCSH 4PIRF 3SN6N 1T0NB 1VACA 5ILTH 2C1OA 1MVUA 4PRID 3VWJA 1WQVT 2J8OA 2PUQT 3EHBD 3JUZA 3MXWH 4JQVA 4N8CH 4U1IB 3T09A 5HDQL 4DFIA 1BD2B 1Q9OB 1JNHA 1YQ2A 3D85B 5GIRB 1CZ8L 3KR3H 3KYMB 4K9EH 4JO1L 3ET9F 4KUZL 2RBLA 3HMWL 5J13C 2VDKL 1BVLB 2QSCH 2Y6SD 3AROA 4ZG1A 4M7LH 3T0BA 1N7MH 3E1F1 5DD0H 2DQDH 4DKAA 3NMEA 3VFMB 2VSCA 1UYWH 4POUB 3HAEB 1WBYB 4GW5A 1W8NA 5TDPB 3V2AR 5GZND 4DGIH 4K9EC 4NP4H 3VXRD 1XF4B 5GS2H 4DGIL 4LVNB 3MNZB 3CZFA 4XPBL 3WIHL 5D1QD 5C0AD 3HFMH 5ISZA 3SJVA 4LQFL 3GJFH 3MRJB 4NO0A 2LQRA 2VLKB 4LQFH 3MV01 1KSRA 4JHAL 3MLXL 2CJUH 1TVDA 2RFXA 4OD3H 5E8PB 3U9UA 5IB1B 1QLFA 5DZLA 1NLBL 3V6BR 2Q7YA 4NP4L 3UJJH 1UT9A 3LS4H 1WCQA 4WW2C 3VD9A 1OP9A 3KPNA 3HLAB 1XGYL 3ULVD 2F58L 1FL3B 2PYFA 5BV7C 4EDXA 4EI5C 3QQ4A 5HGHA 4ZAKB 1Q9KB 1I3RA 2GY7B 5DD6B 1LEGB 4YHKL 3NPSC 1EO5A 1U92A 1XF5B 3C5ZD 3ZE0F 4XXCA 3HPLB 4XMKH 4CJ1A 3IRZA 1JF1B 4KJQD 5D70H 5I18H 5D1ZA 3V5KA 5I2IB 3IDMB 4NC1C 4HCRA 3F65A 2A73B 1FZKB 1U8HB 1TMCB 5EO9A 3OKMA 3K1DA 2H2SC 3MOBH 1HDMB 3CH1B 4XC1H 4ZTPH 1R24B 3CX5K 3Q3GB 3CVIH 4P9HL 5IVXE 1EAPA 4HWBL 3S3SA 1UZ8B 3PWPA 2VTFA 2V2TB 1MAKA 3QIBB 3JWOH 3RGVC 3UYRL 1FNEB 1IVLA 1HQRA 3P0VL 1KTDA 2EH8H 3O6LH 1VFBB 4LEOA 4HG4K 4KTEH 3KPPB 4GRLA 5KVFL 2Z0BA 5DUBB 2EDLA 4OZIB 3MJ7B 4F15C 5C0BA 4I2XB 2EIEA 4W6XB 2ITDA 4HIJB 4LHUG 5GS1C 5HGAB 2VDPH 5MERA 3SDDA 1R24A 2APBA 32C2A 3FO2B 2VQUA 2F9BT 3BWUC 3HE7A 3P73A 3C6LB 3QI9C 4QRRB 3WFDH 4XPHH 3X3GL 2AQ1A 3I50H 3V6FB 4D9QE 4KK6C 4JM2A 2A6DB 2WBJB 1C7TA 4CAGA 3L5IA 1ZWIA 2BY2A 4LCWD 5HHOE 4OZIA 1L0YA 1IAKB 4JY4A 4Y4KC 2VUOA 4XXDB 1X9QA 4FABL 1S7TB 4HCRH 4IDJH 3VFUA 1A6TA 5ELIA 4KQ4L 3RWFB 1A3LH 3QAZB 1OP3K 2IQAB 3LEYL 1LK2B 1HH6A 1T04A 4HMEA 4NNYA 5FA3B 1FFNB 2YXMA 3D0LA 3FB7A 1QACA 2DQTH 1U3JA 2PO6A 5DHVA 3RU8H 3TT1H 4HGKC 3BH8A 4XBPB 4NQEB 5FHAH 1K2DB 4KVCH 5CZVH 4OQ1A 4YO0B 5C0GB 5CGMA 3VXRE 1DE4A 1QYGL 4G42A 5FDWB 5I1GH 1OW0A 3LIZL 5IB1A 3CH8A 1QYGH 5T1KB 5IJKC 4KKLD 1CFQA 2B0SH 3B9KB 1ZV5A 2IMMA 4DZBB 1A7BA 2LAGB 5DLMH 5TH2A 1WV7T 1ND0B 3KHOA 1GXEA 5EUOA 4KHTL 3WJLA 2WSKA 4HS3A 5IM7B 3QA3B 3LPFA 1S7WB 1ZHKB 1ZANL 5DJXB 4QY8A 1OY3B 1QFUH 4GG6E 4OD2A 4XNXL 3N1PC 4KPHH 2IADA 5D6DC 1VB9A 3MLRH 3M45A 4LAJH 4FXLA 5D1XC 1KIQB 1EJOL 1T5XB 4KK8D 3VXSD 5KSUB 2RQ8A 5ACMA 3S37X 3NACH 3RQ3A 2WBJD 4PRHE 1IKNC 3HNTL 2CPCA 4JFZH 4UV4L 4JVUA 4PRAB 3KPQB 2DL2A 4QOKD 1KPRA 4Y4FC 5DJZB 4WTWA 3Q5YA 4OZFB 2ZUVA 3KPSD 3VGAB 4TTDC 3UJTH 3QEUA 2NCMA 5C6PB 5DK0A 3ZDYE 1AKJA 5DFWH 4XPGH 2UZIL 2ZJSH 4HK3J 4JG1H 3D39B 4L8SC 4RIRB 1V7ML 2BNUB 4OF0A 3I9GL 1Z9SA 4O4YH 3FCTA 4YXKH 4R7NB 1EEQA 4GLRH 4GG6B 1HH9A 4OCRH 2OTUA 1INQB 3E2HB 1CTNA 5GIRA 3ZL4H 4PJFA 1QHPA 2A83A 3WIIL 1O7VA 3D85A 4JQIL 1NPUA 4WY7H 4ZPTB 4Q0XH 3S36X 1MCPH 1J1OH 1F6FB 3RHWF 4ELMF 4OM0H 4JB9H 5ESVA 1MRCH 4QT5B 5F7MC 1A22B 2ITCB 4MXQD 3T3PF 1UACH 2X89A 3VXTB 4LPVA 1XGQB 5HJ3B 2W0LA 3EYQD 5IIEB 3V0VB 2OR9L 1GSMA 1IC5L 2YRZA 3BZEA 4PJIF 5FYJE 2Z8VC 4FFVD 4I3SH 1BFSA 4PJBE 3QUZC 1JHTA 5F21B 5GISH 4U6VL 3ULSB 5F72S 5HYEA 3QRGH 4P4KB 5E2UH 1OTUC 3FO0L 4IOSD 4OIAA 1ZS8B 1I7UA 4U6XA 5FIEA 1OAUH 5FUZL 4JHWL 5JPMB 5DURD 4Q9CA 4FQCL 4AENB 2HH0H 1KYOK 3MRQB 2CGRH 2H2SD 3GUTB 2W9EL 3QDGE 5T3ZL 2R4SH 2HFGH 1HE7A 3EDKA 4IJ3B 4XVJH 3B2VH 2FSEB 4BSVA 3FB8A 5E2JA 1WTGT 3IDXL 2B1HL 4HIHB 5HVHC 5C1MB 4CVZB 2FJFA 5JPNA 1JMZA 1ZOXA 1VGEH 3WS6A 4EXKA 1Z5LA 4U1LA 1AHWB 4JPVH 1KF9B 3BEWB 1BOGB 3RWEA 3O2DA 4DWHA 3V9FA 1ORQB 5I1DB 5ICZA 2JJVA 3PDGA 3WNOA 3X17A 2Z31B 4I3SL 5C2BL 5DRNB 1IAMA 3HZVB 5CINH 5C9JB 3BIKB 2K1MA 2R2BB 1JK8A 3PGFL 3UTQA 4BFIA 3NTCL 2OR8A 4BQ6A 3WFBH 3SCMC 4F7TB 1OM3L 3ZKXC 4EOWH 3GSQB 5GJSH 3IJSB 5AEAA 5SWZD 4PGEA 3FTGB 2IQ9L 4Z7UE 3O2VL 5FUOL 2KZWA 1A5FH 2WV3A 3P9LA 5SWZE 3ARDC 3T0VA 3F5WB 3MGTA 3DRQB 1TQBC 4P9ML 1VFAB 1KELL 3B5TA 2FJHA 5EC1A 5EOCJ 4U1SA 3P30L 5K9JL 1EFQA 2AJ3A 1PQZB 2EYSA 4Q74A 1U8KB 1I3GL 3RJDA 3QZWG 5EU7C 2X05A 3SDCD 1CG9A 3GZKA 3REWA 5J13B 2A38A 2M26A 2IH1B 4YZFE 4GAYB 3DIFA 2FECL 4I48A 4WO4A 3EO0B 4Z7QE 4PJXA 5IVZA 4NCC1 5DMYA 1SYSB 3JV4B 1MJ8H 5L8KB 4CU6A 4KJWC 2BVQB 3CK0H 3UTSA 1X4YA 5FV2A 4UTAH 3QHZL 3EJZC 1BOYA 3WKNA 2E7LA 5J6HB 3QG7L 2X7LB 3QA3A 2W65A 4YDVB 1UKQA 4BSWA 1UWEL 4HLJA 2B20A 2EZ0D 1AC0A 5E00A 1LO3L 3SBWC 3VI4F 3VXPB 2EDQA 4DZBA 3T4YB 4M1DH 4HKJA 4QRUB 5E6IB 1IQDA 4RFNC 3ARDA 1SYSA 2Y06L 1X44A 1M1SA 1UH3A 4UI2A 3EO0A 4TRPH 2WM0A 3KNBB 4PRNA 4Z7WB 3LS5H 2A9MH 4HT1H 4XNZC 3FB7B 4YFLF 5DD1H 2AV7A 1AD9B 1SVZA 4OLWH 3EZJB 5JLZB 3WCYA 3PV7A 3NIGE 3BZ4A 1LD9B 3MBEC 3OV6A 4G9FE 2B1AL 3KYAA 2VO5A 1NGPL 5HPOA 4ODUA 1QPPA 3NTCH 5JZ7C 35C8L 1ZHLB 3BPOB 1BIIB 2R23A 4ELME 1IT9L 1RZKC 4FZ8H 3FTGA 3IB4A 3V52L 4Y1AD 1RU9L 3SQBA 4RGNC 1WCBA 4MD5A 5IB3B 4FG6C 4I0PC 2D0GA 2JE8A 4Q9QH 3ZYOA 1S9WA 3KPSB 1A4JB 3O0RH 3ZDYF 5DJCB 3QUMB 3HB3D 4PBXA 1P6AB 1MHHA 1AR2A 2DYPA 3LD8C 4PGJA 1YYLL 4OUUA 1XGTA 3H3BC 3ZHKA 3BIKA 1RAMA 3PWUA 4GOSA 2Z93A 4KMLB 5B38B 5DR5H 3NCBB 4I77H 2YPVL 5IQ9A 4OTXH 3KPPA 5HDLA 4RRPG 1UWEH 1RZJH 4LRNL 2Y36H 4OJFH 3VXSE 4TVPH 3BIBX 2NZ9D 4F80A 4OF3A 1UZ8A 1HKFA 4XWGL 1R5VB 5EU7E 5DYOA 5E8DL 4QRPA 5K59E 1DTUA 3BP7A 3Q3GA 2WMPA 4NZUL 4QOKA 1NBVH 4L4TA 1HKLL 1HDMA 2D4DA 1PFCA 3HG1A 4X6EA 5DT1H 3E6FB 1MY7A 4X4ME 5DD3L 3IF1A 1BJ1J 2DQGH 4E5XB 1J87A 4KC3B 2A77L 5F3HA 1BECA 1YMMA 2NTFB 2FGZA 2I27N 3IDNB 3WNKA 2Z4QB 1FE8L 4XAWH 1DQML 4X5WA 1J7VR 1GGBH 3VWKB 3UTSD 1L7IH 2HVKB 5C0DB 1Q9KA 4W4OA 4PY8J 3WD5L 1EZVX 4RFEA 3RRQA 1A8JH 1JRHL 4MB3A 4M6OH 5EFIA 3G04B 1TLKA 3RBSA 3CFEA 4KH2A 4IMLA 4CN6A 3TESA 5E6ZA 1RZIB 3AXLB 5F6HJ 5BMFH 3RIFK 3GK8L 3C60D 4XXCC 3H6JA 4GKNA 2F74B 2FWOB 2IBBA 4I3RH 3NCYS 4YX2L 1IAII 3K7UA 2P24B 2XWBB 1FFPB 4L8SA 4QT5A 4LP5A 4RGND 3UJJL 1NCCH 3MV8E 5AUMB 5EA0H 1SEQH 4PJ7B 4ALAL 1N64L 3F7VA 3LQMA 4ZPTA 3QO1A 4LLYB 1A2YB 3L9RB 3I3EA 5FO9B 3S8WA 1AP2A 4NZUH 1HIMH 3HAEA 3H9HB 4POZD 2VDNH 4FQHA 1KBGH 2FLBT 2W60A 5EUKA 2X1OA 1MFEL 4CW1A 1TZHA 4HV8A 3O6KH 5L88L 2R0LL 3O4LD 1QSED 4J3XA 3MUHL 4ZFGL 3VXNA 4JREB 1PX3A 3MA9L 3OR7A 2OJEB 1FRGL 5DJDA 4H5SB 1BQLL 3EFDL 3H2WA 3KJ6H 1RULH 4LVNC 1CICD 4OGYH 5DHYA 5IBUG 1H5BB 2AERT 5L6YH 3LKSB 5D7JC 2YEZA 2GUOB 3QFDB 3CIQA 4A2MA 2H26A 1K3IA 5FOBA 4LOUD 4UDUA 1PSKL 2DMKA 4G6AD 4LHQB 5AG9A 2AKRA 3BKJH 5IT2H 3WNMA 5HYJD 1E4WL 3QFJD 5CBEA 2YPLB 3GIVA 1CFTB 1OW0C 1DFBL 3BIAX 4MLSA 4J23A 1M05B 4F57H 4R97C 1LO2L 3D3VA 5DC0A 4WHTB 4XVSL 1W0WB 2HAZA 3HNSH 3ULVE 2PO6D 3BHBA 4HIXL 4LARH 5C8JB 2UWEF 1QA9A 1AXTH 2OJZH 1NCDL 5TH2B 3DNKA 1J0ZA 4XX1E 2NY6C 1F2QA 5JOFA 1AE6L 3ZLQC 2NTFA 3L95B 2VLKD 4IBLT 3BP6A 1QUNA 3PABB 2EE2A 1FZJB 1RQ5A 1ZLWH 1J0JA 4HKXB 4UBDC 1BF8A 3V4UL 5BOPA 4I18C 1P4LA 1AI1H 3RWIB 4GBXB 1WIOA 4RFEB 3GFUA 1GZPB 4XB7A 3BAEL 3HI5L 5GGQH 1JIBA 2G60H 2ZUSA 3RWFA 3FKUS 3TN0A 1N5YL 4KJPC 1X5YA 3MRKB 2JK5A 1S7TA 3BMWA 3VFUB 1V05A 1J1PH 1UG9A 1G9NH 1MF2H 3QWOB 4P2QD 1CXFA 1ONQB 1IRAY 3B9KC 3MJ8B 1IGJA 5FO8A 4NN5C 1IAOA 2WIIA 4H0GA 1D5BA 3RDTB 5HGBA 2BY3A 5ID0B 3INUH 2IJ0C 4M6NL 2GHWB 5EPMA 5J1TC 5KZCB 5SX5K 4OCSL 4ZO8A 1A9EA 4R90H 3ARPA 4DN4L 5SV4A 4U1MA 3BP7B 4H8WH 4O5LL 1TTGA 4ODSL 1MFDH 1NCNA 1LO2H 1ONQA 5DRWA 2VXVH 1BREA 1RUAL 5DMIH 3KPLB 1IM3A 2YXFA 4LSDA 1T1ZA 3DO7B 4LCYA 4X6DB 3ZDZF 4U0QB 4DOHB 3QFJB 2AS5M 1NDMB 4YZFF 3VFWA 1MCNA 1R3KB 3BP5B 2IWGA 7CGTA 3NN8A 1JI1A 1IGIL 4OZHB 1EFXB 4JY5L 5BRZD 3W39B 2NYYC 3EOYG 1DDHB 5HY9B 1OP5H 1DP0A 2BDNL 1FZOB 3DOSA 3DYMA 3CCHB 4PJAA 1FGNH 1LP9A 1CGVA 1DLHB 4DUVA 5I8CA 2PR4L 3H9SD 4K2UL 3I6LD 2AP2A 3S36L 1TCRA 1WBXA 3CGTA 4YHYB 4PRPE 2AW2A 4WWID 4I13B 5SX5H 3R8QA 1ZT4A 2YR3A 3HS0B 4UIKH 4WIQA 15C8H 2X70A 3O45A 4OFIA 3VA6A 1QSZA 1VFOA 3FT4B 4PV8A 4YHNA 1QNZH 1UWXH 1WFNA 4FRWA 3GBNL 1B0RB 4GQ9L 3FQNA 4NBZB 3ARGC 1IARB 4NZJA 15C8L 4ORGA 5E9DE 1AGCA 4HG4J 3FL7A 5KOVC 5CGYC 1YUHB 3C09B 1CLZH 3UDWC 5TQ0L 4YJZL 2R29L 4PRHB 4D9LH 3BXNA 3IXAA 2R4SL 3DGCR 5FGCE 5EORL 3QXDB 1AFVH 1XF3A 4H8WL 1IQDB 4M5YL 3SDCA 2NY2B 3I02B 5I9QC 1P53A 1T7WA 2G75A 5DS8B 3IDJA 2GJZA 2I60H 4YPGA 3DWTA 3REWB 3KYKH 1YY8B 4CDHA 1KULA 2W65B 4ZFFB 3MCLL 5F7KC 1MUJA 2NY0D 5FYKU 1NGQL 3ARED 1QLEL 3CMOL 3GSXA 4HUUB 1AQDB 4FQLL 3CFDA 3FHAA 2AGJL 4XRCB 3FRPA 5ANMB 3VWJC 1M7IA 2LU3A 1H3VA 4HAGA 3V6ZA 2CDFB 1BFTA 4Z5RB 3TO4B 3THML 4GKZB 4LCCB 5GZNC 4XNQA 3RUGE 2HKFL 4HZAA 3SY0A 3LKNB 5KSVB 5L9DL 5C0BD 3KPOA 3CSYA 3PQYA 1OAYH 2R2HA 4G80B 3PGDA 1EBAA 3KWWB 1D5IH 4NHCL 3KHQA 1RUMH 4O2FB 5F89A 4M6NH 4WFHD 4ZD3H 1KEML 1D5MA 4H1LH 4TNVK 4RGOL 5K33A 2V9QA 3W11C 1MWAB 5DF0A 5IVNA 1JRHH 2CMRL 5J1AB 2D7OA 3I6LE 5HHXH 3H9SE 5HHOA 1ORQA 3F5WA 3MGTB 1KEMH 3IDGA 4GS7C 4YQXH 1C12A 4HS6B 2HT2C 3QUYB 3MV9A 1DUZA 3HI6L 4QF1B 3SKMB 3U4EA 3VXQA 3BKML 3AXLA 1WAAE 5C70A 3BKMH 4JPKH 1KJ3H 1D3CA 4J3VA 3QPQC 1KG0B 1TQBB 5C09A 2XTJE 4OUOA 1XGRA 4PJ7E 4WVRA 4O58H 3TV3H 4RZCA 4LLMA 3SO3C 4BKLB 2X4RA 4P4KC 4GQ9H 3ZHLA 3MFFA 4K8RH 2RCSL 2R1WA 4PRDB 5CJQH 4YGVB 2IQ9H 4XWGH 4IIQA 1DANU 3V5HA 3VD7A 3VMPA 4HF5L 5DC4B 4X5WB 2QQQA 3H7LA 4RAHA 5FO7A 1TJHL 4FP8L 4E0RA 4WUUE 1KNOB 1AH1A 4JPIA 3W2DH 3ESVF 3KXFB 4OFKA 1H0DB 5EZLB 4DGVL 1BEYL 2HKFH 3S36H 3QUZA 5KAQG 4I0KA 5DA0B 4N1HB 5F71A 4C56A 2ORBH 4JFOB 2HMIC 2VR9A 1INEL 2J2ZA 1TETH 2FATL 2XG5A 3VFPA 5FO7B 3VFGL 4M93B 3MRQA 1T21A 1TQCC 5HDOA 4QLRA 2GKIA 5E7FA 4FZ8L 3V52H 2VL5B 1FAKT 3MROB 4M48H 3DV6A 2QHRL 3SKOA 1RZ8B 5DJ6A 4OZGA 3ECBB 3B43A 4X99A 3DRTA 4X8JA 4CU7A 4WHTA 4OUUB 3QWRD 5F89B 1OWRM 2DYPB 1MELA 5FGSA 1ZT1A 3ARUA 5C09B 4NYLA 5FV1L 5HHNA 1JN6B 1JHTB 1LQSR 5JORA 4YX2H 5JDSA 4ODBD 1CLYH 1T5WA 4QHNB 3RL2B 3HC4H 3MRLA 3NCEB 3S5LG 5DMKB 1Q9WB 3CJJA 4H88L 2BSRB 1U8IA 1GZQA 3RI5F 5HI5C 1WT5C 1WFUA 1DVFB 3LKSA 1MAMH 2UVEA 3S97C 3QEUB 2P8PB 3TT3L 5JOPD 1AD0B 3WEXA 3KPSE 1MQKH 4FMKA 4NNPL 1IJ9A 5KVDH 3SGKC 3BW9A 1ZTXH 5DQ9A 2A83B 3TBSA 5AWNH 1NCCL 5FYLH 3FB6B 4LSPL 1T7VA 3C2AL 1FE8H 1FVDB 4ELMB 1TZHB 4KTDL 4JRYD 1BD2D 2XPGA 5I74C 1NCAL 4ZDHA 2QQKL 5D7IB 4YQXL 3D39A 1S9XA 2BCKB 3OAYK 2H32B 4JM4L 4GH7B 1V5JA 1HKLH 3O6LL 3STLB 2X89D 3DI2B 1NBYA 2ATKA 5EZOL 4YR6B 4XCCH 5C0JA 2GFBB 3G6AB 1DBKL 5A3IC 3GSVA 4LF3A 4TQEL 4ZTOH 2MKLC 1WITA 3MLYL 3SE9L 2WBKA 1G7HA 4Q9RH 4KKNA 2VLLA 3PGFH 3QEHB 3OB0K 1PY9A 3DETD 3UZVB 5FF6B 5LGJB 1CICB 3MRHB 2NXZC 3BJLA 5HVHB 4XP6H 1I1CA 5DK3A 1DQTA 2GJ6B 3PDOA 2HLAB 2Z8RA 4JZNA 2X1WL 5LWYL 1NANH 5BQ7B 2C1PA 4DAGH 2OZ4H 1VADA 2NXYB 3LSOA 4RDQF 1MF2L 1IL1A 1ZLSL 5HHQA 3MRGA 1R3KA 1SEBA 1OAZL 5F9JB 3WJJC 4MWFA 3L6FA 4X7SH 5C0CE 3QFJA 3S35L 1SBSL 2Y07L 4H8WC 2YKLH 3QEQA 1OARH 3U7YL 4NCC2 1UH2A 5TE4L 5FYLL 1X4XA 4ZPVA 5AWNL 4P2QE 4MXQC 5F1OB 4UV7L 4O2EB 4JM2B 4PLKC 4N90E 4PJBB 4JRXE 4F15B 2CRZA 1DLHA 3NFSL 4TSBH 1K2DA 4R26L 2JELH 4C57C 1F4AA 3BKJL 5H94B 4BFIB 2BNQD 3CXHK 4KDTC 4NRYA 1G7IB 2FIRT 4PJ9C 5C0BB 1ACZA 4F8QA 4Y1AA 1G7LA 4XP5L 5I0DA 5EBLA 2EXWC 3VFWB 1OSZB 4MQTB 4PBWD 1A47A 3TWCL 2VXSH 4Z7UB 2EDKA 3UTTE 4X6DA 3BN3B 4Z7UA 5DK2B 1FDLL 3QUKA 1VFMA 4R7DA 2UYLA 4OAWA 3RWEB 2APFA 5LAXA 2NLJB 4HHAB 1AHWA 2A6DA 1NC2A 1VHPA 2YD3A 1MCOH 3C8DA 4I3RL 4UDTB 1LEKB 3N1FC 3S98A 4WJ5A 4HIHA 5FK9A 2QADC 1H15A 2RR3A 2HJKA 4GXVH 3O2WL 2OZ4L 1PSKH 2HVJA 1AGBA 5D1QA 5HGAA 4TUJA 2P7TB 3PGCA 3ZKMD 2IPKA 3GUTA 1BIIA 2R23B 4O02L 4WO4D 1KCVH 3FT2A 3OKEA 3WSQL 4JDTL 3GI8H 1NC4D 5LBSH 4MAYA 5KVGH 4RGNE 4ZUWA 4ORZC 4V1DB 4GAGL 2JLLA 4M1GL 1UACL 1H8SA 4TPRL 4ZFZB 3WHXA 4WNQB 3WIHA 1IL1B 1ZS8A 3OZ9H 3PQYD 5JW4N 3IJYA 4GRWB 5GSVA 1DQLL 5JNYA 1VKXA 1IC1A 1NGZA 4QCIA 1UADC 3IRPX 1F4YH 3WIIH 5EDXA 3CDGA 1J8HD 1U8PA 2AJXL 5IWLC 4DGYH 5F1KC 1CVRA 1XCQB 2HT2D 3NFPB 1EHLL 4OLUH 1M6OA 5DHVH 5E8EB 3QUXC 2VDRL 3MR9B 5B3JE 4IOFC 4PP1D 5EG6C 1AIFA 3D0VB 3P40A 1CDYA 2VLJE 1X6NA 1O7SA 3BHBB 2EXYD 4U05A 2ED9A 4LRNH 5HGHB 4MNQA 2UZIH 2ZJSL 5FKAB 4FHBD 5BS0D 5C0JB 5CCKL 5GZOD 3GB7A 1RUPL 5CBAB 3JV6B 3GGWB 2FGWL 1DEEB 4P9MH 5KJRL 4FQQB 3MC0A 1WTLA 1JJUA 2BVQA 4R7NA 3FCTB 4B7IA 1UB5B 3TJEH 2OMNA 2DRUA 3BEVB 4HAFA 1OGAD 5D2LF 4ZD3L 3OGCB 3T1WA 1L4IA 3RP1A 4LRIC 4NO2A 2OX5A 1U6AH 3CVHL 1DQQB 1U42A 3NA4A 1A2YA 2WUBL 1G0DA 3SJVB 5ISZB 1AFVL 3MCKA 5L7XL 3QXWA 1AD0A 4KKBC 2NXZD 4XNXH 2EIBA 4K55A 5HYSA 5FHAL 2DWEB 2W38A 2I9TB 4JPWH 3LRSA 3V4VL 3RTQB 5FM5M 4LLUB 2NX5B 2F53D 5DVKA 1A1OB 2WQ8A 3RGVD 3VFGH 1GHFH 3VI3E 2DKMA 1E28B 1ODAA 5DJYB 3C6SB 5CZKA 4OD2B 1S5IL 3KYOB 1DEEA 3BD3A 3V4PL 1A64A 1PAMA 2VC2H 3DMMD 4R97B 3OKKB 1S7VB 2A1WL 1A14L 3N9GL 1M71B 2NW2A 2LE9A 4LCIL 5FYKL 5DVLA 1JCKA 1YC8A 4QRRD 3DV6B 2R29H 1CK0L 4FZEL 4Y5VB 2VDQH 3FQRA 1ND0A 1GGYA 4PRBA 4PJ7F 4Q2ZA 1A6ZB 5I30L 2FBJH 3LN9A 5HVFB 4BZ1H 4HCRL 4IDJL 5CKGA 1KGCD 3FO0H 4HJ0D 4JHBA 2DJSA 4MJIE 1YNLH 4ONHA 5IMOA 5M94B 3QDJA 4J3WA 1E27A 3U7WL 3L3OB 2QQNH 1YECH 2IC2A 1JYVA 4AMKL 1QOKA 1RZJC 2X1XR 1PDKA 1JPGB 5EZLA 3MRBB 3AB0B 3P3YA 5MEQA 1ZT7A 3ES6A 4JDZA 1FNGA 3OXSA 1G6RA 3E6HA 2MWCA 1A7NL 4WFEE 4AG4L 5CUSL 4WHDA 3MGOA 4LPYA 4PGDB 4ZAKC 3G6DH 4AZ8A 2VXTL 2G9HA 2O5YL 2Z93B 3VFSB 5H35A 5I8EB 3QUYD 2J8HA 2R69H 3OWEA 4M6ML 4JQIH 4M1CD 4F7CA 1XGRB 2YPLE 3QUMA 3E6FA 5CLTA 3IU4L 1NBZA 4ZAKD 5EN2A 3ZKND 3R1GH 5EH1A 2EDWA 5IMKB 1WGOA 1G7JA 4MJ6B 3IJHB 3MRRB 4X7FC 3ULUD 2FR4B 1C5DB 2BOBA 2VZUA 1SY6A 1T03H 3EDEA 2E9IA 5JMOC 4Z0XA 3FN0H 2JF1A 3JWOC 3U7WH 1QQDB 5E1HB 4URTB 3PWPB 1P1ZB 5L0QC 4H0HB 5ITFB 2QKIB 2G5BB 3O2VH 4O2FA 4WU5A 5EU4A 1HHHB 1KTLA 3DVGB 4ZMAT 1MCHA 4X4XA 3FOLB 1FG2B 4K7PY 3QNZB 3VXRA 4OKDA 2VERN 3WFBL 4WTXA 3QDGD 2BNUA 3ZO0A 1F6AA 1QFHA 4LLVA 4GKZA 3EKCA 5MENB 4L5FL 2IGFL 1FAIL 3HN3A 1NCWL 1MSPA 3ARWA 5DEFB 1JV5A 3IVKB 5CGYD 5JXEA 2D7NA 1DN2A 3FO1A 3WL9A 4MJID 4LSRH 4DVBA 2VAAA 3HMXL 1GHFL 3CSPA 4XNYH 1KELH 1QD0A 3SDDC 3SKJH 1I3RB 4AIXA 1CN4A 3QDHA 4FTVE 5CHNB 5SWQB 2VXQH 4J3TA 1YY8A 3MRIA 3M1BA 5EO1B 3D18B 2R4RL 4RA3A 4F33A 1UM6L 4R96B 2NY6B 4U1JB 4HBCL 5HGDA 4DZ8A 2YK1L 1N5AB 1Q94B 4LSRL 3HLAA 1MFCH 3GSWA 2WK2A 3KPRE 4S1QH 4DQOH 3SDXE 2NY1B 2IGFH 3HR5A 2GSGA 2ZWLT 3O3EB 3DHMA 2X4QA 5HPMA 3L5XH 3SE4A 1UWGH 2OR9H 3FMGL 3NZHL 4J6RH 4K3DL 3VA2C 3UBXB 3UPCA 1B0RA 1I9RL 4ZOCA 1S7WA 2ESVA 2O61A 3H8NA 3HRZA 2ESVB 3V0AC 3MV7E 1EUTA 3OXRA 3WUWA 4DFHA 3LZFL 4PGCB 5EOQL 3NH7L 3OKNA 2XY2A 5CD3B 4E41B 3CFIC 3JVGA 3KG5A 3VXMB 3ULUF 1IEAB 2CK2A 3QRGL 1E6JH 1LVEA 3VXUD 2JJSA 5D7IA 4MQ7A 3O3EA 4MAYD 3TZVA 1JL8A 3BPOC 1DBBH 1QSFE 5ILTL 2HJLA 5EU6E 2DDQL 2EE3A 1Q1JL 2H8PA 4X7DC 4XBPA 1Q1JH 2JCCE 3G9AB 2DDQH 3Q6GH 2DTMH 1OAXH 4JJ5B 2BMKB 1AO7E 3FOLA 5DDHB 1DSFL 5A2JH 1N5AA 1EEYA 1CDGA 5ITFA 4X5XA 1EGJH 3MRIB 3QUXD 2AEPH 2QLVB 5IK3A 1BIHA 3HZVA 5ALCH 1DVFA 2ADIB 3QULB 2BOBB 4P57B 3BSZL 2VLKE 3JWNC 4WRLA 4G8FA 3MRRA 2VLME 5DRWB 1L9MA 3STZB 5DTFA 4K3DH 1LDPH 3EUUA 2NY5L 3QUML 3TA3B 1YN6A 5KVEL 3CX2A 2DQUL 1U8LA 1ZTXL 2XWTA 3O6FD 5HYFA 1FG2A 2ZKHL 5HHNB 5BS0E 1Y6NR 4ZOAA 1P5VA 3W9EA 4Z7VE 3MV9D 3T08A 1QFWL 3O3BB 3U83A 1NL0H 5C92A 3RY4A 4LVEA 1RZ8A 2BNQB 3TCLB 5F7HA 2A6IB 4PGDA 3A6CH 4WDIB 4MCZA 2VWEC 3FQTA 4PRPA 4LHJB 5KSBB 1SYVB 4LLQA 1DBJH 2EC9U 3I6KA 4PRHD 4R4BA 1NCDH 3HE6C 4GXUN 4Z7WE 4N8VB 5L2JB 2C3WA 2ZG3A 2GSIA 2VDOL 3CDYA 1T20B 2CO7B 2NY4B 4F7CB 3NA9L 2DJUA 3IDMA 3ARFA 4YK4B 3L95A 4HXAH 2W0PA 5HJ3A 3P0YL 2QEJA 5T33H 4FMFA 2F53A 3MLTB 3ZDXE 2FATH 3U7AA 1EAJA 1MCDA 3C6LD 4PJ9D 2VXQL 4B5EA 5GS0H 1HHGB 4EN3B 5JPMA 5IOPA 3V0WL 2BVOA 2YUWA 3P0YH 5I16B 3WIHH 1TTUA 1S7UA 1G6RB 5F7LB 3NZHH 3VMOA 1WUNT 4YGAB 4NKDA 3OKKA 3D3VB 4XC3H 1OGAE 4GRWH 4UQ2A 3DURB 3UTTD 2XKUA 5FFLA 3VU2A 5GGTL 3BN9C 4GMTL 2ARJB 3KYNA 2NR6D 4I4WB 4ZTOL 5AD0A 4TQEH 4XI5D 3U9UB 3G6JB 4PJCE 3OSKA 3WLWD 4EN3D 5ADPH 2Q76B 4NDMA 2VXUH 1VPOL 4K3HA 4JKWA 1AHWC 5CJOL 1X5GA 1CZ8H 1WK0A 4FQIH 4UAOB 1EX0A 4HUMB 4XP6L 5I73C 5C0IB 3VE0B 4FABH 2IAMB 2VMFA 2BVEA 3V7AE 5I8OL 1EJ6A 2J8UA 5IMLB 3P4MB 2YD7A 2AJVH 3MZGB 4JFDA 3UO1L 2OS7A 4NC0B 3MBEA 2DM3A 1NGPH 3WFDL 4HBQA 3LHPL 2NW3A 2BSTB 4PFEA 1Y18A 3MOBL 1YDPB 1QKZL 1Z9MA 2FX7H 2IADB 2AXJA 1MNUH 4KQ4H 5D1ZD 4ZOEA 5CEZH 4G6JH 3WUWB 5B38G 4LDEB 3P0VH 1A6WL 1BFOB 1Q0XL 4N90D 3L7FB 4G3YL