1PKTA

Structure of the pi3k sh3 domain and analysis of the sh3 family
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
b'EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Structure of the PI3K SH3 domain and analysis of the SH3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase
total genus 11
structure length 76
sequence length 76
ec nomenclature ec 2.7.1.137: Phosphatidylinositol 3-kinase.
pdb deposition date 1994-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pktA00
4DEYA 1GBRA 2KYBA 2F2WA 2J7IA 2EPDA 1ZSGA 1AOJA 4OMQA 3I9QA 1MUZA 1OPLA 2VVKA 1SPKA 5FWCA 1UFFA 1Y0MA 1M27C 1T0JA 3H0HA 2KNBB 3VS4A 1X2QA 4Z8AA 2JS0A 2DJQA 1K1ZA 2J6KA 5IHKA 1GCPA 2C0TA 1LCKA 3EG0A 1G2BA 1IO6A 1FMKA 2GQIA 1UJYA 1QLYA 4J9IA 4AFUC 1WIEA 2LZ6B 4JPBW 1PNJA 3EG3A 4D8KA 1PWTA 1UECA 4HCKA 1NYFA 2FPEA 2GBQA 4OMNA 1FYNA 4OMOA 2YT6A 1U5SA 3TSZA 3M0QA 2FO0A 3TSWA 2EKHA 2L3PA 1OEBA 1VA7A 4HVUA 2OAWA 2DLPA 3EHRA 2P4RA 2O9VA 2JMAA 3EGUA 3I5RA 3RBBB 1BK2A 2BZ8A 2FEIA 1WXBA 3PVLA 2KRSA 4HVWA 4OMLA 1WFWA 1ZUYA 2LQNA 3VS1A 1M30A 1M8MA 3JV3A 2CSQA 3UF4A 3REBB 4AG1C 1B07A 1CKAA 1SSHA 1QCFA 2JT4A 2JTEA 2DX1A 3EG1A 3M0SA 2BZYA 2C0IA 2KXCA 4GLMA 1BU1A 1W1FA 1RUWA 1K9AA 4LUDA 3R6NA 1KIKA 3PVQA 2O2OA 2K6DA 3UA7A 2OI3A 1AEYA 3VS2A 1N5ZA 2HBWA 2DNUA 2YDLA 1GBQA 1T0HA 3VRYA 2K9GA 4E6RA 4KRTA 3O5ZA 2G6FX 1E6GA 1UHCA 5IH2A 2EYXA 2AKKA 2HCKA 5IHIA 1YWOA 4ESRA 4AFSC 1H3HA 1HJDA 2DRKA 3NHNA 1QKWA 4ZNXA 2KBTA 2KROA 2DL7A 2RPNA 4JZ3A 1PKTA 1ZX6A 4R0KA 1H8KA 1RLPC 1MV0B 3NMZC 2DL4A 2CUBA 2AZSA 3M0UA 2CDTA 1ABOA 2GGRA 2LX7A 4RTXA 1HSQA 1X69A 2C0OA 3NGPA 4RTTA 2GTJA 1NLOC 3H0IA 2A08A 4AFQC 1X6GA 1I07A 1CSKA 4J9EA 4CC2A 1MV3A 4RTVA 2RQRA 4J9DA 2PNIA 3H41A 1UE9A 2MCNA 2K7AA 2KRNA 4JZ4A 2F2VA 1WX6A 4OMPA 3M0PA 1X43A 2LMJA 5I22A 1NM7A 4JJCA 2EYZA 2FG0A 4X1VA 1NYGA 1X6BA 1W70A 1AWOA 3NPFA 1X27A 2L3SA 2RN8A 1TG0A 3U23A 3EG2A 2EW3A 4LE9A 1B3QA 1WYXA 4HVVA 1ZUUA 3KFVA 3M0TA 1TUCA 2DA9A 4HXJA 2BZXA 1JXMA 2DF6A 2ED1A 2KT1A 2FRWA 1RLQC 2D1XA 5IXBA 1NG2A 2V1RA 3VS0A 1GFCA 1JU5C 2HSPA 2DM1A 2NWMA 2KR3A 1XOVA 1A0NB 4QT7A 1QWFA 2CUDA 2F2XA 3TVTA 2DE0X 1YWPA 5IHNA 2ENMA 2DL8A 3EHQA 2A36A 2B86A 3VS3A 4F17A 2MIOA 4J9FA 4F14A 2CT3A 4CC3A 2ROTA 1WDXA 3C0CA 3SHWA 1HD3A 1TUDA 1VYTA 4CC7A 1AVZC 5FW9A 2LJ1A 2PZ1A 2XMFA 1SRLA 2K2MA 1YP5A 1ARKA 1SRMA 2K3BA 3VS6A 2X3XD 2LJ3A 2DILA 2KEAA 2RNAA 3A98A 1Y57A 5HCKA 4Y92A 1WXUA 1KSWA 2EVRA 2FPFA 2JM9A 4LNPA 5EC7A 1SHGA 1UHFA 2LJ0A 1PRLC 2L3QA 1T3LA 2OJ2A 3M0RA 2M51A 2JMCA 2HDAA 1UDLA 1JXOA 2EBPA 1GCQC 1UGVA 1BBZA 1NEGA 2FRYA 1QWEA 2DVJA 1UJ0A 2RF0A 1SHFA 3VS5A 2KGTA 4LN2A 2K79A 4AG2C 1K0XA 4AFZC 2O9SA 2GNCA 1Z9QA 5L23A 1VYUA 4OMMA 2CT4A 2RQWA 2KYMA 1M3BA 2ED0A 2SRCA 1ZLMA 2EYWA 2LCSA 4IIOA 1YNZA 1UTIA 1AWJA 1X2KA 2FPDA 3THKA 2H8HA 2CH4W 2O88A 1K4US 2EGAA 2V1QA 5GJVB 4M4ZA 2A37A 1J3TA 1U3OA 2VKNA 5ECAA 1PKSA 2GTOA 2LQWA 1ABQA 2J6FA 2L0AA 2LP5A 2RQVA 3VS7A 4A63B 2EGEA 4J9CA 2ROLA 1GCQA 3UA6A 2D8JA 2KXDA 2NUZA 3LH5A 1KJWA 2DL5A 4GBQA 4J9GA 2EYYA 2M0YA 1NEBA 3ULRB 1G83A 1GFDA 2RQTA 4Z88A 1PRMC 2D0NA 2AZVA 1E7OA 4K11A 1M3AA 2PTKA 4J9HA 5IXFA 3PE0A 4J9BA 1E6HA 3I35A 4RUGA 3GBQA 2RQUA 3QWYA 2YUPA 3SEMA 2LNHB 3FJ5A 4DEXA 1QKXA 2W0ZA 2L2PA 2DMOA 1OV3A 4JJDA 1RI9A 2YUOA 2CREA 2AK5A 1NLPC 1ZBJA 1Z9ZA 2X3WD 4RTZA 1AWXA 2O31A 2VWFA 1UG1A 2A28A 1JO8A 4IIMA 1OPKA 4ORZA 1H92A 3H0FA 2YUNA 4RTWA 3REAB 2DBMA 2SEMA 2JW4A 2ECZA 2YSQA 1CKBA 3RNJA 4Z89A 4JJBA 2KT8A 1OOTA 2JXBA 2ABLA 1I0CA 3VRZA 1AD5A 2EGCA 2ESWA 1I1JA 1M3CA 4RTYA 2JM8A 2MOXA 2CSIA 1PHTA 1YN8A 2DRMA 1KFZA 2HEQA 1AZEA 1BB9A 2QDLA 1S1NA 1SEMA 1YCSB 2EQIA 3CQTA 2KRMA 2DBKA 3ZL7C 1V1CA 1WI7A 1K0SA 4EIKA 1JQQA 1ZUKA 1GRIA 2YUQA 1U06A 1VYVA 3IQLA 1K76A 2E5KA 2J05A 1WLPB 2J06A 1JEGA 1AZGB 2DL3A 2W10A 4CC4B 3UATA 3QWXX 2KE9A 1T3SA 2J6OA 4D8DA 1AWWA 1WXTA 4WCIA 5GJWB 1W6XA 2BTTA 5FWBA 2AKLA 3I5SA 2DYBA 5I11A 4F16A 1GL5A 2I0NA 1EFNA 2JS2A 2D8HA 4RTUA 2RMOA 4FSSA 2CH4A 1UUEA 1WA7A 2IIMA 4LUEA
chains in the Genus database with same CATH superfamily
3BDLA 3PIPA 4DEYA 3QDRB 4A4FA 1KQSP 5FU6C 1V76A 3JCMh 1OPLA 5FWCA 4BI8B 1UFFA 3CCUQ 2QASA 1YITQ 1Y0MA 2JN0A 4AMCA 1T0JA 4DQ2A 1VQ9Q 4ME7A 4II1A 3WXMB 3HL8A 1X2QA 1PM3A 2CS7A 5CKDA 3QO3A 4C92B 2E6ZA 1PD1A 4MMLA 4BI4A 3GF5A 5GAMj 1PSEA 2MI6A 1WJSA 2P0QA 2EAYA 3CCQQ 1U1SA 2PVGB 2V8JA 4UC4A 3OS2A 2FB7A 2OTLT 2LZ6B 1PNJA 1IGQA 3EG3A 1D3BA 1WHKA 4D8KA 3NTHA 4HCKA 3OMCA 4OMOA 4ZTFA 1HYOA 5A0DA 3M0QA 3JCMV 1M90C 1QCOA 1OEBA 2HKQB 1M90R 3EGUA 3I5RA 3RBBB 4R56A 6AT1B 1BK2A 2BZ8A 4NS5A 2PUOB 3PVLA 3QKJA 2KRSA 2QQAA 1KG1A 1WFWA 1ZUYA 2GF7A 1JJ2S 4Y91A 3OBWA 5GANg 1CKAA 4XTZA 1ZQ1A 2JT4A 2JTEA 3EG9B 3M0SA 2BZYA 4IUVA 3FIFA 4GLMA 1BU1A 4A4KA 1KD1U 1Q86C 2O2OA 2KDSA 4A54A 1N5ZA 2HBWA 1C6VX 1OZ3A 4BE2A 2YDLA 1Q86R 2L3RA 1T0HA 1VOMA 3CCMT 2OTJT 1YHQA 1R8OB 5GANd 2QYZA 1E6GA 4MMKA 1VQKQ 3OA6A 2X4WA 2AKKA 1I5OB 1RADB 4FYXB 5GAMf 1HJDA 2O4XA 1PSFA 3JCMJ 2K57A 5GAOp 4ZNXA 2RPNA 4E2FB 1H8KA 2FZKB 3EAEA 4C5HA 1RLPC 4KBMB 1MV0B 3D7SB 3VKIA 2OTLQ 3LGLA 3J81E 5GAMh 4OGCA 1WQWA 4Q5WA 4RMOA 1VIFA 3JB9G 1X6GA 1I07A 3L1AA 4CC2A 4ANJA 2XDDA 1MV3A 2RQRA 4J9DA 2PNIA 2MCNA 4BY6B 4O5VA 2K7AA 4FW1A 4ZGJB 3CBPA 2LMJA 3G7ZA 1Q7YU 3VV0A 1NYGA 3BY7A 4LD9K 3UT1A 3VUZA 3I56Q 1X27A 2HNIA 4IUUA 1Y7XA 4C8QC 2EW3A 4ZN3A 1B34B 3M0TA 3JCMb 1JXMA 2DF6A 2KT1A 2FRWA 3TU4K 2F5TX 3CCLQ 1B7TA 1YJWA 2NWMA 3HRTA 1XOVA 1XJWB 2EJGA 5KYWB 3CCMQ 2RJFA 1FWZA 1NBEB 2RM4A 2DE0X 2XU8A 5IHNA 3GOXA 2K4YA 3EHQA 5FLXE 2B86A 5GMKi 2YXYA 4F14A 2CT3A 1PC0A 1WDXA 2F1LA 3C0CA 2QXFA 1BCOA 4ATOA 4QVZA 4BE0A 3CCUA 1YITA 2IG0A 4CC7A 1VQ9A 1AVZC 5LJ5d 1SG5A 3LGFA 5KCHA 4BDYA 3GP8A 4C8QA 1EIFA 2DO3A 4HT9A 3VS6A 2CP5A 2RNAA 3MP8A 3V7RA 3CCQA 4Y92A 1WXUA 3OBYA 4QW2A 3CMAA 4LXCA 2DYIA 2LJ0A 5C6SA 2OJ2A 2X4JA 2HDAA 4M75F 2FRYA 2DVJA 4M75D 1W2BA 1LNXA 3EH2A 2ZPBB 1K0XA 2LT1A 4AFZC 2O9SA 1QP2A 5DM7R 2RJEA 2E65A 3BFMA 2KYMA 2ED0A 3CD6T 5LJ3h 5KCOA 1UTIA 3A8OB 3OYFA 4ZN1A 1AWJA 4XAXB 2H8HA 2DD5A 2CH4W 1K4US 1YCYA 2YRCA 1LPLA 2DXBA 5DY9A 2PVOB 4JRPA 1IB8A 5GANe 1Q82U 1J3TA 2VKNA 3DLLA 1OULA 4GY5A 2LQWA 1ABQA 1KHCA 1PD0A 2HQEA 2CP7A 3JCMd 2RQVA 4OB0B 3CPWA 1WHGA 4LDYA 1NJIC 2EGEA 2DXTA 2ROLA 1QVGA 5A2QE 3LH5A 3UPUA 1NJIR 4DBHA 2M0YA 2IPOB 5J39A 2QK0A 1PRMC 4PJJA 3E9GA 3R6OA 4C92C 5IXFA 3PE0A 2QDYB 3RMSA 1XNIA 4KUIA 1OYXA 2RQUA 2YHTA 3C4SA 3HRSA 2LNHB 3FDRA 1DJ7B 5DLOA 1QKXA 3A8GB 1U8RA 1Y71A 1HK9A 1RI9A 2CREA 2QEXQ 3J7AF 4E7SA 1VQ6T 3DB3A 1NE8A 1SF9A 3RR6A 3RKWA 2KSSA 1OPKA 3M9QA 2QTVA 2RI2A 3H0FA 3MO8A 8ATCB 5M9OA 3RIRA 2JW4A 5EG2A 3CD6Q 2QGFB 4JJBA 4HA8A 2KT8A 3LX7A 2XDPA 2HD0A 4E47A 4E7IA 2X9HA 2M1HA 3VRZA 1AD5A 2ESWA 1I1JA 5HKCA 2RHZA 1BIAA 4C92A 1BCMA 2HSEB 1X6OA 2MOXA 2CSIA 4AT1B 2QTXA 1AZEA 1S1NA 1SEMA 2A0FB 3CQTA 3CBMA 2DBKA 1BI0A 1V1CA 1WI7A 3CCMA 4M77G 1TS9A 3CXCA 2OTJA 2R58A 4E7JA 1VYVA 2WACA 4M78F 2E5KA 5LJ5e 4J8OA 3GNFB 3JRZA 2MPXC 1UEBA 2EQJA 4EMKB 1T3SA 1IXDA 1MMDA 4F7UF 5FWBA 3A5ZB 4RKUE 1GL5A 3CC2T 2Y90A 5GAMd 4FSSA 4M75G 4N4GA 1G3TA 3CCJA 2F2WA 4LDVA 3L2ZA 3OYAA 3QSUA 1ZSGA 1BYMA 4PJOA 3EG9A 1MUZA 2X4YA 2XI9A 2VVKA 1SPKA 3OYHA 1Y96B 3CCRA 3OYGA 1M5Q1 4BY6C 3CC7A 1QCNA 1M27C 5CK9A 2KNBB 4A4HA 2KMTA 3JB9J 2CP2A 1VQMT 5A0GA 2JS0A 4BD3A 5AYFA 1SKUB 4J6XA 2QQSA 2J6KA 4N4IA 4XTYA 2NUPB 3X20B 1LCKA 3PFSA 4J83A 1FMKA 3EGDB 1YHQQ 1WIEA 2MYSA 4JPBW 1G5VA 1UGQB 3KBGA 3BW1A 4NL3A 1OU8A 4OMNA 3JCMe 2P0KA 2YT6A 2FHDA 3OYDA 4CI0C 2K2VA 5KYUB 2L3PA 2R57A 2DLPA 4X9CA 2P4RA 4A53A 1WJQA 1IHVA 2O9VA 4O6JA 2EQUA 2LVMA 1RAGB 4M7DG 2E10A 1WXBA 4LDUA 3CXCS 2VC8A 5IAYA 4HVWA 4OMLA 2G3RA 3ZFJA 2LQNA 3VS1A 5DLQE 3CC2Q 2HQHA 3LW5E 3GLXA 3V7SA 1QCFA 3X26B 2RHYA 1YJ9T 2C0IA 3R6NA 4QVDA 1RUWA 1K9AA 1BKBA 3MEWA 2K6DA 2OI3A 1AEYA 1OZ2A 4PJLA 2DNUA 2JZ2A 1VQ4T 3VRYA 3S3OA 3UDCA 1VQPT 5KYWA 1VQMQ 3JB9D 2RK1A 5GMKh 5IH2A 2EYXA 5IN1A 2HCKA 1LVKA 2HBPA 2L5QA 2ZGWA 1YWOA 4CRIA 4OGEA 1R0BG 1NZ9A 2KROA 4E7HA 1YJWQ 5CCAA 4R0KA 4RG2A 2DL4A 1KC8U 1M90U 2Z0WA 5LJ3d 2CDTA 4DBRA 1O9SA 2LX7A 2C0OA 3NGPA 4RTTA 1NLOC 5GAN3 4M78G 4AFQC 3E2UA 1LJOA 3HTRA 1UE9A 2RI3A 3M55A 4HKEA 4M7AA 2KRNA 4M75B 1WX6A 2K3YA 3QXEB 4F7UG 2NUTA 4IUPA 4C0FA 3OS0A 4X1VA 3MCAB 5D6YA 1D1CA 1W70A 1QQJA 4JLGA 3U23A 4QQ6A 3ASKA 3GPLA 2B8AA 2XKOC 1B3QA 4HVVA 3JCMW 1ZUUA 2XK0A 5GAMe 4B6MA 2VXEA 3CMAQ 1YJ9Q 4HXJA 2KI7A 3OYIA 1NG2A 2V1RA 4EPCA 2QGGA 2ZCFB 3M57A 4JUVA 5KE2A 2CP3A 4X9DA 4BACA 3CCET 1VQPQ 4NL2A 1I5LA 1YWPA 2VGNA 1VQ6A 3VS3A 3QJYA 2FL7A 4CC3A 2ROTA 1D1AA 2CGHA 4J6WA 2HL5C 4GLKA 3FLGA 1N27A 1SSFA 3I55A 2PU9B 3VYGA 2CZ7B 2K3XA 2PZ1A 3CEYA 4DOVA 2V8KA 3TEEA 3QJ6A 2P84A 1ARKA 2K3BA 3TCJA 2LJ3A 2HL3A 4QQGA 5HCKA 2XIDA 3JCMX 2FPFA 2D6FA 2BUDA 1JJ2P 4LNPA 1SHGA 1UHFA 2QA4T 3RKYA 1G3WA 2L3QA 1T3LA 3V8JA 4M77E 2M51A 1Q81C 3OYJA 4XU3A 1UDLA 3JCMQ 2MF2A 3RDVA 2JTMA 4JS5A 1NEGA 1Q81R 1QWEA 1UJ0A 3VS5A 2KGTA 3HFNA 2MWOA 3M54A 4OMMA 2CT4A 4BDZA 2SRCA 1ZLMA 4C8QF 3VU3C 1QP3A 4EMKC 1YNZA 3EFOA 3CCJT 3G1JA 2D0QB 2DERA 3CC2A 3CCEQ 4M75E 2YRDA 4WTOB 2EFIA 3CCRT 3OYKA 4N0AC 2V1QA 3CC7T 2A37A 3VUBA 2GTOA 2CP6A 3INZA 4M78B 3VS7A 4MZTA 2XD0A 2NUZA 1G8XA 3QZ5B 1F1BB 1VQMA 1OX8A 3OSSC 3OMGA 2EYYA 3SB2A 4KULA 4Z88A 3M5AA 5LJ3e 2D0NA 5I21A 1E7OA 3TQ7P 5CAIA 3X28B 2PTKA 1M9SA 2K5IA 3GBQA 5GAN2 4EMKA 3LWHA 2K5LA 5LJ5g 2OTJQ 3HRUA 3E1SA 4DEXA 2QA4Q 2E3HA 3NTKA 3MEUA 4JJDA 2YUOA 2LC4A 2AK5A 4N0AA 1M4ZA 2X3WD 1YJNT 2RD1A 2O31A 2VWFA 1WJRA 1UG1A 2A28A 5KE3A 1JO8A 4OB2B 1D09B 3LH0A 4ORZA 1H92A 2YUNA 4RTWA 3DKMA 3QDFA 5GAOm 2VXFA 4JRKA 4M77F 3V7CA 5HK0A 4M77D 3RNJA 1N9SA 1BI2A 4HT8A 1I0CA 3CCJQ 2EIFA 3P8HA 1M2VA 4FT4A 3PMTA 3S3NA 2JM8A 4Y28E 1NJIU 3CCRQ 2VV5A 4FYVB 4Z02A 3CC7Q 1YJ9A 1KFZA 2PVDB 1N8RC 4OB3B 4L6V5 4PNOA 4JRQA 1N8RR 3EGDA 3DB4A 4EMGA 5CVIA 3JAME 2LCCA 1VQ4A 1VQPA 1JQQA 2E41A 3NFCA 3QYGB 2YUQA 4RG8A 1TXQA 5GAOq 1OX9A 2J05A 5CKFA 3GIBA 1HXDA 2CKKA 4DOWA 4P5NA 5KYUA 1AZGB 1OU9A 8AT1B 4XTVA 3UATA 3JCMg 3C12A 4D8DA 1WHJA 4WCIA 5I2MA 2WSCE 3I5SA 5I11A 3MJXA 2I0NA 2D8HA 4RTUA 1D3BB 1WA7A 2DAQA 2LQ8A 2DVEA 1M1GA 4M78E 1GBRA 2KYBA 1YJNQ 2J7IA 2RHIA 5J3BA 5GAOr 4OMQA 1AOJA 2MAMA 1I4K1 5GANj 4DBQA 2HQXA 3QZ9B 5FRMA 4C5EA 2RA2A 2DEUA 4F7UE 4FW2A 4C8QG 3CC4T 3H0HA 1K73C 4M75C 3VS4A 4IUTA 2I2LA 2E6NA 4PJMA 1K73R 1V29B 2LX9A 4JLIA 1Y07A 2K5FA 1K1ZA 1EX4A 1MGQA 2C06A 4M7DF 1GCPA 2C0TA 1N6AA 2ZPIB 1TSFA 3G6ET 4M7DD 3EGXB 5I2SA 1G2BA 2GQIA 2DZ9A 1QLYA 4AFUC 5D7UA 4LDWA 1TU0B 5FU7B 1PWTA 1NYFA 2FPEA 1S72T 1FYNA 3SFMA 2CZ1B 4PJOF 3CCEA 3A8HB 3MEAA 3TSZA 2FO0A 3QIIA 5A0LA 4PJOD 5D6XA 4HVUA 1VA7A 1M2OA 1QVFA 2OAWA 3EHRA 3I55T 1ZA1B 4QKUA 4EMHA 4LDXA 1W2BS 5KYNA 3L2UA 1ZHIA 2CYZB 1M8MA 2CSQA 2NYSA 1O75A 3REBB 1SSHA 2X35A 2AHJB 3BDUA 3EG1A 2KXCA 4MZMA 1KIKA 5GANf 3M4GA 1GBQA 2QA4A 1VQLT 5GAMg 1YIJT 2AT1B 4J5YA 3EFRA 1IRXA 4E6RA 2RI5A 3O5ZA 3WVEB 4M78D 4MDWA 3CPWS 3A8LB 1R77A 1QVGS 1K9MC 5LJ5j 3QG1A 4C0DB 3G6EQ 4OF1A 1K9MR 1ZX6A 3C95A 2DIQA 3M58A 2DTHA 2KQWA 3F70A 2CUBA 3RERA 2AZSA 1VQ6Q 1ABOA 2O01E 2VGMA 3M56A 2RJCA 1K8AU 1S72Q 5CKHA 3P8DA 3CPWP 1HSQA 3FB9A 1PCXA 2GTJA 2VB6A 2VASA 3G4ST 5GAN5 1WGSA 3H41A 3I55Q 2XDBA 3OW2A 4JZ4A 5GMKe 1D0ZA 4XTXA 1X43A 3MP1A 2EYZA 1OQKA 4C92G 1X6BA 2JNGA 5J26A 3NPFA 3FC3A 3RESA 4FSXA 1P92A 2E5QA 1KQSA 4C8QB 1ZBXA 3FJPA 1FMVA 1TUCA 4PFZA 5D6WA 2BZXA 4XQ3A 1RLQC 2D1XA 3VS0A 2LTOA 4VUBA 2HSPA 2LDMA 1A0NB 2M02A 4QT7A 2CUDA 2F2XA 5IT9E 1YIJQ 2LRQA 5KYXB 2JVVA 3TREA 4M7AF 3CPFA 1MMNA 4XU1A 5LL6S 2A36A 4KH0B 2DFUA 2RO0A 2EWNA 2X51A 1YJNA 4F17A 5LJ5f 2DZCA 4B9XA 2X4XA 5GAOn 3SHWA 1HD3A 3OQ5A 1EZZB 2EQKA 1C1AA 4KGXB 3MKDA 3SWNB 2XMFA 1KK7A 1SRLA 3ZEHA 2MK5A 4XU2A 4PJOG 1BI3A 4C0GA 2V26A 1SRMA 4N4HA 1B34A 2IVWA 4IKFA 1WHHA 4NOYA 3CXCP 2KEAA 3G4SQ 3RKXA 3P8BB 1GXIE 3FEOA 2JM9A 2HZYA 2FVUA 2KAFA 5LJ3g 1YBYA 4HCZA 1M1KC 1PRLC 1RAAB 4BE1A 1JXOA 2EBPA 3ER0A 1UGVA 1M1KR 2ZPEB 1BBZA 3OW2S 4M77B 2HKNA 2YLCA 2RF0A 1SHFA 4LN2A 4PJNA 4PFPA 2K79A 2OAUA 4AG2C 1M3BA 2COWA 2BE7D 2EYWA 1KQSS 3UWNA 1QW1A 2H3EB 2FZGB 9ATCB 2NLUA 2DTIA 2KK4A 5CIUA 1X2KA 2FPDA 3THKA 2JUFA 2DD4A 1NPPA 3JCMf 2Y4XA 2EGAA 4TVRA 2JOYA 1YI2T 3OYEA 3OYYA 3SD4A 1U3OA 1PKSA 4B9WA 5GMKm 3S3MA 2A7YA 4PLLA 1RI0A 3QBYA 1TWBA 3LLRA 1RAFB 2GQVA 4C8QE 4X34A 4A63B 1Q86U 4BUGA 3KXTA 3CC4A 4J9CA 1D1BA 2RH2A 2KXDA 2EQMA 1RAIB 3A1PA 4OP0A 1KJWA 4J9GA 5GAN7 3L2RA 4QVCA 3QUIA 1WNLA 2RQTA 4C0ZA 3CCVT 3JCMc 1G3SA 1QVPA 1VQKT 3LYIA 4K11A 4J9HA 4J9BA 1Q81U 3G6EA 3I35A 4RUGA 4ZGDB 1VQ5T 3QWYA 1I81A 1VQ4Q 1MMAA 2DTOA 2YUPA 3SEMA 4OVAA 3FJ5A 2FYKA 1ACMB 3OS5A 2L2PA 5FU7C 4WF2A 1S72A 1NLPC 1ZBJA 1Z9ZA 5FRNA 1AWXA 3L2VA 3EH1A 1C0MA 4FYYB 1KC8C 3JSCA 3REAB 3E19A 2DBMA 2SEMA 2BE9B 1KC8R 3JB9I 4FU6A 2YSQA 1CKBA 4M7DB 1VQOT 2YWWA 5GAN6 4Z89A 2F69A 3OSVA 1OOTA 4DA4A 1VQ7T 3HSBA 1KQ1A 4J6YA 4M7AG 3I56T 1WHMA 1M3CA 4RTYA 2PUKB 2ZAEA 2KY9A 1PHTA 1YN8A 1KHIA 1YI2Q 2QAZA 5CKBA 2DRMA 1XTDA 4LD6A 3EGXA 2HEQA 4FIBA 1H3ZA 1BB9A 4YTLA 4A4EA 1YCSB 4PJOB 3L2QA 1VUBA 3X24B 3CCLT 2R5MA 3ZL7C 2EJFA 4DBFA 4EIKA 1VQLA 1YIJA 1WQ7A 1GRIA 3IQLA 1JBMA 3E9FA 1JB0E 3CCVQ 2RK2A 3HFOA 2KVQG 2W10A 1VQ8T 2QI2A 4C8QD 3WVDB 2LT4A 1VQ5Q 4C0DC 2J6OA 1AWWA 5GJWB 1W6XA 1G3YA 2RMOA 1UUEA 1MNEA 4RCBA 1ZSZB 2EPDA 3G4SA 3I9QA 3PNWC 4L5GA 2LQKA 2FZCB 4HCCA 4EDUA 4JRIA 3O8VA 2E3IA 4C92E 1VQOQ 2A3LA 1KD1C 4Z8AA 3OB9A 4F7UB 2DJQA 1BI1A 1N8RU 1MMGA 2EYQA 1VQ7Q 4PLIA 1KD1R 5IHKA 3OYNA 1D0XA 4L59A 2PQWA 5LJ3j 3QPHA 2CZ6B 4IURA 1X75C 1U1TA 3EG0A 1IO6A 2XICA 1UJYA 4J9IA 1UECA 3OYCA 1AT1B 1IREB 2WSEE 2GBQA 4XU0A 1VQNA 4FM4B 1RABB 2GCXA 2R5AA 4E7KA 1U5SA 2LCLA 1TH7A 3MEVA 3HHTB 3TSWA 3HPWA 4M7DE 2EKHA 1RL2A 1QMCA 5CQYA 1Y96A 2JMAA 1VQ8Q 4F04B 1MHNA 4IUQA 2FEIA 5KYYB 4XTWA 4XK8E 3VYHB 1M30A 3JV3A 1KQ2A 2EJ9A 3UF4A 4AG1C 2MMPA 1B07A 4PJOE 2QQRA 2NUPA 3SWNC 2LNVA 3CMET 5CO7A 2E4HA 1OI1A 1Q7YC 1IGUA 2ZPFB 1K73U 2DX1A 2RJDA 1W1FA 4LUDA 4ZGEB 3PVQA 1Q7YR 3UA7A 3V8KA 4MZPA 2E70A 3VS2A 4M7AB 1FXXA 2P4TA 3SDZA 3CCST 1RAEB 4C5IA 2K9GA 1TOVA 2NUTB 4KRTA 2G6FX 1UHCA 1MNDA 5KYXA 1UGSB 3GNGA 2ZPHB 5IHIA 2QEXT 4ESRA 4AFSC 1H3HA 5LJ3f 2DRKA 3NHNA 4M77C 1QKWA 2KBTA 4JZ3A 2DL7A 3PIOA 1ZA2B 1PKTA 2XG8D 4E7LA 4C92F 2COYA 3NMZC 2HAXA 3DLMA 4C92D 3M0UA 1UB4A 3ZBDA 3URGA 2ZPGB 4XTUA 5L8RE 2GGRA 3META 3SWNA 2L89A 3G71T 4RTXA 4A4GA 1X69A 2VUBA 4PFOA 3H0IA 1Q95G 2JTFA 2A08A 5FU6B 7AT1B 3PTAA 4KGVB 4J9EA 1CSKA 4RTVA 3H8ZA 1YI2A 2RHXA 1TTHB 1UGPB 4PK4A 3T9NA 2F2VA 4OMPA 3M0PA 4D6WA 2DXUA 5I22A 1NM7A 2DKGA 4JJCA 5GMKl 2FG0A 3RUXA 1AWOA 2RN8A 2L3SA 1TG0A 3EG2A 1R0CB 1NPRA 1XQHA 1M1FA 4M77A 4LE9A 3CMEQ 3CCVA 1WYXA 3C94A 3KFVA 1H641 3EFSA 1VQKA 3FRNA 2DA9A 2M16A 2ED1A 5IXBA 1GFCA 1JU5C 3RMQA 1VQ5A 2YRVA 2E12A 2DM1A 2DK3A 3HKSA 3CCSQ 2KR3A 4PKCC 1K9MU 1QWFA 2F5KA 3TVTA 2D9TA 2OTLA 2ENMA 2EKOA 2ATCB 2DL8A 2O4XB 2MIOA 4J9FA 2QQ9A 4M75A 3PT9A 4C5GA 1TUDA 1VYTA 3HP9A 1M8VA 2ZZDA 2E1HA 1UGRB 3OYLA 3CBOA 5FW9A 1Q82C 1VQOA 2LJ1A 1LOJA 1YP5A 2K2MA 5CQXA 4M7DC 1WZOA 4V2SA 1Q82R 3EFOB 4M7AE 3G71Q 1VQ7A 2GFAA 2M9UA 1W4SA 3I56A 2X3XD 1W2BP 2DILA 2E64A 3A98A 1Y57A 5KH6A 2WSFE 3CC4Q 4J7FA 1KSWA 2EVRA 2YLBA 5EC7A 2CZ0B 1BIBA 4PJOC 5GANh 3M0RA 5FROA 1YHQT 3CCLA 2DEQA 1AHJB 2JMCA 2GFUA 1GCQC 3AHUA 2DIGA 3V8LA 3OY9A 1IHWA 3KUFA 3NTIA 2CP0A 3PGGA 3L2WA 2GNCA 1Z9QA 5L23A 1VYUA 1VQ8A 1PG5B 2RQWA 2QQBA 2H3JA 2LCSA 4IIOA 1I8FA 2AIRB 4M7DA 4RCCA 4ELZC 3MP6A 2DPPB 3LWIA 1QVGP 2O88A 2COZA 3JCMP 5GJVB 3H9NA 4M4ZA 5ECAA 2DJZA 1ZSZC 2J6FA 1YFNA 2L0AA 2LP5A 4M78C 1QVFS 5GMKj 4JDSA 4JS4A 2V8IA 1GCQA 1X01A 3UA6A 1RAHB 2D8JA 1TUGB 1D0YA 4FCYA 2DL5A 4GBQA 3OYBA 1NEBA 3ULRB 1G83A 3A8MB 1GFDA 3N5BB 3AT1B 3PMIA 5HY6A 5C0MA 2AZVA 1M1KU 1M2VB 1M3AA 4FT2A 4KT0E 1E6HA 2JJ9A 1VQNT 2VYTA 1QVFP 1VQLQ 4OB1B 3MPUB 1YJWT 2L8DA 2Y4YA 4JJNK 5GAN4 2BIVA 3QYHB 2W0ZA 2DMOA 4R55A 1OV3A 4M7AD 2RB6A 5GAN8 1WPYA 4RTZA 2DXCA 3VJPA 3MHXA 5HK3A 1FMWA 4IIMA 3OS1A 3BE3A 1ZSZA 3L42A 1VIEA 4M78A 3CCUT 5GAOl 1YITT 1FX7A 4BI3A 2ECZA 5LJ5h 4FYWB 1VQ9T 1K8AC 3ME9A 3OYMA 2RHUA 2JXBA 2HMAA 2ABLA 4HCBA 2P0PA 1K8AR 5CR2A 2EGCA 4ELYC 1WHLA 4PL6A 4F7UA 5AT1B 4KH1B 3CMEA 3CCQT 1RACB 2M0OA 2OX7A 3M59A 2QDLA 3X25B 3CMAT 2EQIA 2KRMA 1N9RA 3CCSA 4M7AC 1K0SA 1IZ6A 3S6WA 4QQDA 2BKDN 1ZUKA 3M53A 3JB9F 1U06A 1K76A 2QG9B 2XHCA 1WLPB 2J06A 1JEGA 4OMFB 4J7IA 1JJ2A 2DL3A 2MWPA 2QEXA 4FL6A 2DETA 4CC4B 3J80E 4KUDK 4ZTJA 3QHSA 3QWXX 5CKEA 2KE9A 3JB9H 4E7ZA 1JRIA 1VQNQ 1WXTA 5KYYA 4MDXA 2BTTA 4BB7A 3OW2P 2AKLA 2DYBA 3M4YA 3H6ZA 4F16A 1EFNA 3Q1JA 2JS2A 3CD6A 2CH4A 3G71A 4KGZB 2IIMA 4LUEA
chains in the Genus database with same CATH topology
4DEYA 1GBRA 2KYBA 2F2WA 2J7IA 2EPDA 1ZSGA 1AOJA 4OMQA 3I9QA 1MUZA 1OPLA 2VVKA 1SPKA 5FWCA 1UFFA 1Y0MA 1M27C 1T0JA 3H0HA 2KNBB 3VS4A 1X2QA 4Z8AA 2JS0A 2DJQA 1K1ZA 2J6KA 5IHKA 1GCPA 2C0TA 1LCKA 3EG0A 1G2BA 1IO6A 1FMKA 2GQIA 1UJYA 1QLYA 4J9IA 4AFUC 1WIEA 2LZ6B 4JPBW 1PNJA 3EG3A 4D8KA 1PWTA 1UECA 4HCKA 1NYFA 2FPEA 2GBQA 4OMNA 1FYNA 4OMOA 2YT6A 1U5SA 3TSZA 3M0QA 2FO0A 3TSWA 2EKHA 2L3PA 1OEBA 1VA7A 4HVUA 2OAWA 2DLPA 3EHRA 2P4RA 2O9VA 2JMAA 3EGUA 3I5RA 3RBBB 1BK2A 2BZ8A 2FEIA 1WXBA 3PVLA 2KRSA 4HVWA 4OMLA 1WFWA 1ZUYA 2LQNA 3VS1A 1M30A 1M8MA 3JV3A 2CSQA 3UF4A 3REBB 4AG1C 1B07A 1CKAA 1SSHA 1QCFA 2JT4A 2JTEA 2DX1A 3EG1A 3M0SA 2BZYA 2C0IA 2KXCA 4GLMA 1BU1A 1W1FA 1RUWA 1K9AA 4LUDA 3R6NA 1KIKA 3PVQA 2O2OA 2K6DA 3UA7A 2OI3A 1AEYA 3VS2A 1N5ZA 2HBWA 2DNUA 2YDLA 1GBQA 1T0HA 3VRYA 2K9GA 4E6RA 4KRTA 3O5ZA 2G6FX 1E6GA 1UHCA 5IH2A 2EYXA 2AKKA 2HCKA 5IHIA 1YWOA 4ESRA 4AFSC 1H3HA 1HJDA 2DRKA 3NHNA 1QKWA 4ZNXA 2KBTA 2KROA 2DL7A 2RPNA 4JZ3A 1PKTA 1ZX6A 4R0KA 1H8KA 1RLPC 1MV0B 3NMZC 2DL4A 2CUBA 2AZSA 3M0UA 2CDTA 1ABOA 2GGRA 2LX7A 4RTXA 1HSQA 1X69A 2C0OA 3NGPA 4RTTA 2GTJA 1NLOC 3H0IA 2A08A 4AFQC 1X6GA 1I07A 1CSKA 4J9EA 4CC2A 1MV3A 4RTVA 2RQRA 4J9DA 2PNIA 3H41A 1UE9A 2MCNA 2K7AA 2KRNA 4JZ4A 2F2VA 1WX6A 4OMPA 3M0PA 1X43A 2LMJA 5I22A 1NM7A 4JJCA 2EYZA 2FG0A 4X1VA 1NYGA 1X6BA 1W70A 1AWOA 3NPFA 1X27A 2L3SA 2RN8A 1TG0A 3U23A 3EG2A 2EW3A 4LE9A 1B3QA 1WYXA 4HVVA 1ZUUA 3KFVA 3M0TA 1TUCA 2DA9A 4HXJA 2BZXA 1JXMA 2DF6A 2ED1A 2KT1A 2FRWA 1RLQC 2D1XA 5IXBA 1NG2A 2V1RA 3VS0A 1GFCA 1JU5C 2HSPA 2DM1A 2NWMA 2KR3A 1XOVA 1A0NB 4QT7A 1QWFA 2CUDA 2F2XA 3TVTA 2DE0X 1YWPA 5IHNA 2ENMA 2DL8A 3EHQA 2A36A 2B86A 3VS3A 4F17A 2MIOA 4J9FA 4F14A 2CT3A 4CC3A 2ROTA 1WDXA 3C0CA 3SHWA 1HD3A 1TUDA 1VYTA 4CC7A 1AVZC 5FW9A 2LJ1A 2PZ1A 2XMFA 1SRLA 2K2MA 1YP5A 1ARKA 1SRMA 2K3BA 3VS6A 2X3XD 2LJ3A 2DILA 2KEAA 2RNAA 3A98A 1Y57A 5HCKA 4Y92A 1WXUA 1KSWA 2EVRA 2FPFA 2JM9A 4LNPA 5EC7A 1SHGA 1UHFA 2LJ0A 1PRLC 2L3QA 1T3LA 2OJ2A 3M0RA 2M51A 2JMCA 2HDAA 1UDLA 1JXOA 2EBPA 1GCQC 1UGVA 1BBZA 1NEGA 2FRYA 1QWEA 2DVJA 1UJ0A 2RF0A 1SHFA 3VS5A 2KGTA 4LN2A 2K79A 4AG2C 1K0XA 4AFZC 2O9SA 2GNCA 1Z9QA 5L23A 1VYUA 4OMMA 2CT4A 2RQWA 2KYMA 1M3BA 2ED0A 2SRCA 1ZLMA 2EYWA 2LCSA 4IIOA 1YNZA 1UTIA 1AWJA 1X2KA 2FPDA 3THKA 2H8HA 2CH4W 2O88A 1K4US 2EGAA 2V1QA 5GJVB 4M4ZA 2A37A 1J3TA 1U3OA 2VKNA 5ECAA 1PKSA 2GTOA 2LQWA 1ABQA 2J6FA 2L0AA 2LP5A 2RQVA 3VS7A 4A63B 2EGEA 4J9CA 2ROLA 1GCQA 3UA6A 2D8JA 2KXDA 2NUZA 3LH5A 1KJWA 2DL5A 4GBQA 4J9GA 2EYYA 2M0YA 1NEBA 3ULRB 1G83A 1GFDA 2RQTA 4Z88A 1PRMC 2D0NA 2AZVA 1E7OA 4K11A 1M3AA 2PTKA 4J9HA 5IXFA 3PE0A 4J9BA 1E6HA 3I35A 4RUGA 3GBQA 2RQUA 3QWYA 2YUPA 3SEMA 2LNHB 3FJ5A 4DEXA 1QKXA 2W0ZA 2L2PA 2DMOA 1OV3A 4JJDA 1RI9A 2YUOA 2CREA 2AK5A 1NLPC 1ZBJA 1Z9ZA 2X3WD 4RTZA 1AWXA 2O31A 2VWFA 1UG1A 2A28A 1JO8A 4IIMA 1OPKA 4ORZA 1H92A 3H0FA 2YUNA 4RTWA 3REAB 2DBMA 2SEMA 2JW4A 2ECZA 2YSQA 1CKBA 3RNJA 4Z89A 4JJBA 2KT8A 1OOTA 2JXBA 2ABLA 1I0CA 3VRZA 1AD5A 2EGCA 2ESWA 1I1JA 1M3CA 4RTYA 2JM8A 2MOXA 2CSIA 1PHTA 1YN8A 2DRMA 1KFZA 2HEQA 1AZEA 1BB9A 2QDLA 1S1NA 1SEMA 1YCSB 2EQIA 3CQTA 2KRMA 2DBKA 3ZL7C 1V1CA 1WI7A 1K0SA 4EIKA 1JQQA 1ZUKA 1GRIA 2YUQA 1U06A 1VYVA 3IQLA 1K76A 2E5KA 2J05A 1WLPB 2J06A 1JEGA 1AZGB 2DL3A 2W10A 4CC4B 3UATA 3QWXX 2KE9A 1T3SA 2J6OA 4D8DA 1AWWA 1WXTA 4WCIA 5GJWB 1W6XA 2BTTA 5FWBA 2AKLA 3I5SA 2DYBA 5I11A 4F16A 1GL5A 2I0NA 1EFNA 2JS2A 2D8HA 4RTUA 2RMOA 4FSSA 2CH4A 1UUEA 1WA7A 2IIMA 4LUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEY A;  1GBR A;  2KYB A;  2F2W A;  2J7I A;  2EPD A;  1ZSG A;  1AOJ A;  4OMQ A;  3I9Q A;  1MUZ A;  1OPL A;  2VVK A;  1SPK A;  5FWC A;  1UFF A;  1Y0M A;  1M27 C;  1T0J A;  3H0H A;  2KNB B;  3VS4 A;  1X2Q A;  4Z8A A;  2JS0 A;  2DJQ A;  1K1Z A;  2J6K A;  5IHK A;  1GCP A;  2C0T A;  1LCK A;  3EG0 A;  1G2B A;  1IO6 A;  1FMK A;  2GQI A;  1UJY A;  1QLY A;  4J9I A;  4AFU C;  1WIE A;  2LZ6 B;  4JPB W;  1PNJ A;  3EG3 A;  4D8K A;  1PWT A;  1UEC A;  4HCK A;  1NYF A;  2FPE A;  2GBQ A;  4OMN A;  1FYN A;  4OMO A;  2YT6 A;  1U5S A;  3TSZ A;  3M0Q A;  2FO0 A;  3TSW A;  2EKH A;  2L3P A;  1OEB A;  1VA7 A;  4HVU A;  2OAW A;  2DLP A;  3EHR A;  2P4R A;  2O9V A;  2JMA A;  3EGU A;  3I5R A;  3RBB B;  1BK2 A;  2BZ8 A;  2FEI A;  1WXB A;  3PVL A;  2KRS A;  4HVW A;  4OML A;  1WFW A;  1ZUY A;  2LQN A;  3VS1 A;  1M30 A;  1M8M A;  3JV3 A;  2CSQ A;  3UF4 A;  3REB B;  4AG1 C;  1B07 A;  1CKA A;  1SSH A;  1QCF A;  2JT4 A;  2JTE A;  2DX1 A;  3EG1 A;  3M0S A;  2BZY A;  2C0I A;  2KXC A;  4GLM A;  1BU1 A;  1W1F A;  1RUW A;  1K9A A;  4LUD A;  3R6N A;  1KIK A;  3PVQ A;  2O2O A;  2K6D A;  3UA7 A;  2OI3 A;  1AEY A;  3VS2 A;  1N5Z A;  2HBW A;  2DNU A;  2YDL A;  1GBQ A;  1T0H A;  3VRY A;  2K9G A;  4E6R A;  4KRT A;  3O5Z A;  2G6F X;  1E6G A;  1UHC A;  5IH2 A;  2EYX A;  2AKK A;  2HCK A;  5IHI A;  1YWO A;  4ESR A;  4AFS C;  1H3H A;  1HJD A;  2DRK A;  3NHN A;  1QKW A;  4ZNX A;  2KBT A;  2KRO A;  2DL7 A;  2RPN A;  4JZ3 A;  1PKT A;  1ZX6 A;  4R0K A;  1H8K A;  1RLP C;  1MV0 B;  3NMZ C;  2DL4 A;  2CUB A;  2AZS A;  3M0U A;  2CDT A;  1ABO A;  2GGR A;  2LX7 A;  4RTX A;  1HSQ A;  1X69 A;  2C0O A;  3NGP A;  4RTT A;  2GTJ A;  1NLO C;  3H0I A;  2A08 A;  4AFQ C;  1X6G A;  1I07 A;  1CSK A;  4J9E A;  4CC2 A;  1MV3 A;  4RTV A;  2RQR A;  4J9D A;  2PNI A;  3H41 A;  1UE9 A;  2MCN A;  2K7A A;  2KRN A;  4JZ4 A;  2F2V A;  1WX6 A;  4OMP A;  3M0P A;  1X43 A;  2LMJ A;  5I22 A;  1NM7 A;  4JJC A;  2EYZ A;  2FG0 A;  4X1V A;  1NYG A;  1X6B A;  1W70 A;  1AWO A;  3NPF A;  1X27 A;  2L3S A;  2RN8 A;  1TG0 A;  3U23 A;  3EG2 A;  2EW3 A;  4LE9 A;  1B3Q A;  1WYX A;  4HVV A;  1ZUU A;  3KFV A;  3M0T A;  1TUC A;  2DA9 A;  4HXJ A;  2BZX A;  1JXM A;  2DF6 A;  2ED1 A;  2KT1 A;  2FRW A;  1RLQ C;  2D1X A;  5IXB A;  1NG2 A;  2V1R A;  3VS0 A;  1GFC A;  1JU5 C;  2HSP A;  2DM1 A;  2NWM A;  2KR3 A;  1XOV A;  1A0N B;  4QT7 A;  1QWF A;  2CUD A;  2F2X A;  3TVT A;  2DE0 X;  1YWP A;  5IHN A;  2ENM A;  2DL8 A;  3EHQ A;  2A36 A;  2B86 A;  3VS3 A;  4F17 A;  2MIO A;  4J9F A;  4F14 A;  2CT3 A;  4CC3 A;  2ROT A;  1WDX A;  3C0C A;  3SHW A;  1HD3 A;  1TUD A;  1VYT A;  4CC7 A;  1AVZ C;  5FW9 A;  2LJ1 A;  2PZ1 A;  2XMF A;  1SRL A;  2K2M A;  1YP5 A;  1ARK A;  1SRM A;  2K3B A;  3VS6 A;  2X3X D;  2LJ3 A;  2DIL A;  2KEA A;  2RNA A;  3A98 A;  1Y57 A;  5HCK A;  4Y92 A;  1WXU A;  1KSW A;  2EVR A;  2FPF A;  2JM9 A;  4LNP A;  5EC7 A;  1SHG A;  1UHF A;  2LJ0 A;  1PRL C;  2L3Q A;  1T3L A;  2OJ2 A;  3M0R A;  2M51 A;  2JMC A;  2HDA A;  1UDL A;  1JXO A;  2EBP A;  1GCQ C;  1UGV A;  1BBZ A;  1NEG A;  2FRY A;  1QWE A;  2DVJ A;  1UJ0 A;  2RF0 A;  1SHF A;  3VS5 A;  2KGT A;  4LN2 A;  2K79 A;  4AG2 C;  1K0X A;  4AFZ C;  2O9S A;  2GNC A;  1Z9Q A;  5L23 A;  1VYU A;  4OMM A;  2CT4 A;  2RQW A;  2KYM A;  1M3B A;  2ED0 A;  2SRC A;  1ZLM A;  2EYW A;  2LCS A;  4IIO A;  1YNZ A;  1UTI A;  1AWJ A;  1X2K A;  2FPD A;  3THK A;  2H8H A;  2CH4 W;  2O88 A;  1K4U S;  2EGA A;  2V1Q A;  5GJV B;  4M4Z A;  2A37 A;  1J3T A;  1U3O A;  2VKN A;  5ECA A;  1PKS A;  2GTO A;  2LQW A;  1ABQ A;  2J6F A;  2L0A A;  2LP5 A;  2RQV A;  3VS7 A;  4A63 B;  2EGE A;  4J9C A;  2ROL A;  1GCQ A;  3UA6 A;  2D8J A;  2KXD A;  2NUZ A;  3LH5 A;  1KJW A;  2DL5 A;  4GBQ A;  4J9G A;  2EYY A;  2M0Y A;  1NEB A;  3ULR B;  1G83 A;  1GFD A;  2RQT A;  4Z88 A;  1PRM C;  2D0N A;  2AZV A;  1E7O A;  4K11 A;  1M3A A;  2PTK A;  4J9H A;  5IXF A;  3PE0 A;  4J9B A;  1E6H A;  3I35 A;  4RUG A;  3GBQ A;  2RQU A;  3QWY A;  2YUP A;  3SEM A;  2LNH B;  3FJ5 A;  4DEX A;  1QKX A;  2W0Z A;  2L2P A;  2DMO A;  1OV3 A;  4JJD A;  1RI9 A;  2YUO A;  2CRE A;  2AK5 A;  1NLP C;  1ZBJ A;  1Z9Z A;  2X3W D;  4RTZ A;  1AWX A;  2O31 A;  2VWF A;  1UG1 A;  2A28 A;  1JO8 A;  4IIM A;  1OPK A;  4ORZ A;  1H92 A;  3H0F A;  2YUN A;  4RTW A;  3REA B;  2DBM A;  2SEM A;  2JW4 A;  2ECZ A;  2YSQ A;  1CKB A;  3RNJ A;  4Z89 A;  4JJB A;  2KT8 A;  1OOT A;  2JXB A;  2ABL A;  1I0C A;  3VRZ A;  1AD5 A;  2EGC A;  2ESW A;  1I1J A;  1M3C A;  4RTY A;  2JM8 A;  2MOX A;  2CSI A;  1PHT A;  1YN8 A;  2DRM A;  1KFZ A;  2HEQ A;  1AZE A;  1BB9 A;  2QDL A;  1S1N A;  1SEM A;  1YCS B;  2EQI A;  3CQT A;  2KRM A;  2DBK A;  3ZL7 C;  1V1C A;  1WI7 A;  1K0S A;  4EIK A;  1JQQ A;  1ZUK A;  1GRI A;  2YUQ A;  1U06 A;  1VYV A;  3IQL A;  1K76 A;  2E5K A;  2J05 A;  1WLP B;  2J06 A;  1JEG A;  1AZG B;  2DL3 A;  2W10 A;  4CC4 B;  3UAT A;  3QWX X;  2KE9 A;  1T3S A;  2J6O A;  4D8D A;  1AWW A;  1WXT A;  4WCI A;  5GJW B;  1W6X A;  2BTT A;  5FWB A;  2AKL A;  3I5S A;  2DYB A;  5I11 A;  4F16 A;  1GL5 A;  2I0N A;  1EFN A;  2JS2 A;  2D8H A;  4RTU A;  2RMO A;  4FSS A;  2CH4 A;  1UUE A;  1WA7 A;  2IIM A;  4LUE A; 
#chains in the Genus database with same CATH topology
 3BDL A;  3PIP A;  4DEY A;  3QDR B;  4A4F A;  1KQS P;  5FU6 C;  1V76 A;  3JCM h;  1OPL A;  5FWC A;  4BI8 B;  1UFF A;  3CCU Q;  2QAS A;  1YIT Q;  1Y0M A;  2JN0 A;  4AMC A;  1T0J A;  4DQ2 A;  1VQ9 Q;  4ME7 A;  4II1 A;  3WXM B;  3HL8 A;  1X2Q A;  1PM3 A;  2CS7 A;  5CKD A;  3QO3 A;  4C92 B;  2E6Z A;  1PD1 A;  4MML A;  4BI4 A;  3GF5 A;  5GAM j;  1PSE A;  2MI6 A;  1WJS A;  2P0Q A;  2EAY A;  3CCQ Q;  1U1S A;  2PVG B;  2V8J A;  4UC4 A;  3OS2 A;  2FB7 A;  2OTL T;  2LZ6 B;  1PNJ A;  1IGQ A;  3EG3 A;  1D3B A;  1WHK A;  4D8K A;  3NTH A;  4HCK A;  3OMC A;  4OMO A;  4ZTF A;  1HYO A;  5A0D A;  3M0Q A;  3JCM V;  1M90 C;  1QCO A;  1OEB A;  2HKQ B;  1M90 R;  3EGU A;  3I5R A;  3RBB B;  4R56 A;  6AT1 B;  1BK2 A;  2BZ8 A;  4NS5 A;  2PUO B;  3PVL A;  3QKJ A;  2KRS A;  2QQA A;  1KG1 A;  1WFW A;  1ZUY A;  2GF7 A;  1JJ2 S;  4Y91 A;  3OBW A;  5GAN g;  1CKA A;  4XTZ A;  1ZQ1 A;  2JT4 A;  2JTE A;  3EG9 B;  3M0S A;  2BZY A;  4IUV A;  3FIF A;  4GLM A;  1BU1 A;  4A4K A;  1KD1 U;  1Q86 C;  2O2O A;  2KDS A;  4A54 A;  1N5Z A;  2HBW A;  1C6V X;  1OZ3 A;  4BE2 A;  2YDL A;  1Q86 R;  2L3R A;  1T0H A;  1VOM A;  3CCM T;  2OTJ T;  1YHQ A;  1R8O B;  5GAN d;  2QYZ A;  1E6G A;  4MMK A;  1VQK Q;  3OA6 A;  2X4W A;  2AKK A;  1I5O B;  1RAD B;  4FYX B;  5GAM f;  1HJD A;  2O4X A;  1PSF A;  3JCM J;  2K57 A;  5GAO p;  4ZNX A;  2RPN A;  4E2F B;  1H8K A;  2FZK B;  3EAE A;  4C5H A;  1RLP C;  4KBM B;  1MV0 B;  3D7S B;  3VKI A;  2OTL Q;  3LGL A;  3J81 E;  5GAM h;  4OGC A;  1WQW A;  4Q5W A;  4RMO A;  1VIF A;  3JB9 G;  1X6G A;  1I07 A;  3L1A A;  4CC2 A;  4ANJ A;  2XDD A;  1MV3 A;  2RQR A;  4J9D A;  2PNI A;  2MCN A;  4BY6 B;  4O5V A;  2K7A A;  4FW1 A;  4ZGJ B;  3CBP A;  2LMJ A;  3G7Z A;  1Q7Y U;  3VV0 A;  1NYG A;  3BY7 A;  4LD9 K;  3UT1 A;  3VUZ A;  3I56 Q;  1X27 A;  2HNI A;  4IUU A;  1Y7X A;  4C8Q C;  2EW3 A;  4ZN3 A;  1B34 B;  3M0T A;  3JCM b;  1JXM A;  2DF6 A;  2KT1 A;  2FRW A;  3TU4 K;  2F5T X;  3CCL Q;  1B7T A;  1YJW A;  2NWM A;  3HRT A;  1XOV A;  1XJW B;  2EJG A;  5KYW B;  3CCM Q;  2RJF A;  1FWZ A;  1NBE B;  2RM4 A;  2DE0 X;  2XU8 A;  5IHN A;  3GOX A;  2K4Y A;  3EHQ A;  5FLX E;  2B86 A;  5GMK i;  2YXY A;  4F14 A;  2CT3 A;  1PC0 A;  1WDX A;  2F1L A;  3C0C A;  2QXF A;  1BCO A;  4ATO A;  4QVZ A;  4BE0 A;  3CCU A;  1YIT A;  2IG0 A;  4CC7 A;  1VQ9 A;  1AVZ C;  5LJ5 d;  1SG5 A;  3LGF A;  5KCH A;  4BDY A;  3GP8 A;  4C8Q A;  1EIF A;  2DO3 A;  4HT9 A;  3VS6 A;  2CP5 A;  2RNA A;  3MP8 A;  3V7R A;  3CCQ A;  4Y92 A;  1WXU A;  3OBY A;  4QW2 A;  3CMA A;  4LXC A;  2DYI A;  2LJ0 A;  5C6S A;  2OJ2 A;  2X4J A;  2HDA A;  4M75 F;  2FRY A;  2DVJ A;  4M75 D;  1W2B A;  1LNX A;  3EH2 A;  2ZPB B;  1K0X A;  2LT1 A;  4AFZ C;  2O9S A;  1QP2 A;  5DM7 R;  2RJE A;  2E65 A;  3BFM A;  2KYM A;  2ED0 A;  3CD6 T;  5LJ3 h;  5KCO A;  1UTI A;  3A8O B;  3OYF A;  4ZN1 A;  1AWJ A;  4XAX B;  2H8H A;  2DD5 A;  2CH4 W;  1K4U S;  1YCY A;  2YRC A;  1LPL A;  2DXB A;  5DY9 A;  2PVO B;  4JRP A;  1IB8 A;  5GAN e;  1Q82 U;  1J3T A;  2VKN A;  3DLL A;  1OUL A;  4GY5 A;  2LQW A;  1ABQ A;  1KHC A;  1PD0 A;  2HQE A;  2CP7 A;  3JCM d;  2RQV A;  4OB0 B;  3CPW A;  1WHG A;  4LDY A;  1NJI C;  2EGE A;  2DXT A;  2ROL A;  1QVG A;  5A2Q E;  3LH5 A;  3UPU A;  1NJI R;  4DBH A;  2M0Y A;  2IPO B;  5J39 A;  2QK0 A;  1PRM C;  4PJJ A;  3E9G A;  3R6O A;  4C92 C;  5IXF A;  3PE0 A;  2QDY B;  3RMS A;  1XNI A;  4KUI A;  1OYX A;  2RQU A;  2YHT A;  3C4S A;  3HRS A;  2LNH B;  3FDR A;  1DJ7 B;  5DLO A;  1QKX A;  3A8G B;  1U8R A;  1Y71 A;  1HK9 A;  1RI9 A;  2CRE A;  2QEX Q;  3J7A F;  4E7S A;  1VQ6 T;  3DB3 A;  1NE8 A;  1SF9 A;  3RR6 A;  3RKW A;  2KSS A;  1OPK A;  3M9Q A;  2QTV A;  2RI2 A;  3H0F A;  3MO8 A;  8ATC B;  5M9O A;  3RIR A;  2JW4 A;  5EG2 A;  3CD6 Q;  2QGF B;  4JJB A;  4HA8 A;  2KT8 A;  3LX7 A;  2XDP A;  2HD0 A;  4E47 A;  4E7I A;  2X9H A;  2M1H A;  3VRZ A;  1AD5 A;  2ESW A;  1I1J A;  5HKC A;  2RHZ A;  1BIA A;  4C92 A;  1BCM A;  2HSE B;  1X6O A;  2MOX A;  2CSI A;  4AT1 B;  2QTX A;  1AZE A;  1S1N A;  1SEM A;  2A0F B;  3CQT A;  3CBM A;  2DBK A;  1BI0 A;  1V1C A;  1WI7 A;  3CCM A;  4M77 G;  1TS9 A;  3CXC A;  2OTJ A;  2R58 A;  4E7J A;  1VYV A;  2WAC A;  4M78 F;  2E5K A;  5LJ5 e;  4J8O A;  3GNF B;  3JRZ A;  2MPX C;  1UEB A;  2EQJ A;  4EMK B;  1T3S A;  1IXD A;  1MMD A;  4F7U F;  5FWB A;  3A5Z B;  4RKU E;  1GL5 A;  3CC2 T;  2Y90 A;  5GAM d;  4FSS A;  4M75 G;  4N4G A;  1G3T A;  3CCJ A;  2F2W A;  4LDV A;  3L2Z A;  3OYA A;  3QSU A;  1ZSG A;  1BYM A;  4PJO A;  3EG9 A;  1MUZ A;  2X4Y A;  2XI9 A;  2VVK A;  1SPK A;  3OYH A;  1Y96 B;  3CCR A;  3OYG A;  1M5Q 1;  4BY6 C;  3CC7 A;  1QCN A;  1M27 C;  5CK9 A;  2KNB B;  4A4H A;  2KMT A;  3JB9 J;  2CP2 A;  1VQM T;  5A0G A;  2JS0 A;  4BD3 A;  5AYF A;  1SKU B;  4J6X A;  2QQS A;  2J6K A;  4N4I A;  4XTY A;  2NUP B;  3X20 B;  1LCK A;  3PFS A;  4J83 A;  1FMK A;  3EGD B;  1YHQ Q;  1WIE A;  2MYS A;  4JPB W;  1G5V A;  1UGQ B;  3KBG A;  3BW1 A;  4NL3 A;  1OU8 A;  4OMN A;  3JCM e;  2P0K A;  2YT6 A;  2FHD A;  3OYD A;  4CI0 C;  2K2V A;  5KYU B;  2L3P A;  2R57 A;  2DLP A;  4X9C A;  2P4R A;  4A53 A;  1WJQ A;  1IHV A;  2O9V A;  4O6J A;  2EQU A;  2LVM A;  1RAG B;  4M7D G;  2E10 A;  1WXB A;  4LDU A;  3CXC S;  2VC8 A;  5IAY A;  4HVW A;  4OML A;  2G3R A;  3ZFJ A;  2LQN A;  3VS1 A;  5DLQ E;  3CC2 Q;  2HQH A;  3LW5 E;  3GLX A;  3V7S A;  1QCF A;  3X26 B;  2RHY A;  1YJ9 T;  2C0I A;  3R6N A;  4QVD A;  1RUW A;  1K9A A;  1BKB A;  3MEW A;  2K6D A;  2OI3 A;  1AEY A;  1OZ2 A;  4PJL A;  2DNU A;  2JZ2 A;  1VQ4 T;  3VRY A;  3S3O A;  3UDC A;  1VQP T;  5KYW A;  1VQM Q;  3JB9 D;  2RK1 A;  5GMK h;  5IH2 A;  2EYX A;  5IN1 A;  2HCK A;  1LVK A;  2HBP A;  2L5Q A;  2ZGW A;  1YWO A;  4CRI A;  4OGE A;  1R0B G;  1NZ9 A;  2KRO A;  4E7H A;  1YJW Q;  5CCA A;  4R0K A;  4RG2 A;  2DL4 A;  1KC8 U;  1M90 U;  2Z0W A;  5LJ3 d;  2CDT A;  4DBR A;  1O9S A;  2LX7 A;  2C0O A;  3NGP A;  4RTT A;  1NLO C;  5GAN 3;  4M78 G;  4AFQ C;  3E2U A;  1LJO A;  3HTR A;  1UE9 A;  2RI3 A;  3M55 A;  4HKE A;  4M7A A;  2KRN A;  4M75 B;  1WX6 A;  2K3Y A;  3QXE B;  4F7U G;  2NUT A;  4IUP A;  4C0F A;  3OS0 A;  4X1V A;  3MCA B;  5D6Y A;  1D1C A;  1W70 A;  1QQJ A;  4JLG A;  3U23 A;  4QQ6 A;  3ASK A;  3GPL A;  2B8A A;  2XKO C;  1B3Q A;  4HVV A;  3JCM W;  1ZUU A;  2XK0 A;  5GAM e;  4B6M A;  2VXE A;  3CMA Q;  1YJ9 Q;  4HXJ A;  2KI7 A;  3OYI A;  1NG2 A;  2V1R A;  4EPC A;  2QGG A;  2ZCF B;  3M57 A;  4JUV A;  5KE2 A;  2CP3 A;  4X9D A;  4BAC A;  3CCE T;  1VQP Q;  4NL2 A;  1I5L A;  1YWP A;  2VGN A;  1VQ6 A;  3VS3 A;  3QJY A;  2FL7 A;  4CC3 A;  2ROT A;  1D1A A;  2CGH A;  4J6W A;  2HL5 C;  4GLK A;  3FLG A;  1N27 A;  1SSF A;  3I55 A;  2PU9 B;  3VYG A;  2CZ7 B;  2K3X A;  2PZ1 A;  3CEY A;  4DOV A;  2V8K A;  3TEE A;  3QJ6 A;  2P84 A;  1ARK A;  2K3B A;  3TCJ A;  2LJ3 A;  2HL3 A;  4QQG A;  5HCK A;  2XID A;  3JCM X;  2FPF A;  2D6F A;  2BUD A;  1JJ2 P;  4LNP A;  1SHG A;  1UHF A;  2QA4 T;  3RKY A;  1G3W A;  2L3Q A;  1T3L A;  3V8J A;  4M77 E;  2M51 A;  1Q81 C;  3OYJ A;  4XU3 A;  1UDL A;  3JCM Q;  2MF2 A;  3RDV A;  2JTM A;  4JS5 A;  1NEG A;  1Q81 R;  1QWE A;  1UJ0 A;  3VS5 A;  2KGT A;  3HFN A;  2MWO A;  3M54 A;  4OMM A;  2CT4 A;  4BDZ A;  2SRC A;  1ZLM A;  4C8Q F;  3VU3 C;  1QP3 A;  4EMK C;  1YNZ A;  3EFO A;  3CCJ T;  3G1J A;  2D0Q B;  2DER A;  3CC2 A;  3CCE Q;  4M75 E;  2YRD A;  4WTO B;  2EFI A;  3CCR T;  3OYK A;  4N0A C;  2V1Q A;  3CC7 T;  2A37 A;  3VUB A;  2GTO A;  2CP6 A;  3INZ A;  4M78 B;  3VS7 A;  4MZT A;  2XD0 A;  2NUZ A;  1G8X A;  3QZ5 B;  1F1B B;  1VQM A;  1OX8 A;  3OSS C;  3OMG A;  2EYY A;  3SB2 A;  4KUL A;  4Z88 A;  3M5A A;  5LJ3 e;  2D0N A;  5I21 A;  1E7O A;  3TQ7 P;  5CAI A;  3X28 B;  2PTK A;  1M9S A;  2K5I A;  3GBQ A;  5GAN 2;  4EMK A;  3LWH A;  2K5L A;  5LJ5 g;  2OTJ Q;  3HRU A;  3E1S A;  4DEX A;  2QA4 Q;  2E3H A;  3NTK A;  3MEU A;  4JJD A;  2YUO A;  2LC4 A;  2AK5 A;  4N0A A;  1M4Z A;  2X3W D;  1YJN T;  2RD1 A;  2O31 A;  2VWF A;  1WJR A;  1UG1 A;  2A28 A;  5KE3 A;  1JO8 A;  4OB2 B;  1D09 B;  3LH0 A;  4ORZ A;  1H92 A;  2YUN A;  4RTW A;  3DKM A;  3QDF A;  5GAO m;  2VXF A;  4JRK A;  4M77 F;  3V7C A;  5HK0 A;  4M77 D;  3RNJ A;  1N9S A;  1BI2 A;  4HT8 A;  1I0C A;  3CCJ Q;  2EIF A;  3P8H A;  1M2V A;  4FT4 A;  3PMT A;  3S3N A;  2JM8 A;  4Y28 E;  1NJI U;  3CCR Q;  2VV5 A;  4FYV B;  4Z02 A;  3CC7 Q;  1YJ9 A;  1KFZ A;  2PVD B;  1N8R C;  4OB3 B;  4L6V 5;  4PNO A;  4JRQ A;  1N8R R;  3EGD A;  3DB4 A;  4EMG A;  5CVI A;  3JAM E;  2LCC A;  1VQ4 A;  1VQP A;  1JQQ A;  2E41 A;  3NFC A;  3QYG B;  2YUQ A;  4RG8 A;  1TXQ A;  5GAO q;  1OX9 A;  2J05 A;  5CKF A;  3GIB A;  1HXD A;  2CKK A;  4DOW A;  4P5N A;  5KYU A;  1AZG B;  1OU9 A;  8AT1 B;  4XTV A;  3UAT A;  3JCM g;  3C12 A;  4D8D A;  1WHJ A;  4WCI A;  5I2M A;  2WSC E;  3I5S A;  5I11 A;  3MJX A;  2I0N A;  2D8H A;  4RTU A;  1D3B B;  1WA7 A;  2DAQ A;  2LQ8 A;  2DVE A;  1M1G A;  4M78 E;  1GBR A;  2KYB A;  1YJN Q;  2J7I A;  2RHI A;  5J3B A;  5GAO r;  4OMQ A;  1AOJ A;  2MAM A;  1I4K 1;  5GAN j;  4DBQ A;  2HQX A;  3QZ9 B;  5FRM A;  4C5E A;  2RA2 A;  2DEU A;  4F7U E;  4FW2 A;  4C8Q G;  3CC4 T;  3H0H A;  1K73 C;  4M75 C;  3VS4 A;  4IUT A;  2I2L A;  2E6N A;  4PJM A;  1K73 R;  1V29 B;  2LX9 A;  4JLI A;  1Y07 A;  2K5F A;  1K1Z A;  1EX4 A;  1MGQ A;  2C06 A;  4M7D F;  1GCP A;  2C0T A;  1N6A A;  2ZPI B;  1TSF A;  3G6E T;  4M7D D;  3EGX B;  5I2S A;  1G2B A;  2GQI A;  2DZ9 A;  1QLY A;  4AFU C;  5D7U A;  4LDW A;  1TU0 B;  5FU7 B;  1PWT A;  1NYF A;  2FPE A;  1S72 T;  1FYN A;  3SFM A;  2CZ1 B;  4PJO F;  3CCE A;  3A8H B;  3MEA A;  3TSZ A;  2FO0 A;  3QII A;  5A0L A;  4PJO D;  5D6X A;  4HVU A;  1VA7 A;  1M2O A;  1QVF A;  2OAW A;  3EHR A;  3I55 T;  1ZA1 B;  4QKU A;  4EMH A;  4LDX A;  1W2B S;  5KYN A;  3L2U A;  1ZHI A;  2CYZ B;  1M8M A;  2CSQ A;  2NYS A;  1O75 A;  3REB B;  1SSH A;  2X35 A;  2AHJ B;  3BDU A;  3EG1 A;  2KXC A;  4MZM A;  1KIK A;  5GAN f;  3M4G A;  1GBQ A;  2QA4 A;  1VQL T;  5GAM g;  1YIJ T;  2AT1 B;  4J5Y A;  3EFR A;  1IRX A;  4E6R A;  2RI5 A;  3O5Z A;  3WVE B;  4M78 D;  4MDW A;  3CPW S;  3A8L B;  1R77 A;  1QVG S;  1K9M C;  5LJ5 j;  3QG1 A;  4C0D B;  3G6E Q;  4OF1 A;  1K9M R;  1ZX6 A;  3C95 A;  2DIQ A;  3M58 A;  2DTH A;  2KQW A;  3F70 A;  2CUB A;  3RER A;  2AZS A;  1VQ6 Q;  1ABO A;  2O01 E;  2VGM A;  3M56 A;  2RJC A;  1K8A U;  1S72 Q;  5CKH A;  3P8D A;  3CPW P;  1HSQ A;  3FB9 A;  1PCX A;  2GTJ A;  2VB6 A;  2VAS A;  3G4S T;  5GAN 5;  1WGS A;  3H41 A;  3I55 Q;  2XDB A;  3OW2 A;  4JZ4 A;  5GMK e;  1D0Z A;  4XTX A;  1X43 A;  3MP1 A;  2EYZ A;  1OQK A;  4C92 G;  1X6B A;  2JNG A;  5J26 A;  3NPF A;  3FC3 A;  3RES A;  4FSX A;  1P92 A;  2E5Q A;  1KQS A;  4C8Q B;  1ZBX A;  3FJP A;  1FMV A;  1TUC A;  4PFZ A;  5D6W A;  2BZX A;  4XQ3 A;  1RLQ C;  2D1X A;  3VS0 A;  2LTO A;  4VUB A;  2HSP A;  2LDM A;  1A0N B;  2M02 A;  4QT7 A;  2CUD A;  2F2X A;  5IT9 E;  1YIJ Q;  2LRQ A;  5KYX B;  2JVV A;  3TRE A;  4M7A F;  3CPF A;  1MMN A;  4XU1 A;  5LL6 S;  2A36 A;  4KH0 B;  2DFU A;  2RO0 A;  2EWN A;  2X51 A;  1YJN A;  4F17 A;  5LJ5 f;  2DZC A;  4B9X A;  2X4X A;  5GAO n;  3SHW A;  1HD3 A;  3OQ5 A;  1EZZ B;  2EQK A;  1C1A A;  4KGX B;  3MKD A;  3SWN B;  2XMF A;  1KK7 A;  1SRL A;  3ZEH A;  2MK5 A;  4XU2 A;  4PJO G;  1BI3 A;  4C0G A;  2V26 A;  1SRM A;  4N4H A;  1B34 A;  2IVW A;  4IKF A;  1WHH A;  4NOY A;  3CXC P;  2KEA A;  3G4S Q;  3RKX A;  3P8B B;  1GXI E;  3FEO A;  2JM9 A;  2HZY A;  2FVU A;  2KAF A;  5LJ3 g;  1YBY A;  4HCZ A;  1M1K C;  1PRL C;  1RAA B;  4BE1 A;  1JXO A;  2EBP A;  3ER0 A;  1UGV A;  1M1K R;  2ZPE B;  1BBZ A;  3OW2 S;  4M77 B;  2HKN A;  2YLC A;  2RF0 A;  1SHF A;  4LN2 A;  4PJN A;  4PFP A;  2K79 A;  2OAU A;  4AG2 C;  1M3B A;  2COW A;  2BE7 D;  2EYW A;  1KQS S;  3UWN A;  1QW1 A;  2H3E B;  2FZG B;  9ATC B;  2NLU A;  2DTI A;  2KK4 A;  5CIU A;  1X2K A;  2FPD A;  3THK A;  2JUF A;  2DD4 A;  1NPP A;  3JCM f;  2Y4X A;  2EGA A;  4TVR A;  2JOY A;  1YI2 T;  3OYE A;  3OYY A;  3SD4 A;  1U3O A;  1PKS A;  4B9W A;  5GMK m;  3S3M A;  2A7Y A;  4PLL A;  1RI0 A;  3QBY A;  1TWB A;  3LLR A;  1RAF B;  2GQV A;  4C8Q E;  4X34 A;  4A63 B;  1Q86 U;  4BUG A;  3KXT A;  3CC4 A;  4J9C A;  1D1B A;  2RH2 A;  2KXD A;  2EQM A;  1RAI B;  3A1P A;  4OP0 A;  1KJW A;  4J9G A;  5GAN 7;  3L2R A;  4QVC A;  3QUI A;  1WNL A;  2RQT A;  4C0Z A;  3CCV T;  3JCM c;  1G3S A;  1QVP A;  1VQK T;  3LYI A;  4K11 A;  4J9H A;  4J9B A;  1Q81 U;  3G6E A;  3I35 A;  4RUG A;  4ZGD B;  1VQ5 T;  3QWY A;  1I81 A;  1VQ4 Q;  1MMA A;  2DTO A;  2YUP A;  3SEM A;  4OVA A;  3FJ5 A;  2FYK A;  1ACM B;  3OS5 A;  2L2P A;  5FU7 C;  4WF2 A;  1S72 A;  1NLP C;  1ZBJ A;  1Z9Z A;  5FRN A;  1AWX A;  3L2V A;  3EH1 A;  1C0M A;  4FYY B;  1KC8 C;  3JSC A;  3REA B;  3E19 A;  2DBM A;  2SEM A;  2BE9 B;  1KC8 R;  3JB9 I;  4FU6 A;  2YSQ A;  1CKB A;  4M7D B;  1VQO T;  2YWW A;  5GAN 6;  4Z89 A;  2F69 A;  3OSV A;  1OOT A;  4DA4 A;  1VQ7 T;  3HSB A;  1KQ1 A;  4J6Y A;  4M7A G;  3I56 T;  1WHM A;  1M3C A;  4RTY A;  2PUK B;  2ZAE A;  2KY9 A;  1PHT A;  1YN8 A;  1KHI A;  1YI2 Q;  2QAZ A;  5CKB A;  2DRM A;  1XTD A;  4LD6 A;  3EGX A;  2HEQ A;  4FIB A;  1H3Z A;  1BB9 A;  4YTL A;  4A4E A;  1YCS B;  4PJO B;  3L2Q A;  1VUB A;  3X24 B;  3CCL T;  2R5M A;  3ZL7 C;  2EJF A;  4DBF A;  4EIK A;  1VQL A;  1YIJ A;  1WQ7 A;  1GRI A;  3IQL A;  1JBM A;  3E9F A;  1JB0 E;  3CCV Q;  2RK2 A;  3HFO A;  2KVQ G;  2W10 A;  1VQ8 T;  2QI2 A;  4C8Q D;  3WVD B;  2LT4 A;  1VQ5 Q;  4C0D C;  2J6O A;  1AWW A;  5GJW B;  1W6X A;  1G3Y A;  2RMO A;  1UUE A;  1MNE A;  4RCB A;  1ZSZ B;  2EPD A;  3G4S A;  3I9Q A;  3PNW C;  4L5G A;  2LQK A;  2FZC B;  4HCC A;  4EDU A;  4JRI A;  3O8V A;  2E3I A;  4C92 E;  1VQO Q;  2A3L A;  1KD1 C;  4Z8A A;  3OB9 A;  4F7U B;  2DJQ A;  1BI1 A;  1N8R U;  1MMG A;  2EYQ A;  1VQ7 Q;  4PLI A;  1KD1 R;  5IHK A;  3OYN A;  1D0X A;  4L59 A;  2PQW A;  5LJ3 j;  3QPH A;  2CZ6 B;  4IUR A;  1X75 C;  1U1T A;  3EG0 A;  1IO6 A;  2XIC A;  1UJY A;  4J9I A;  1UEC A;  3OYC A;  1AT1 B;  1IRE B;  2WSE E;  2GBQ A;  4XU0 A;  1VQN A;  4FM4 B;  1RAB B;  2GCX A;  2R5A A;  4E7K A;  1U5S A;  2LCL A;  1TH7 A;  3MEV A;  3HHT B;  3TSW A;  3HPW A;  4M7D E;  2EKH A;  1RL2 A;  1QMC A;  5CQY A;  1Y96 A;  2JMA A;  1VQ8 Q;  4F04 B;  1MHN A;  4IUQ A;  2FEI A;  5KYY B;  4XTW A;  4XK8 E;  3VYH B;  1M30 A;  3JV3 A;  1KQ2 A;  2EJ9 A;  3UF4 A;  4AG1 C;  2MMP A;  1B07 A;  4PJO E;  2QQR A;  2NUP A;  3SWN C;  2LNV A;  3CME T;  5CO7 A;  2E4H A;  1OI1 A;  1Q7Y C;  1IGU A;  2ZPF B;  1K73 U;  2DX1 A;  2RJD A;  1W1F A;  4LUD A;  4ZGE B;  3PVQ A;  1Q7Y R;  3UA7 A;  3V8K A;  4MZP A;  2E70 A;  3VS2 A;  4M7A B;  1FXX A;  2P4T A;  3SDZ A;  3CCS T;  1RAE B;  4C5I A;  2K9G A;  1TOV A;  2NUT B;  4KRT A;  2G6F X;  1UHC A;  1MND A;  5KYX A;  1UGS B;  3GNG A;  2ZPH B;  5IHI A;  2QEX T;  4ESR A;  4AFS C;  1H3H A;  5LJ3 f;  2DRK A;  3NHN A;  4M77 C;  1QKW A;  2KBT A;  4JZ3 A;  2DL7 A;  3PIO A;  1ZA2 B;  1PKT A;  2XG8 D;  4E7L A;  4C92 F;  2COY A;  3NMZ C;  2HAX A;  3DLM A;  4C92 D;  3M0U A;  1UB4 A;  3ZBD A;  3URG A;  2ZPG B;  4XTU A;  5L8R E;  2GGR A;  3MET A;  3SWN A;  2L89 A;  3G71 T;  4RTX A;  4A4G A;  1X69 A;  2VUB A;  4PFO A;  3H0I A;  1Q95 G;  2JTF A;  2A08 A;  5FU6 B;  7AT1 B;  3PTA A;  4KGV B;  4J9E A;  1CSK A;  4RTV A;  3H8Z A;  1YI2 A;  2RHX A;  1TTH B;  1UGP B;  4PK4 A;  3T9N A;  2F2V A;  4OMP A;  3M0P A;  4D6W A;  2DXU A;  5I22 A;  1NM7 A;  2DKG A;  4JJC A;  5GMK l;  2FG0 A;  3RUX A;  1AWO A;  2RN8 A;  2L3S A;  1TG0 A;  3EG2 A;  1R0C B;  1NPR A;  1XQH A;  1M1F A;  4M77 A;  4LE9 A;  3CME Q;  3CCV A;  1WYX A;  3C94 A;  3KFV A;  1H64 1;  3EFS A;  1VQK A;  3FRN A;  2DA9 A;  2M16 A;  2ED1 A;  5IXB A;  1GFC A;  1JU5 C;  3RMQ A;  1VQ5 A;  2YRV A;  2E12 A;  2DM1 A;  2DK3 A;  3HKS A;  3CCS Q;  2KR3 A;  4PKC C;  1K9M U;  1QWF A;  2F5K A;  3TVT A;  2D9T A;  2OTL A;  2ENM A;  2EKO A;  2ATC B;  2DL8 A;  2O4X B;  2MIO A;  4J9F A;  2QQ9 A;  4M75 A;  3PT9 A;  4C5G A;  1TUD A;  1VYT A;  3HP9 A;  1M8V A;  2ZZD A;  2E1H A;  1UGR B;  3OYL A;  3CBO A;  5FW9 A;  1Q82 C;  1VQO A;  2LJ1 A;  1LOJ A;  1YP5 A;  2K2M A;  5CQX A;  4M7D C;  1WZO A;  4V2S A;  1Q82 R;  3EFO B;  4M7A E;  3G71 Q;  1VQ7 A;  2GFA A;  2M9U A;  1W4S A;  3I56 A;  2X3X D;  1W2B P;  2DIL A;  2E64 A;  3A98 A;  1Y57 A;  5KH6 A;  2WSF E;  3CC4 Q;  4J7F A;  1KSW A;  2EVR A;  2YLB A;  5EC7 A;  2CZ0 B;  1BIB A;  4PJO C;  5GAN h;  3M0R A;  5FRO A;  1YHQ T;  3CCL A;  2DEQ A;  1AHJ B;  2JMC A;  2GFU A;  1GCQ C;  3AHU A;  2DIG A;  3V8L A;  3OY9 A;  1IHW A;  3KUF A;  3NTI A;  2CP0 A;  3PGG A;  3L2W A;  2GNC A;  1Z9Q A;  5L23 A;  1VYU A;  1VQ8 A;  1PG5 B;  2RQW A;  2QQB A;  2H3J A;  2LCS A;  4IIO A;  1I8F A;  2AIR B;  4M7D A;  4RCC A;  4ELZ C;  3MP6 A;  2DPP B;  3LWI A;  1QVG P;  2O88 A;  2COZ A;  3JCM P;  5GJV B;  3H9N A;  4M4Z A;  5ECA A;  2DJZ A;  1ZSZ C;  2J6F A;  1YFN A;  2L0A A;  2LP5 A;  4M78 C;  1QVF S;  5GMK j;  4JDS A;  4JS4 A;  2V8I A;  1GCQ A;  1X01 A;  3UA6 A;  1RAH B;  2D8J A;  1TUG B;  1D0Y A;  4FCY A;  2DL5 A;  4GBQ A;  3OYB A;  1NEB A;  3ULR B;  1G83 A;  3A8M B;  1GFD A;  3N5B B;  3AT1 B;  3PMI A;  5HY6 A;  5C0M A;  2AZV A;  1M1K U;  1M2V B;  1M3A A;  4FT2 A;  4KT0 E;  1E6H A;  2JJ9 A;  1VQN T;  2VYT A;  1QVF P;  1VQL Q;  4OB1 B;  3MPU B;  1YJW T;  2L8D A;  2Y4Y A;  4JJN K;  5GAN 4;  2BIV A;  3QYH B;  2W0Z A;  2DMO A;  4R55 A;  1OV3 A;  4M7A D;  2RB6 A;  5GAN 8;  1WPY A;  4RTZ A;  2DXC A;  3VJP A;  3MHX A;  5HK3 A;  1FMW A;  4IIM A;  3OS1 A;  3BE3 A;  1ZSZ A;  3L42 A;  1VIE A;  4M78 A;  3CCU T;  5GAO l;  1YIT T;  1FX7 A;  4BI3 A;  2ECZ A;  5LJ5 h;  4FYW B;  1VQ9 T;  1K8A C;  3ME9 A;  3OYM A;  2RHU A;  2JXB A;  2HMA A;  2ABL A;  4HCB A;  2P0P A;  1K8A R;  5CR2 A;  2EGC A;  4ELY C;  1WHL A;  4PL6 A;  4F7U A;  5AT1 B;  4KH1 B;  3CME A;  3CCQ T;  1RAC B;  2M0O A;  2OX7 A;  3M59 A;  2QDL A;  3X25 B;  3CMA T;  2EQI A;  2KRM A;  1N9R A;  3CCS A;  4M7A C;  1K0S A;  1IZ6 A;  3S6W A;  4QQD A;  2BKD N;  1ZUK A;  3M53 A;  3JB9 F;  1U06 A;  1K76 A;  2QG9 B;  2XHC A;  1WLP B;  2J06 A;  1JEG A;  4OMF B;  4J7I A;  1JJ2 A;  2DL3 A;  2MWP A;  2QEX A;  4FL6 A;  2DET A;  4CC4 B;  3J80 E;  4KUD K;  4ZTJ A;  3QHS A;  3QWX X;  5CKE A;  2KE9 A;  3JB9 H;  4E7Z A;  1JRI A;  1VQN Q;  1WXT A;  5KYY A;  4MDX A;  2BTT A;  4BB7 A;  3OW2 P;  2AKL A;  2DYB A;  3M4Y A;  3H6Z A;  4F16 A;  1EFN A;  3Q1J A;  2JS2 A;  3CD6 A;  2CH4 A;  3G71 A;  4KGZ B;  2IIM A;  4LUE A; 
#chains in the Genus database with same CATH homology
 4DEY A;  1GBR A;  2KYB A;  2F2W A;  2J7I A;  2EPD A;  1ZSG A;  1AOJ A;  4OMQ A;  3I9Q A;  1MUZ A;  1OPL A;  2VVK A;  1SPK A;  5FWC A;  1UFF A;  1Y0M A;  1M27 C;  1T0J A;  3H0H A;  2KNB B;  3VS4 A;  1X2Q A;  4Z8A A;  2JS0 A;  2DJQ A;  1K1Z A;  2J6K A;  5IHK A;  1GCP A;  2C0T A;  1LCK A;  3EG0 A;  1G2B A;  1IO6 A;  1FMK A;  2GQI A;  1UJY A;  1QLY A;  4J9I A;  4AFU C;  1WIE A;  2LZ6 B;  4JPB W;  1PNJ A;  3EG3 A;  4D8K A;  1PWT A;  1UEC A;  4HCK A;  1NYF A;  2FPE A;  2GBQ A;  4OMN A;  1FYN A;  4OMO A;  2YT6 A;  1U5S A;  3TSZ A;  3M0Q A;  2FO0 A;  3TSW A;  2EKH A;  2L3P A;  1OEB A;  1VA7 A;  4HVU A;  2OAW A;  2DLP A;  3EHR A;  2P4R A;  2O9V A;  2JMA A;  3EGU A;  3I5R A;  3RBB B;  1BK2 A;  2BZ8 A;  2FEI A;  1WXB A;  3PVL A;  2KRS A;  4HVW A;  4OML A;  1WFW A;  1ZUY A;  2LQN A;  3VS1 A;  1M30 A;  1M8M A;  3JV3 A;  2CSQ A;  3UF4 A;  3REB B;  4AG1 C;  1B07 A;  1CKA A;  1SSH A;  1QCF A;  2JT4 A;  2JTE A;  2DX1 A;  3EG1 A;  3M0S A;  2BZY A;  2C0I A;  2KXC A;  4GLM A;  1BU1 A;  1W1F A;  1RUW A;  1K9A A;  4LUD A;  3R6N A;  1KIK A;  3PVQ A;  2O2O A;  2K6D A;  3UA7 A;  2OI3 A;  1AEY A;  3VS2 A;  1N5Z A;  2HBW A;  2DNU A;  2YDL A;  1GBQ A;  1T0H A;  3VRY A;  2K9G A;  4E6R A;  4KRT A;  3O5Z A;  2G6F X;  1E6G A;  1UHC A;  5IH2 A;  2EYX A;  2AKK A;  2HCK A;  5IHI A;  1YWO A;  4ESR A;  4AFS C;  1H3H A;  1HJD A;  2DRK A;  3NHN A;  1QKW A;  4ZNX A;  2KBT A;  2KRO A;  2DL7 A;  2RPN A;  4JZ3 A;  1PKT A;  1ZX6 A;  4R0K A;  1H8K A;  1RLP C;  1MV0 B;  3NMZ C;  2DL4 A;  2CUB A;  2AZS A;  3M0U A;  2CDT A;  1ABO A;  2GGR A;  2LX7 A;  4RTX A;  1HSQ A;  1X69 A;  2C0O A;  3NGP A;  4RTT A;  2GTJ A;  1NLO C;  3H0I A;  2A08 A;  4AFQ C;  1X6G A;  1I07 A;  1CSK A;  4J9E A;  4CC2 A;  1MV3 A;  4RTV A;  2RQR A;  4J9D A;  2PNI A;  3H41 A;  1UE9 A;  2MCN A;  2K7A A;  2KRN A;  4JZ4 A;  2F2V A;  1WX6 A;  4OMP A;  3M0P A;  1X43 A;  2LMJ A;  5I22 A;  1NM7 A;  4JJC A;  2EYZ A;  2FG0 A;  4X1V A;  1NYG A;  1X6B A;  1W70 A;  1AWO A;  3NPF A;  1X27 A;  2L3S A;  2RN8 A;  1TG0 A;  3U23 A;  3EG2 A;  2EW3 A;  4LE9 A;  1B3Q A;  1WYX A;  4HVV A;  1ZUU A;  3KFV A;  3M0T A;  1TUC A;  2DA9 A;  4HXJ A;  2BZX A;  1JXM A;  2DF6 A;  2ED1 A;  2KT1 A;  2FRW A;  1RLQ C;  2D1X A;  5IXB A;  1NG2 A;  2V1R A;  3VS0 A;  1GFC A;  1JU5 C;  2HSP A;  2DM1 A;  2NWM A;  2KR3 A;  1XOV A;  1A0N B;  4QT7 A;  1QWF A;  2CUD A;  2F2X A;  3TVT A;  2DE0 X;  1YWP A;  5IHN A;  2ENM A;  2DL8 A;  3EHQ A;  2A36 A;  2B86 A;  3VS3 A;  4F17 A;  2MIO A;  4J9F A;  4F14 A;  2CT3 A;  4CC3 A;  2ROT A;  1WDX A;  3C0C A;  3SHW A;  1HD3 A;  1TUD A;  1VYT A;  4CC7 A;  1AVZ C;  5FW9 A;  2LJ1 A;  2PZ1 A;  2XMF A;  1SRL A;  2K2M A;  1YP5 A;  1ARK A;  1SRM A;  2K3B A;  3VS6 A;  2X3X D;  2LJ3 A;  2DIL A;  2KEA A;  2RNA A;  3A98 A;  1Y57 A;  5HCK A;  4Y92 A;  1WXU A;  1KSW A;  2EVR A;  2FPF A;  2JM9 A;  4LNP A;  5EC7 A;  1SHG A;  1UHF A;  2LJ0 A;  1PRL C;  2L3Q A;  1T3L A;  2OJ2 A;  3M0R A;  2M51 A;  2JMC A;  2HDA A;  1UDL A;  1JXO A;  2EBP A;  1GCQ C;  1UGV A;  1BBZ A;  1NEG A;  2FRY A;  1QWE A;  2DVJ A;  1UJ0 A;  2RF0 A;  1SHF A;  3VS5 A;  2KGT A;  4LN2 A;  2K79 A;  4AG2 C;  1K0X A;  4AFZ C;  2O9S A;  2GNC A;  1Z9Q A;  5L23 A;  1VYU A;  4OMM A;  2CT4 A;  2RQW A;  2KYM A;  1M3B A;  2ED0 A;  2SRC A;  1ZLM A;  2EYW A;  2LCS A;  4IIO A;  1YNZ A;  1UTI A;  1AWJ A;  1X2K A;  2FPD A;  3THK A;  2H8H A;  2CH4 W;  2O88 A;  1K4U S;  2EGA A;  2V1Q A;  5GJV B;  4M4Z A;  2A37 A;  1J3T A;  1U3O A;  2VKN A;  5ECA A;  1PKS A;  2GTO A;  2LQW A;  1ABQ A;  2J6F A;  2L0A A;  2LP5 A;  2RQV A;  3VS7 A;  4A63 B;  2EGE A;  4J9C A;  2ROL A;  1GCQ A;  3UA6 A;  2D8J A;  2KXD A;  2NUZ A;  3LH5 A;  1KJW A;  2DL5 A;  4GBQ A;  4J9G A;  2EYY A;  2M0Y A;  1NEB A;  3ULR B;  1G83 A;  1GFD A;  2RQT A;  4Z88 A;  1PRM C;  2D0N A;  2AZV A;  1E7O A;  4K11 A;  1M3A A;  2PTK A;  4J9H A;  5IXF A;  3PE0 A;  4J9B A;  1E6H A;  3I35 A;  4RUG A;  3GBQ A;  2RQU A;  3QWY A;  2YUP A;  3SEM A;  2LNH B;  3FJ5 A;  4DEX A;  1QKX A;  2W0Z A;  2L2P A;  2DMO A;  1OV3 A;  4JJD A;  1RI9 A;  2YUO A;  2CRE A;  2AK5 A;  1NLP C;  1ZBJ A;  1Z9Z A;  2X3W D;  4RTZ A;  1AWX A;  2O31 A;  2VWF A;  1UG1 A;  2A28 A;  1JO8 A;  4IIM A;  1OPK A;  4ORZ A;  1H92 A;  3H0F A;  2YUN A;  4RTW A;  3REA B;  2DBM A;  2SEM A;  2JW4 A;  2ECZ A;  2YSQ A;  1CKB A;  3RNJ A;  4Z89 A;  4JJB A;  2KT8 A;  1OOT A;  2JXB A;  2ABL A;  1I0C A;  3VRZ A;  1AD5 A;  2EGC A;  2ESW A;  1I1J A;  1M3C A;  4RTY A;  2JM8 A;  2MOX A;  2CSI A;  1PHT A;  1YN8 A;  2DRM A;  1KFZ A;  2HEQ A;  1AZE A;  1BB9 A;  2QDL A;  1S1N A;  1SEM A;  1YCS B;  2EQI A;  3CQT A;  2KRM A;  2DBK A;  3ZL7 C;  1V1C A;  1WI7 A;  1K0S A;  4EIK A;  1JQQ A;  1ZUK A;  1GRI A;  2YUQ A;  1U06 A;  1VYV A;  3IQL A;  1K76 A;  2E5K A;  2J05 A;  1WLP B;  2J06 A;  1JEG A;  1AZG B;  2DL3 A;  2W10 A;  4CC4 B;  3UAT A;  3QWX X;  2KE9 A;  1T3S A;  2J6O A;  4D8D A;  1AWW A;  1WXT A;  4WCI A;  5GJW B;  1W6X A;  2BTT A;  5FWB A;  2AKL A;  3I5S A;  2DYB A;  5I11 A;  4F16 A;  1GL5 A;  2I0N A;  1EFN A;  2JS2 A;  2D8H A;  4RTU A;  2RMO A;  4FSS A;  2CH4 A;  1UUE A;  1WA7 A;  2IIM A;  4LUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...