1PKTA

Structure of the pi3k sh3 domain and analysis of the sh3 family
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
b'EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the PI3K SH3 domain and analysis of the SH3 family.
pubmed doi rcsb
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
source organism Homo sapiens
molecule tags Phosphotransferase
total genus 11
structure length 76
sequence length 76
ec nomenclature ec 2.7.1.137: Phosphatidylinositol 3-kinase.
pdb deposition date 1994-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pktA00
2EPDA 1ZX6A 1M3AA 2E5KA 2DVJA 2MOXA 2DRMA 2KXDA 1NEGA 1J3TA 4HVUA 1JO8A 2LJ3A 1W70A 2RQWA 2FO0A 1PWTA 1ZUYA 3I5RA 5GJWB 1G2BA 3M0RA 2YUQA 1PKTA 3VS7A 2JMAA 1SHGA 2AK5A 4J9IA 2I0NA 4QT7A 2DRKA 5I22A 4JZ3A 4AFZC 3NGPA 1AOJA 1NM7A 2KT1A 4RTVA 2DBMA 1NYGA 1JU5C 1WX6A 1MV0B 2PNIA 2DE0X 2KBTA 4K11A 2KRMA 2X3XD 2YUNA 2LNHB 4ORZA 3EHQA 4LUEA 2ENMA 1UDLA 1BB9A 4CC3A 2CDTA 2V1RA 1UG1A 2YUOA 2RQUA 5L23A 2LQNA 1M27C 2DA9A 2MIOA 1RLPC 4F17A 2LX7A 1HD3A 2FG0A 2C0TA 2JTEA 4Z89A 2FEIA 3VS4A 4OMPA 1SRMA 2BZYA 2DYBA 4HVWA 1ZLMA 2J7IA 3VS5A 5IHNA 2YSQA 3IQLA 1X27A 2D1XA 2K6DA 4LNPA 2W0ZA 2RQRA 1B07A 1Y57A 1HSQA 3TVTA 1TUDA 2YT6A 1X2QA 2HBWA 1GCQC 1Y0MA 4RTZA 1QKWA 2HEQA 1W6XA 1QLYA 3EG3A 3UA7A 2KGTA 3VRYA 2F2XA 4AG2C 2VVKA 2HDAA 2DILA 1CKBA 2RMOA 1I1JA 2RQTA 2CH4A 4LN2A 2ED0A 1IO6A 2KE9A 3NHNA 1OPKA 1K4US 3JV3A 2EGAA 1KSWA 1WXTA 1FYNA 2FPFA 4IIMA 2K2MA 3SEMA 2ROLA 2LZ6B 2A37A 3LH5A 2EW3A 3VS0A 1GRIA 1NYFA 1Z9QA 1N5ZA 2HCKA 4D8DA 2P4RA 1A0NB 1E6GA 3M0UA 3SHWA 1WA7A 4Z88A 2JS2A 3U23A 2FPEA 1S1NA 3THKA 3M0PA 2DF6A 2EGEA 5IXBA 3QWYA 1SSHA 1TUCA 2CSQA 1GFDA 4OMMA 2B86A 2CT3A 2BTTA 2KNBB 3H0HA 1ABQA 1H3HA 3R6NA 1CKAA 2KRNA 2PTKA 4GLMA 1TG0A 1T0JA 2XMFA 3CQTA 2J6KA 1WXUA 1UTIA 2EGCA 4OMQA 2M51A 1OPLA 2CREA 1M8MA 1T3SA 1LCKA 4J9BA 4M4ZA 1H92A 1GBQA 5IH2A 1I0CA 4RUGA 2JS0A 2KR3A 1OOTA 1GCPA 4OMLA 1G83A 1ARKA 2D8JA 4Y92A 2O2OA 1BK2A 2L3SA 1BU1A 1UECA 1PHTA 1ZSGA 2VWFA 2L3PA 4AFSC 1JQQA 1WYXA 2J6FA 3EG0A 1B3QA 1E6HA 2KYMA 2ESWA 2LP5A 2LCSA 4RTUA 1JEGA 1K0SA 1UHFA 1KIKA 5EC7A 3VS6A 5IHKA 1T3LA 1SHFA 1VA7A 4RTYA 1BBZA 2GTJA 2W10A 1QWEA 5ECAA 2DL4A 2DM1A 1AZGB 1YWPA 1PNJA 4J9EA 2OAWA 2AZVA 2O31A 4OMNA 2F2WA 1KFZA 2DJQA 1YN8A 3VS1A 4RTTA 2EYWA 4JJCA 3TSWA 1ZBJA 2RPNA 1HJDA 2GTOA 1W1FA 2LQWA 1AWWA 3NMZC 4AFQC 1PKSA 1WDXA 5FWCA 2GNCA 1MUZA 4F16A 2DX1A 1JXOA 2FPDA 1VYUA 1T0HA 5HCKA 1EFNA 3VS2A 2LJ0A 2YDLA 1WXBA 2IIMA 2A36A 3ZL7C 1UHCA 4D8KA 2JW4A 1ABOA 3VRZA 1YNZA 1NEBA 4OMOA 1AWJA 2DLPA 1E7OA 4AG1C 2J06A 1WIEA 3PVLA 4JZ4A 1MV3A 1AVZC 2RN8A 3RNJA 1GCQA 1UE9A 2O9VA 1X43A 1VYVA 3M0SA 3PE0A 1OV3A 2V1QA 1WI7A 1H8KA 3REBB 2SEMA 2GBQA 1M3BA 4JJBA 1XOVA 2K9GA 5IHIA 1YCSB 2J6OA 3NPFA 3M0TA 2D0NA 1UJYA 2KRSA 1SEMA 2EYYA 4ZNXA 1UUEA 2L0AA 2JM8A 1RUWA 2CT4A 4RTXA 4FSSA 2L3QA 1I07A 2DL8A 2GGRA 4R0KA 4EIKA 2EKHA 1KJWA 2VKNA 4J9CA 2JT4A 4JJDA 2QDLA 2EVRA 1GL5A 2JMCA 1NLPC 4CC7A 3EGUA 2GQIA 3KFVA 2C0IA 1ZUUA 3TSZA 3QWXX 2ED1A 2ROTA 1WFWA 4IIOA 1NG2A 5GJVB 5FWBA 2CUBA 1AD5A 1FMKA 2O9SA 3I35A 2BZ8A 2SRCA 2HSPA 3M0QA 3UF4A 3H0FA 1X69A 2EBPA 1QKXA 1QWFA 3RBBB 3C0CA 2AKKA 4X1VA 4ESRA 2DL3A 3A98A 1UFFA 1AEYA 1SRLA 1V1CA 4JPBW 3I5SA 2K3BA 1U3OA 2YUPA 1UGVA 2LJ1A 3GBQA 1NLOC 1WLPB 2OJ2A 3EHRA 3O5ZA 2MCNA 4DEYA 2K7AA 1AWXA 2C0OA 2DL5A 3UATA 2KEAA 4Z8AA 2KROA 2OI3A 2ECZA 3EG2A 2AKLA 2RQVA 4J9FA 4LUDA 2J05A 1QCFA 1SPKA 3UA6A 1CSKA 1ZUKA 5FW9A 4CC2A 2BZXA 4E6RA 4F14A 1K0XA 2DL7A 2EYZA 2FRYA 4AFUC 1PRLC 3H0IA 1PRMC 2L2PA 2RNAA 4HVVA 3FJ5A 1RI9A 2CUDA 1M30A 4J9HA 4RTWA 2H8HA 2K79A 1AWOA 1K76A 2NUZA 5IXFA 2NWMA 2D8HA 4DEXA 2DBKA 1OEBA 1GFCA 4A63B 4HCKA 2DNUA 3ULRB 1K9AA 3H41A 2AZSA 2A08A 4KRTA 2EYXA 2FRWA 2LMJA 4WCIA 1X6BA 2CSIA 2G6FX 3EG1A 2O88A 2RF0A 4HXJA 2DMOA 5I11A 1U5SA 1YP5A 2EQIA 2F2VA 1YWOA 2JM9A 4J9GA 2KXCA 4GBQA 2M0YA 1U06A 2PZ1A 1RLQC 3REAB 1K1ZA 1JXMA 4CC4B 2X3WD 3PVQA 1X6GA 2A28A 2KYBA 1VYTA 2ABLA 2JXBA 4J9DA 3VS3A 1UJ0A 2KT8A 1GBRA 1M3CA 1Z9ZA 3I9QA 1AZEA 4LE9A 1X2KA 2CH4W
chains in the Genus database with same CATH superfamily
2HD0A 2E70A 2GCXA 4O5VA 5FU6B 3VJPA 1N8RU 2E5KA 1VQ8A 3BE3A 1NPPA 2EJGA 3JB9H 3JCMf 4HVUA 4C92A 1W70A 1KHCA 2FO0A 1PWTA 5GJWB 4HCZA 1TH7A 1VQLQ 2YUQA 1PD1A 1VQ9A 2YRVA 1MGQA 4PFOA 4M77B 1I81A 2CKKA 2RD1A 1AOJA 1NM7A 4RTVA 1KQSS 2DBMA 2YWWA 3MKDA 4BDYA 3MP1A 3QZ9B 2DE0X 1VQMQ 1S72A 2YUNA 2XI9A 3RERA 3CC4Q 3QJYA 3JAME 1BI2A 1BB9A 2CP0A 2V1RA 2K57A 4QQDA 3CCSQ 1UG1A 1VQKA 2DA9A 4F17A 2WSEE 2FG0A 2C0TA 2QEXT 4PJOB 3VU3C 2FEIA 5KYUB 1SRMA 2BZYA 2LCLA 4PJLA 5GAN8 3M4YA 4F7UA 2YRDA 4M75F 3MHXA 3VS5A 3A5ZB 2RJEA 3CMAA 2NUTB 3EH1A 1EZZB 1U1SA 2HQHA 2RQRA 1B07A 1Y57A 3EFOB 1OX8A 3TVTA 2RI5A 3JB9J 2HSEB 2HBWA 1NJIR 2A3LA 3QG1A 3KUFA 3OW2P 1QKWA 4M7DE 3M54A 3HRTA 3EG3A 4B9WA 2HL3A 2DXBA 1VUBA 2KGTA 3CC7T 4C0ZA 2VVKA 3MJXA 2JTMA 2DILA 2G3RA 4OF1A 2CH4A 1OZ2A 3DLMA 1H3ZA 1IO6A 3RMQA 3NHNA 2QGGA 2QA4A 2P0QA 2EGAA 1VQNT 1RL2A 2ZPHB 4ZGEB 2H3JA 3SWNA 1Q81C 2K2MA 4M75G 2ROLA 3CCMA 3VS0A 1GRIA 3EAEA 4C8QF 2E6ZA 4XTWA 3CMEA 3OA6A 3M0UA 3L2WA 3SHWA 3LX7A 4Z88A 2JTFA 2HKNA 4CI0C 3U23A 1YJ9T 4MDWA 3QWYA 1SSHA 3GOXA 4OMMA 2CT3A 1NPRA 2LDMA 3OMGA 2KNBB 3H0HA 5C6SA 2ZAEA 4IKFA 1CKAA 2L3RA 2PTKA 5CKFA 5LJ3h 4GLMA 3I55A 1F1BB 4F7UE 2NLUA 1QCNA 2QXFA 3UWNA 2XG8D 4PJMA 3CQTA 1WXUA 4RG2A 4HA8A 2EGCA 2PU9B 2YHTA 2M51A 4R56A 1NJIU 1JJ2P 1T3SA 1LCKA 2DD4A 5A0GA 4M4ZA 2JOYA 1H92A 5IH2A 4RMOA 4C8QG 4RUGA 3SD4A 3PIOA 1IGUA 3SFMA 1ARKA 5CQXA 2HQEA 1WHLA 2PUKB 2O2OA 3I56T 2K3XA 1BU1A 1BI3A 2RHXA 4AFSC 2E6NA 4MZPA 1JQQA 3GIBA 3EG0A 4C5EA 3PMIA 2GQVA 4M7AD 2ESWA 2LP5A 4M77D 1AHJB 3H6ZA 1JBMA 1KIKA 4ME7A 1VQ6Q 3JSCA 3RKYA 1WJRA 2HZYA 3UT1A 1T3LA 1VA7A 3RIRA 2DM1A 2DAQA 1YWPA 2WACA 4J9EA 1Y07A 2O31A 2PUOB 3MPUB 1WNLA 2R5MA 3M55A 2MK5A 4RTTA 3QIIA 3L42A 1PD0A 3QUIA 4CRIA 4KUDK 1HJDA 4PJOD 4XTZA 3GLXA 1K8AC 3CCRA 1PKSA 1WDXA 1YJWA 3M9QA 1ZQ1A 2DXUA 2EQUA 3PGGA 4ELYC 4E2FB 3OYBA 1VYUA 1T0HA 4BY6C 5HCKA 3VS2A 4KUIA 1RAIB 3ZL7C 4D8KA 3S3OA 3V7RA 1QVPA 2NUPB 2VV5A 1MMAA 2DLPA 3LH0A 2J06A 3C95A 4IUPA 2GFAA 3ZEHA 5KYWA 2GFUA 3CC2Q 1GCQA 4M7AA 2O9VA 2QYZA 3HRUA 3X26B 2QQSA 5D7UA 1WI7A 4E7SA 2SEMA 3QJ6A 2BIVA 3X24B 2FL7A 2OTJQ 4ATOA 2KRSA 2L8DA 2ZPEB 4M7DG 3GF5A 4ZNXA 1OULA 3BDLA 2RI3A 4PJOA 5GMKi 1PM3A 3C94A 1M2VB 2QDYB 2DL8A 1WQ7A 3PIPA 8AT1B 2CP7A 2VKNA 4JJNK 4FCYA 4J9CA 3EGDA 1LVKA 2RI2A 1XJWB 4DOVA 3G4SQ 2EVRA 5GMKj 2JMCA 3J81E 4CC7A 3CCVA 3OW2A 2MAMA 3EGUA 4JS5A 1P92A 1BCMA 5DY9A 3KFVA 2KY9A 3P8HA 1FWZA 2HKQB 2ED1A 3RKWA 2V8JA 1PC0A 1Q95G 2HBPA 2CUBA 1AD5A 3OB9A 2WSCE 2BZ8A 2SRCA 3I35A 5EG2A 5LJ5e 2QI2A 4M75D 3H0FA 1X69A 5LJ5d 1QKXA 4M7AE 4ESRA 3A98A 5DLOA 3JB9F 1UFFA 1AEYA 2DTOA 4M7DB 3OW2S 1WHMA 4L59A 3OYIA 3FDRA 2YUPA 1UGVA 3GBQA 3MP6A 4EMGA 1K9MC 4N4HA 3UPUA 3UATA 1VQ5T 5FU6C 2KEAA 3QDFA 3J80E 2ECZA 4JDSA 1FXXA 3G6ET 4FYVB 5GANe 1RAGB 3BFMA 5FRMA 1QCFA 3ZFJA 1ZUKA 5FW9A 4CC2A 1K73U 5C0MA 4EDUA 2EYZA 2FRYA 1VQOT 1KQ1A 3N5BB 2XDPA 1G5VA 4AFUC 3ER0A 3A8MB 1PRMC 1QVGP 3OYEA 4HVVA 2QEXQ 1Q82U 4C8QD 1O9SA 1M30A 1H641 1Q86U 4RTWA 1W2BP 1M1FA 2VC8A 1X6OA 2NUZA 3BY7A 5A0DA 2DBKA 5GAMg 1VQ4T 4QVDA 3CCLT 4IURA 4M78E 4M75A 3ULRB 1K9AA 3H41A 3E19A 2DO3A 3NTKA 1MHNA 1MNDA 4F7UB 2EYXA 4QW2A 1D1CA 2F1LA 2LMJA 4WCIA 3CCET 1X6BA 3L2VA 3CC7Q 2DMOA 2QQRA 1RAHB 1B34A 4J9GA 1YWOA 4XU1A 2M0YA 3HFNA 3CC2A 4A4GA 1RLQC 3REAB 1K1ZA 4PJJA 1KK7A 3M59A 1VQNQ 2D6FA 2JXBA 3QSUA 5KYXA 1UJ0A 1GBRA 3LGLA 1OX9A 1M3CA 2VXFA 4LE9A 2EPDA 2XKOC 1RACB 1U1TA 2OTJA 2MOXA 2DRMA 1NEGA 3OYLA 1TWBA 4C8QA 3SWNB 2A7YA 1NBEB 1ZUYA 3VS7A 4QVZA 1YJ9Q 4ZN1A 4JZ3A 1KD1C 1C1AA 2PVOB 1NYGA 3A8OB 4IUVA 4N0AC 2KBTA 1WZOA 3LYIA 4ORZA 2E12A 3ME9A 2ENMA 1UDLA 1YITT 2CDTA 3FB9A 2CP5A 3FIFA 4M75E 1I5OB 2QASA 1RLPC 4OGCA 1MMNA 1M1GA 1UGPB 5D6WA 2F5TX 3VS4A 2DYBA 2J7IA 2YSQA 3I56Q 3QBYA 4FT2A 5CQYA 3E1SA 2CZ0B 2EFIA 1Y71A 2KI7A 3CPFA 3OYMA 3V8KA 5GAMj 1HSQA 3VV0A 1X2QA 1M1KC 1NZ9A 5KCHA 4MDXA 4C5GA 5IT9E 5FRNA 4AG2C 2RM4A 1V76A 2RMOA 5FU7B 4EPCA 3GP8A 1I1JA 2EIFA 2H3EB 4ELZC 2ED0A 1WQWA 3S3NA 4C8QE 1U8RA 4D6WA 1VIEA 4Y28E 5GAN2 1ZA2B 3H9NA 2FPFA 1TOVA 4IIMA 2A37A 5LJ3g 1TS9A 5J39A 3QZ5B 1E6GA 3BW1A 2CGHA 4PKCC 1NE8A 3CPWP 2KK4A 5CKHA 2F69A 2JS2A 2V26A 3KXTA 2FPEA 2K5LA 2EGEA 1OZ3A 1GFDA 3FRNA 1M90R 5CKEA 2DD5A 2RH2A 1H3HA 4LD6A 3R6NA 2RJCA 4JRPA 1TG0A 1Y96A 4VUBA 4PL6A 2NYSA 2J6KA 3EFSA 4PFPA 1MMGA 2HQXA 5KYWB 2LT1A 3NTHA 4J9BA 4II1A 2FYKA 3E9FA 2X4XA 4M78G 4M7AB 4MZTA 1I0CA 2XD0A 2MMPA 4J8OA 1G83A 1TU0B 2D8JA 2MPXC 1LNXA 3JB9D 5HK3A 2L3SA 4HCBA 1PHTA 4J6WA 2L3PA 2PQWA 1BIBA 1WYXA 4J5YA 1B3QA 3LLRA 2KYMA 3OBWA 3OS5A 3OYGA 8ATCB 1JEGA 4RTUA 3O8VA 1V29B 1W2BA 1M4ZA 2O01E 4BE2A 2VASA 1BBZA 5HY6A 5ECAA 5GANh 3MCAB 3QDRB 3X20B 2QTVA 4A4KA 5I21A 2K5IA 4OMNA 2F2WA 2DJQA 5GAN6 1YN8A 1OU9A 3G71T 1EIFA 5DLQE 2EYWA 2HNIA 3X28B 3EGDB 1G8XA 1JB0E 2XU8A 2LQWA 1MNEA 3P8DA 5GMKl 3NMZC 4AFQC 2RJFA 1W2BS 1M90U 3R6OA 2GNCA 1I8FA 2CYZB 5HK0A 1RAEB 1I4K1 1ZSZC 1MUZA 4M78B 5LJ3j 1JXOA 2DTIA 3TU4K 4ZN3A 2D0QB 3WVDB 1D1BA 5CVIA 1WXBA 2IIMA 2A36A 1UHCA 3DB4A 2JW4A 3VRZA 2M16A 3J7AF 2OTLT 1Q7YC 5HKCA 2BKDN 2Y4YA 3EG9B 1AWJA 2LTOA 1QQJA 1VQ8T 4QKUA 4FIBA 1E7OA 4AG1C 2DJZA 3TCJA 1VQ5Q 1G3SA 1MV3A 4DQ2A 1AVZC 3RNJA 3LGFA 3G6EQ 1VQ9T 3RDVA 4JRIA 4XU0A 4XTUA 2V8IA 5GMKe 4Z02A 1M3BA 1WPYA 1M1KR 2X4WA 2J6OA 2MWPA 1VQOQ 3NPFA 3M56A 3QXEB 3M0TA 1UJYA 3CCUA 4C92C 1D09B 3HL8A 1O75A 2EYYA 5D6XA 3CCJA 2JM8A 1VQKT 2LC4A 2COZA 4OB1B 1VQ4Q 2LX9A 1QP2A 3CCLQ 2FHDA 2JVVA 1KC8R 1D0XA 4R0KA 4EIKA 2EKHA 3META 3CMAT 4LDWA 2JN0A 1QP3A 1PSFA 3CCEQ 1D1AA 1PG5B 4M75B 1YJNA 3OYYA 2C0IA 1ZUUA 4NOYA 3QWXX 4X34A 2DVEA 4ZGDB 1WHJA 4HT8A 1RAAB 3LWIA 1NG2A 4FW1A 5FWBA 1FMKA 1G3WA 2O9SA 3M0QA 1R8OB 1VQLA 5D6YA 1B34B 3JCMh 2QA4T 4OVAA 4E7IA 2E64A 1V1CA 3LWHA 2C06A 2B8AA 4X9DA 4E7JA 2M0OA 3CCMT 5KYXB 3EFRA 1AT1B 2LJ1A 1VQMA 2OJ2A 4DEYA 2DIGA 1M8VA 3CC4A 2DL5A 5KCOA 3CMET 4J7FA 3CCSA 3CPWA 2KROA 3CEYA 3A1PA 2RQVA 3E2UA 1VQPT 3RUXA 2OAUA 4C8QB 3PFSA 4C5IA 4LUDA 4OP0A 2LT4A 3GPLA 2DK3A 3HRSA 2BZXA 1VIFA 5LL6S 1YITQ 3GNGA 2QQ9A 1K0XA 2X4YA 3V8JA 4C0DB 3A8GB 3I55T 1KC8U 3MEUA 4M78D 5GAOq 4J9HA 1VQ7T 5GAOm 2P4TA 2H8HA 3CPWS 2D8HA 2DERA 2DNUA 1YHQT 3OYNA 2MWOA 2Y90A 4XTVA 2FRWA 4C92F 4IUUA 4XU2A 1N6AA 1VQ5A 2K4YA 2HAXA 3L2UA 2K3YA 4GBQA 3OY9A 1U06A 4L6V5 1Q7YR 4FYYB 4J6YA 2A28A 2FZGB 2KYBA 2RHIA 2VB6A 2EAYA 3MEVA 3HSBA 1Q81R 4BUGA 3VS3A 3VYGA 5GAN3 1AZEA 5FU7C 1ZX6A 4C0FA 2VGNA 5KE3A 2DETA 2KXDA 3CCRT 4F04B 4M78A 1JO8A 3JCMX 1HK9A 2BE7D 4X9CA 4GY5A 3M0RA 4KT0E 1SHGA 5GAMe 2AK5A 4XTYA 4JLGA 3S6WA 2VGMA 2DRKA 5I22A 5KH6A 2ATCB 3NGPA 5GAMd 3A8LB 2DYIA 2JJ9A 3EG9A 4PK4A 1JU5C 2RHUA 1WX6A 1N8RC 1MV0B 3TREA 5IAYA 5IN1A 2KRMA 2PVDB 2X3XD 4LXCA 3CCEA 2LNHB 3DB3A 3EHQA 4LUEA 4CC3A 5KYYA 3QKJA 3G7ZA 3DLLA 4KGXB 2RQUA 2RK1A 2JUFA 4A4EA 4EMKC 1IRXA 2LX7A 4Z89A 2JTEA 1Y96B 3CCQT 2EQJA 4OMPA 1VQ6A 1YCYA 3IQLA 1KQSP 1X27A 3BDUA 2D1XA 1BI1A 1D0YA 3WXMB 2W0ZA 5GAOp 4QVCA 4J7IA 4LDUA 1RAFB 1TUDA 4JS4A 1GCQC 4N0AA 4DBFA 1Y0MA 4M77C 2HEQA 3EGXB 1W6XA 1QLYA 1Q81U 2CZ1B 2ZPBB 2ZPFB 3VRYA 2P0KA 3V7SA 9ATCB 3JB9G 4LDVA 1JJ2A 4AT1B 3G71Q 3L2QA 2RQTA 2KQWA 5CCAA 3OYDA 4LN2A 2DXTA 3OYCA 2KE9A 4QQ6A 1JRIA 2X4JA 1OPKA 4HKEA 3ASKA 1K4US 3CCVT 1BCOA 2AHJB 1WXTA 4KBMB 3OYKA 1ZHIA 1FYNA 5CKBA 4PJOC 1K8AR 3SEMA 4ANJA 5GAMf 2LZ6B 2YRCA 2EW3A 1N5ZA 4GLKA 4D8DA 2P4RA 2RHZA 1A0NB 3OQ5A 5KE2A 5CAIA 1JJ2S 2EWNA 2E3IA 4FM4B 5LJ5g 4BE0A 4J6XA 4B9XA 2OTLQ 3THKA 2DF6A 1VQ8Q 2BTTA 3OS1A 3CD6T 2RO0A 4BE1A 2DEUA 1QMCA 4LDYA 2LVMA 1VQ9Q 1BKBA 3FLGA 5L8RE 3GNFB 3V8LA 4XU3A 3VYHB 1UTIA 1OU8A 1FMVA 1M8MA 2E3HA 3KBGA 4DBQA 2QQBA 5GANg 2JS0A 2KR3A 2COYA 5DM7R 1OOTA 3INZA 2DTHA 4EMHA 4E7ZA 3CBPA 4A4FA 2DFUA 4PLIA 1VQKQ 5J3BA 1C6VX 1UECA 2X35A 5LJ3e 4R55A 3G4SA 2J6FA 1E6HA 2F5KA 1NJIC 2LCSA 5LJ3d 2AT1B 1RI0A 2VYTA 1K0SA 5EC7A 3VS6A 2ZGWA 4JRQA 1SHFA 4RTYA 1K8AU 1QWEA 3CMAQ 1TTHB 4NL3A 3QPHA 2QTXA 2KAFA 1G3YA 1AZGB 2HL5C 5A0LA 2OAWA 4L5GA 3QYGB 2EYQA 3PMTA 3VS1A 4PFZA 2KDSA 4E7HA 4OGEA 1R0BG 1ZBJA 4Y91A 4N4IA 5M9OA 4M77F 2DPPB 3OS2A 2XHCA 1AWWA 2A0FB 5GAOn 5FWCA 4M75C 1N8RR 2DX1A 2QQAA 2QA4Q 2I2LA 3CXCP 1EFNA 1MMDA 2LJ0A 1IHWA 5FLXE 3VUZA 4OMFB 5LJ5j 3CCMQ 2O4XA 1NEBA 4OMOA 1K9MR 2DZ9A 1YIJT 1N9SA 4PJOF 1SF9A 1WIEA 2EQMA 3CMEQ 3CBMA 1RABB 1G3TA 2LQKA 3M0SA 1VQPQ 4JUVA 1OV3A 2QEXA 4DOWA 2GBQA 4JJBA 1GXIE 2K9GA 5IHIA 1I5LA 2KSSA 5LJ3f 4FYXB 2RA2A 1BI0A 4E47A 1VOMA 2HMAA 3I55Q 2D0NA 5GANj 1YI2T 2R57A 4HT9A 2EJ9A 1M2OA 4C8QC 1SEMA 1VQ7Q 2MF2A 2L0AA 1SG5A 1RUWA 3JCMJ 3JCMc 3HKSA 2E41A 2L3QA 3CC7A 1I07A 2GGRA 5LJ5h 1YHQQ 3M58A 1KJWA 2IVWA 1DJ7B 3JCMg 2EQKA 4JJDA 2QDLA 4BACA 2X9HA 2QG9B 3EGXA 3SB2A 6AT1B 1VQNA 1UEBA 1QVGA 3FC3A 2ROTA 3PTAA 4C0GA 1KG1A 5GJVB 2XIDA 2Y4XA 2QGFB 1K9MU 1FMWA 2XDBA 1QVFP 3NTIA 4KGZB 2HSPA 4RCBA 3JCMV 3MEWA 2CP2A 1QWFA 3RBBB 1YJ9A 3C0CA 2DL3A 1IB8A 1YBYA 1SRLA 3CCRQ 3I5SA 1YJWQ 1U3OA 1QVGS 1NLOC 1WLPB 2K2VA 3EHRA 1YFNA 3O5ZA 2MCNA 1AWXA 3G1JA 4DA4A 1XNIA 3QYHB 1KD1R 4Z8AA 2DIQA 2FZKB 2OI3A 3EG2A 2J05A 1SPKA 1N9RA 4F14A 3I56A 2LRQA 4BI8B 3RR6A 2RNAA 1PCXA 5CIUA 3CCQQ 4HCCA 5KYYB 2K79A 2CZ6B 4M7DC 2M1HA 1K76A 2NWMA 4ZTFA 4DEXA 1TUGB 4PLLA 4NS5A 1BYMA 1GFCA 3MP8A 1K73C 4C92E 1BIAA 2RHYA 2AZSA 2QAZA 2YLBA 4AMCA 3OYHA 4E7LA 1S72T 3JRZA 1Q82C 4FT4A 4MMKA 2G6FX 2LCCA 2O88A 1Q86C 4BI3A 2EQIA 4KH1B 3M53A 2FVUA 2F2VA 2JM9A 2WSFE 1LPLA 4LDXA 2PZ1A 1VQPA 1JXMA 3PVQA 3CCVQ 4IUQA 1WHHA 4J9DA 2KT8A 4YTLA 1KD1U 2Z0WA 1M3AA 2DVJA 1J3TA 3DKMA 1LOJA 3PT9A 1VQ7A 2LJ3A 2RQWA 4KGVB 3I5RA 1G2BA 1IREB 1PKTA 2K5FA 2JMAA 3MO8A 4N4GA 2M9UA 4J9IA 2I0NA 4QT7A 3CXCA 3L1AA 4JLIA 4AFZC 2KT1A 1OI1A 3FJPA 1YHQA 3CD6Q 3AHUA 2PNIA 4K11A 3UDCA 1ZA1B 2MI6A 4MMLA 1D3BB 1OQKA 1UGRB 3NFCA 1M1KU 2YUOA 4FYWB 5L23A 2LQNA 3D7SB 2LNVA 1M27C 2MIOA 1HD3A 3HP9A 5AYFA 2JNGA 4V2SA 3CXCS 4HVWA 4WF2A 1SKUB 1ZLMA 2JZ2A 1R0CB 5IHNA 2P84A 2K6DA 4LNPA 1KQ2A 4NL2A 4DBHA 3SWNC 3CCUT 1WHKA 2M02A 2VUBA 2YT6A 3H8ZA 4RG8A 2RK2A 2FZCB 4RTZA 4BB7A 3CCJT 2VXEA 2XICA 3UA7A 2X51A 5CKDA 2F2XA 1TSFA 2CP3A 4EMKA 2HDAA 4M7DF 1CKBA 3L2ZA 4E7KA 2CS7A 1IGQA 3TEEA 2MYSA 3HPWA 3OS0A 1UGSB 3C4SA 3JV3A 3VKIA 1M5Q1 1KSWA 1YJNT 3LH5A 2YXYA 1NYFA 4M77A 1Z9QA 1LJOA 2HCKA 5AT1B 4OB3B 3QHSA 5GAN4 1QVFA 3CCQA 2BUDA 1KHIA 3MEAA 4UC4A 3LW5E 4OB2B 1WA7A 1N27A 4JRKA 2EKOA 4A53A 1VQLT 3G6EA 4FW2A 1S1NA 3VUBA 3M0PA 1YIJQ 1HYOA 5IXBA 1TUCA 2CSQA 2B86A 1X75C 4Q5WA 2RJDA 4MZMA 3PNWC 1ABQA 2R5AA 2KRNA 1VQOA 2E1HA 1VQMT 2KVQG 5KYUA 3WVEB 2O4XB 1T0JA 1B7TA 2XMFA 4PJNA 3CC4T 3CBOA 4BD3A 1K73R 3CCST 1HXDA 1QW1A 1QVFS 1YJWT 4OMQA 1OPLA 2CREA 4F7UF 2NUTA 4C92G 1GBQA 3EFOA 2ZPIB 3M5AA 1VQ4A 1Q82R 3CCLA 1UB4A 1YI2Q 3T9NA 1GCPA 2R58A 4ZTJA 4OMLA 2PVGB 4O6JA 1Q86R 1X01A 3A8HB 4Y92A 1BK2A 1ZSZB 5A2QE 2V8KA 3OBYA 4FL6A 1ZSGA 2VWFA 4PNOA 2GF7A 3OYFA 4XQ3A 1UHFA 5GAN7 4XTXA 4BDZA 5IHKA 2KMTA 2GTJA 2ZPGB 2W10A 2IPOB 2E5QA 2DL4A 2L89A 1PNJA 1XTDA 2AZVA 1KFZA 4M77E 1M9SA 2FB7A 3AT1B 4F7UG 4JJCA 3CD6A 3ZBDA 4QQGA 2COWA 3HFOA 3TSWA 2RPNA 3OSSC 4M7AC 1Q7YU 4P5NA 7AT1B 2GTOA 1W1FA 1FX7A 2DEQA 3L2RA 3JCMP 5GMKh 4C92B 4F16A 2FPDA 4PJOE 4B6MA 1C0MA 2YDLA 5GANd 2QK0A 1ABOA 4C5HA 1YNZA 4A4HA 5GMKm 5J26A 3V7CA 1IXDA 3PVLA 3TQ7P 4JZ4A 3OYJA 1YITA 1M90C 5FROA 2RN8A 4IUTA 3OSVA 1UE9A 3JB9I 1D0ZA 1X43A 1VYVA 3RMSA 2D9TA 3PE0A 4FSXA 2V1QA 3RKXA 1H8KA 3REBB 1WHGA 1XOVA 1ACMB 1YCSB 3RESA 1D3BA 1ZBXA 3OMCA 2XK0A 4M78C 5LJ5f 3JCMQ 1UUEA 4WTOB 1UGQB 2OX7A 2CT4A 4RTXA 4FSSA 3P8BB 5KYNA 2BE9B 5CR2A 1VQ6T 1S72Q 2JT4A 1GL5A 1NLPC 1YIJA 2GQIA 3F70A 2DZCA 2E4HA 3URGA 3M57A 3TSZA 5GANf 1XQHA 1WFWA 4RCCA 3S3MA 4BY6B 2CP6A 4IIOA 4XAXB 1Y7XA 1WJQA 3E9GA 2DXCA 3X25B 4ZGJB 2NUPA 3SDZA 1TXQA 3UF4A 1W4SA 2EBPA 5GAN5 2AKKA 4X1VA 4DBRA 1R77A 1YI2A 1EX4A 4JPBW 2K3BA 4BI4A 4M7AF 1IHVA 3FEOA 2K7AA 2C0OA 2IG0A 2DKGA 5GAOr 2E10A 1SSFA 3CC2T 2AKLA 1OYXA 3JCMW 4M7DD 4J9FA 3JCMb 5I2SA 3JCMe 5I2MA 5GAOl 2RB6A 3UA6A 4RKUE 1CSKA 4E6RA 2YLCA 3JCMd 2P0PA 4KULA 1QCOA 2DL7A 3HHTB 3OYAA 2E65A 4KH0B 4FU6A 2LQ8A 1PRLC 3H0IA 1M2VA 2L2PA 1PSEA 4J83A 2OTJT 4C92D 5CO7A 3FJ5A 1RI9A 2CUDA 1AWOA 4XK8E 5IXFA 4OB0B 4M7AG 1OEBA 2ZCFB 4M77G 4A63B 3C12A 4HCKA 3CCUQ 1ZSZA 2A08A 4KRTA 1KC8C 3G71A 3QO3A 3CCJQ 1WGSA 3HTRA 1RADB 3G4ST 4M78F 2CSIA 4LD9K 3EG1A 2RF0A 4HXJA 2CZ7B 3M4GA 5I11A 2L5QA 4A54A 5CK9A 1U5SA 1YP5A 2XDDA 2KXCA 2ZZDA 4TVRA 5GAMh 4C0DC 4PJOG 2EJFA 4CC4B 2X3WD 2AIRB 3Q1JA 3EH2A 4M7DA 1X6GA 1KQSA 1VYTA 2ABLA 1IZ6A 1YJNQ 4EMKB 1Z9ZA 1WJSA 3I9QA 2OTLA 1X2KA 2CH4W
chains in the Genus database with same CATH topology
2EPDA 1ZX6A 1M3AA 2E5KA 2DVJA 2MOXA 2DRMA 2KXDA 1NEGA 1J3TA 4HVUA 1JO8A 2LJ3A 1W70A 2RQWA 2FO0A 1PWTA 1ZUYA 3I5RA 5GJWB 1G2BA 3M0RA 2YUQA 1PKTA 3VS7A 2JMAA 1SHGA 2AK5A 4J9IA 2I0NA 4QT7A 2DRKA 5I22A 4JZ3A 4AFZC 3NGPA 1AOJA 1NM7A 2KT1A 4RTVA 2DBMA 1NYGA 1JU5C 1WX6A 1MV0B 2PNIA 2DE0X 2KBTA 4K11A 2KRMA 2X3XD 2YUNA 2LNHB 4ORZA 3EHQA 4LUEA 2ENMA 1UDLA 1BB9A 4CC3A 2CDTA 2V1RA 1UG1A 2YUOA 2RQUA 5L23A 2LQNA 1M27C 2DA9A 2MIOA 1RLPC 4F17A 2LX7A 1HD3A 2FG0A 2C0TA 2JTEA 4Z89A 2FEIA 3VS4A 4OMPA 1SRMA 2BZYA 2DYBA 4HVWA 1ZLMA 2J7IA 3VS5A 5IHNA 2YSQA 3IQLA 1X27A 2D1XA 2K6DA 4LNPA 2W0ZA 2RQRA 1B07A 1Y57A 1HSQA 3TVTA 1TUDA 2YT6A 1X2QA 2HBWA 1GCQC 1Y0MA 4RTZA 1QKWA 2HEQA 1W6XA 1QLYA 3EG3A 3UA7A 2KGTA 3VRYA 2F2XA 4AG2C 2VVKA 2HDAA 2DILA 1CKBA 2RMOA 1I1JA 2RQTA 2CH4A 4LN2A 2ED0A 1IO6A 2KE9A 3NHNA 1OPKA 1K4US 3JV3A 2EGAA 1KSWA 1WXTA 1FYNA 2FPFA 4IIMA 2K2MA 3SEMA 2ROLA 2LZ6B 2A37A 3LH5A 2EW3A 3VS0A 1GRIA 1NYFA 1Z9QA 1N5ZA 2HCKA 4D8DA 2P4RA 1A0NB 1E6GA 3M0UA 3SHWA 1WA7A 4Z88A 2JS2A 3U23A 2FPEA 1S1NA 3THKA 3M0PA 2DF6A 2EGEA 5IXBA 3QWYA 1SSHA 1TUCA 2CSQA 1GFDA 4OMMA 2B86A 2CT3A 2BTTA 2KNBB 3H0HA 1ABQA 1H3HA 3R6NA 1CKAA 2KRNA 2PTKA 4GLMA 1TG0A 1T0JA 2XMFA 3CQTA 2J6KA 1WXUA 1UTIA 2EGCA 4OMQA 2M51A 1OPLA 2CREA 1M8MA 1T3SA 1LCKA 4J9BA 4M4ZA 1H92A 1GBQA 5IH2A 1I0CA 4RUGA 2JS0A 2KR3A 1OOTA 1GCPA 4OMLA 1G83A 1ARKA 2D8JA 4Y92A 2O2OA 1BK2A 2L3SA 1BU1A 1UECA 1PHTA 1ZSGA 2VWFA 2L3PA 4AFSC 1JQQA 1WYXA 2J6FA 3EG0A 1B3QA 1E6HA 2KYMA 2ESWA 2LP5A 2LCSA 4RTUA 1JEGA 1K0SA 1UHFA 1KIKA 5EC7A 3VS6A 5IHKA 1T3LA 1SHFA 1VA7A 4RTYA 1BBZA 2GTJA 2W10A 1QWEA 5ECAA 2DL4A 2DM1A 1AZGB 1YWPA 1PNJA 4J9EA 2OAWA 2AZVA 2O31A 4OMNA 2F2WA 1KFZA 2DJQA 1YN8A 3VS1A 4RTTA 2EYWA 4JJCA 3TSWA 1ZBJA 2RPNA 1HJDA 2GTOA 1W1FA 2LQWA 1AWWA 3NMZC 4AFQC 1PKSA 1WDXA 5FWCA 2GNCA 1MUZA 4F16A 2DX1A 1JXOA 2FPDA 1VYUA 1T0HA 5HCKA 1EFNA 3VS2A 2LJ0A 2YDLA 1WXBA 2IIMA 2A36A 3ZL7C 1UHCA 4D8KA 2JW4A 1ABOA 3VRZA 1YNZA 1NEBA 4OMOA 1AWJA 2DLPA 1E7OA 4AG1C 2J06A 1WIEA 3PVLA 4JZ4A 1MV3A 1AVZC 2RN8A 3RNJA 1GCQA 1UE9A 2O9VA 1X43A 1VYVA 3M0SA 3PE0A 1OV3A 2V1QA 1WI7A 1H8KA 3REBB 2SEMA 2GBQA 1M3BA 4JJBA 1XOVA 2K9GA 5IHIA 1YCSB 2J6OA 3NPFA 3M0TA 2D0NA 1UJYA 2KRSA 1SEMA 2EYYA 4ZNXA 1UUEA 2L0AA 2JM8A 1RUWA 2CT4A 4RTXA 4FSSA 2L3QA 1I07A 2DL8A 2GGRA 4R0KA 4EIKA 2EKHA 1KJWA 2VKNA 4J9CA 2JT4A 4JJDA 2QDLA 2EVRA 1GL5A 2JMCA 1NLPC 4CC7A 3EGUA 2GQIA 3KFVA 2C0IA 1ZUUA 3TSZA 3QWXX 2ED1A 2ROTA 1WFWA 4IIOA 1NG2A 5GJVB 5FWBA 2CUBA 1AD5A 1FMKA 2O9SA 3I35A 2BZ8A 2SRCA 2HSPA 3M0QA 3UF4A 3H0FA 1X69A 2EBPA 1QKXA 1QWFA 3RBBB 3C0CA 2AKKA 4X1VA 4ESRA 2DL3A 3A98A 1UFFA 1AEYA 1SRLA 1V1CA 4JPBW 3I5SA 2K3BA 1U3OA 2YUPA 1UGVA 2LJ1A 3GBQA 1NLOC 1WLPB 2OJ2A 3EHRA 3O5ZA 2MCNA 4DEYA 2K7AA 1AWXA 2C0OA 2DL5A 3UATA 2KEAA 4Z8AA 2KROA 2OI3A 2ECZA 3EG2A 2AKLA 2RQVA 4J9FA 4LUDA 2J05A 1QCFA 1SPKA 3UA6A 1CSKA 1ZUKA 5FW9A 4CC2A 2BZXA 4E6RA 4F14A 1K0XA 2DL7A 2EYZA 2FRYA 4AFUC 1PRLC 3H0IA 1PRMC 2L2PA 2RNAA 4HVVA 3FJ5A 1RI9A 2CUDA 1M30A 4J9HA 4RTWA 2H8HA 2K79A 1AWOA 1K76A 2NUZA 5IXFA 2NWMA 2D8HA 4DEXA 2DBKA 1OEBA 1GFCA 4A63B 4HCKA 2DNUA 3ULRB 1K9AA 3H41A 2AZSA 2A08A 4KRTA 2EYXA 2FRWA 2LMJA 4WCIA 1X6BA 2CSIA 2G6FX 3EG1A 2O88A 2RF0A 4HXJA 2DMOA 5I11A 1U5SA 1YP5A 2EQIA 2F2VA 1YWOA 2JM9A 4J9GA 2KXCA 4GBQA 2M0YA 1U06A 2PZ1A 1RLQC 3REAB 1K1ZA 1JXMA 4CC4B 2X3WD 3PVQA 1X6GA 2A28A 2KYBA 1VYTA 2ABLA 2JXBA 4J9DA 3VS3A 1UJ0A 2KT8A 1GBRA 1M3CA 1Z9ZA 3I9QA 1AZEA 4LE9A 1X2KA 2CH4W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPD A;  1ZX6 A;  1M3A A;  2E5K A;  2DVJ A;  2MOX A;  2DRM A;  2KXD A;  1NEG A;  1J3T A;  4HVU A;  1JO8 A;  2LJ3 A;  1W70 A;  2RQW A;  2FO0 A;  1PWT A;  1ZUY A;  3I5R A;  5GJW B;  1G2B A;  3M0R A;  2YUQ A;  1PKT A;  3VS7 A;  2JMA A;  1SHG A;  2AK5 A;  4J9I A;  2I0N A;  4QT7 A;  2DRK A;  5I22 A;  4JZ3 A;  4AFZ C;  3NGP A;  1AOJ A;  1NM7 A;  2KT1 A;  4RTV A;  2DBM A;  1NYG A;  1JU5 C;  1WX6 A;  1MV0 B;  2PNI A;  2DE0 X;  2KBT A;  4K11 A;  2KRM A;  2X3X D;  2YUN A;  2LNH B;  4ORZ A;  3EHQ A;  4LUE A;  2ENM A;  1UDL A;  1BB9 A;  4CC3 A;  2CDT A;  2V1R A;  1UG1 A;  2YUO A;  2RQU A;  5L23 A;  2LQN A;  1M27 C;  2DA9 A;  2MIO A;  1RLP C;  4F17 A;  2LX7 A;  1HD3 A;  2FG0 A;  2C0T A;  2JTE A;  4Z89 A;  2FEI A;  3VS4 A;  4OMP A;  1SRM A;  2BZY A;  2DYB A;  4HVW A;  1ZLM A;  2J7I A;  3VS5 A;  5IHN A;  2YSQ A;  3IQL A;  1X27 A;  2D1X A;  2K6D A;  4LNP A;  2W0Z A;  2RQR A;  1B07 A;  1Y57 A;  1HSQ A;  3TVT A;  1TUD A;  2YT6 A;  1X2Q A;  2HBW A;  1GCQ C;  1Y0M A;  4RTZ A;  1QKW A;  2HEQ A;  1W6X A;  1QLY A;  3EG3 A;  3UA7 A;  2KGT A;  3VRY A;  2F2X A;  4AG2 C;  2VVK A;  2HDA A;  2DIL A;  1CKB A;  2RMO A;  1I1J A;  2RQT A;  2CH4 A;  4LN2 A;  2ED0 A;  1IO6 A;  2KE9 A;  3NHN A;  1OPK A;  1K4U S;  3JV3 A;  2EGA A;  1KSW A;  1WXT A;  1FYN A;  2FPF A;  4IIM A;  2K2M A;  3SEM A;  2ROL A;  2LZ6 B;  2A37 A;  3LH5 A;  2EW3 A;  3VS0 A;  1GRI A;  1NYF A;  1Z9Q A;  1N5Z A;  2HCK A;  4D8D A;  2P4R A;  1A0N B;  1E6G A;  3M0U A;  3SHW A;  1WA7 A;  4Z88 A;  2JS2 A;  3U23 A;  2FPE A;  1S1N A;  3THK A;  3M0P A;  2DF6 A;  2EGE A;  5IXB A;  3QWY A;  1SSH A;  1TUC A;  2CSQ A;  1GFD A;  4OMM A;  2B86 A;  2CT3 A;  2BTT A;  2KNB B;  3H0H A;  1ABQ A;  1H3H A;  3R6N A;  1CKA A;  2KRN A;  2PTK A;  4GLM A;  1TG0 A;  1T0J A;  2XMF A;  3CQT A;  2J6K A;  1WXU A;  1UTI A;  2EGC A;  4OMQ A;  2M51 A;  1OPL A;  2CRE A;  1M8M A;  1T3S A;  1LCK A;  4J9B A;  4M4Z A;  1H92 A;  1GBQ A;  5IH2 A;  1I0C A;  4RUG A;  2JS0 A;  2KR3 A;  1OOT A;  1GCP A;  4OML A;  1G83 A;  1ARK A;  2D8J A;  4Y92 A;  2O2O A;  1BK2 A;  2L3S A;  1BU1 A;  1UEC A;  1PHT A;  1ZSG A;  2VWF A;  2L3P A;  4AFS C;  1JQQ A;  1WYX A;  2J6F A;  3EG0 A;  1B3Q A;  1E6H A;  2KYM A;  2ESW A;  2LP5 A;  2LCS A;  4RTU A;  1JEG A;  1K0S A;  1UHF A;  1KIK A;  5EC7 A;  3VS6 A;  5IHK A;  1T3L A;  1SHF A;  1VA7 A;  4RTY A;  1BBZ A;  2GTJ A;  2W10 A;  1QWE A;  5ECA A;  2DL4 A;  2DM1 A;  1AZG B;  1YWP A;  1PNJ A;  4J9E A;  2OAW A;  2AZV A;  2O31 A;  4OMN A;  2F2W A;  1KFZ A;  2DJQ A;  1YN8 A;  3VS1 A;  4RTT A;  2EYW A;  4JJC A;  3TSW A;  1ZBJ A;  2RPN A;  1HJD A;  2GTO A;  1W1F A;  2LQW A;  1AWW A;  3NMZ C;  4AFQ C;  1PKS A;  1WDX A;  5FWC A;  2GNC A;  1MUZ A;  4F16 A;  2DX1 A;  1JXO A;  2FPD A;  1VYU A;  1T0H A;  5HCK A;  1EFN A;  3VS2 A;  2LJ0 A;  2YDL A;  1WXB A;  2IIM A;  2A36 A;  3ZL7 C;  1UHC A;  4D8K A;  2JW4 A;  1ABO A;  3VRZ A;  1YNZ A;  1NEB A;  4OMO A;  1AWJ A;  2DLP A;  1E7O A;  4AG1 C;  2J06 A;  1WIE A;  3PVL A;  4JZ4 A;  1MV3 A;  1AVZ C;  2RN8 A;  3RNJ A;  1GCQ A;  1UE9 A;  2O9V A;  1X43 A;  1VYV A;  3M0S A;  3PE0 A;  1OV3 A;  2V1Q A;  1WI7 A;  1H8K A;  3REB B;  2SEM A;  2GBQ A;  1M3B A;  4JJB A;  1XOV A;  2K9G A;  5IHI A;  1YCS B;  2J6O A;  3NPF A;  3M0T A;  2D0N A;  1UJY A;  2KRS A;  1SEM A;  2EYY A;  4ZNX A;  1UUE A;  2L0A A;  2JM8 A;  1RUW A;  2CT4 A;  4RTX A;  4FSS A;  2L3Q A;  1I07 A;  2DL8 A;  2GGR A;  4R0K A;  4EIK A;  2EKH A;  1KJW A;  2VKN A;  4J9C A;  2JT4 A;  4JJD A;  2QDL A;  2EVR A;  1GL5 A;  2JMC A;  1NLP C;  4CC7 A;  3EGU A;  2GQI A;  3KFV A;  2C0I A;  1ZUU A;  3TSZ A;  3QWX X;  2ED1 A;  2ROT A;  1WFW A;  4IIO A;  1NG2 A;  5GJV B;  5FWB A;  2CUB A;  1AD5 A;  1FMK A;  2O9S A;  3I35 A;  2BZ8 A;  2SRC A;  2HSP A;  3M0Q A;  3UF4 A;  3H0F A;  1X69 A;  2EBP A;  1QKX A;  1QWF A;  3RBB B;  3C0C A;  2AKK A;  4X1V A;  4ESR A;  2DL3 A;  3A98 A;  1UFF A;  1AEY A;  1SRL A;  1V1C A;  4JPB W;  3I5S A;  2K3B A;  1U3O A;  2YUP A;  1UGV A;  2LJ1 A;  3GBQ A;  1NLO C;  1WLP B;  2OJ2 A;  3EHR A;  3O5Z A;  2MCN A;  4DEY A;  2K7A A;  1AWX A;  2C0O A;  2DL5 A;  3UAT A;  2KEA A;  4Z8A A;  2KRO A;  2OI3 A;  2ECZ A;  3EG2 A;  2AKL A;  2RQV A;  4J9F A;  4LUD A;  2J05 A;  1QCF A;  1SPK A;  3UA6 A;  1CSK A;  1ZUK A;  5FW9 A;  4CC2 A;  2BZX A;  4E6R A;  4F14 A;  1K0X A;  2DL7 A;  2EYZ A;  2FRY A;  4AFU C;  1PRL C;  3H0I A;  1PRM C;  2L2P A;  2RNA A;  4HVV A;  3FJ5 A;  1RI9 A;  2CUD A;  1M30 A;  4J9H A;  4RTW A;  2H8H A;  2K79 A;  1AWO A;  1K76 A;  2NUZ A;  5IXF A;  2NWM A;  2D8H A;  4DEX A;  2DBK A;  1OEB A;  1GFC A;  4A63 B;  4HCK A;  2DNU A;  3ULR B;  1K9A A;  3H41 A;  2AZS A;  2A08 A;  4KRT A;  2EYX A;  2FRW A;  2LMJ A;  4WCI A;  1X6B A;  2CSI A;  2G6F X;  3EG1 A;  2O88 A;  2RF0 A;  4HXJ A;  2DMO A;  5I11 A;  1U5S A;  1YP5 A;  2EQI A;  2F2V A;  1YWO A;  2JM9 A;  4J9G A;  2KXC A;  4GBQ A;  2M0Y A;  1U06 A;  2PZ1 A;  1RLQ C;  3REA B;  1K1Z A;  1JXM A;  4CC4 B;  2X3W D;  3PVQ A;  1X6G A;  2A28 A;  2KYB A;  1VYT A;  2ABL A;  2JXB A;  4J9D A;  3VS3 A;  1UJ0 A;  2KT8 A;  1GBR A;  1M3C A;  1Z9Z A;  3I9Q A;  1AZE A;  4LE9 A;  1X2K A;  2CH4 W; 
#chains in the Genus database with same CATH topology
 2HD0 A;  2E70 A;  2GCX A;  4O5V A;  5FU6 B;  3VJP A;  1N8R U;  2E5K A;  1VQ8 A;  3BE3 A;  1NPP A;  2EJG A;  3JB9 H;  3JCM f;  4HVU A;  4C92 A;  1W70 A;  1KHC A;  2FO0 A;  1PWT A;  5GJW B;  4HCZ A;  1TH7 A;  1VQL Q;  2YUQ A;  1PD1 A;  1VQ9 A;  2YRV A;  1MGQ A;  4PFO A;  4M77 B;  1I81 A;  2CKK A;  2RD1 A;  1AOJ A;  1NM7 A;  4RTV A;  1KQS S;  2DBM A;  2YWW A;  3MKD A;  4BDY A;  3MP1 A;  3QZ9 B;  2DE0 X;  1VQM Q;  1S72 A;  2YUN A;  2XI9 A;  3RER A;  3CC4 Q;  3QJY A;  3JAM E;  1BI2 A;  1BB9 A;  2CP0 A;  2V1R A;  2K57 A;  4QQD A;  3CCS Q;  1UG1 A;  1VQK A;  2DA9 A;  4F17 A;  2WSE E;  2FG0 A;  2C0T A;  2QEX T;  4PJO B;  3VU3 C;  2FEI A;  5KYU B;  1SRM A;  2BZY A;  2LCL A;  4PJL A;  5GAN 8;  3M4Y A;  4F7U A;  2YRD A;  4M75 F;  3MHX A;  3VS5 A;  3A5Z B;  2RJE A;  3CMA A;  2NUT B;  3EH1 A;  1EZZ B;  1U1S A;  2HQH A;  2RQR A;  1B07 A;  1Y57 A;  3EFO B;  1OX8 A;  3TVT A;  2RI5 A;  3JB9 J;  2HSE B;  2HBW A;  1NJI R;  2A3L A;  3QG1 A;  3KUF A;  3OW2 P;  1QKW A;  4M7D E;  3M54 A;  3HRT A;  3EG3 A;  4B9W A;  2HL3 A;  2DXB A;  1VUB A;  2KGT A;  3CC7 T;  4C0Z A;  2VVK A;  3MJX A;  2JTM A;  2DIL A;  2G3R A;  4OF1 A;  2CH4 A;  1OZ2 A;  3DLM A;  1H3Z A;  1IO6 A;  3RMQ A;  3NHN A;  2QGG A;  2QA4 A;  2P0Q A;  2EGA A;  1VQN T;  1RL2 A;  2ZPH B;  4ZGE B;  2H3J A;  3SWN A;  1Q81 C;  2K2M A;  4M75 G;  2ROL A;  3CCM A;  3VS0 A;  1GRI A;  3EAE A;  4C8Q F;  2E6Z A;  4XTW A;  3CME A;  3OA6 A;  3M0U A;  3L2W A;  3SHW A;  3LX7 A;  4Z88 A;  2JTF A;  2HKN A;  4CI0 C;  3U23 A;  1YJ9 T;  4MDW A;  3QWY A;  1SSH A;  3GOX A;  4OMM A;  2CT3 A;  1NPR A;  2LDM A;  3OMG A;  2KNB B;  3H0H A;  5C6S A;  2ZAE A;  4IKF A;  1CKA A;  2L3R A;  2PTK A;  5CKF A;  5LJ3 h;  4GLM A;  3I55 A;  1F1B B;  4F7U E;  2NLU A;  1QCN A;  2QXF A;  3UWN A;  2XG8 D;  4PJM A;  3CQT A;  1WXU A;  4RG2 A;  4HA8 A;  2EGC A;  2PU9 B;  2YHT A;  2M51 A;  4R56 A;  1NJI U;  1JJ2 P;  1T3S A;  1LCK A;  2DD4 A;  5A0G A;  4M4Z A;  2JOY A;  1H92 A;  5IH2 A;  4RMO A;  4C8Q G;  4RUG A;  3SD4 A;  3PIO A;  1IGU A;  3SFM A;  1ARK A;  5CQX A;  2HQE A;  1WHL A;  2PUK B;  2O2O A;  3I56 T;  2K3X A;  1BU1 A;  1BI3 A;  2RHX A;  4AFS C;  2E6N A;  4MZP A;  1JQQ A;  3GIB A;  3EG0 A;  4C5E A;  3PMI A;  2GQV A;  4M7A D;  2ESW A;  2LP5 A;  4M77 D;  1AHJ B;  3H6Z A;  1JBM A;  1KIK A;  4ME7 A;  1VQ6 Q;  3JSC A;  3RKY A;  1WJR A;  2HZY A;  3UT1 A;  1T3L A;  1VA7 A;  3RIR A;  2DM1 A;  2DAQ A;  1YWP A;  2WAC A;  4J9E A;  1Y07 A;  2O31 A;  2PUO B;  3MPU B;  1WNL A;  2R5M A;  3M55 A;  2MK5 A;  4RTT A;  3QII A;  3L42 A;  1PD0 A;  3QUI A;  4CRI A;  4KUD K;  1HJD A;  4PJO D;  4XTZ A;  3GLX A;  1K8A C;  3CCR A;  1PKS A;  1WDX A;  1YJW A;  3M9Q A;  1ZQ1 A;  2DXU A;  2EQU A;  3PGG A;  4ELY C;  4E2F B;  3OYB A;  1VYU A;  1T0H A;  4BY6 C;  5HCK A;  3VS2 A;  4KUI A;  1RAI B;  3ZL7 C;  4D8K A;  3S3O A;  3V7R A;  1QVP A;  2NUP B;  2VV5 A;  1MMA A;  2DLP A;  3LH0 A;  2J06 A;  3C95 A;  4IUP A;  2GFA A;  3ZEH A;  5KYW A;  2GFU A;  3CC2 Q;  1GCQ A;  4M7A A;  2O9V A;  2QYZ A;  3HRU A;  3X26 B;  2QQS A;  5D7U A;  1WI7 A;  4E7S A;  2SEM A;  3QJ6 A;  2BIV A;  3X24 B;  2FL7 A;  2OTJ Q;  4ATO A;  2KRS A;  2L8D A;  2ZPE B;  4M7D G;  3GF5 A;  4ZNX A;  1OUL A;  3BDL A;  2RI3 A;  4PJO A;  5GMK i;  1PM3 A;  3C94 A;  1M2V B;  2QDY B;  2DL8 A;  1WQ7 A;  3PIP A;  8AT1 B;  2CP7 A;  2VKN A;  4JJN K;  4FCY A;  4J9C A;  3EGD A;  1LVK A;  2RI2 A;  1XJW B;  4DOV A;  3G4S Q;  2EVR A;  5GMK j;  2JMC A;  3J81 E;  4CC7 A;  3CCV A;  3OW2 A;  2MAM A;  3EGU A;  4JS5 A;  1P92 A;  1BCM A;  5DY9 A;  3KFV A;  2KY9 A;  3P8H A;  1FWZ A;  2HKQ B;  2ED1 A;  3RKW A;  2V8J A;  1PC0 A;  1Q95 G;  2HBP A;  2CUB A;  1AD5 A;  3OB9 A;  2WSC E;  2BZ8 A;  2SRC A;  3I35 A;  5EG2 A;  5LJ5 e;  2QI2 A;  4M75 D;  3H0F A;  1X69 A;  5LJ5 d;  1QKX A;  4M7A E;  4ESR A;  3A98 A;  5DLO A;  3JB9 F;  1UFF A;  1AEY A;  2DTO A;  4M7D B;  3OW2 S;  1WHM A;  4L59 A;  3OYI A;  3FDR A;  2YUP A;  1UGV A;  3GBQ A;  3MP6 A;  4EMG A;  1K9M C;  4N4H A;  3UPU A;  3UAT A;  1VQ5 T;  5FU6 C;  2KEA A;  3QDF A;  3J80 E;  2ECZ A;  4JDS A;  1FXX A;  3G6E T;  4FYV B;  5GAN e;  1RAG B;  3BFM A;  5FRM A;  1QCF A;  3ZFJ A;  1ZUK A;  5FW9 A;  4CC2 A;  1K73 U;  5C0M A;  4EDU A;  2EYZ A;  2FRY A;  1VQO T;  1KQ1 A;  3N5B B;  2XDP A;  1G5V A;  4AFU C;  3ER0 A;  3A8M B;  1PRM C;  1QVG P;  3OYE A;  4HVV A;  2QEX Q;  1Q82 U;  4C8Q D;  1O9S A;  1M30 A;  1H64 1;  1Q86 U;  4RTW A;  1W2B P;  1M1F A;  2VC8 A;  1X6O A;  2NUZ A;  3BY7 A;  5A0D A;  2DBK A;  5GAM g;  1VQ4 T;  4QVD A;  3CCL T;  4IUR A;  4M78 E;  4M75 A;  3ULR B;  1K9A A;  3H41 A;  3E19 A;  2DO3 A;  3NTK A;  1MHN A;  1MND A;  4F7U B;  2EYX A;  4QW2 A;  1D1C A;  2F1L A;  2LMJ A;  4WCI A;  3CCE T;  1X6B A;  3L2V A;  3CC7 Q;  2DMO A;  2QQR A;  1RAH B;  1B34 A;  4J9G A;  1YWO A;  4XU1 A;  2M0Y A;  3HFN A;  3CC2 A;  4A4G A;  1RLQ C;  3REA B;  1K1Z A;  4PJJ A;  1KK7 A;  3M59 A;  1VQN Q;  2D6F A;  2JXB A;  3QSU A;  5KYX A;  1UJ0 A;  1GBR A;  3LGL A;  1OX9 A;  1M3C A;  2VXF A;  4LE9 A;  2EPD A;  2XKO C;  1RAC B;  1U1T A;  2OTJ A;  2MOX A;  2DRM A;  1NEG A;  3OYL A;  1TWB A;  4C8Q A;  3SWN B;  2A7Y A;  1NBE B;  1ZUY A;  3VS7 A;  4QVZ A;  1YJ9 Q;  4ZN1 A;  4JZ3 A;  1KD1 C;  1C1A A;  2PVO B;  1NYG A;  3A8O B;  4IUV A;  4N0A C;  2KBT A;  1WZO A;  3LYI A;  4ORZ A;  2E12 A;  3ME9 A;  2ENM A;  1UDL A;  1YIT T;  2CDT A;  3FB9 A;  2CP5 A;  3FIF A;  4M75 E;  1I5O B;  2QAS A;  1RLP C;  4OGC A;  1MMN A;  1M1G A;  1UGP B;  5D6W A;  2F5T X;  3VS4 A;  2DYB A;  2J7I A;  2YSQ A;  3I56 Q;  3QBY A;  4FT2 A;  5CQY A;  3E1S A;  2CZ0 B;  2EFI A;  1Y71 A;  2KI7 A;  3CPF A;  3OYM A;  3V8K A;  5GAM j;  1HSQ A;  3VV0 A;  1X2Q A;  1M1K C;  1NZ9 A;  5KCH A;  4MDX A;  4C5G A;  5IT9 E;  5FRN A;  4AG2 C;  2RM4 A;  1V76 A;  2RMO A;  5FU7 B;  4EPC A;  3GP8 A;  1I1J A;  2EIF A;  2H3E B;  4ELZ C;  2ED0 A;  1WQW A;  3S3N A;  4C8Q E;  1U8R A;  4D6W A;  1VIE A;  4Y28 E;  5GAN 2;  1ZA2 B;  3H9N A;  2FPF A;  1TOV A;  4IIM A;  2A37 A;  5LJ3 g;  1TS9 A;  5J39 A;  3QZ5 B;  1E6G A;  3BW1 A;  2CGH A;  4PKC C;  1NE8 A;  3CPW P;  2KK4 A;  5CKH A;  2F69 A;  2JS2 A;  2V26 A;  3KXT A;  2FPE A;  2K5L A;  2EGE A;  1OZ3 A;  1GFD A;  3FRN A;  1M90 R;  5CKE A;  2DD5 A;  2RH2 A;  1H3H A;  4LD6 A;  3R6N A;  2RJC A;  4JRP A;  1TG0 A;  1Y96 A;  4VUB A;  4PL6 A;  2NYS A;  2J6K A;  3EFS A;  4PFP A;  1MMG A;  2HQX A;  5KYW B;  2LT1 A;  3NTH A;  4J9B A;  4II1 A;  2FYK A;  3E9F A;  2X4X A;  4M78 G;  4M7A B;  4MZT A;  1I0C A;  2XD0 A;  2MMP A;  4J8O A;  1G83 A;  1TU0 B;  2D8J A;  2MPX C;  1LNX A;  3JB9 D;  5HK3 A;  2L3S A;  4HCB A;  1PHT A;  4J6W A;  2L3P A;  2PQW A;  1BIB A;  1WYX A;  4J5Y A;  1B3Q A;  3LLR A;  2KYM A;  3OBW A;  3OS5 A;  3OYG A;  8ATC B;  1JEG A;  4RTU A;  3O8V A;  1V29 B;  1W2B A;  1M4Z A;  2O01 E;  4BE2 A;  2VAS A;  1BBZ A;  5HY6 A;  5ECA A;  5GAN h;  3MCA B;  3QDR B;  3X20 B;  2QTV A;  4A4K A;  5I21 A;  2K5I A;  4OMN A;  2F2W A;  2DJQ A;  5GAN 6;  1YN8 A;  1OU9 A;  3G71 T;  1EIF A;  5DLQ E;  2EYW A;  2HNI A;  3X28 B;  3EGD B;  1G8X A;  1JB0 E;  2XU8 A;  2LQW A;  1MNE A;  3P8D A;  5GMK l;  3NMZ C;  4AFQ C;  2RJF A;  1W2B S;  1M90 U;  3R6O A;  2GNC A;  1I8F A;  2CYZ B;  5HK0 A;  1RAE B;  1I4K 1;  1ZSZ C;  1MUZ A;  4M78 B;  5LJ3 j;  1JXO A;  2DTI A;  3TU4 K;  4ZN3 A;  2D0Q B;  3WVD B;  1D1B A;  5CVI A;  1WXB A;  2IIM A;  2A36 A;  1UHC A;  3DB4 A;  2JW4 A;  3VRZ A;  2M16 A;  3J7A F;  2OTL T;  1Q7Y C;  5HKC A;  2BKD N;  2Y4Y A;  3EG9 B;  1AWJ A;  2LTO A;  1QQJ A;  1VQ8 T;  4QKU A;  4FIB A;  1E7O A;  4AG1 C;  2DJZ A;  3TCJ A;  1VQ5 Q;  1G3S A;  1MV3 A;  4DQ2 A;  1AVZ C;  3RNJ A;  3LGF A;  3G6E Q;  1VQ9 T;  3RDV A;  4JRI A;  4XU0 A;  4XTU A;  2V8I A;  5GMK e;  4Z02 A;  1M3B A;  1WPY A;  1M1K R;  2X4W A;  2J6O A;  2MWP A;  1VQO Q;  3NPF A;  3M56 A;  3QXE B;  3M0T A;  1UJY A;  3CCU A;  4C92 C;  1D09 B;  3HL8 A;  1O75 A;  2EYY A;  5D6X A;  3CCJ A;  2JM8 A;  1VQK T;  2LC4 A;  2COZ A;  4OB1 B;  1VQ4 Q;  2LX9 A;  1QP2 A;  3CCL Q;  2FHD A;  2JVV A;  1KC8 R;  1D0X A;  4R0K A;  4EIK A;  2EKH A;  3MET A;  3CMA T;  4LDW A;  2JN0 A;  1QP3 A;  1PSF A;  3CCE Q;  1D1A A;  1PG5 B;  4M75 B;  1YJN A;  3OYY A;  2C0I A;  1ZUU A;  4NOY A;  3QWX X;  4X34 A;  2DVE A;  4ZGD B;  1WHJ A;  4HT8 A;  1RAA B;  3LWI A;  1NG2 A;  4FW1 A;  5FWB A;  1FMK A;  1G3W A;  2O9S A;  3M0Q A;  1R8O B;  1VQL A;  5D6Y A;  1B34 B;  3JCM h;  2QA4 T;  4OVA A;  4E7I A;  2E64 A;  1V1C A;  3LWH A;  2C06 A;  2B8A A;  4X9D A;  4E7J A;  2M0O A;  3CCM T;  5KYX B;  3EFR A;  1AT1 B;  2LJ1 A;  1VQM A;  2OJ2 A;  4DEY A;  2DIG A;  1M8V A;  3CC4 A;  2DL5 A;  5KCO A;  3CME T;  4J7F A;  3CCS A;  3CPW A;  2KRO A;  3CEY A;  3A1P A;  2RQV A;  3E2U A;  1VQP T;  3RUX A;  2OAU A;  4C8Q B;  3PFS A;  4C5I A;  4LUD A;  4OP0 A;  2LT4 A;  3GPL A;  2DK3 A;  3HRS A;  2BZX A;  1VIF A;  5LL6 S;  1YIT Q;  3GNG A;  2QQ9 A;  1K0X A;  2X4Y A;  3V8J A;  4C0D B;  3A8G B;  3I55 T;  1KC8 U;  3MEU A;  4M78 D;  5GAO q;  4J9H A;  1VQ7 T;  5GAO m;  2P4T A;  2H8H A;  3CPW S;  2D8H A;  2DER A;  2DNU A;  1YHQ T;  3OYN A;  2MWO A;  2Y90 A;  4XTV A;  2FRW A;  4C92 F;  4IUU A;  4XU2 A;  1N6A A;  1VQ5 A;  2K4Y A;  2HAX A;  3L2U A;  2K3Y A;  4GBQ A;  3OY9 A;  1U06 A;  4L6V 5;  1Q7Y R;  4FYY B;  4J6Y A;  2A28 A;  2FZG B;  2KYB A;  2RHI A;  2VB6 A;  2EAY A;  3MEV A;  3HSB A;  1Q81 R;  4BUG A;  3VS3 A;  3VYG A;  5GAN 3;  1AZE A;  5FU7 C;  1ZX6 A;  4C0F A;  2VGN A;  5KE3 A;  2DET A;  2KXD A;  3CCR T;  4F04 B;  4M78 A;  1JO8 A;  3JCM X;  1HK9 A;  2BE7 D;  4X9C A;  4GY5 A;  3M0R A;  4KT0 E;  1SHG A;  5GAM e;  2AK5 A;  4XTY A;  4JLG A;  3S6W A;  2VGM A;  2DRK A;  5I22 A;  5KH6 A;  2ATC B;  3NGP A;  5GAM d;  3A8L B;  2DYI A;  2JJ9 A;  3EG9 A;  4PK4 A;  1JU5 C;  2RHU A;  1WX6 A;  1N8R C;  1MV0 B;  3TRE A;  5IAY A;  5IN1 A;  2KRM A;  2PVD B;  2X3X D;  4LXC A;  3CCE A;  2LNH B;  3DB3 A;  3EHQ A;  4LUE A;  4CC3 A;  5KYY A;  3QKJ A;  3G7Z A;  3DLL A;  4KGX B;  2RQU A;  2RK1 A;  2JUF A;  4A4E A;  4EMK C;  1IRX A;  2LX7 A;  4Z89 A;  2JTE A;  1Y96 B;  3CCQ T;  2EQJ A;  4OMP A;  1VQ6 A;  1YCY A;  3IQL A;  1KQS P;  1X27 A;  3BDU A;  2D1X A;  1BI1 A;  1D0Y A;  3WXM B;  2W0Z A;  5GAO p;  4QVC A;  4J7I A;  4LDU A;  1RAF B;  1TUD A;  4JS4 A;  1GCQ C;  4N0A A;  4DBF A;  1Y0M A;  4M77 C;  2HEQ A;  3EGX B;  1W6X A;  1QLY A;  1Q81 U;  2CZ1 B;  2ZPB B;  2ZPF B;  3VRY A;  2P0K A;  3V7S A;  9ATC B;  3JB9 G;  4LDV A;  1JJ2 A;  4AT1 B;  3G71 Q;  3L2Q A;  2RQT A;  2KQW A;  5CCA A;  3OYD A;  4LN2 A;  2DXT A;  3OYC A;  2KE9 A;  4QQ6 A;  1JRI A;  2X4J A;  1OPK A;  4HKE A;  3ASK A;  1K4U S;  3CCV T;  1BCO A;  2AHJ B;  1WXT A;  4KBM B;  3OYK A;  1ZHI A;  1FYN A;  5CKB A;  4PJO C;  1K8A R;  3SEM A;  4ANJ A;  5GAM f;  2LZ6 B;  2YRC A;  2EW3 A;  1N5Z A;  4GLK A;  4D8D A;  2P4R A;  2RHZ A;  1A0N B;  3OQ5 A;  5KE2 A;  5CAI A;  1JJ2 S;  2EWN A;  2E3I A;  4FM4 B;  5LJ5 g;  4BE0 A;  4J6X A;  4B9X A;  2OTL Q;  3THK A;  2DF6 A;  1VQ8 Q;  2BTT A;  3OS1 A;  3CD6 T;  2RO0 A;  4BE1 A;  2DEU A;  1QMC A;  4LDY A;  2LVM A;  1VQ9 Q;  1BKB A;  3FLG A;  5L8R E;  3GNF B;  3V8L A;  4XU3 A;  3VYH B;  1UTI A;  1OU8 A;  1FMV A;  1M8M A;  2E3H A;  3KBG A;  4DBQ A;  2QQB A;  5GAN g;  2JS0 A;  2KR3 A;  2COY A;  5DM7 R;  1OOT A;  3INZ A;  2DTH A;  4EMH A;  4E7Z A;  3CBP A;  4A4F A;  2DFU A;  4PLI A;  1VQK Q;  5J3B A;  1C6V X;  1UEC A;  2X35 A;  5LJ3 e;  4R55 A;  3G4S A;  2J6F A;  1E6H A;  2F5K A;  1NJI C;  2LCS A;  5LJ3 d;  2AT1 B;  1RI0 A;  2VYT A;  1K0S A;  5EC7 A;  3VS6 A;  2ZGW A;  4JRQ A;  1SHF A;  4RTY A;  1K8A U;  1QWE A;  3CMA Q;  1TTH B;  4NL3 A;  3QPH A;  2QTX A;  2KAF A;  1G3Y A;  1AZG B;  2HL5 C;  5A0L A;  2OAW A;  4L5G A;  3QYG B;  2EYQ A;  3PMT A;  3VS1 A;  4PFZ A;  2KDS A;  4E7H A;  4OGE A;  1R0B G;  1ZBJ A;  4Y91 A;  4N4I A;  5M9O A;  4M77 F;  2DPP B;  3OS2 A;  2XHC A;  1AWW A;  2A0F B;  5GAO n;  5FWC A;  4M75 C;  1N8R R;  2DX1 A;  2QQA A;  2QA4 Q;  2I2L A;  3CXC P;  1EFN A;  1MMD A;  2LJ0 A;  1IHW A;  5FLX E;  3VUZ A;  4OMF B;  5LJ5 j;  3CCM Q;  2O4X A;  1NEB A;  4OMO A;  1K9M R;  2DZ9 A;  1YIJ T;  1N9S A;  4PJO F;  1SF9 A;  1WIE A;  2EQM A;  3CME Q;  3CBM A;  1RAB B;  1G3T A;  2LQK A;  3M0S A;  1VQP Q;  4JUV A;  1OV3 A;  2QEX A;  4DOW A;  2GBQ A;  4JJB A;  1GXI E;  2K9G A;  5IHI A;  1I5L A;  2KSS A;  5LJ3 f;  4FYX B;  2RA2 A;  1BI0 A;  4E47 A;  1VOM A;  2HMA A;  3I55 Q;  2D0N A;  5GAN j;  1YI2 T;  2R57 A;  4HT9 A;  2EJ9 A;  1M2O A;  4C8Q C;  1SEM A;  1VQ7 Q;  2MF2 A;  2L0A A;  1SG5 A;  1RUW A;  3JCM J;  3JCM c;  3HKS A;  2E41 A;  2L3Q A;  3CC7 A;  1I07 A;  2GGR A;  5LJ5 h;  1YHQ Q;  3M58 A;  1KJW A;  2IVW A;  1DJ7 B;  3JCM g;  2EQK A;  4JJD A;  2QDL A;  4BAC A;  2X9H A;  2QG9 B;  3EGX A;  3SB2 A;  6AT1 B;  1VQN A;  1UEB A;  1QVG A;  3FC3 A;  2ROT A;  3PTA A;  4C0G A;  1KG1 A;  5GJV B;  2XID A;  2Y4X A;  2QGF B;  1K9M U;  1FMW A;  2XDB A;  1QVF P;  3NTI A;  4KGZ B;  2HSP A;  4RCB A;  3JCM V;  3MEW A;  2CP2 A;  1QWF A;  3RBB B;  1YJ9 A;  3C0C A;  2DL3 A;  1IB8 A;  1YBY A;  1SRL A;  3CCR Q;  3I5S A;  1YJW Q;  1U3O A;  1QVG S;  1NLO C;  1WLP B;  2K2V A;  3EHR A;  1YFN A;  3O5Z A;  2MCN A;  1AWX A;  3G1J A;  4DA4 A;  1XNI A;  3QYH B;  1KD1 R;  4Z8A A;  2DIQ A;  2FZK B;  2OI3 A;  3EG2 A;  2J05 A;  1SPK A;  1N9R A;  4F14 A;  3I56 A;  2LRQ A;  4BI8 B;  3RR6 A;  2RNA A;  1PCX A;  5CIU A;  3CCQ Q;  4HCC A;  5KYY B;  2K79 A;  2CZ6 B;  4M7D C;  2M1H A;  1K76 A;  2NWM A;  4ZTF A;  4DEX A;  1TUG B;  4PLL A;  4NS5 A;  1BYM A;  1GFC A;  3MP8 A;  1K73 C;  4C92 E;  1BIA A;  2RHY A;  2AZS A;  2QAZ A;  2YLB A;  4AMC A;  3OYH A;  4E7L A;  1S72 T;  3JRZ A;  1Q82 C;  4FT4 A;  4MMK A;  2G6F X;  2LCC A;  2O88 A;  1Q86 C;  4BI3 A;  2EQI A;  4KH1 B;  3M53 A;  2FVU A;  2F2V A;  2JM9 A;  2WSF E;  1LPL A;  4LDX A;  2PZ1 A;  1VQP A;  1JXM A;  3PVQ A;  3CCV Q;  4IUQ A;  1WHH A;  4J9D A;  2KT8 A;  4YTL A;  1KD1 U;  2Z0W A;  1M3A A;  2DVJ A;  1J3T A;  3DKM A;  1LOJ A;  3PT9 A;  1VQ7 A;  2LJ3 A;  2RQW A;  4KGV B;  3I5R A;  1G2B A;  1IRE B;  1PKT A;  2K5F A;  2JMA A;  3MO8 A;  4N4G A;  2M9U A;  4J9I A;  2I0N A;  4QT7 A;  3CXC A;  3L1A A;  4JLI A;  4AFZ C;  2KT1 A;  1OI1 A;  3FJP A;  1YHQ A;  3CD6 Q;  3AHU A;  2PNI A;  4K11 A;  3UDC A;  1ZA1 B;  2MI6 A;  4MML A;  1D3B B;  1OQK A;  1UGR B;  3NFC A;  1M1K U;  2YUO A;  4FYW B;  5L23 A;  2LQN A;  3D7S B;  2LNV A;  1M27 C;  2MIO A;  1HD3 A;  3HP9 A;  5AYF A;  2JNG A;  4V2S A;  3CXC S;  4HVW A;  4WF2 A;  1SKU B;  1ZLM A;  2JZ2 A;  1R0C B;  5IHN A;  2P84 A;  2K6D A;  4LNP A;  1KQ2 A;  4NL2 A;  4DBH A;  3SWN C;  3CCU T;  1WHK A;  2M02 A;  2VUB A;  2YT6 A;  3H8Z A;  4RG8 A;  2RK2 A;  2FZC B;  4RTZ A;  4BB7 A;  3CCJ T;  2VXE A;  2XIC A;  3UA7 A;  2X51 A;  5CKD A;  2F2X A;  1TSF A;  2CP3 A;  4EMK A;  2HDA A;  4M7D F;  1CKB A;  3L2Z A;  4E7K A;  2CS7 A;  1IGQ A;  3TEE A;  2MYS A;  3HPW A;  3OS0 A;  1UGS B;  3C4S A;  3JV3 A;  3VKI A;  1M5Q 1;  1KSW A;  1YJN T;  3LH5 A;  2YXY A;  1NYF A;  4M77 A;  1Z9Q A;  1LJO A;  2HCK A;  5AT1 B;  4OB3 B;  3QHS A;  5GAN 4;  1QVF A;  3CCQ A;  2BUD A;  1KHI A;  3MEA A;  4UC4 A;  3LW5 E;  4OB2 B;  1WA7 A;  1N27 A;  4JRK A;  2EKO A;  4A53 A;  1VQL T;  3G6E A;  4FW2 A;  1S1N A;  3VUB A;  3M0P A;  1YIJ Q;  1HYO A;  5IXB A;  1TUC A;  2CSQ A;  2B86 A;  1X75 C;  4Q5W A;  2RJD A;  4MZM A;  3PNW C;  1ABQ A;  2R5A A;  2KRN A;  1VQO A;  2E1H A;  1VQM T;  2KVQ G;  5KYU A;  3WVE B;  2O4X B;  1T0J A;  1B7T A;  2XMF A;  4PJN A;  3CC4 T;  3CBO A;  4BD3 A;  1K73 R;  3CCS T;  1HXD A;  1QW1 A;  1QVF S;  1YJW T;  4OMQ A;  1OPL A;  2CRE A;  4F7U F;  2NUT A;  4C92 G;  1GBQ A;  3EFO A;  2ZPI B;  3M5A A;  1VQ4 A;  1Q82 R;  3CCL A;  1UB4 A;  1YI2 Q;  3T9N A;  1GCP A;  2R58 A;  4ZTJ A;  4OML A;  2PVG B;  4O6J A;  1Q86 R;  1X01 A;  3A8H B;  4Y92 A;  1BK2 A;  1ZSZ B;  5A2Q E;  2V8K A;  3OBY A;  4FL6 A;  1ZSG A;  2VWF A;  4PNO A;  2GF7 A;  3OYF A;  4XQ3 A;  1UHF A;  5GAN 7;  4XTX A;  4BDZ A;  5IHK A;  2KMT A;  2GTJ A;  2ZPG B;  2W10 A;  2IPO B;  2E5Q A;  2DL4 A;  2L89 A;  1PNJ A;  1XTD A;  2AZV A;  1KFZ A;  4M77 E;  1M9S A;  2FB7 A;  3AT1 B;  4F7U G;  4JJC A;  3CD6 A;  3ZBD A;  4QQG A;  2COW A;  3HFO A;  3TSW A;  2RPN A;  3OSS C;  4M7A C;  1Q7Y U;  4P5N A;  7AT1 B;  2GTO A;  1W1F A;  1FX7 A;  2DEQ A;  3L2R A;  3JCM P;  5GMK h;  4C92 B;  4F16 A;  2FPD A;  4PJO E;  4B6M A;  1C0M A;  2YDL A;  5GAN d;  2QK0 A;  1ABO A;  4C5H A;  1YNZ A;  4A4H A;  5GMK m;  5J26 A;  3V7C A;  1IXD A;  3PVL A;  3TQ7 P;  4JZ4 A;  3OYJ A;  1YIT A;  1M90 C;  5FRO A;  2RN8 A;  4IUT A;  3OSV A;  1UE9 A;  3JB9 I;  1D0Z A;  1X43 A;  1VYV A;  3RMS A;  2D9T A;  3PE0 A;  4FSX A;  2V1Q A;  3RKX A;  1H8K A;  3REB B;  1WHG A;  1XOV A;  1ACM B;  1YCS B;  3RES A;  1D3B A;  1ZBX A;  3OMC A;  2XK0 A;  4M78 C;  5LJ5 f;  3JCM Q;  1UUE A;  4WTO B;  1UGQ B;  2OX7 A;  2CT4 A;  4RTX A;  4FSS A;  3P8B B;  5KYN A;  2BE9 B;  5CR2 A;  1VQ6 T;  1S72 Q;  2JT4 A;  1GL5 A;  1NLP C;  1YIJ A;  2GQI A;  3F70 A;  2DZC A;  2E4H A;  3URG A;  3M57 A;  3TSZ A;  5GAN f;  1XQH A;  1WFW A;  4RCC A;  3S3M A;  4BY6 B;  2CP6 A;  4IIO A;  4XAX B;  1Y7X A;  1WJQ A;  3E9G A;  2DXC A;  3X25 B;  4ZGJ B;  2NUP A;  3SDZ A;  1TXQ A;  3UF4 A;  1W4S A;  2EBP A;  5GAN 5;  2AKK A;  4X1V A;  4DBR A;  1R77 A;  1YI2 A;  1EX4 A;  4JPB W;  2K3B A;  4BI4 A;  4M7A F;  1IHV A;  3FEO A;  2K7A A;  2C0O A;  2IG0 A;  2DKG A;  5GAO r;  2E10 A;  1SSF A;  3CC2 T;  2AKL A;  1OYX A;  3JCM W;  4M7D D;  4J9F A;  3JCM b;  5I2S A;  3JCM e;  5I2M A;  5GAO l;  2RB6 A;  3UA6 A;  4RKU E;  1CSK A;  4E6R A;  2YLC A;  3JCM d;  2P0P A;  4KUL A;  1QCO A;  2DL7 A;  3HHT B;  3OYA A;  2E65 A;  4KH0 B;  4FU6 A;  2LQ8 A;  1PRL C;  3H0I A;  1M2V A;  2L2P A;  1PSE A;  4J83 A;  2OTJ T;  4C92 D;  5CO7 A;  3FJ5 A;  1RI9 A;  2CUD A;  1AWO A;  4XK8 E;  5IXF A;  4OB0 B;  4M7A G;  1OEB A;  2ZCF B;  4M77 G;  4A63 B;  3C12 A;  4HCK A;  3CCU Q;  1ZSZ A;  2A08 A;  4KRT A;  1KC8 C;  3G71 A;  3QO3 A;  3CCJ Q;  1WGS A;  3HTR A;  1RAD B;  3G4S T;  4M78 F;  2CSI A;  4LD9 K;  3EG1 A;  2RF0 A;  4HXJ A;  2CZ7 B;  3M4G A;  5I11 A;  2L5Q A;  4A54 A;  5CK9 A;  1U5S A;  1YP5 A;  2XDD A;  2KXC A;  2ZZD A;  4TVR A;  5GAM h;  4C0D C;  4PJO G;  2EJF A;  4CC4 B;  2X3W D;  2AIR B;  3Q1J A;  3EH2 A;  4M7D A;  1X6G A;  1KQS A;  1VYT A;  2ABL A;  1IZ6 A;  1YJN Q;  4EMK B;  1Z9Z A;  1WJS A;  3I9Q A;  2OTL A;  1X2K A;  2CH4 W; 
#chains in the Genus database with same CATH homology
 2EPD A;  1ZX6 A;  1M3A A;  2E5K A;  2DVJ A;  2MOX A;  2DRM A;  2KXD A;  1NEG A;  1J3T A;  4HVU A;  1JO8 A;  2LJ3 A;  1W70 A;  2RQW A;  2FO0 A;  1PWT A;  1ZUY A;  3I5R A;  5GJW B;  1G2B A;  3M0R A;  2YUQ A;  1PKT A;  3VS7 A;  2JMA A;  1SHG A;  2AK5 A;  4J9I A;  2I0N A;  4QT7 A;  2DRK A;  5I22 A;  4JZ3 A;  4AFZ C;  3NGP A;  1AOJ A;  1NM7 A;  2KT1 A;  4RTV A;  2DBM A;  1NYG A;  1JU5 C;  1WX6 A;  1MV0 B;  2PNI A;  2DE0 X;  2KBT A;  4K11 A;  2KRM A;  2X3X D;  2YUN A;  2LNH B;  4ORZ A;  3EHQ A;  4LUE A;  2ENM A;  1UDL A;  1BB9 A;  4CC3 A;  2CDT A;  2V1R A;  1UG1 A;  2YUO A;  2RQU A;  5L23 A;  2LQN A;  1M27 C;  2DA9 A;  2MIO A;  1RLP C;  4F17 A;  2LX7 A;  1HD3 A;  2FG0 A;  2C0T A;  2JTE A;  4Z89 A;  2FEI A;  3VS4 A;  4OMP A;  1SRM A;  2BZY A;  2DYB A;  4HVW A;  1ZLM A;  2J7I A;  3VS5 A;  5IHN A;  2YSQ A;  3IQL A;  1X27 A;  2D1X A;  2K6D A;  4LNP A;  2W0Z A;  2RQR A;  1B07 A;  1Y57 A;  1HSQ A;  3TVT A;  1TUD A;  2YT6 A;  1X2Q A;  2HBW A;  1GCQ C;  1Y0M A;  4RTZ A;  1QKW A;  2HEQ A;  1W6X A;  1QLY A;  3EG3 A;  3UA7 A;  2KGT A;  3VRY A;  2F2X A;  4AG2 C;  2VVK A;  2HDA A;  2DIL A;  1CKB A;  2RMO A;  1I1J A;  2RQT A;  2CH4 A;  4LN2 A;  2ED0 A;  1IO6 A;  2KE9 A;  3NHN A;  1OPK A;  1K4U S;  3JV3 A;  2EGA A;  1KSW A;  1WXT A;  1FYN A;  2FPF A;  4IIM A;  2K2M A;  3SEM A;  2ROL A;  2LZ6 B;  2A37 A;  3LH5 A;  2EW3 A;  3VS0 A;  1GRI A;  1NYF A;  1Z9Q A;  1N5Z A;  2HCK A;  4D8D A;  2P4R A;  1A0N B;  1E6G A;  3M0U A;  3SHW A;  1WA7 A;  4Z88 A;  2JS2 A;  3U23 A;  2FPE A;  1S1N A;  3THK A;  3M0P A;  2DF6 A;  2EGE A;  5IXB A;  3QWY A;  1SSH A;  1TUC A;  2CSQ A;  1GFD A;  4OMM A;  2B86 A;  2CT3 A;  2BTT A;  2KNB B;  3H0H A;  1ABQ A;  1H3H A;  3R6N A;  1CKA A;  2KRN A;  2PTK A;  4GLM A;  1TG0 A;  1T0J A;  2XMF A;  3CQT A;  2J6K A;  1WXU A;  1UTI A;  2EGC A;  4OMQ A;  2M51 A;  1OPL A;  2CRE A;  1M8M A;  1T3S A;  1LCK A;  4J9B A;  4M4Z A;  1H92 A;  1GBQ A;  5IH2 A;  1I0C A;  4RUG A;  2JS0 A;  2KR3 A;  1OOT A;  1GCP A;  4OML A;  1G83 A;  1ARK A;  2D8J A;  4Y92 A;  2O2O A;  1BK2 A;  2L3S A;  1BU1 A;  1UEC A;  1PHT A;  1ZSG A;  2VWF A;  2L3P A;  4AFS C;  1JQQ A;  1WYX A;  2J6F A;  3EG0 A;  1B3Q A;  1E6H A;  2KYM A;  2ESW A;  2LP5 A;  2LCS A;  4RTU A;  1JEG A;  1K0S A;  1UHF A;  1KIK A;  5EC7 A;  3VS6 A;  5IHK A;  1T3L A;  1SHF A;  1VA7 A;  4RTY A;  1BBZ A;  2GTJ A;  2W10 A;  1QWE A;  5ECA A;  2DL4 A;  2DM1 A;  1AZG B;  1YWP A;  1PNJ A;  4J9E A;  2OAW A;  2AZV A;  2O31 A;  4OMN A;  2F2W A;  1KFZ A;  2DJQ A;  1YN8 A;  3VS1 A;  4RTT A;  2EYW A;  4JJC A;  3TSW A;  1ZBJ A;  2RPN A;  1HJD A;  2GTO A;  1W1F A;  2LQW A;  1AWW A;  3NMZ C;  4AFQ C;  1PKS A;  1WDX A;  5FWC A;  2GNC A;  1MUZ A;  4F16 A;  2DX1 A;  1JXO A;  2FPD A;  1VYU A;  1T0H A;  5HCK A;  1EFN A;  3VS2 A;  2LJ0 A;  2YDL A;  1WXB A;  2IIM A;  2A36 A;  3ZL7 C;  1UHC A;  4D8K A;  2JW4 A;  1ABO A;  3VRZ A;  1YNZ A;  1NEB A;  4OMO A;  1AWJ A;  2DLP A;  1E7O A;  4AG1 C;  2J06 A;  1WIE A;  3PVL A;  4JZ4 A;  1MV3 A;  1AVZ C;  2RN8 A;  3RNJ A;  1GCQ A;  1UE9 A;  2O9V A;  1X43 A;  1VYV A;  3M0S A;  3PE0 A;  1OV3 A;  2V1Q A;  1WI7 A;  1H8K A;  3REB B;  2SEM A;  2GBQ A;  1M3B A;  4JJB A;  1XOV A;  2K9G A;  5IHI A;  1YCS B;  2J6O A;  3NPF A;  3M0T A;  2D0N A;  1UJY A;  2KRS A;  1SEM A;  2EYY A;  4ZNX A;  1UUE A;  2L0A A;  2JM8 A;  1RUW A;  2CT4 A;  4RTX A;  4FSS A;  2L3Q A;  1I07 A;  2DL8 A;  2GGR A;  4R0K A;  4EIK A;  2EKH A;  1KJW A;  2VKN A;  4J9C A;  2JT4 A;  4JJD A;  2QDL A;  2EVR A;  1GL5 A;  2JMC A;  1NLP C;  4CC7 A;  3EGU A;  2GQI A;  3KFV A;  2C0I A;  1ZUU A;  3TSZ A;  3QWX X;  2ED1 A;  2ROT A;  1WFW A;  4IIO A;  1NG2 A;  5GJV B;  5FWB A;  2CUB A;  1AD5 A;  1FMK A;  2O9S A;  3I35 A;  2BZ8 A;  2SRC A;  2HSP A;  3M0Q A;  3UF4 A;  3H0F A;  1X69 A;  2EBP A;  1QKX A;  1QWF A;  3RBB B;  3C0C A;  2AKK A;  4X1V A;  4ESR A;  2DL3 A;  3A98 A;  1UFF A;  1AEY A;  1SRL A;  1V1C A;  4JPB W;  3I5S A;  2K3B A;  1U3O A;  2YUP A;  1UGV A;  2LJ1 A;  3GBQ A;  1NLO C;  1WLP B;  2OJ2 A;  3EHR A;  3O5Z A;  2MCN A;  4DEY A;  2K7A A;  1AWX A;  2C0O A;  2DL5 A;  3UAT A;  2KEA A;  4Z8A A;  2KRO A;  2OI3 A;  2ECZ A;  3EG2 A;  2AKL A;  2RQV A;  4J9F A;  4LUD A;  2J05 A;  1QCF A;  1SPK A;  3UA6 A;  1CSK A;  1ZUK A;  5FW9 A;  4CC2 A;  2BZX A;  4E6R A;  4F14 A;  1K0X A;  2DL7 A;  2EYZ A;  2FRY A;  4AFU C;  1PRL C;  3H0I A;  1PRM C;  2L2P A;  2RNA A;  4HVV A;  3FJ5 A;  1RI9 A;  2CUD A;  1M30 A;  4J9H A;  4RTW A;  2H8H A;  2K79 A;  1AWO A;  1K76 A;  2NUZ A;  5IXF A;  2NWM A;  2D8H A;  4DEX A;  2DBK A;  1OEB A;  1GFC A;  4A63 B;  4HCK A;  2DNU A;  3ULR B;  1K9A A;  3H41 A;  2AZS A;  2A08 A;  4KRT A;  2EYX A;  2FRW A;  2LMJ A;  4WCI A;  1X6B A;  2CSI A;  2G6F X;  3EG1 A;  2O88 A;  2RF0 A;  4HXJ A;  2DMO A;  5I11 A;  1U5S A;  1YP5 A;  2EQI A;  2F2V A;  1YWO A;  2JM9 A;  4J9G A;  2KXC A;  4GBQ A;  2M0Y A;  1U06 A;  2PZ1 A;  1RLQ C;  3REA B;  1K1Z A;  1JXM A;  4CC4 B;  2X3W D;  3PVQ A;  1X6G A;  2A28 A;  2KYB A;  1VYT A;  2ABL A;  2JXB A;  4J9D A;  3VS3 A;  1UJ0 A;  2KT8 A;  1GBR A;  1M3C A;  1Z9Z A;  3I9Q A;  1AZE A;  4LE9 A;  1X2K A;  2CH4 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...