1PKTA

Structure of the pi3k sh3 domain and analysis of the sh3 family
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Structure of the PI3K SH3 domain and analysis of the SH3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase
total genus 11
structure length 76
sequence length 76
ec nomenclature ec 2.7.1.137: Phosphatidylinositol 3-kinase.
pdb deposition date 1994-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pktA00
2AZSA 4Z88A 2KE9A 1KSWA 3EG3A 4J9FA 4AG1C 2DF6A 1PHTA 3I5RA 3H0HA 3R6NA 1VYUA 1U5SA 2M51A 4RTZA 1W70A 2CT4A 4LUEA 4OMPA 4F16A 1NG2A 4J9HA 2IIMA 2FPDA 4OMNA 2DL3A 1FMKA 2I0NA 2L3PA 2RMOA 1HSQA 1UFFA 4F14A 1N5ZA 4A63B 1AVZC 1XOVA 4DEXA 1IO6A 1AZGB 3GBQA 1AD5A 3REBB 3IQLA 2ECZA 2W10A 1SHGA 2GBQA 4LNPA 5FW9A 2EKHA 2A08A 1SRLA 1V1CA 1T0JA 4IIOA 1PKTA 1YP5A 3LH5A 1UTIA 2MIOA 2C0TA 5IXFA 2KBTA 4M4ZA 3I9QA 2GTJA 2EQIA 2K3BA 2LX7A 2W0ZA 1GFCA 3I35A 1K0XA 2K2MA 3KFVA 2HCKA 1BBZA 3CQTA 2DRMA 1TUCA 1WA7A 2FG0A 4ESRA 2RN8A 3UA6A 1E6GA 4D8KA 3QWXX 2OI3A 2KEAA 2YUNA 3TSZA 4RTYA 2LMJA 3ZL7C 2DBKA 1E7OA 1MUZA 4AFSC 4ORZA 2J7IA 2F2WA 5FWBA 3M0TA 1X6GA 2BTTA 2C0OA 2GQIA 2ED1A 2CH4W 2DL4A 1PRLC 2KT1A 2FRYA 1UHFA 3NMZC 1WIEA 1OPLA 4HVVA 4JPBW 2YUOA 2GGRA 2CUDA 3NPFA 2BZYA 2HSPA 2CT3A 2KT8A 1MV3A 3NGPA 4HVUA 2EW3A 4J9EA 2L2PA 1J3TA 2LJ1A 4AFZC 4IIMA 2LP5A 2RQTA 1I1JA 2DM1A 2DRKA 4CC2A 1CSKA 4WCIA 1PKSA 1JEGA 1U06A 1ZUKA 4LUDA 3UA7A 2LJ3A 3VS1A 3JV3A 3VS3A 1GRIA 2EYWA 2KRSA 1E6HA 1JO8A 4AFQC 2LCSA 2KYBA 1QWEA 1JXOA 1NYGA 4J9DA 1GBRA 1JU5C 1QCFA 2O31A 1ZX6A 1X6BA 1AWJA 1H8KA 1NYFA 2KYMA 1M30A 2H8HA 2EVRA 4GLMA 2DJQA 2B86A 2K9GA 2EYZA 1SSHA 2K6DA 4AG2C 2RQWA 1I0CA 1M3CA 4K11A 4Z89A 2FEIA 2J06A 4JJCA 2ROLA 1WLPB 3VS0A 1AWWA 2DBMA 4RTVA 1SRMA 1K76A 1BB9A 2CREA 1HD3A 1ZUYA 2DA9A 2O9VA 4HXJA 2JM8A 5FWCA 3EGUA 1X69A 4CC3A 5EC7A 3SEMA 2J6KA 1EFNA 2J6FA 2CUBA 1LCKA 3M0RA 4QT7A 2EGCA 2EYYA 2HEQA 1SEMA 2DL5A 4Z8AA 1AWXA 1WDXA 2EBPA 2DLPA 2A37A 4OMQA 1M3BA 2C0IA 1T3LA 2V1QA 1GCPA 1Y57A 1WI7A 1KIKA 1OPKA 2JXBA 2PNIA 2ROTA 2DNUA 4Y92A 1KJWA 4E6RA 3VS5A 3O5ZA 3VRZA 1JXMA 4J9GA 1AOJA 2D1XA 2M0YA 1UJYA 3EG1A 1BK2A 4LE9A 1M8MA 2DL7A 2LJ0A 3VS6A 1CKBA 2BZ8A 2VVKA 2SRCA 2KROA 1X27A 2AKLA 2ENMA 2RQVA 2L0AA 1H3HA 1NEBA 1NLPC 2NUZA 2V1RA 3NHNA 2VKNA 1QKWA 4RTXA 1AZEA 4CC4B 1Z9QA 1QWFA 3I5SA 1FYNA 1YN8A 4RTUA 2GNCA 2PTKA 3UATA 3ULRB 3VS2A 2JS0A 2D8JA 2EGEA 1OEBA 3VS4A 4KRTA 2F2VA 3RBBB 2AZVA 4RUGA 1QKXA 3VS7A 1ZBJA 2FPFA 2JS2A 3A98A 4F17A 1WXBA 1OV3A 1G83A 1S1NA 1WX6A 1ABOA 2J6OA 1SPKA 1PRMC 2RQUA 1K1ZA 2VWFA 1ZUUA 1H92A 1GCQC 3M0UA 1M3AA 4JJDA 1UDLA 2ED0A 2HDAA 4X1VA 1UGVA 2LQWA 3THKA 2FRWA 1UUEA 3SHWA 4JJBA 2SEMA 4RTWA 4OMOA 1Y0MA 1KFZA 1VA7A 2DX1A 1RLPC 1WYXA 2EYXA 2LNHB 3M0PA 2O88A 1YWOA 2O2OA 3RNJA 3EHQA 3C0CA 1ZSGA 2YSQA 2G6FX 1YWPA 5IHIA 2JW4A 2MCNA 3H0IA 2EPDA 2KRNA 2FO0A 1ZLMA 5GJVB 1RI9A 1B07A 4D8DA 2KGTA 3PE0A 5IHNA 1X2KA 1NEGA 1WXUA 2DE0X 2KXDA 3EG2A 5HCKA 2MOXA 4AFUC 1CKAA 2X3WD 2ESWA 2KRMA 1Z9ZA 5IHKA 2GTOA 1K4US 3M0SA 2JMAA 1BU1A 3TVTA 1YNZA 1M27C 2K79A 4OMMA 4HCKA 2AKKA 2NWMA 2AK5A 2RF0A 4J9IA 1T0HA 4CC7A 2LQNA 3U23A 5L23A 2OJ2A 1K0SA 2A28A 2OAWA 4EIKA 3EG0A 2JTEA 1I07A 1UG1A 5I22A 2DILA 1TUDA 2DL8A 2J05A 3PVLA 1PNJA 1TG0A 3VRYA 4RTTA 1HJDA 2RNAA 2DMOA 5IH2A 1JQQA 2L3QA 2FPEA 2A36A 3H0FA 1NLOC 1UHCA 1VYTA 3UF4A 2D8HA 1WXTA 1VYVA 2EGAA 1OOTA 2QDLA 2YUPA 3TSWA 3EHRA 4JZ3A 1UECA 2L3SA 1U3OA 1K9AA 2CH4A 1X43A 2F2XA 3H41A 2BZXA 2JMCA 1X2QA 2PZ1A 1AEYA 1SHFA 4LN2A 2XMFA 2DYBA 1GBQA 4JZ4A 1W1FA 1GFDA 2KXCA 1MV0B 3FJ5A 4FSSA 5ECAA 4DEYA 4HVWA 1NM7A 4ZNXA 1GL5A 4OMLA 2CSQA 2CDTA 1T3SA 2RQRA 4GBQA 2E5KA 4R0KA 1PWTA 1W6XA 2K7AA 1UJ0A 3REAB 5IXBA 1A0NB 1AWOA 2YUQA 5GJWB 2CSIA 2HBWA 2YDLA 1QLYA 2DVJA 2P4RA 2O9SA 2D0NA 1RUWA 2RPNA 1ABQA 4J9BA 4J9CA 2ABLA 5I11A 1ARKA 2JM9A 1YCSB 2LZ6B 2KR3A 2KNBB 3PVQA 2JT4A 1UE9A 1B3QA 1G2BA 3M0QA 2YT6A 1WFWA 1RLQC 1GCQA 3QWYA 2X3XD
chains in the Genus database with same CATH superfamily
4LDYA 3HKSA 4IUTA 3EG3A 4AG1C 4BE1A 2DETA 3X26B 2AIRB 3H0HA 4FIBA 1VYUA 4OB2B 3V8JA 5CKHA 3V7RA 3M5AA 4F16A 4KULA 4DBFA 4GY5A 1YITT 4Z02A 1YITQ 4OMNA 5FRNA 3MHXA 2IPOB 2JN0A 2L3PA 1I5LA 3NFCA 2OTLA 2JNGA 2NLUA 4AMCA 1RADB 3BDUA 3QZ9B 3OYBA 5FW9A 2WSFE 1RL2A 3KXTA 1SRLA 1V1CA 1PKTA 1H641 1YP5A 3A8MB 1X01A 1UTIA 3JB9J 1VQ4A 2YLBA 5IT9E 4HCBA 1VQ9T 4FT2A 1VQ9Q 2W0ZA 4HT9A 3I35A 3GPLA 2EIFA 2Y4XA 3JCMb 2HL3A 3FLGA 1TUCA 3HHTB 4AT1B 3HSBA 5CR2A 2YUNA 4QKUA 3TSZA 5KCOA 2CP5A 2LMJA 2X35A 1K9MR 1TH7A 2K2VA 2ED1A 4N4IA 4ME7A 2KT1A 2DK3A 3O8VA 2CZ6B 3JSCA 4HVVA 4NOYA 2DPPB 2VXEA 4E7SA 1Y71A 4C8QE 3JB9F 4D6WA 4LD6A 5LJ3e 1OI1A 3CCVT 2EW3A 4PJOD 4J9EA 1W2BP 3RIRA 2LP5A 3CPWP 3QPHA 1I1JA 3F70A 2DRKA 4CC2A 1CSKA 1PKSA 4HT8A 4ZGJB 1ZUKA 2COWA 2ZPHB 4ZTFA 3CCLT 3VS1A 3CCLQ 1GRIA 2KRSA 3TEEA 4M7DD 1M90R 3OY9A 4AFQC 2KI7A 4M7AE 3ZBDA 1GBRA 2O31A 1WHHA 3MEAA 1M30A 5KYUA 4PJNA 4HA8A 3AT1B 1RAAB 5CCAA 1K9MU 2QEXA 2ZPIB 4AG2C 2RQWA 3EAEA 4DBRA 1I0CA 3OYCA 4JLIA 3JRZA 3MP6A 1FXXA 4ELZC 3GOXA 4JJCA 3JCMP 2CP6A 1WLPB 3DKMA 3VS0A 3CCEA 4C5EA 4E7KA 3URGA 2DXUA 2VV5A 3HRSA 2CREA 2XU8A 4RMOA 1ZUYA 2O9VA 4FCYA 5FU6C 2FHDA 2BE7D 3OYDA 4B9WA 2J6FA 2DEQA 1U1SA 3CC2A 4V2SA 1B34A 3C4SA 2EGCA 1M90U 4PJOC 3FDRA 2JZ2A 4M78G 1AWXA 3MJXA 2KAFA 3OYYA 2COZA 5GAN3 2DLPA 2E1HA 2EQMA 3QHSA 5HKCA 3CD6A 4JDSA 3RR6A 1YIJA 4M7DC 3L2VA 3OB9A 4A4HA 1VQ7T 1VQ7Q 3EGXA 3I56T 1OPKA 4Y92A 2DXCA 3VS5A 4KBMB 1LNXA 1VQKT 4DBHA 1VQKQ 1U1TA 1YJNA 2JUFA 4OGCA 2E6ZA 4X9DA 2QI2A 2M0YA 1M2VA 5GAN7 1M8MA 2DL7A 2VVKA 4DQ2A 2SRCA 2KROA 4BACA 4M78A 2RHUA 1H3HA 2E6NA 1N8RU 5L8RE 2M02A 1K73C 2VKNA 1QKWA 1OX9A 3C94A 1AZEA 3G1JA 3TREA 1Z9QA 3JB9I 1FYNA 1YN8A 2JS0A 4J83A 2CP0A 1OEBA 2AZVA 3PMIA 3A98A 4F17A 4O6JA 1OV3A 2KVQG 4QW2A 3QDRB 1RACB 3OS5A 4M77B 4M75E 1K1ZA 4PNOA 1D0YA 2QQRA 1UGPB 2JTMA 1K8AC 3M59A 4JJDA 3TCJA 3HP9A 1UDLA 1UGVA 2GQVA 4KGZB 4ZN3A 4J8OA 3MEVA 1D09B 1UUEA 3SHWA 5DM7R 1H3ZA 1Y0MA 3X24B 2LX9A 4C8QF 4ZGEB 1VQ4Q 3M57A 3A8OB 1WYXA 1D3BB 5CKBA 5GAMd 5GAOl 3CCSA 2PVGB 3BY7A 1M1GA 2JW4A 5IHIA 1WJQA 1B07A 1KHIA 4D8DA 2KGTA 1X2KA 5C6SA 4PLLA 2M9UA 1YI2T 2KXDA 1YI2Q 3OYKA 4X9CA 1CKAA 3QYHB 2ESWA 4M7AF 5IHKA 1K4US 3M0SA 1QW1A 3JCMh 2I2LA 3CMAA 1G3WA 1M27C 4QVDA 1WHJA 1OX8A 3D7SB 2NWMA 2AK5A 2FYKA 1T0HA 1IXDA 2K5IA 2QG9B 4M7AG 1KK7A 1C0MA 4EIKA 1I07A 2QA4A 3X25B 4PJJA 1JRIA 2J05A 1PNJA 4XK8E 3VRYA 4C8QA 4RTTA 1IHWA 2DXTA 1VQ6T 1UGSB 2DMOA 1VQ6Q 3CCRA 2FPEA 2XKOC 1EZZB 3JCMX 2A36A 5KH6A 1R0CB 2FB7A 3M4GA 1UHCA 1VYTA 1WXTA 2PQWA 2EGAA 2LT1A 2QDLA 5D6WA 3VYGA 2L3SA 2E4HA 2YRDA 3MCAB 1TTHB 1MMNA 3CMEA 2V26A 5GMKi 3L42A 3CCMA 4PLIA 1JB0E 4M7AA 1X2QA 2PZ1A 2QEXQ 4ELYC 4O5VA 4FW1A 3OYNA 3MEUA 1W1FA 2MYSA 1GFDA 2RO0A 1BI1A 3I55T 3OS0A 3I55Q 4BD3A 5GANd 2V8KA 3FJ5A 1NM7A 3QO3A 4ZNXA 2V8JA 1WHMA 1XQHA 2CDTA 4Y28E 1VQ5T 4C92G 1YHQT 1VQ5Q 4GBQA 1YHQQ 2GFAA 3G71T 4PJOB 1PWTA 1W6XA 5IXBA 3G71Q 4NL3A 1LJOA 2CSIA 1R8OB 2HBWA 4NL2A 2QQSA 1QLYA 4J7IA 2P4RA 3CC2Q 3E2UA 4M78D 4OGEA 4JRQA 2D0NA 1ABQA 4M7DB 1LPLA 3UWNA 3G4SA 1DJ7B 3HRTA 4F7UE 1ARKA 2PU9B 2YXYA 4QQ6A 2JM9A 3QUIA 2LZ6B 2RK2A 2YRCA 2JT4A 1HYOA 3CD6Q 1NZ9A 1YIJQ 1RLQC 4ANJA 2X3XD 2AZSA 1X75C 2KE9A 1KSWA 4J9FA 2DJZA 4M75F 2GCXA 2DF6A 1PHTA 5A2QE 1VQNT 1YJNQ 2M51A 1M4ZA 4RG2A 5CAIA 2CT4A 3LGFA 4LUEA 2LNVA 1NG2A 5KYWA 2M1HA 4J9HA 4VUBA 2RM4A 3ME9A 3V7SA 1FMKA 2OTJA 4M75G 1TU0B 4IUPA 3E9GA 1N5ZA 2X4WA 1HK9A 1XOVA 1VQOT 1IO6A 3REBB 1ZBXA 1G3SA 2ECZA 2W10A 2GBQA 4IKFA 8ATCB 3N5BB 1BIBA 5DY9A 5GAN4 1OZ3A 2PUKB 1UB4A 4BUGA 5IXFA 5LJ5g 4M78C 4YTLA 2EQIA 5AYFA 2K3BA 2ZPEB 3KFVA 2VB6A 1TS9A 1WA7A 4M75A 2RN8A 5I2SA 2ZGWA 1E6GA 4D8KA 1KG1A 3CXCS 5GAN8 3SD4A 5FRMA 2K3XA 4FYWB 2VUBA 5GAOm 4AFSC 4ORZA 3CC4T 5FWBA 1PM3A 3M0TA 5DLOA 2DL4A 4EMKA 1PRLC 2FRYA 2QDYB 4B6MA 1K73R 3ER0A 1WIEA 4OB3B 1OPLA 1KQ2A 5J26A 3CCSQ 3MPUB 2KMTA 2P0KA 3NTHA 2BZYA 2HSPA 2RHYA 4RCBA 4HVUA 2HQXA 4XU1A 2L2PA 2DIGA 2LJ1A 2X51A 4MMLA 3SWNA 3EG9A 4MZTA 4E7HA 4PFZA 3QXEB 4N0AC 1QCOA 3Q1JA 2NYSA 1OZ2A 1JEGA 2XG8D 3G6EA 4PJLA 1YJ9A 2LJ3A 3JV3A 5A0DA 2EYWA 5GMKh 3L2QA 1E6HA 5LJ3d 1UGQB 2LCSA 4C0ZA 3JB9H 3MKDA 4M7AD 1ZSZA 4EMGA 2Y90A 4J9DA 1QCFA 1X6BA 1NYFA 2KYMA 3LLRA 2H8HA 2YHTA 4GLMA 1OU8A 2HD0A 2DZ9A 3NTKA 2PUOB 4F04B 1SSHA 2K6DA 2RI3A 3RMSA 4Z89A 5M9OA 1SG5A 3CCRQ 1K73U 2FEIA 2DEUA 2NUPB 5CKEA 1LVKA 1AWWA 1HXDA 4QVCA 2DBMA 3M53A 1SRMA 3ZEHA 1O75A 1K76A 5KYNA 1P92A 5FWCA 2RI2A 1X69A 2LCLA 1NJIR 3J7AF 3SEMA 2J6KA 1EFNA 2HZYA 5D7UA 4F7UF 1C6VX 5CK9A 5LJ5j 4JS4A 3S3OA 3QSUA 1K8AU 1TSFA 2L3RA 5KYUB 1VQLT 4Z8AA 1VQLQ 1D1AA 1WDXA 2EBPA 3S3NA 3CBMA 4C92D 1M3BA 4FW2A 4F7UG 2EKOA 1IGUA 5KYYA 2RK1A 5LJ5d 4OB1B 1Y57A 5HK3A 4M7AC 2JXBA 2QYZA 3O5ZA 3EFOA 3GNFB 2O4XA 1SSFA 2C06A 2D1XA 3DB3A 1Y96B 1UJYA 1NE8A 1WZOA 5GMKj 2LJ0A 4DOWA 2BZ8A 3JCMQ 3T9NA 2AKLA 5GMKm 3CCQA 2RQVA 1B34B 4E2FB 4C5IA 1NJIU 1FMWA 1OU9A 2A3LA 5GAN2 2XICA 2YLCA 2M16A 3CXCP 2LC4A 4F7UA 1VQPA 4CC4B 3I5SA 2QASA 3UATA 1KC8R 2IVWA 4OMFB 2EGEA 2JS2A 1WXBA 2EFIA 2RHZA 3OYFA 3EGXB 1S1NA 1SPKA 4M75D 4M77E 1ZUUA 3JB9G 3M0UA 3CC7A 2E65A 1M3AA 3P8DA 3TQ7P 4HKEA 4C92C 2DTHA 2HDAA 1MNEA 2E10A 4L59A 3QBYA 4M78B 5CKDA 2FRWA 1V76A 2HNIA 2LCCA 4MDWA 2ZAEA 3E9FA 2HKNA 3RDVA 3EGDA 1ZQ1A 2DX1A 1PC0A 3C95A 2O88A 2CP7A 1WHKA 1ZSGA 2RA2A 3DLLA 2YSQA 4EMHA 5GAMf 4J6XA 2EPDA 2FO0A 1KC8U 1ZLMA 1EX4A 3J81E 3EFSA 3OYEA 3OYAA 2CZ1B 5HCKA 3GIBA 2X3WD 3G7ZA 2KRMA 1N9RA 2HL5C 1ZA2B 5LJ5e 5I21A 3V8KA 2KDSA 4CRIA 3CCUT 1I4K1 1QVGS 2QAZA 3CCUQ 4KUIA 4HCKA 1G8XA 2RF0A 4J9IA 4M75C 2FVUA 3LWIA 2E5QA 5GAOp 1UG1A 2P0QA 1Y07A 2FZGB 1TG0A 4PFPA 5HK0A 4MMKA 4XTUA 1VQ8T 2ATCB 1VQ8Q 2DVEA 5IH2A 3S3MA 1JQQA 2L3QA 3P8HA 4EMKC 1OYXA 3LW5E 1YJ9T 1YJ9Q 4IUVA 3M9QA 3FEOA 2E70A 2RD1A 1BCOA 4FYYB 3TSWA 4A53A 3AHUA 3EHRA 2WSCE 4JZ3A 4E7LA 1UECA 1U3OA 1QCNA 3SWNC 2EJ9A 3HFNA 4J6YA 1X43A 2F2XA 1RABB 3H41A 3WVEB 2BZXA 3OMCA 3X20B 1AEYA 4LN2A 5J3BA 1GBQA 2JTFA 4JZ4A 2GFUA 3PMTA 4R55A 2KXCA 4BI8B 2K57A 2MK5A 3RKXA 5GANf 2DTOA 4FSSA 1BCMA 4HVWA 2F5KA 1RAFB 1IZ6A 4OMLA 3UDCA 3CEYA 2GF7A 1T3SA 5I2MA 2E5KA 2OTLT 4EDUA 2OTLQ 2K7AA 4PJOE 3S6WA 3VYHB 1AWOA 2YUQA 4OP0A 2HQEA 2MWOA 2DKGA 3QZ5B 4E7IA 4QQGA 1QVFP 1RUWA 2RPNA 1PG5B 1VQ4T 4MZPA 4J9CA 4M7AB 1D0XA 2KR3A 2EAYA 3OYIA 3PVQA 1UE9A 4FT4A 1B3QA 1G2BA 1N6AA 3JCMg 1G5VA 1GCQA 2ZCFB 3OYMA 5GAN6 4Z88A 1BYMA 3VUBA 1S72A 2OAUA 3PT9A 4C8QG 4M77F 4BI4A 2AT1B 2RB6A 2WACA 1NJIC 3QIIA 1MGQA 1W70A 4OMPA 1PSFA 1WGSA 2R57A 3OW2A 2FPDA 2XIDA 1D1CA 4ZGDB 3CCQQ 1Q82C 4KT0E 4PFOA 2RMOA 4F14A 4A63B 1AVZC 4KGXB 3GBQA 1AZGB 4J7FA 3IQLA 4LNPA 5KYXA 1BI3A 1Q7YC 3M4YA 4IIOA 3E19A 3LH5A 5CO7A 5KE3A 3ASKA 3JB9D 1QVGP 2KBTA 4C92B 4Y91A 3I9QA 2VXFA 3HTRA 3CCJA 2FZKB 4L6V5 2LX7A 1K0XA 1XJWB 2HCKA 2EQUA 2RJCA 3CQTA 4B9XA 2DRMA 3TU4K 2FG0A 4ESRA 2DTIA 4N4HA 5KYWB 4M77A 1WPYA 3UA6A 3PIPA 3QWXX 3CXCA 2EYQA 2KEAA 2OI3A 4LDXA 1D0ZA 1VIFA 1WHGA 2H3EB 2LQ8A 4RTYA 4BI3A 3OBWA 2QEXT 3P8BB 1E7OA 1MMGA 2F2WA 1X6GA 1KC8C 2GQIA 1YITA 1Q86C 3LH0A 1MNDA 3SFMA 3VUZA 1UHFA 4JLGA 3NMZC 5FU6B 3CCET 4JRKA 3CCEQ 2GGRA 3L2UA 3NPFA 4JS5A 1VOMA 1MV3A 4BE2A 1J3TA 4AFZC 1IHVA 3H8ZA 2K3YA 1Q81R 3CC2T 4XU0A 4M75B 4LUDA 2EQJA 3UA7A 1VQ9A 5LJ3f 2DIQA 1I5OB 2E3HA 3CD6T 7AT1B 1ZX6A 2RHIA 1YIJT 1SF9A 3OSVA 1H8KA 3NTIA 2LQKA 5FU7C 2DD4A 2EVRA 4EMKB 3QDFA 3WXMB 2B86A 2K9GA 3JCMd 2EYZA 2LRQA 1M3CA 4DBQA 4K11A 5GMKl 5KE2A 3BDLA 1YJNT 3VV0A 1Y7XA 4J5YA 1M1KC 2ZPBB 2J06A 5GAOn 4WF2A 2X9HA 4PJOF 4NS5A 5A0LA 3SWNB 4ATOA 3EG9B 4LDUA 3OW2S 4RTVA 1BB9A 4XTWA 1HD3A 2DA9A 1BKBA 3CCVA 1KD1C 2G3RA 2QXFA 3EGUA 3FJPA 3EH2A 4MZMA 4C5HA 5HY6A 2JVVA 2CUBA 1LCKA 4QT7A 1QP3A 2EYYA 2MI6A 4XTXA 4Q5WA 3H6ZA 3CCLA 2HEQA 2QQBA 2P84A 2CP3A 2A37A 2P0PA 4OMQA 4C0GA 1T3LA 1IRXA 4QQDA 2V1QA 3JCMc 3A8GB 2E3IA 2XDBA 2PNIA 2ROTA 2DNUA 4LDVA 4E6RA 3VRZA 3OYJA 1TWBA 4J9GA 3RERA 4PJOA 1AOJA 2R5AA 3GLXA 2LTOA 2EJFA 1CKBA 2KSSA 2L0AA 2DAQA 2OX7A 4BB7A 3CCST 1LOJA 2HSEB 4DA4A 3NHNA 3PFSA 4C8QD 1FWZA 1M8VA 2CYZB 1V29B 1QWFA 4RTUA 3VS2A 2GNCA 1JJ2A 1PSEA 2D8JA 5GAOr 3VS4A 4KRTA 2F2VA 3RBBB 3VS7A 1QKXA 4P5NA 1WHLA 1ZBJA 4WTOB 2D0QB 4FYVB 1QVFA 1WX6A 2J6OA 1PRMC 4M77D 3MEWA 1IGQA 2MF2A 3X28B 4E7ZA 3CMAT 3OA6A 3CMAQ 3JCMe 3EFOB 1VUBA 2NUTA 1H92A 1GCQC 3ZFJA 2O4XB 4L5GA 5IN1A 2XDDA 1VQ7A 3I56A 2Y4YA 3C12A 2IG0A 1VQKA 2QA4T 2QA4Q 3RUXA 2QGFB 5GAN5 3THKA 1RAEB 4JJBA 1FX7A 1YJWA 4RTWA 3OYGA 4OMOA 2HAXA 1M2OA 3CCRT 4F7UB 1VA7A 1OULA 1MMDA 2R58A 2LNHB 1YWOA 2O2OA 3RNJA 3EHQA 3C0CA 4ZN1A 3BW1A 2G6FX 1YWPA 2MCNA 2CKKA 5CKFA 5GJVB 4FYXB 3CMET 3A8LB 3CMEQ 1IREB 3PE0A 3GNGA 2DFUA 2QK0A 4OF1A 1WXUA 3CCMT 3UPUA 3CCMQ 4C8QC 2MOXA 2V8IA 4A54A 1Z9ZA 2HMAA 2GTOA 2VYTA 2JMAA 1BU1A 3TVTA 1Q82R 1QVGA 3OW2P 2F69A 4OMMA 2AKKA 4CC7A 4M77C 2QQ9A 2RJDA 5L23A 4JUVA 1Q7YR 5I22A 2JTEA 3EGDB 2PVOB 2DL8A 3QKJA 2DD5A 3EH1A 1N9SA 3V8LA 2RNAA 4IUQA 3M56A 2E41A 1NLOC 5FU7B 1C1AA 2K5FA 2R5MA 3G4ST 2D8HA 1RAIB 3G4SQ 3LWHA 1OOTA 2YUPA 3FB9A 3VKIA 1MMAA 2WSEE 1PD0A 2CZ7B 1K9AA 5DLQE 4IURA 2EJGA 1YI2A 1Q82U 6AT1B 5FLXE 2M0OA 1JJ2S 4XQ3A 1Q86R 2MAMA 3FIFA 1B7TA 5A0GA 4DEYA 1Q81C 1QVFS 2O01E 1Q7YU 3LYIA 8AT1B 2X4YA 4HCZA 1NPRA 2OTJT 3UT1A 2MWPA 2OTJQ 4BE0A 3OBYA 2D9TA 3CCVQ 2NUPA 1A0NB 5GJWB 2XHCA 4XTVA 1YBYA 2CS7A 2YDLA 1D1BA 1M2VB 4R56A 1VQ6A 4GLKA 5FROA 3L2RA 4C0DC 2VGMA 1YCSB 2KNBB 2DXBA 3KUFA 3M0QA 2YT6A 3J80E 2VC8A 4BDYA 1KQ1A 3JCMW 1Q86U 2DO3A 1UEBA 4J6WA 2H3JA 3I5RA 3R6NA 1M1KR 5GAMg 4PJMA 2VASA 1U5SA 3RESA 4RTZA 3R6OA 3I55A 3FC3A 2IIMA 1QQJA 3GF5A 3LGLA 2DL3A 3FRNA 2I0NA 1VQ5A 1YHQA 1KD1R 2CP2A 4M78F 1HSQA 1UFFA 3G71A 1RAGB 1Y96A 1KQSA 1WJRA 4DEXA 4KUDK 1AD5A 1N8RR 1SHGA 5GAMh 2EKHA 3QJYA 2A08A 1T0JA 2QQAA 1GXIE 1F1BB 4E47A 2AHJB 2MIOA 2C0TA 4M4ZA 3V7CA 3G6ET 4C92E 3G6EQ 2GTJA 2DYIA 3SB2A 1GFCA 2XI9A 2K2MA 2A7YA 3A5ZB 5GMKe 4A4FA 1BBZA 1WQ7A 1M1KU 3L2ZA 4BDZA 3I56Q 3META 3L2WA 2QGGA 1NPPA 1VQNA 3BE3A 4JRPA 3PTAA 3ZL7C 2DBKA 1G3YA 1MUZA 1YJWT 1R77A 2J7IA 2YRVA 1YJWQ 2BTTA 2C0OA 1KD1U 5KYXB 2CH4W 1ZSZC 4JPBW 2YUOA 3OQ5A 3OS2A 2CUDA 4C8QB 1VQOA 5KCHA 3A1PA 2CT3A 4C5GA 1BI0A 1TOVA 2KT8A 3NGPA 2HBPA 5GANg 3OMGA 4RKUE 2RJFA 5D6XA 1OQKA 4IIMA 1JJ2P 2RQTA 2DM1A 4WCIA 1U06A 1RI0A 2LDMA 4EPCA 3VS3A 1EIFA 4M7DE 1JO8A 4OB0B 2KYBA 1QWEA 1JXOA 1NYGA 1JU5C 5GANh 1AWJA 3INZA 3QJ6A 2L5QA 5GAMj 1JBMA 2KQWA 2A0FB 2DJQA 9ATCB 4LXCA 3JCMf 3CC4A 1ACMB 4PK4A 4N0AA 3WVDB 3OYLA 2QTVA 1VQMA 1WNLA 4PL6A 2ROLA 2XDPA 3VU3C 2BKDN 1QVPA 4BY6C 3HFOA 5GAOq 3QYGB 3SDZA 1KHCA 3L1AA 3CCQT 4M77G 4PKCC 4HXJA 2JM8A 3VJPA 2DERA 4FU6A 1KQSS 4CC3A 3QG1A 5EC7A 1VQPT 1BI2A 3EFRA 2CGHA 3OSSC 1VQPQ 1WQWA 4XU2A 3JCMJ 1TUGB 3M0RA 1NBEB 1WJSA 3LX7A 1SEMA 2DL5A 1XTDA 4XTZA 4A4EA 2C0IA 4E7JA 3CC7T 3CC7Q 2E64A 1GCPA 2RH2A 2KK4A 1WI7A 1KIKA 1I81A 2JJ9A 2FL7A 2L89A 1KJWA 4C0DB 3CPFA 2D6FA 1JXMA 2F1LA 5CVIA 1ZA1B 1U8RA 2X4XA 3EG1A 1BK2A 4LE9A 4RG8A 1K9MC 3VS6A 4IUUA 1MHNA 5CQYA 1X27A 3MP8A 2ENMA 3DB4A 2ZZDA 5GANj 1NEBA 2E12A 3M55A 1NLPC 2NUZA 2V1RA 4RTXA 1W2BA 3RKYA 4C92F 3PNWC 3ULRB 2PTKA 4OVAA 3CPWA 1D3BA 4RUGA 2FPFA 1O9SA 2ZPGB 1VQLA 2K4YA 1G83A 4LD9K 1Q95G 1AT1B 1ABOA 3JCMV 2RQUA 3E1SA 2VWFA 2BUDA 2FZCB 1IB8A 3MP1A 1M90C 2ED0A 2MPXC 4X1VA 5J39A 2RI5A 1M1FA 5LJ3g 5GAMe 2LQWA 4RCCA 5C0MA 2SEMA 3OYHA 2VGNA 2P4TA 4KH0B 1KFZA 3JAME 1RLPC 2EYXA 1M5Q1 3M0PA 1PD1A 1YCYA 2JOYA 3BFMA 2MMPA 2HKQB 4FSXA 3PIOA 1X6OA 2KRNA 3H0IA 5LJ3h 4C92A 1RI9A 5IHNA 1Q81U 1NEGA 1VQNQ 4M7DF 2NUTB 2DE0X 3EG2A 1AHJB 4PJOG 4AFUC 1N8RC 3A8HB 1ZSZB 1BIAA 1YNZA 2K79A 4KH1B 1SKUB 4II1A 2X4JA 1I8FA 4M7DG 3PGGA 4FM4B 2LQNA 3CBOA 4A4GA 3U23A 1VQOQ 2OJ2A 1K0SA 1KQSP 2A28A 2OAWA 1XNIA 3EG0A 4LDWA 2DILA 4KGVB 1N27A 1TUDA 1ZHIA 3PVLA 4C0FA 5LJ5f 1YFNA 4QVZA 4CI0C 4A4KA 3KBGA 3GP8A 2PVDB 1HJDA 4ZTJA 1PCXA 4HCCA 2RJEA 4UC4A 4JJNK 2COYA 5IAYA 3H0FA 2BE9B 1M9SA 3M54A 2L8DA 3UF4A 4JRIA 1VYVA 2XK0A 3HRUA 4DOVA 3RMQA 2ZPFB 2YWWA 5GANe 4M7DA 5D6YA 2CH4A 2B8AA 3MO8A 1S72T 2JMCA 1S72Q 1W2BS 5CIUA 1SHFA 5LJ5h 3HL8A 2LT4A 3CC4Q 4BY6B 2XMFA 2DYBA 3CBPA 3CPWS 2RHXA 4XU3A 1UGRB 1R0BG 4XTYA 1VQMT 3CCUA 1VQMQ 5KYYB 1MV0B 1QMCA 4X34A 5ECAA 1QP2A 1TXQA 1GL5A 2K5LA 2CSQA 2QTXA 2RQRA 3HPWA 5LJ3j 4R0KA 2HQHA 2KY9A 4TVRA 3REAB 1UJ0A 4XAXB 5EG2A 3RKWA 1VQ8A 2BIVA 3H9NA 1VIEA 2EQKA 1FMVA 2DVJA 2CZ0B 2Z0WA 4N4GA 4M78E 2O9SA 3OS1A 5AT1B 2F5TX 1G3TA 4J9BA 1K8AR 2LVMA 1W4SA 2ABLA 2EWNA 5I11A 4FL6A 3CCJT 3CCJQ 4MDXA 2DZCA 5CQXA 1WFWA 1RAHB 3M58A 3QWYA 2XD0A 5LL6S 3DLMA
chains in the Genus database with same CATH topology
2AZSA 4Z88A 2KE9A 1KSWA 3EG3A 4J9FA 4AG1C 2DF6A 1PHTA 3I5RA 3H0HA 3R6NA 1VYUA 1U5SA 2M51A 4RTZA 1W70A 2CT4A 4LUEA 4OMPA 4F16A 1NG2A 4J9HA 2IIMA 2FPDA 4OMNA 2DL3A 1FMKA 2I0NA 2L3PA 2RMOA 1HSQA 1UFFA 4F14A 1N5ZA 4A63B 1AVZC 1XOVA 4DEXA 1IO6A 1AZGB 3GBQA 1AD5A 3REBB 3IQLA 2ECZA 2W10A 1SHGA 2GBQA 4LNPA 5FW9A 2EKHA 2A08A 1SRLA 1V1CA 1T0JA 4IIOA 1PKTA 1YP5A 3LH5A 1UTIA 2MIOA 2C0TA 5IXFA 2KBTA 4M4ZA 3I9QA 2GTJA 2EQIA 2K3BA 2LX7A 2W0ZA 1GFCA 3I35A 1K0XA 2K2MA 3KFVA 2HCKA 1BBZA 3CQTA 2DRMA 1TUCA 1WA7A 2FG0A 4ESRA 2RN8A 3UA6A 1E6GA 4D8KA 3QWXX 2OI3A 2KEAA 2YUNA 3TSZA 4RTYA 2LMJA 3ZL7C 2DBKA 1E7OA 1MUZA 4AFSC 4ORZA 2J7IA 2F2WA 5FWBA 3M0TA 1X6GA 2BTTA 2C0OA 2GQIA 2ED1A 2CH4W 2DL4A 1PRLC 2KT1A 2FRYA 1UHFA 3NMZC 1WIEA 1OPLA 4HVVA 4JPBW 2YUOA 2GGRA 2CUDA 3NPFA 2BZYA 2HSPA 2CT3A 2KT8A 1MV3A 3NGPA 4HVUA 2EW3A 4J9EA 2L2PA 1J3TA 2LJ1A 4AFZC 4IIMA 2LP5A 2RQTA 1I1JA 2DM1A 2DRKA 4CC2A 1CSKA 4WCIA 1PKSA 1JEGA 1U06A 1ZUKA 4LUDA 3UA7A 2LJ3A 3VS1A 3JV3A 3VS3A 1GRIA 2EYWA 2KRSA 1E6HA 1JO8A 4AFQC 2LCSA 2KYBA 1QWEA 1JXOA 1NYGA 4J9DA 1GBRA 1JU5C 1QCFA 2O31A 1ZX6A 1X6BA 1AWJA 1H8KA 1NYFA 2KYMA 1M30A 2H8HA 2EVRA 4GLMA 2DJQA 2B86A 2K9GA 2EYZA 1SSHA 2K6DA 4AG2C 2RQWA 1I0CA 1M3CA 4K11A 4Z89A 2FEIA 2J06A 4JJCA 2ROLA 1WLPB 3VS0A 1AWWA 2DBMA 4RTVA 1SRMA 1K76A 1BB9A 2CREA 1HD3A 1ZUYA 2DA9A 2O9VA 4HXJA 2JM8A 5FWCA 3EGUA 1X69A 4CC3A 5EC7A 3SEMA 2J6KA 1EFNA 2J6FA 2CUBA 1LCKA 3M0RA 4QT7A 2EGCA 2EYYA 2HEQA 1SEMA 2DL5A 4Z8AA 1AWXA 1WDXA 2EBPA 2DLPA 2A37A 4OMQA 1M3BA 2C0IA 1T3LA 2V1QA 1GCPA 1Y57A 1WI7A 1KIKA 1OPKA 2JXBA 2PNIA 2ROTA 2DNUA 4Y92A 1KJWA 4E6RA 3VS5A 3O5ZA 3VRZA 1JXMA 4J9GA 1AOJA 2D1XA 2M0YA 1UJYA 3EG1A 1BK2A 4LE9A 1M8MA 2DL7A 2LJ0A 3VS6A 1CKBA 2BZ8A 2VVKA 2SRCA 2KROA 1X27A 2AKLA 2ENMA 2RQVA 2L0AA 1H3HA 1NEBA 1NLPC 2NUZA 2V1RA 3NHNA 2VKNA 1QKWA 4RTXA 1AZEA 4CC4B 1Z9QA 1QWFA 3I5SA 1FYNA 1YN8A 4RTUA 2GNCA 2PTKA 3UATA 3ULRB 3VS2A 2JS0A 2D8JA 2EGEA 1OEBA 3VS4A 4KRTA 2F2VA 3RBBB 2AZVA 4RUGA 1QKXA 3VS7A 1ZBJA 2FPFA 2JS2A 3A98A 4F17A 1WXBA 1OV3A 1G83A 1S1NA 1WX6A 1ABOA 2J6OA 1SPKA 1PRMC 2RQUA 1K1ZA 2VWFA 1ZUUA 1H92A 1GCQC 3M0UA 1M3AA 4JJDA 1UDLA 2ED0A 2HDAA 4X1VA 1UGVA 2LQWA 3THKA 2FRWA 1UUEA 3SHWA 4JJBA 2SEMA 4RTWA 4OMOA 1Y0MA 1KFZA 1VA7A 2DX1A 1RLPC 1WYXA 2EYXA 2LNHB 3M0PA 2O88A 1YWOA 2O2OA 3RNJA 3EHQA 3C0CA 1ZSGA 2YSQA 2G6FX 1YWPA 5IHIA 2JW4A 2MCNA 3H0IA 2EPDA 2KRNA 2FO0A 1ZLMA 5GJVB 1RI9A 1B07A 4D8DA 2KGTA 3PE0A 5IHNA 1X2KA 1NEGA 1WXUA 2DE0X 2KXDA 3EG2A 5HCKA 2MOXA 4AFUC 1CKAA 2X3WD 2ESWA 2KRMA 1Z9ZA 5IHKA 2GTOA 1K4US 3M0SA 2JMAA 1BU1A 3TVTA 1YNZA 1M27C 2K79A 4OMMA 4HCKA 2AKKA 2NWMA 2AK5A 2RF0A 4J9IA 1T0HA 4CC7A 2LQNA 3U23A 5L23A 2OJ2A 1K0SA 2A28A 2OAWA 4EIKA 3EG0A 2JTEA 1I07A 1UG1A 5I22A 2DILA 1TUDA 2DL8A 2J05A 3PVLA 1PNJA 1TG0A 3VRYA 4RTTA 1HJDA 2RNAA 2DMOA 5IH2A 1JQQA 2L3QA 2FPEA 2A36A 3H0FA 1NLOC 1UHCA 1VYTA 3UF4A 2D8HA 1WXTA 1VYVA 2EGAA 1OOTA 2QDLA 2YUPA 3TSWA 3EHRA 4JZ3A 1UECA 2L3SA 1U3OA 1K9AA 2CH4A 1X43A 2F2XA 3H41A 2BZXA 2JMCA 1X2QA 2PZ1A 1AEYA 1SHFA 4LN2A 2XMFA 2DYBA 1GBQA 4JZ4A 1W1FA 1GFDA 2KXCA 1MV0B 3FJ5A 4FSSA 5ECAA 4DEYA 4HVWA 1NM7A 4ZNXA 1GL5A 4OMLA 2CSQA 2CDTA 1T3SA 2RQRA 4GBQA 2E5KA 4R0KA 1PWTA 1W6XA 2K7AA 1UJ0A 3REAB 5IXBA 1A0NB 1AWOA 2YUQA 5GJWB 2CSIA 2HBWA 2YDLA 1QLYA 2DVJA 2P4RA 2O9SA 2D0NA 1RUWA 2RPNA 1ABQA 4J9BA 4J9CA 2ABLA 5I11A 1ARKA 2JM9A 1YCSB 2LZ6B 2KR3A 2KNBB 3PVQA 2JT4A 1UE9A 1B3QA 1G2BA 3M0QA 2YT6A 1WFWA 1RLQC 1GCQA 3QWYA 2X3XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZS A;  4Z88 A;  2KE9 A;  1KSW A;  3EG3 A;  4J9F A;  4AG1 C;  2DF6 A;  1PHT A;  3I5R A;  3H0H A;  3R6N A;  1VYU A;  1U5S A;  2M51 A;  4RTZ A;  1W70 A;  2CT4 A;  4LUE A;  4OMP A;  4F16 A;  1NG2 A;  4J9H A;  2IIM A;  2FPD A;  4OMN A;  2DL3 A;  1FMK A;  2I0N A;  2L3P A;  2RMO A;  1HSQ A;  1UFF A;  4F14 A;  1N5Z A;  4A63 B;  1AVZ C;  1XOV A;  4DEX A;  1IO6 A;  1AZG B;  3GBQ A;  1AD5 A;  3REB B;  3IQL A;  2ECZ A;  2W10 A;  1SHG A;  2GBQ A;  4LNP A;  5FW9 A;  2EKH A;  2A08 A;  1SRL A;  1V1C A;  1T0J A;  4IIO A;  1PKT A;  1YP5 A;  3LH5 A;  1UTI A;  2MIO A;  2C0T A;  5IXF A;  2KBT A;  4M4Z A;  3I9Q A;  2GTJ A;  2EQI A;  2K3B A;  2LX7 A;  2W0Z A;  1GFC A;  3I35 A;  1K0X A;  2K2M A;  3KFV A;  2HCK A;  1BBZ A;  3CQT A;  2DRM A;  1TUC A;  1WA7 A;  2FG0 A;  4ESR A;  2RN8 A;  3UA6 A;  1E6G A;  4D8K A;  3QWX X;  2OI3 A;  2KEA A;  2YUN A;  3TSZ A;  4RTY A;  2LMJ A;  3ZL7 C;  2DBK A;  1E7O A;  1MUZ A;  4AFS C;  4ORZ A;  2J7I A;  2F2W A;  5FWB A;  3M0T A;  1X6G A;  2BTT A;  2C0O A;  2GQI A;  2ED1 A;  2CH4 W;  2DL4 A;  1PRL C;  2KT1 A;  2FRY A;  1UHF A;  3NMZ C;  1WIE A;  1OPL A;  4HVV A;  4JPB W;  2YUO A;  2GGR A;  2CUD A;  3NPF A;  2BZY A;  2HSP A;  2CT3 A;  2KT8 A;  1MV3 A;  3NGP A;  4HVU A;  2EW3 A;  4J9E A;  2L2P A;  1J3T A;  2LJ1 A;  4AFZ C;  4IIM A;  2LP5 A;  2RQT A;  1I1J A;  2DM1 A;  2DRK A;  4CC2 A;  1CSK A;  4WCI A;  1PKS A;  1JEG A;  1U06 A;  1ZUK A;  4LUD A;  3UA7 A;  2LJ3 A;  3VS1 A;  3JV3 A;  3VS3 A;  1GRI A;  2EYW A;  2KRS A;  1E6H A;  1JO8 A;  4AFQ C;  2LCS A;  2KYB A;  1QWE A;  1JXO A;  1NYG A;  4J9D A;  1GBR A;  1JU5 C;  1QCF A;  2O31 A;  1ZX6 A;  1X6B A;  1AWJ A;  1H8K A;  1NYF A;  2KYM A;  1M30 A;  2H8H A;  2EVR A;  4GLM A;  2DJQ A;  2B86 A;  2K9G A;  2EYZ A;  1SSH A;  2K6D A;  4AG2 C;  2RQW A;  1I0C A;  1M3C A;  4K11 A;  4Z89 A;  2FEI A;  2J06 A;  4JJC A;  2ROL A;  1WLP B;  3VS0 A;  1AWW A;  2DBM A;  4RTV A;  1SRM A;  1K76 A;  1BB9 A;  2CRE A;  1HD3 A;  1ZUY A;  2DA9 A;  2O9V A;  4HXJ A;  2JM8 A;  5FWC A;  3EGU A;  1X69 A;  4CC3 A;  5EC7 A;  3SEM A;  2J6K A;  1EFN A;  2J6F A;  2CUB A;  1LCK A;  3M0R A;  4QT7 A;  2EGC A;  2EYY A;  2HEQ A;  1SEM A;  2DL5 A;  4Z8A A;  1AWX A;  1WDX A;  2EBP A;  2DLP A;  2A37 A;  4OMQ A;  1M3B A;  2C0I A;  1T3L A;  2V1Q A;  1GCP A;  1Y57 A;  1WI7 A;  1KIK A;  1OPK A;  2JXB A;  2PNI A;  2ROT A;  2DNU A;  4Y92 A;  1KJW A;  4E6R A;  3VS5 A;  3O5Z A;  3VRZ A;  1JXM A;  4J9G A;  1AOJ A;  2D1X A;  2M0Y A;  1UJY A;  3EG1 A;  1BK2 A;  4LE9 A;  1M8M A;  2DL7 A;  2LJ0 A;  3VS6 A;  1CKB A;  2BZ8 A;  2VVK A;  2SRC A;  2KRO A;  1X27 A;  2AKL A;  2ENM A;  2RQV A;  2L0A A;  1H3H A;  1NEB A;  1NLP C;  2NUZ A;  2V1R A;  3NHN A;  2VKN A;  1QKW A;  4RTX A;  1AZE A;  4CC4 B;  1Z9Q A;  1QWF A;  3I5S A;  1FYN A;  1YN8 A;  4RTU A;  2GNC A;  2PTK A;  3UAT A;  3ULR B;  3VS2 A;  2JS0 A;  2D8J A;  2EGE A;  1OEB A;  3VS4 A;  4KRT A;  2F2V A;  3RBB B;  2AZV A;  4RUG A;  1QKX A;  3VS7 A;  1ZBJ A;  2FPF A;  2JS2 A;  3A98 A;  4F17 A;  1WXB A;  1OV3 A;  1G83 A;  1S1N A;  1WX6 A;  1ABO A;  2J6O A;  1SPK A;  1PRM C;  2RQU A;  1K1Z A;  2VWF A;  1ZUU A;  1H92 A;  1GCQ C;  3M0U A;  1M3A A;  4JJD A;  1UDL A;  2ED0 A;  2HDA A;  4X1V A;  1UGV A;  2LQW A;  3THK A;  2FRW A;  1UUE A;  3SHW A;  4JJB A;  2SEM A;  4RTW A;  4OMO A;  1Y0M A;  1KFZ A;  1VA7 A;  2DX1 A;  1RLP C;  1WYX A;  2EYX A;  2LNH B;  3M0P A;  2O88 A;  1YWO A;  2O2O A;  3RNJ A;  3EHQ A;  3C0C A;  1ZSG A;  2YSQ A;  2G6F X;  1YWP A;  5IHI A;  2JW4 A;  2MCN A;  3H0I A;  2EPD A;  2KRN A;  2FO0 A;  1ZLM A;  5GJV B;  1RI9 A;  1B07 A;  4D8D A;  2KGT A;  3PE0 A;  5IHN A;  1X2K A;  1NEG A;  1WXU A;  2DE0 X;  2KXD A;  3EG2 A;  5HCK A;  2MOX A;  4AFU C;  1CKA A;  2X3W D;  2ESW A;  2KRM A;  1Z9Z A;  5IHK A;  2GTO A;  1K4U S;  3M0S A;  2JMA A;  1BU1 A;  3TVT A;  1YNZ A;  1M27 C;  2K79 A;  4OMM A;  4HCK A;  2AKK A;  2NWM A;  2AK5 A;  2RF0 A;  4J9I A;  1T0H A;  4CC7 A;  2LQN A;  3U23 A;  5L23 A;  2OJ2 A;  1K0S A;  2A28 A;  2OAW A;  4EIK A;  3EG0 A;  2JTE A;  1I07 A;  1UG1 A;  5I22 A;  2DIL A;  1TUD A;  2DL8 A;  2J05 A;  3PVL A;  1PNJ A;  1TG0 A;  3VRY A;  4RTT A;  1HJD A;  2RNA A;  2DMO A;  5IH2 A;  1JQQ A;  2L3Q A;  2FPE A;  2A36 A;  3H0F A;  1NLO C;  1UHC A;  1VYT A;  3UF4 A;  2D8H A;  1WXT A;  1VYV A;  2EGA A;  1OOT A;  2QDL A;  2YUP A;  3TSW A;  3EHR A;  4JZ3 A;  1UEC A;  2L3S A;  1U3O A;  1K9A A;  2CH4 A;  1X43 A;  2F2X A;  3H41 A;  2BZX A;  2JMC A;  1X2Q A;  2PZ1 A;  1AEY A;  1SHF A;  4LN2 A;  2XMF A;  2DYB A;  1GBQ A;  4JZ4 A;  1W1F A;  1GFD A;  2KXC A;  1MV0 B;  3FJ5 A;  4FSS A;  5ECA A;  4DEY A;  4HVW A;  1NM7 A;  4ZNX A;  1GL5 A;  4OML A;  2CSQ A;  2CDT A;  1T3S A;  2RQR A;  4GBQ A;  2E5K A;  4R0K A;  1PWT A;  1W6X A;  2K7A A;  1UJ0 A;  3REA B;  5IXB A;  1A0N B;  1AWO A;  2YUQ A;  5GJW B;  2CSI A;  2HBW A;  2YDL A;  1QLY A;  2DVJ A;  2P4R A;  2O9S A;  2D0N A;  1RUW A;  2RPN A;  1ABQ A;  4J9B A;  4J9C A;  2ABL A;  5I11 A;  1ARK A;  2JM9 A;  1YCS B;  2LZ6 B;  2KR3 A;  2KNB B;  3PVQ A;  2JT4 A;  1UE9 A;  1B3Q A;  1G2B A;  3M0Q A;  2YT6 A;  1WFW A;  1RLQ C;  1GCQ A;  3QWY A;  2X3X D; 
#chains in the Genus database with same CATH topology
 4LDY A;  3HKS A;  4IUT A;  3EG3 A;  4AG1 C;  4BE1 A;  2DET A;  3X26 B;  2AIR B;  3H0H A;  4FIB A;  1VYU A;  4OB2 B;  3V8J A;  5CKH A;  3V7R A;  3M5A A;  4F16 A;  4KUL A;  4DBF A;  4GY5 A;  1YIT T;  4Z02 A;  1YIT Q;  4OMN A;  5FRN A;  3MHX A;  2IPO B;  2JN0 A;  2L3P A;  1I5L A;  3NFC A;  2OTL A;  2JNG A;  2NLU A;  4AMC A;  1RAD B;  3BDU A;  3QZ9 B;  3OYB A;  5FW9 A;  2WSF E;  1RL2 A;  3KXT A;  1SRL A;  1V1C A;  1PKT A;  1H64 1;  1YP5 A;  3A8M B;  1X01 A;  1UTI A;  3JB9 J;  1VQ4 A;  2YLB A;  5IT9 E;  4HCB A;  1VQ9 T;  4FT2 A;  1VQ9 Q;  2W0Z A;  4HT9 A;  3I35 A;  3GPL A;  2EIF A;  2Y4X A;  3JCM b;  2HL3 A;  3FLG A;  1TUC A;  3HHT B;  4AT1 B;  3HSB A;  5CR2 A;  2YUN A;  4QKU A;  3TSZ A;  5KCO A;  2CP5 A;  2LMJ A;  2X35 A;  1K9M R;  1TH7 A;  2K2V A;  2ED1 A;  4N4I A;  4ME7 A;  2KT1 A;  2DK3 A;  3O8V A;  2CZ6 B;  3JSC A;  4HVV A;  4NOY A;  2DPP B;  2VXE A;  4E7S A;  1Y71 A;  4C8Q E;  3JB9 F;  4D6W A;  4LD6 A;  5LJ3 e;  1OI1 A;  3CCV T;  2EW3 A;  4PJO D;  4J9E A;  1W2B P;  3RIR A;  2LP5 A;  3CPW P;  3QPH A;  1I1J A;  3F70 A;  2DRK A;  4CC2 A;  1CSK A;  1PKS A;  4HT8 A;  4ZGJ B;  1ZUK A;  2COW A;  2ZPH B;  4ZTF A;  3CCL T;  3VS1 A;  3CCL Q;  1GRI A;  2KRS A;  3TEE A;  4M7D D;  1M90 R;  3OY9 A;  4AFQ C;  2KI7 A;  4M7A E;  3ZBD A;  1GBR A;  2O31 A;  1WHH A;  3MEA A;  1M30 A;  5KYU A;  4PJN A;  4HA8 A;  3AT1 B;  1RAA B;  5CCA A;  1K9M U;  2QEX A;  2ZPI B;  4AG2 C;  2RQW A;  3EAE A;  4DBR A;  1I0C A;  3OYC A;  4JLI A;  3JRZ A;  3MP6 A;  1FXX A;  4ELZ C;  3GOX A;  4JJC A;  3JCM P;  2CP6 A;  1WLP B;  3DKM A;  3VS0 A;  3CCE A;  4C5E A;  4E7K A;  3URG A;  2DXU A;  2VV5 A;  3HRS A;  2CRE A;  2XU8 A;  4RMO A;  1ZUY A;  2O9V A;  4FCY A;  5FU6 C;  2FHD A;  2BE7 D;  3OYD A;  4B9W A;  2J6F A;  2DEQ A;  1U1S A;  3CC2 A;  4V2S A;  1B34 A;  3C4S A;  2EGC A;  1M90 U;  4PJO C;  3FDR A;  2JZ2 A;  4M78 G;  1AWX A;  3MJX A;  2KAF A;  3OYY A;  2COZ A;  5GAN 3;  2DLP A;  2E1H A;  2EQM A;  3QHS A;  5HKC A;  3CD6 A;  4JDS A;  3RR6 A;  1YIJ A;  4M7D C;  3L2V A;  3OB9 A;  4A4H A;  1VQ7 T;  1VQ7 Q;  3EGX A;  3I56 T;  1OPK A;  4Y92 A;  2DXC A;  3VS5 A;  4KBM B;  1LNX A;  1VQK T;  4DBH A;  1VQK Q;  1U1T A;  1YJN A;  2JUF A;  4OGC A;  2E6Z A;  4X9D A;  2QI2 A;  2M0Y A;  1M2V A;  5GAN 7;  1M8M A;  2DL7 A;  2VVK A;  4DQ2 A;  2SRC A;  2KRO A;  4BAC A;  4M78 A;  2RHU A;  1H3H A;  2E6N A;  1N8R U;  5L8R E;  2M02 A;  1K73 C;  2VKN A;  1QKW A;  1OX9 A;  3C94 A;  1AZE A;  3G1J A;  3TRE A;  1Z9Q A;  3JB9 I;  1FYN A;  1YN8 A;  2JS0 A;  4J83 A;  2CP0 A;  1OEB A;  2AZV A;  3PMI A;  3A98 A;  4F17 A;  4O6J A;  1OV3 A;  2KVQ G;  4QW2 A;  3QDR B;  1RAC B;  3OS5 A;  4M77 B;  4M75 E;  1K1Z A;  4PNO A;  1D0Y A;  2QQR A;  1UGP B;  2JTM A;  1K8A C;  3M59 A;  4JJD A;  3TCJ A;  3HP9 A;  1UDL A;  1UGV A;  2GQV A;  4KGZ B;  4ZN3 A;  4J8O A;  3MEV A;  1D09 B;  1UUE A;  3SHW A;  5DM7 R;  1H3Z A;  1Y0M A;  3X24 B;  2LX9 A;  4C8Q F;  4ZGE B;  1VQ4 Q;  3M57 A;  3A8O B;  1WYX A;  1D3B B;  5CKB A;  5GAM d;  5GAO l;  3CCS A;  2PVG B;  3BY7 A;  1M1G A;  2JW4 A;  5IHI A;  1WJQ A;  1B07 A;  1KHI A;  4D8D A;  2KGT A;  1X2K A;  5C6S A;  4PLL A;  2M9U A;  1YI2 T;  2KXD A;  1YI2 Q;  3OYK A;  4X9C A;  1CKA A;  3QYH B;  2ESW A;  4M7A F;  5IHK A;  1K4U S;  3M0S A;  1QW1 A;  3JCM h;  2I2L A;  3CMA A;  1G3W A;  1M27 C;  4QVD A;  1WHJ A;  1OX8 A;  3D7S B;  2NWM A;  2AK5 A;  2FYK A;  1T0H A;  1IXD A;  2K5I A;  2QG9 B;  4M7A G;  1KK7 A;  1C0M A;  4EIK A;  1I07 A;  2QA4 A;  3X25 B;  4PJJ A;  1JRI A;  2J05 A;  1PNJ A;  4XK8 E;  3VRY A;  4C8Q A;  4RTT A;  1IHW A;  2DXT A;  1VQ6 T;  1UGS B;  2DMO A;  1VQ6 Q;  3CCR A;  2FPE A;  2XKO C;  1EZZ B;  3JCM X;  2A36 A;  5KH6 A;  1R0C B;  2FB7 A;  3M4G A;  1UHC A;  1VYT A;  1WXT A;  2PQW A;  2EGA A;  2LT1 A;  2QDL A;  5D6W A;  3VYG A;  2L3S A;  2E4H A;  2YRD A;  3MCA B;  1TTH B;  1MMN A;  3CME A;  2V26 A;  5GMK i;  3L42 A;  3CCM A;  4PLI A;  1JB0 E;  4M7A A;  1X2Q A;  2PZ1 A;  2QEX Q;  4ELY C;  4O5V A;  4FW1 A;  3OYN A;  3MEU A;  1W1F A;  2MYS A;  1GFD A;  2RO0 A;  1BI1 A;  3I55 T;  3OS0 A;  3I55 Q;  4BD3 A;  5GAN d;  2V8K A;  3FJ5 A;  1NM7 A;  3QO3 A;  4ZNX A;  2V8J A;  1WHM A;  1XQH A;  2CDT A;  4Y28 E;  1VQ5 T;  4C92 G;  1YHQ T;  1VQ5 Q;  4GBQ A;  1YHQ Q;  2GFA A;  3G71 T;  4PJO B;  1PWT A;  1W6X A;  5IXB A;  3G71 Q;  4NL3 A;  1LJO A;  2CSI A;  1R8O B;  2HBW A;  4NL2 A;  2QQS A;  1QLY A;  4J7I A;  2P4R A;  3CC2 Q;  3E2U A;  4M78 D;  4OGE A;  4JRQ A;  2D0N A;  1ABQ A;  4M7D B;  1LPL A;  3UWN A;  3G4S A;  1DJ7 B;  3HRT A;  4F7U E;  1ARK A;  2PU9 B;  2YXY A;  4QQ6 A;  2JM9 A;  3QUI A;  2LZ6 B;  2RK2 A;  2YRC A;  2JT4 A;  1HYO A;  3CD6 Q;  1NZ9 A;  1YIJ Q;  1RLQ C;  4ANJ A;  2X3X D;  2AZS A;  1X75 C;  2KE9 A;  1KSW A;  4J9F A;  2DJZ A;  4M75 F;  2GCX A;  2DF6 A;  1PHT A;  5A2Q E;  1VQN T;  1YJN Q;  2M51 A;  1M4Z A;  4RG2 A;  5CAI A;  2CT4 A;  3LGF A;  4LUE A;  2LNV A;  1NG2 A;  5KYW A;  2M1H A;  4J9H A;  4VUB A;  2RM4 A;  3ME9 A;  3V7S A;  1FMK A;  2OTJ A;  4M75 G;  1TU0 B;  4IUP A;  3E9G A;  1N5Z A;  2X4W A;  1HK9 A;  1XOV A;  1VQO T;  1IO6 A;  3REB B;  1ZBX A;  1G3S A;  2ECZ A;  2W10 A;  2GBQ A;  4IKF A;  8ATC B;  3N5B B;  1BIB A;  5DY9 A;  5GAN 4;  1OZ3 A;  2PUK B;  1UB4 A;  4BUG A;  5IXF A;  5LJ5 g;  4M78 C;  4YTL A;  2EQI A;  5AYF A;  2K3B A;  2ZPE B;  3KFV A;  2VB6 A;  1TS9 A;  1WA7 A;  4M75 A;  2RN8 A;  5I2S A;  2ZGW A;  1E6G A;  4D8K A;  1KG1 A;  3CXC S;  5GAN 8;  3SD4 A;  5FRM A;  2K3X A;  4FYW B;  2VUB A;  5GAO m;  4AFS C;  4ORZ A;  3CC4 T;  5FWB A;  1PM3 A;  3M0T A;  5DLO A;  2DL4 A;  4EMK A;  1PRL C;  2FRY A;  2QDY B;  4B6M A;  1K73 R;  3ER0 A;  1WIE A;  4OB3 B;  1OPL A;  1KQ2 A;  5J26 A;  3CCS Q;  3MPU B;  2KMT A;  2P0K A;  3NTH A;  2BZY A;  2HSP A;  2RHY A;  4RCB A;  4HVU A;  2HQX A;  4XU1 A;  2L2P A;  2DIG A;  2LJ1 A;  2X51 A;  4MML A;  3SWN A;  3EG9 A;  4MZT A;  4E7H A;  4PFZ A;  3QXE B;  4N0A C;  1QCO A;  3Q1J A;  2NYS A;  1OZ2 A;  1JEG A;  2XG8 D;  3G6E A;  4PJL A;  1YJ9 A;  2LJ3 A;  3JV3 A;  5A0D A;  2EYW A;  5GMK h;  3L2Q A;  1E6H A;  5LJ3 d;  1UGQ B;  2LCS A;  4C0Z A;  3JB9 H;  3MKD A;  4M7A D;  1ZSZ A;  4EMG A;  2Y90 A;  4J9D A;  1QCF A;  1X6B A;  1NYF A;  2KYM A;  3LLR A;  2H8H A;  2YHT A;  4GLM A;  1OU8 A;  2HD0 A;  2DZ9 A;  3NTK A;  2PUO B;  4F04 B;  1SSH A;  2K6D A;  2RI3 A;  3RMS A;  4Z89 A;  5M9O A;  1SG5 A;  3CCR Q;  1K73 U;  2FEI A;  2DEU A;  2NUP B;  5CKE A;  1LVK A;  1AWW A;  1HXD A;  4QVC A;  2DBM A;  3M53 A;  1SRM A;  3ZEH A;  1O75 A;  1K76 A;  5KYN A;  1P92 A;  5FWC A;  2RI2 A;  1X69 A;  2LCL A;  1NJI R;  3J7A F;  3SEM A;  2J6K A;  1EFN A;  2HZY A;  5D7U A;  4F7U F;  1C6V X;  5CK9 A;  5LJ5 j;  4JS4 A;  3S3O A;  3QSU A;  1K8A U;  1TSF A;  2L3R A;  5KYU B;  1VQL T;  4Z8A A;  1VQL Q;  1D1A A;  1WDX A;  2EBP A;  3S3N A;  3CBM A;  4C92 D;  1M3B A;  4FW2 A;  4F7U G;  2EKO A;  1IGU A;  5KYY A;  2RK1 A;  5LJ5 d;  4OB1 B;  1Y57 A;  5HK3 A;  4M7A C;  2JXB A;  2QYZ A;  3O5Z A;  3EFO A;  3GNF B;  2O4X A;  1SSF A;  2C06 A;  2D1X A;  3DB3 A;  1Y96 B;  1UJY A;  1NE8 A;  1WZO A;  5GMK j;  2LJ0 A;  4DOW A;  2BZ8 A;  3JCM Q;  3T9N A;  2AKL A;  5GMK m;  3CCQ A;  2RQV A;  1B34 B;  4E2F B;  4C5I A;  1NJI U;  1FMW A;  1OU9 A;  2A3L A;  5GAN 2;  2XIC A;  2YLC A;  2M16 A;  3CXC P;  2LC4 A;  4F7U A;  1VQP A;  4CC4 B;  3I5S A;  2QAS A;  3UAT A;  1KC8 R;  2IVW A;  4OMF B;  2EGE A;  2JS2 A;  1WXB A;  2EFI A;  2RHZ A;  3OYF A;  3EGX B;  1S1N A;  1SPK A;  4M75 D;  4M77 E;  1ZUU A;  3JB9 G;  3M0U A;  3CC7 A;  2E65 A;  1M3A A;  3P8D A;  3TQ7 P;  4HKE A;  4C92 C;  2DTH A;  2HDA A;  1MNE A;  2E10 A;  4L59 A;  3QBY A;  4M78 B;  5CKD A;  2FRW A;  1V76 A;  2HNI A;  2LCC A;  4MDW A;  2ZAE A;  3E9F A;  2HKN A;  3RDV A;  3EGD A;  1ZQ1 A;  2DX1 A;  1PC0 A;  3C95 A;  2O88 A;  2CP7 A;  1WHK A;  1ZSG A;  2RA2 A;  3DLL A;  2YSQ A;  4EMH A;  5GAM f;  4J6X A;  2EPD A;  2FO0 A;  1KC8 U;  1ZLM A;  1EX4 A;  3J81 E;  3EFS A;  3OYE A;  3OYA A;  2CZ1 B;  5HCK A;  3GIB A;  2X3W D;  3G7Z A;  2KRM A;  1N9R A;  2HL5 C;  1ZA2 B;  5LJ5 e;  5I21 A;  3V8K A;  2KDS A;  4CRI A;  3CCU T;  1I4K 1;  1QVG S;  2QAZ A;  3CCU Q;  4KUI A;  4HCK A;  1G8X A;  2RF0 A;  4J9I A;  4M75 C;  2FVU A;  3LWI A;  2E5Q A;  5GAO p;  1UG1 A;  2P0Q A;  1Y07 A;  2FZG B;  1TG0 A;  4PFP A;  5HK0 A;  4MMK A;  4XTU A;  1VQ8 T;  2ATC B;  1VQ8 Q;  2DVE A;  5IH2 A;  3S3M A;  1JQQ A;  2L3Q A;  3P8H A;  4EMK C;  1OYX A;  3LW5 E;  1YJ9 T;  1YJ9 Q;  4IUV A;  3M9Q A;  3FEO A;  2E70 A;  2RD1 A;  1BCO A;  4FYY B;  3TSW A;  4A53 A;  3AHU A;  3EHR A;  2WSC E;  4JZ3 A;  4E7L A;  1UEC A;  1U3O A;  1QCN A;  3SWN C;  2EJ9 A;  3HFN A;  4J6Y A;  1X43 A;  2F2X A;  1RAB B;  3H41 A;  3WVE B;  2BZX A;  3OMC A;  3X20 B;  1AEY A;  4LN2 A;  5J3B A;  1GBQ A;  2JTF A;  4JZ4 A;  2GFU A;  3PMT A;  4R55 A;  2KXC A;  4BI8 B;  2K57 A;  2MK5 A;  3RKX A;  5GAN f;  2DTO A;  4FSS A;  1BCM A;  4HVW A;  2F5K A;  1RAF B;  1IZ6 A;  4OML A;  3UDC A;  3CEY A;  2GF7 A;  1T3S A;  5I2M A;  2E5K A;  2OTL T;  4EDU A;  2OTL Q;  2K7A A;  4PJO E;  3S6W A;  3VYH B;  1AWO A;  2YUQ A;  4OP0 A;  2HQE A;  2MWO A;  2DKG A;  3QZ5 B;  4E7I A;  4QQG A;  1QVF P;  1RUW A;  2RPN A;  1PG5 B;  1VQ4 T;  4MZP A;  4J9C A;  4M7A B;  1D0X A;  2KR3 A;  2EAY A;  3OYI A;  3PVQ A;  1UE9 A;  4FT4 A;  1B3Q A;  1G2B A;  1N6A A;  3JCM g;  1G5V A;  1GCQ A;  2ZCF B;  3OYM A;  5GAN 6;  4Z88 A;  1BYM A;  3VUB A;  1S72 A;  2OAU A;  3PT9 A;  4C8Q G;  4M77 F;  4BI4 A;  2AT1 B;  2RB6 A;  2WAC A;  1NJI C;  3QII A;  1MGQ A;  1W70 A;  4OMP A;  1PSF A;  1WGS A;  2R57 A;  3OW2 A;  2FPD A;  2XID A;  1D1C A;  4ZGD B;  3CCQ Q;  1Q82 C;  4KT0 E;  4PFO A;  2RMO A;  4F14 A;  4A63 B;  1AVZ C;  4KGX B;  3GBQ A;  1AZG B;  4J7F A;  3IQL A;  4LNP A;  5KYX A;  1BI3 A;  1Q7Y C;  3M4Y A;  4IIO A;  3E19 A;  3LH5 A;  5CO7 A;  5KE3 A;  3ASK A;  3JB9 D;  1QVG P;  2KBT A;  4C92 B;  4Y91 A;  3I9Q A;  2VXF A;  3HTR A;  3CCJ A;  2FZK B;  4L6V 5;  2LX7 A;  1K0X A;  1XJW B;  2HCK A;  2EQU A;  2RJC A;  3CQT A;  4B9X A;  2DRM A;  3TU4 K;  2FG0 A;  4ESR A;  2DTI A;  4N4H A;  5KYW B;  4M77 A;  1WPY A;  3UA6 A;  3PIP A;  3QWX X;  3CXC A;  2EYQ A;  2KEA A;  2OI3 A;  4LDX A;  1D0Z A;  1VIF A;  1WHG A;  2H3E B;  2LQ8 A;  4RTY A;  4BI3 A;  3OBW A;  2QEX T;  3P8B B;  1E7O A;  1MMG A;  2F2W A;  1X6G A;  1KC8 C;  2GQI A;  1YIT A;  1Q86 C;  3LH0 A;  1MND A;  3SFM A;  3VUZ A;  1UHF A;  4JLG A;  3NMZ C;  5FU6 B;  3CCE T;  4JRK A;  3CCE Q;  2GGR A;  3L2U A;  3NPF A;  4JS5 A;  1VOM A;  1MV3 A;  4BE2 A;  1J3T A;  4AFZ C;  1IHV A;  3H8Z A;  2K3Y A;  1Q81 R;  3CC2 T;  4XU0 A;  4M75 B;  4LUD A;  2EQJ A;  3UA7 A;  1VQ9 A;  5LJ3 f;  2DIQ A;  1I5O B;  2E3H A;  3CD6 T;  7AT1 B;  1ZX6 A;  2RHI A;  1YIJ T;  1SF9 A;  3OSV A;  1H8K A;  3NTI A;  2LQK A;  5FU7 C;  2DD4 A;  2EVR A;  4EMK B;  3QDF A;  3WXM B;  2B86 A;  2K9G A;  3JCM d;  2EYZ A;  2LRQ A;  1M3C A;  4DBQ A;  4K11 A;  5GMK l;  5KE2 A;  3BDL A;  1YJN T;  3VV0 A;  1Y7X A;  4J5Y A;  1M1K C;  2ZPB B;  2J06 A;  5GAO n;  4WF2 A;  2X9H A;  4PJO F;  4NS5 A;  5A0L A;  3SWN B;  4ATO A;  3EG9 B;  4LDU A;  3OW2 S;  4RTV A;  1BB9 A;  4XTW A;  1HD3 A;  2DA9 A;  1BKB A;  3CCV A;  1KD1 C;  2G3R A;  2QXF A;  3EGU A;  3FJP A;  3EH2 A;  4MZM A;  4C5H A;  5HY6 A;  2JVV A;  2CUB A;  1LCK A;  4QT7 A;  1QP3 A;  2EYY A;  2MI6 A;  4XTX A;  4Q5W A;  3H6Z A;  3CCL A;  2HEQ A;  2QQB A;  2P84 A;  2CP3 A;  2A37 A;  2P0P A;  4OMQ A;  4C0G A;  1T3L A;  1IRX A;  4QQD A;  2V1Q A;  3JCM c;  3A8G B;  2E3I A;  2XDB A;  2PNI A;  2ROT A;  2DNU A;  4LDV A;  4E6R A;  3VRZ A;  3OYJ A;  1TWB A;  4J9G A;  3RER A;  4PJO A;  1AOJ A;  2R5A A;  3GLX A;  2LTO A;  2EJF A;  1CKB A;  2KSS A;  2L0A A;  2DAQ A;  2OX7 A;  4BB7 A;  3CCS T;  1LOJ A;  2HSE B;  4DA4 A;  3NHN A;  3PFS A;  4C8Q D;  1FWZ A;  1M8V A;  2CYZ B;  1V29 B;  1QWF A;  4RTU A;  3VS2 A;  2GNC A;  1JJ2 A;  1PSE A;  2D8J A;  5GAO r;  3VS4 A;  4KRT A;  2F2V A;  3RBB B;  3VS7 A;  1QKX A;  4P5N A;  1WHL A;  1ZBJ A;  4WTO B;  2D0Q B;  4FYV B;  1QVF A;  1WX6 A;  2J6O A;  1PRM C;  4M77 D;  3MEW A;  1IGQ A;  2MF2 A;  3X28 B;  4E7Z A;  3CMA T;  3OA6 A;  3CMA Q;  3JCM e;  3EFO B;  1VUB A;  2NUT A;  1H92 A;  1GCQ C;  3ZFJ A;  2O4X B;  4L5G A;  5IN1 A;  2XDD A;  1VQ7 A;  3I56 A;  2Y4Y A;  3C12 A;  2IG0 A;  1VQK A;  2QA4 T;  2QA4 Q;  3RUX A;  2QGF B;  5GAN 5;  3THK A;  1RAE B;  4JJB A;  1FX7 A;  1YJW A;  4RTW A;  3OYG A;  4OMO A;  2HAX A;  1M2O A;  3CCR T;  4F7U B;  1VA7 A;  1OUL A;  1MMD A;  2R58 A;  2LNH B;  1YWO A;  2O2O A;  3RNJ A;  3EHQ A;  3C0C A;  4ZN1 A;  3BW1 A;  2G6F X;  1YWP A;  2MCN A;  2CKK A;  5CKF A;  5GJV B;  4FYX B;  3CME T;  3A8L B;  3CME Q;  1IRE B;  3PE0 A;  3GNG A;  2DFU A;  2QK0 A;  4OF1 A;  1WXU A;  3CCM T;  3UPU A;  3CCM Q;  4C8Q C;  2MOX A;  2V8I A;  4A54 A;  1Z9Z A;  2HMA A;  2GTO A;  2VYT A;  2JMA A;  1BU1 A;  3TVT A;  1Q82 R;  1QVG A;  3OW2 P;  2F69 A;  4OMM A;  2AKK A;  4CC7 A;  4M77 C;  2QQ9 A;  2RJD A;  5L23 A;  4JUV A;  1Q7Y R;  5I22 A;  2JTE A;  3EGD B;  2PVO B;  2DL8 A;  3QKJ A;  2DD5 A;  3EH1 A;  1N9S A;  3V8L A;  2RNA A;  4IUQ A;  3M56 A;  2E41 A;  1NLO C;  5FU7 B;  1C1A A;  2K5F A;  2R5M A;  3G4S T;  2D8H A;  1RAI B;  3G4S Q;  3LWH A;  1OOT A;  2YUP A;  3FB9 A;  3VKI A;  1MMA A;  2WSE E;  1PD0 A;  2CZ7 B;  1K9A A;  5DLQ E;  4IUR A;  2EJG A;  1YI2 A;  1Q82 U;  6AT1 B;  5FLX E;  2M0O A;  1JJ2 S;  4XQ3 A;  1Q86 R;  2MAM A;  3FIF A;  1B7T A;  5A0G A;  4DEY A;  1Q81 C;  1QVF S;  2O01 E;  1Q7Y U;  3LYI A;  8AT1 B;  2X4Y A;  4HCZ A;  1NPR A;  2OTJ T;  3UT1 A;  2MWP A;  2OTJ Q;  4BE0 A;  3OBY A;  2D9T A;  3CCV Q;  2NUP A;  1A0N B;  5GJW B;  2XHC A;  4XTV A;  1YBY A;  2CS7 A;  2YDL A;  1D1B A;  1M2V B;  4R56 A;  1VQ6 A;  4GLK A;  5FRO A;  3L2R A;  4C0D C;  2VGM A;  1YCS B;  2KNB B;  2DXB A;  3KUF A;  3M0Q A;  2YT6 A;  3J80 E;  2VC8 A;  4BDY A;  1KQ1 A;  3JCM W;  1Q86 U;  2DO3 A;  1UEB A;  4J6W A;  2H3J A;  3I5R A;  3R6N A;  1M1K R;  5GAM g;  4PJM A;  2VAS A;  1U5S A;  3RES A;  4RTZ A;  3R6O A;  3I55 A;  3FC3 A;  2IIM A;  1QQJ A;  3GF5 A;  3LGL A;  2DL3 A;  3FRN A;  2I0N A;  1VQ5 A;  1YHQ A;  1KD1 R;  2CP2 A;  4M78 F;  1HSQ A;  1UFF A;  3G71 A;  1RAG B;  1Y96 A;  1KQS A;  1WJR A;  4DEX A;  4KUD K;  1AD5 A;  1N8R R;  1SHG A;  5GAM h;  2EKH A;  3QJY A;  2A08 A;  1T0J A;  2QQA A;  1GXI E;  1F1B B;  4E47 A;  2AHJ B;  2MIO A;  2C0T A;  4M4Z A;  3V7C A;  3G6E T;  4C92 E;  3G6E Q;  2GTJ A;  2DYI A;  3SB2 A;  1GFC A;  2XI9 A;  2K2M A;  2A7Y A;  3A5Z B;  5GMK e;  4A4F A;  1BBZ A;  1WQ7 A;  1M1K U;  3L2Z A;  4BDZ A;  3I56 Q;  3MET A;  3L2W A;  2QGG A;  1NPP A;  1VQN A;  3BE3 A;  4JRP A;  3PTA A;  3ZL7 C;  2DBK A;  1G3Y A;  1MUZ A;  1YJW T;  1R77 A;  2J7I A;  2YRV A;  1YJW Q;  2BTT A;  2C0O A;  1KD1 U;  5KYX B;  2CH4 W;  1ZSZ C;  4JPB W;  2YUO A;  3OQ5 A;  3OS2 A;  2CUD A;  4C8Q B;  1VQO A;  5KCH A;  3A1P A;  2CT3 A;  4C5G A;  1BI0 A;  1TOV A;  2KT8 A;  3NGP A;  2HBP A;  5GAN g;  3OMG A;  4RKU E;  2RJF A;  5D6X A;  1OQK A;  4IIM A;  1JJ2 P;  2RQT A;  2DM1 A;  4WCI A;  1U06 A;  1RI0 A;  2LDM A;  4EPC A;  3VS3 A;  1EIF A;  4M7D E;  1JO8 A;  4OB0 B;  2KYB A;  1QWE A;  1JXO A;  1NYG A;  1JU5 C;  5GAN h;  1AWJ A;  3INZ A;  3QJ6 A;  2L5Q A;  5GAM j;  1JBM A;  2KQW A;  2A0F B;  2DJQ A;  9ATC B;  4LXC A;  3JCM f;  3CC4 A;  1ACM B;  4PK4 A;  4N0A A;  3WVD B;  3OYL A;  2QTV A;  1VQM A;  1WNL A;  4PL6 A;  2ROL A;  2XDP A;  3VU3 C;  2BKD N;  1QVP A;  4BY6 C;  3HFO A;  5GAO q;  3QYG B;  3SDZ A;  1KHC A;  3L1A A;  3CCQ T;  4M77 G;  4PKC C;  4HXJ A;  2JM8 A;  3VJP A;  2DER A;  4FU6 A;  1KQS S;  4CC3 A;  3QG1 A;  5EC7 A;  1VQP T;  1BI2 A;  3EFR A;  2CGH A;  3OSS C;  1VQP Q;  1WQW A;  4XU2 A;  3JCM J;  1TUG B;  3M0R A;  1NBE B;  1WJS A;  3LX7 A;  1SEM A;  2DL5 A;  1XTD A;  4XTZ A;  4A4E A;  2C0I A;  4E7J A;  3CC7 T;  3CC7 Q;  2E64 A;  1GCP A;  2RH2 A;  2KK4 A;  1WI7 A;  1KIK A;  1I81 A;  2JJ9 A;  2FL7 A;  2L89 A;  1KJW A;  4C0D B;  3CPF A;  2D6F A;  1JXM A;  2F1L A;  5CVI A;  1ZA1 B;  1U8R A;  2X4X A;  3EG1 A;  1BK2 A;  4LE9 A;  4RG8 A;  1K9M C;  3VS6 A;  4IUU A;  1MHN A;  5CQY A;  1X27 A;  3MP8 A;  2ENM A;  3DB4 A;  2ZZD A;  5GAN j;  1NEB A;  2E12 A;  3M55 A;  1NLP C;  2NUZ A;  2V1R A;  4RTX A;  1W2B A;  3RKY A;  4C92 F;  3PNW C;  3ULR B;  2PTK A;  4OVA A;  3CPW A;  1D3B A;  4RUG A;  2FPF A;  1O9S A;  2ZPG B;  1VQL A;  2K4Y A;  1G83 A;  4LD9 K;  1Q95 G;  1AT1 B;  1ABO A;  3JCM V;  2RQU A;  3E1S A;  2VWF A;  2BUD A;  2FZC B;  1IB8 A;  3MP1 A;  1M90 C;  2ED0 A;  2MPX C;  4X1V A;  5J39 A;  2RI5 A;  1M1F A;  5LJ3 g;  5GAM e;  2LQW A;  4RCC A;  5C0M A;  2SEM A;  3OYH A;  2VGN A;  2P4T A;  4KH0 B;  1KFZ A;  3JAM E;  1RLP C;  2EYX A;  1M5Q 1;  3M0P A;  1PD1 A;  1YCY A;  2JOY A;  3BFM A;  2MMP A;  2HKQ B;  4FSX A;  3PIO A;  1X6O A;  2KRN A;  3H0I A;  5LJ3 h;  4C92 A;  1RI9 A;  5IHN A;  1Q81 U;  1NEG A;  1VQN Q;  4M7D F;  2NUT B;  2DE0 X;  3EG2 A;  1AHJ B;  4PJO G;  4AFU C;  1N8R C;  3A8H B;  1ZSZ B;  1BIA A;  1YNZ A;  2K79 A;  4KH1 B;  1SKU B;  4II1 A;  2X4J A;  1I8F A;  4M7D G;  3PGG A;  4FM4 B;  2LQN A;  3CBO A;  4A4G A;  3U23 A;  1VQO Q;  2OJ2 A;  1K0S A;  1KQS P;  2A28 A;  2OAW A;  1XNI A;  3EG0 A;  4LDW A;  2DIL A;  4KGV B;  1N27 A;  1TUD A;  1ZHI A;  3PVL A;  4C0F A;  5LJ5 f;  1YFN A;  4QVZ A;  4CI0 C;  4A4K A;  3KBG A;  3GP8 A;  2PVD B;  1HJD A;  4ZTJ A;  1PCX A;  4HCC A;  2RJE A;  4UC4 A;  4JJN K;  2COY A;  5IAY A;  3H0F A;  2BE9 B;  1M9S A;  3M54 A;  2L8D A;  3UF4 A;  4JRI A;  1VYV A;  2XK0 A;  3HRU A;  4DOV A;  3RMQ A;  2ZPF B;  2YWW A;  5GAN e;  4M7D A;  5D6Y A;  2CH4 A;  2B8A A;  3MO8 A;  1S72 T;  2JMC A;  1S72 Q;  1W2B S;  5CIU A;  1SHF A;  5LJ5 h;  3HL8 A;  2LT4 A;  3CC4 Q;  4BY6 B;  2XMF A;  2DYB A;  3CBP A;  3CPW S;  2RHX A;  4XU3 A;  1UGR B;  1R0B G;  4XTY A;  1VQM T;  3CCU A;  1VQM Q;  5KYY B;  1MV0 B;  1QMC A;  4X34 A;  5ECA A;  1QP2 A;  1TXQ A;  1GL5 A;  2K5L A;  2CSQ A;  2QTX A;  2RQR A;  3HPW A;  5LJ3 j;  4R0K A;  2HQH A;  2KY9 A;  4TVR A;  3REA B;  1UJ0 A;  4XAX B;  5EG2 A;  3RKW A;  1VQ8 A;  2BIV A;  3H9N A;  1VIE A;  2EQK A;  1FMV A;  2DVJ A;  2CZ0 B;  2Z0W A;  4N4G A;  4M78 E;  2O9S A;  3OS1 A;  5AT1 B;  2F5T X;  1G3T A;  4J9B A;  1K8A R;  2LVM A;  1W4S A;  2ABL A;  2EWN A;  5I11 A;  4FL6 A;  3CCJ T;  3CCJ Q;  4MDX A;  2DZC A;  5CQX A;  1WFW A;  1RAH B;  3M58 A;  3QWY A;  2XD0 A;  5LL6 S;  3DLM A; 
#chains in the Genus database with same CATH homology
 2AZS A;  4Z88 A;  2KE9 A;  1KSW A;  3EG3 A;  4J9F A;  4AG1 C;  2DF6 A;  1PHT A;  3I5R A;  3H0H A;  3R6N A;  1VYU A;  1U5S A;  2M51 A;  4RTZ A;  1W70 A;  2CT4 A;  4LUE A;  4OMP A;  4F16 A;  1NG2 A;  4J9H A;  2IIM A;  2FPD A;  4OMN A;  2DL3 A;  1FMK A;  2I0N A;  2L3P A;  2RMO A;  1HSQ A;  1UFF A;  4F14 A;  1N5Z A;  4A63 B;  1AVZ C;  1XOV A;  4DEX A;  1IO6 A;  1AZG B;  3GBQ A;  1AD5 A;  3REB B;  3IQL A;  2ECZ A;  2W10 A;  1SHG A;  2GBQ A;  4LNP A;  5FW9 A;  2EKH A;  2A08 A;  1SRL A;  1V1C A;  1T0J A;  4IIO A;  1PKT A;  1YP5 A;  3LH5 A;  1UTI A;  2MIO A;  2C0T A;  5IXF A;  2KBT A;  4M4Z A;  3I9Q A;  2GTJ A;  2EQI A;  2K3B A;  2LX7 A;  2W0Z A;  1GFC A;  3I35 A;  1K0X A;  2K2M A;  3KFV A;  2HCK A;  1BBZ A;  3CQT A;  2DRM A;  1TUC A;  1WA7 A;  2FG0 A;  4ESR A;  2RN8 A;  3UA6 A;  1E6G A;  4D8K A;  3QWX X;  2OI3 A;  2KEA A;  2YUN A;  3TSZ A;  4RTY A;  2LMJ A;  3ZL7 C;  2DBK A;  1E7O A;  1MUZ A;  4AFS C;  4ORZ A;  2J7I A;  2F2W A;  5FWB A;  3M0T A;  1X6G A;  2BTT A;  2C0O A;  2GQI A;  2ED1 A;  2CH4 W;  2DL4 A;  1PRL C;  2KT1 A;  2FRY A;  1UHF A;  3NMZ C;  1WIE A;  1OPL A;  4HVV A;  4JPB W;  2YUO A;  2GGR A;  2CUD A;  3NPF A;  2BZY A;  2HSP A;  2CT3 A;  2KT8 A;  1MV3 A;  3NGP A;  4HVU A;  2EW3 A;  4J9E A;  2L2P A;  1J3T A;  2LJ1 A;  4AFZ C;  4IIM A;  2LP5 A;  2RQT A;  1I1J A;  2DM1 A;  2DRK A;  4CC2 A;  1CSK A;  4WCI A;  1PKS A;  1JEG A;  1U06 A;  1ZUK A;  4LUD A;  3UA7 A;  2LJ3 A;  3VS1 A;  3JV3 A;  3VS3 A;  1GRI A;  2EYW A;  2KRS A;  1E6H A;  1JO8 A;  4AFQ C;  2LCS A;  2KYB A;  1QWE A;  1JXO A;  1NYG A;  4J9D A;  1GBR A;  1JU5 C;  1QCF A;  2O31 A;  1ZX6 A;  1X6B A;  1AWJ A;  1H8K A;  1NYF A;  2KYM A;  1M30 A;  2H8H A;  2EVR A;  4GLM A;  2DJQ A;  2B86 A;  2K9G A;  2EYZ A;  1SSH A;  2K6D A;  4AG2 C;  2RQW A;  1I0C A;  1M3C A;  4K11 A;  4Z89 A;  2FEI A;  2J06 A;  4JJC A;  2ROL A;  1WLP B;  3VS0 A;  1AWW A;  2DBM A;  4RTV A;  1SRM A;  1K76 A;  1BB9 A;  2CRE A;  1HD3 A;  1ZUY A;  2DA9 A;  2O9V A;  4HXJ A;  2JM8 A;  5FWC A;  3EGU A;  1X69 A;  4CC3 A;  5EC7 A;  3SEM A;  2J6K A;  1EFN A;  2J6F A;  2CUB A;  1LCK A;  3M0R A;  4QT7 A;  2EGC A;  2EYY A;  2HEQ A;  1SEM A;  2DL5 A;  4Z8A A;  1AWX A;  1WDX A;  2EBP A;  2DLP A;  2A37 A;  4OMQ A;  1M3B A;  2C0I A;  1T3L A;  2V1Q A;  1GCP A;  1Y57 A;  1WI7 A;  1KIK A;  1OPK A;  2JXB A;  2PNI A;  2ROT A;  2DNU A;  4Y92 A;  1KJW A;  4E6R A;  3VS5 A;  3O5Z A;  3VRZ A;  1JXM A;  4J9G A;  1AOJ A;  2D1X A;  2M0Y A;  1UJY A;  3EG1 A;  1BK2 A;  4LE9 A;  1M8M A;  2DL7 A;  2LJ0 A;  3VS6 A;  1CKB A;  2BZ8 A;  2VVK A;  2SRC A;  2KRO A;  1X27 A;  2AKL A;  2ENM A;  2RQV A;  2L0A A;  1H3H A;  1NEB A;  1NLP C;  2NUZ A;  2V1R A;  3NHN A;  2VKN A;  1QKW A;  4RTX A;  1AZE A;  4CC4 B;  1Z9Q A;  1QWF A;  3I5S A;  1FYN A;  1YN8 A;  4RTU A;  2GNC A;  2PTK A;  3UAT A;  3ULR B;  3VS2 A;  2JS0 A;  2D8J A;  2EGE A;  1OEB A;  3VS4 A;  4KRT A;  2F2V A;  3RBB B;  2AZV A;  4RUG A;  1QKX A;  3VS7 A;  1ZBJ A;  2FPF A;  2JS2 A;  3A98 A;  4F17 A;  1WXB A;  1OV3 A;  1G83 A;  1S1N A;  1WX6 A;  1ABO A;  2J6O A;  1SPK A;  1PRM C;  2RQU A;  1K1Z A;  2VWF A;  1ZUU A;  1H92 A;  1GCQ C;  3M0U A;  1M3A A;  4JJD A;  1UDL A;  2ED0 A;  2HDA A;  4X1V A;  1UGV A;  2LQW A;  3THK A;  2FRW A;  1UUE A;  3SHW A;  4JJB A;  2SEM A;  4RTW A;  4OMO A;  1Y0M A;  1KFZ A;  1VA7 A;  2DX1 A;  1RLP C;  1WYX A;  2EYX A;  2LNH B;  3M0P A;  2O88 A;  1YWO A;  2O2O A;  3RNJ A;  3EHQ A;  3C0C A;  1ZSG A;  2YSQ A;  2G6F X;  1YWP A;  5IHI A;  2JW4 A;  2MCN A;  3H0I A;  2EPD A;  2KRN A;  2FO0 A;  1ZLM A;  5GJV B;  1RI9 A;  1B07 A;  4D8D A;  2KGT A;  3PE0 A;  5IHN A;  1X2K A;  1NEG A;  1WXU A;  2DE0 X;  2KXD A;  3EG2 A;  5HCK A;  2MOX A;  4AFU C;  1CKA A;  2X3W D;  2ESW A;  2KRM A;  1Z9Z A;  5IHK A;  2GTO A;  1K4U S;  3M0S A;  2JMA A;  1BU1 A;  3TVT A;  1YNZ A;  1M27 C;  2K79 A;  4OMM A;  4HCK A;  2AKK A;  2NWM A;  2AK5 A;  2RF0 A;  4J9I A;  1T0H A;  4CC7 A;  2LQN A;  3U23 A;  5L23 A;  2OJ2 A;  1K0S A;  2A28 A;  2OAW A;  4EIK A;  3EG0 A;  2JTE A;  1I07 A;  1UG1 A;  5I22 A;  2DIL A;  1TUD A;  2DL8 A;  2J05 A;  3PVL A;  1PNJ A;  1TG0 A;  3VRY A;  4RTT A;  1HJD A;  2RNA A;  2DMO A;  5IH2 A;  1JQQ A;  2L3Q A;  2FPE A;  2A36 A;  3H0F A;  1NLO C;  1UHC A;  1VYT A;  3UF4 A;  2D8H A;  1WXT A;  1VYV A;  2EGA A;  1OOT A;  2QDL A;  2YUP A;  3TSW A;  3EHR A;  4JZ3 A;  1UEC A;  2L3S A;  1U3O A;  1K9A A;  2CH4 A;  1X43 A;  2F2X A;  3H41 A;  2BZX A;  2JMC A;  1X2Q A;  2PZ1 A;  1AEY A;  1SHF A;  4LN2 A;  2XMF A;  2DYB A;  1GBQ A;  4JZ4 A;  1W1F A;  1GFD A;  2KXC A;  1MV0 B;  3FJ5 A;  4FSS A;  5ECA A;  4DEY A;  4HVW A;  1NM7 A;  4ZNX A;  1GL5 A;  4OML A;  2CSQ A;  2CDT A;  1T3S A;  2RQR A;  4GBQ A;  2E5K A;  4R0K A;  1PWT A;  1W6X A;  2K7A A;  1UJ0 A;  3REA B;  5IXB A;  1A0N B;  1AWO A;  2YUQ A;  5GJW B;  2CSI A;  2HBW A;  2YDL A;  1QLY A;  2DVJ A;  2P4R A;  2O9S A;  2D0N A;  1RUW A;  2RPN A;  1ABQ A;  4J9B A;  4J9C A;  2ABL A;  5I11 A;  1ARK A;  2JM9 A;  1YCS B;  2LZ6 B;  2KR3 A;  2KNB B;  3PVQ A;  2JT4 A;  1UE9 A;  1B3Q A;  1G2B A;  3M0Q A;  2YT6 A;  1WFW A;  1RLQ C;  1GCQ A;  3QWY A;  2X3X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...