1PKUA

Crystal structure of nucleoside diphosphate kinase from rice
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
RMEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSFAQQHYADLSDKPFFPGLVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIRADYAVEVGRNVIHGSDSVDNGKKEIALWFPEGLAEWRSNLHPWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside Diphosphate Kinase I
publication title Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (Oryza sativa L.).
pubmed doi rcsb
source organism Oryza sativa
molecule tags Transferase
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1pkuA00
1S57A 2B8PA 2HVDA 2NCKL 5IOLA 1EHWA 1B4SA 3Q8UA 4KPCA 2DXFA 4HR2A 1JXVA 3Q83A 3VGSA 1BUXA 3GP9A 3ZTPA 1HHQA 1PAEX 1BE4A 3BH6B 4O0NA 1NSQA 1WKLA 3ZTOA 3EVWA 2ZUAA 1NDPA 2DXEA 4W98A 2DXDA 1KDNA 3EJMA 3FCVA 2DYAA 3ZTQA 3BBBA 3JS9A 1HLWA 4UOGA 3FCWA 1NCLA 2B8QA 3VVTA 3WX8A 4F36A 1NDCA 1VYAA 2AZ3A 3ENAA 3VGVA 2DY9A 3MPDA 3B6BA 3ETMA 4DI6A 3DDIA 3VVUA 1MN9A 4UOHA 1ZS6A 3Q89A 3FBBA 3Q8YA 3BBFA 1U8WA 3FBEA 3FBCA 3GPAA 3NGRA 4ANDA 1S5ZA 1NSPA 4CP5A 3NGTA 4ANCA 4DZ6A 1BHNA 4ANEA 4UOFA 2CWKA 1PKUA 3VGUA 5CABA 4F4AA 4S0MA 1NLKL 3EVOA 1W7WA 4FKXA 3BBCA 3ZTRA 5BXIA 2VU5A 2BX6A 3FKBA 3EMTA 1NDLA 2AZ1A 3VGTA 3B54A 1S59A 3PJ9A 3FC9A 2HURA 1XIQA 1F3FA 1LEOA 4DUTA 1XQIA 1LWXA 2HVEA 3EICA 3ZTSA 5C7PA 1K44A 2BEFA 1F6TA 1MN7A 1WKJA 4EK2A 1HIYA 1NDKA 3BH7B 5CAAA 3NGSA 3EVMA 3G2XA 3DKDA 4FKYA 1WKKA 4WBFA 1UCNA 3R9LA 3PRVA 3EE3A 3L7UA 3Q8VA 3FBFA 4ENOA 4C6AA 3EM1A 1NHKL 3NGUA 3ELHA 3Q86A 1NUEA 1NSKL 1NPKA 1NB2A 1B99A
chains in the Genus database with same CATH superfamily
4H4OB 5IOLA 2IBKA 2KM8C 2C2MB 4KV8A 1PG5B 3UDCA 2HRYA 4DPOA 2VHGA 1HNXF 2CPDA 1JNZB 3LWLA 3GG0A 3E3XA 5K14A 3POTB 1LW0A 2ZOGA 1U49A 2HFVA 5J2NB 4CM0A 1Q7YT 3NP5A 3T1HF 4PWWA 3R1HA 3ZO7A 3GIKA 3O8WA 2J5AA 3RB6A 1YRXA 1FT8A 2AP6A 3NNHA 4U6PA 4TU9A 2L08A 3S01A 3PIPQ 3W63A 4C8OA 1C0TB 2ERRA 1RT7B 2BR0A 1RHJB 4KO0A 1QY7A 4DV6F 4OYIA 2ZZNA 1Q7LB 1S7HA 2UXCF 3C6UA 5FIIA 3DLJA 3CCJS 1NU4A 3K7RA 1GXLA 2DNQA 3MPVA 2KJWA 4Y2AA 1SUQA 2RMLA 2CRLA 1VOMA 4DV5F 4IR9A 4DX8H 1BE4A 3RRGA 3KFWX 1SC6A 5IT0A 2A6MA 4ZCKA 3CCWA 3SSRA 2LQ5A 2ZM6F 2JHEA 2JL9A 8AT1B 2EKYA 4DFKA 2XZWA 3K5MA 1SJFA 2M9KA 5HAOA 3UN5A 2CJ9A 4DR5F 4ANDA 1ZA1B 1XERA 5GAHI 1JLGA 2IYGA 3CCQS 1SJQA 2Z56B 2UU9J 3KK3A 3LPEA 1GMUA 4GO5X 5CHCB 3KXDA 3AB2B 4PQAA 1HL6A 2JNJA 3H42A 2A0FB 1G4CA 3RB0A 2AKWB 4DL0C 1I1GA 3UD4P 4UZBA 5CD4A 2JFKA 2OO4A 2DHGA 1NEEA 2W1BA 1RTJA 2P9EA 4MFBB 3EGWB 1FCAA 2Y8WA 4P7TA 5HATA 3M7VA 2CFXA 4KB7A 4AL6A 2HAIA 4M5MA 3TUIC 5LSOA 1VYAA 2X51A 2B4VA 2HHQA 4I69A 1T9TA 3DRXA 2XYGB 1TZ0A 4DR4F 4OLOA 1VIXA 2R8GA 1HNIB 2KT3A 1NJWA 1IJEB 5H9EJ 4RW9A 3LP0B 2O66A 4QYRA 4NCGA 2NLWA 4KSEB 1KQKA 1WD6A 1HQUA 1RA6A 3MM6B 2BE7D 2V50A 2LVWA 4OZLA 1FNOA 1AA1B 3CJ8A 1M1KT 2YKOA 2I5JB 1I6JA 2ACMA 1M5PC 2F65A 2B3TB 1H2TZ 4FN5A 1GAOA 4F7VA 3KUEA 5L38A 4RW7A 1S0VA 1CJKA 2B8PA 1TFYA 1VC0A 2A18A 2XWYA 3FDSA 1X5SA 1HWJA 3KLEB 3DRRB 2B56A 4U67Q 1IWAA 3BBBA 1U24A 5AT1B 4D3GA 1S9GB 1RAFB 3HSDA 2QA4G 3HT0A 3H5UA 1WHXA 3DN9A 1FKOB 1N33F 2E7WA 2CQGA 2MLXA 3IBFB 1SIWB 4RNHA 1TL3A 2AJQA 2CG8A 1CQMA 2RE1A 4AQYF 3IBWA 4WKYA 1HNZF 2BVZA 2E1PA 4WIIA 4Q44A 1HYSB 2QLWA 1OQ3A 3B54A 3BO3A 2F1FA 2V8DA 3H0PA 2IJRA 2N3OA 2JH3A 4FYXB 2BANA 3C8YA 3ZZUA 3PV8A 2YBVA 2HHUA 4W4MA 5H9EK 2KXFA 2KG0A 3H4DA 4ENOA 2HBYB 1WNEA 1U8SA 3C3LA 4C11B 5JVGQ 5DGBA 2YH1A 1NRKA 4O0NA 1N6QA 4JI8F 1NKBA 4OI4A 3VZHA 2IRXA 4L72B 5IQ6A 1RXOB 3FCWA 4C8YA 1S76D 1RKIA 3GJRB 3WQPA 3A3NB 3RYLA 2HHWA 3K0JA 4IO1A 2CPJA 3OHBA 1NSPA 3IWLA 2XB2D 4K4YA 2W2MP 2HS4A 1N5YA 4DR2F 5B0FA 3HX9A 1X4FA 1VQOS 3EDRB 1NJZA 1FJEB 4HACA 4PG5A 2VU5A 1NJXA 1NDLA 1V9OA 3AXKA 4WTOB 3G6VA 3T1YF 4XDCA 4LVOP 2KL8A 4GKKJ 2V9WA 4DOZA 1JJ4A 3O6QA 4ED4A 3DYAA 1WF2A 2KXHA 4I2PA 4X4OA 3HZGA 5DZ6A 1HNVA 2EBGA 4FS1A 1RT4B 1EARA 2YX1A 1OO0B 4MIBA 2WVEA 1TL5A 2FVQA 3W9IA 3QPIA 2POKA 4LF4J 4DV7F 5MLCV 2BE9B 2FLOA 4TY8A 2KDOA 3CULA 2K1RB 4MIWA 2DISA 4BHQA 1VK8A 1DLOA 3OUYB 1HHQA 3E01B 3R5DA 3PHEA 6FDRA 5F3TA 4D3HA 2D3UA 3CJKA 1SQEA 5E3AA 2DHSA 1FRLA 4URQU 3DLLQ 2JC0A 2W9BA 3QLHB 2JZ5A 4OZJA 2RDJA 4ZMMA 3DI6A 2V4JB 2W4CA 1CPZA 4NZ0A 3NRBA 1UPPA 1YJ9S 4NLOA 2BV3A 3DGVA 4USWA 3PEJA 1TL4A 2XS7A 2C22A 2ZC3A 5HMZA 4PXCA 2FD2A 1LWFB 3Q22A 7FDRA 3K57A 4ZLLA 5DDRC 4OL8A 3WC0A 1UWAA 5DJBA 4YDXA 1YG0A 4WBFA 3M2VA 1X4BA 2C2DA 3O3LA 2D69A 1HNWJ 2OI2A 4DL2A 3NOCA 3M6XA 1S7IA 4WF9Q 3OV7A 4CLKA 4LBIA 2QYGA 3BO4A 1J2VA 1M1HA 3J80U 1SH3A 1QAXA 2EWHA 1KDNA 1UWBB 2DNPA 2HZAA 3OR2A 3SDEB 2XY5A 3NOGA 3M30A 4HH0A 4ZVRB 3FRZA 4UTGA 1Y11A 2VV5A 3IM8A 3GILA 2ZHAA 5BR8J 1RU2A 2Y1RI 1M5VC 1YJ7A 3VAHA 2CVIA 2OEJA 1PKUA 2YPYA 1JJHA 3CDWA 4DG1A 3GJQB 3GIMA 4KV8B 4UUXA 3BR8A 2EG1A 4X66F 4RX6A 1VHIA 5K14B 2VKRA 4YB7A 1RT1A 1LW0B 4IRCA 2OKQA 1YJRA 1HD0A 5F9NA 2JJ4D 3PX6A 3CB4A 3PX0A 1NKCA 3QWPA 3M2RA 4L73A 5DG8A 1NUEA 3OSNA 4PPDA 3R6GB 5BYSA 4LFAJ 2MLZA 4NL5A 3OVSA 2DJWA 3T6BA 4B9VA 1WHVA 2V34A 1FWLA 4KO0B 4ZVUB 1K73T 4CO2A 1P9YA 3HHLD 4J5OA 4TY9A 1K1QA 1P8GA 3C6UB 3CJ0A 3W9JA 3MPDA 4YY3J 1RGVA 5AXLA 1GMVA 1GXTA 4ALZA 2FYXA 1SUQB 2B4PA 3ZZPA 3FEZA 2AD9A 3CTRA 1VBXA 3X1LB 5GVQA 1DQ9A 1R0BG 4IDKA 5I4MA 3LPYA 1FK9A 1OSDA 4UQTA 2EFVA 2F4FA 2RRNA 2QRRA 4F0MA 2RHSB 1NB7A 2FDNA 5J2PA 4ES1A 1JLGB 1J27A 3PM9A 4U8YA 4A46A 3QYYA 4XPCA 1IBKF 3CVKA 1Q53A 4JI7J 1S9FA 3KK3B 4DHVA 5L1JA 2BM0A 1TAQA 2Y3YA 1ZAXA 2ALZA 2BUNA 5J2MB 1NSQA 4KGVB 5KFMA 1VI7A 4TU7A 6AT1B 3N9UC 2Z0GA 3K5PA 5FDLB 5CXTA 1HD1A 4RWWA 4ES3A 3DOKA 1RBAA 1RTJB 2OSRA 2ROPA 3I9ZA 1L3UA 4P73A 4RJVA 4NA2A 3TUPA 1YTYA 3OTBA 3OPKA 4HKQA 5KFNA 2V8VA 2EBEA 3CW2C 4B02A 3A3OB 3C15B 3N5BA 3DRYA 1WSRA 1IJFB 2HQIA 3SV3A 5LM7E 1TMJA 3KUHA 3MTJA 3M8YA 4JI2J 2BJ8A 5JUMA 4RW9B 4ZPAA 3NL0A 1N52B 1UW4A 2W9CA 4NCGB 2PMZD 1HA1A 1JLCA 1T03A 1HQUB 3GV8B 2QC3A 3ZTPA 2V4QA 1T0TV 1FJ7A 1FRJA 2RB7A 4JI3J 4UOGA 3QGIA 4A48A 3KTQA 4TQRA 3MMBA 1UPMB 4RBVA 5L9NA 2VBXA 2YVSA 1JLFB 2UXBJ 3H2LA 5ETRA 2W2NP 2OPSA 4HLBA 4IOCQ 1WC5A 5D4LA 2WK4A 2I1RA 4USUA 4RW4A 3BZQA 4XDDA 1NH8A 2G2OA 3I96A 3CUNA 1D09B 1WUUA 3BPSP 2K3KA 2BX6A 2IVYA 4URSA 1CJVA 4EEYA 3D6FB 1XMBA 5KFKA 3D0IE 4YHHJ 4F50A 3R5BA 3GFYA 1XTZA 4ZA1A 2DR9A 4R0JA 4LMZA 2E5LJ 4J37A 2F3JA 4DFMA 5C42A 4DV4J 2YKQA 4XO0A 2DRBA 3BKFA 4OX8A 1UVKA 2J0SD 3U1LA 1EKSA 2XO7A 4DR1F 1TUVA 5CZVA 3H2UB 2VODA 3CEDA 2DNKA 1CS4A 1WKLA 1YLXA 4DV3F 2IIHA 5IS2A 4DR7J 1U2FA 2XS2A 2V68A 1KNZA 5KFFA 3MR6A 5DDOC 2DNZA 3WX4A 3J81Y 2ZHBA 1FDBA 1X4GA 3Q2SC 2LFVA 1SB6A 2XSFA 2YWKA 4USVA 5KFHA 1MG7A 2A10A 3GIIA 1UVJA 3QSYB 3F44A 4IRKA 2XBPA 5ETKA 1ZM9A 1N6QB 1CVJA 2J6SA 1HNXJ 1HI8A 2P5VA 3MOJB 5B7WA 3CWJA 2MZRA 1REVA 2CQ3A 1KS2A 4JI4J 1I94F 3KHRA 3T1HJ 4MKVA 5ITHA 4B9TA 1N5YB 1VCTA 4Y28C 2U2FA 4FP9A 3D0HE 2NUUG 4JV2A 3FQLA 2JDJA 4CYUB 4UOHA 3C46A 2FUG9 1U2CA 2E1RA 5L39A 1QUPA 4QOTA 2F7VA 3EJMA 4ZVTB 3KHHA 1RHUB 3DYAB 3UD3P 1M5HA 5KT2A 1DAXA 3MCMA 5HMYA 2GAHC 1HNVB 2OMOA 3OFFA 1MN9A 5D6GA 4QWDA 3R7BB 1VQMS 3ZZTA 2OELA 2CJXB 3BSAA 3ZZ0A 4AD6A 2CPEA 1NHUA 2R9LA 2MZTA 1IWGA 2X1AA 3W61A 1AB8A 2GQQA 4TY8B 1DLOB 2DHXA 3QIPA 4JYAF 1S1VA 3CCTA 1S6QB 4A8WA 5D4NA 4OHVA 3CJKB 3EXYA 3NMAA 5C2GA 2ZM6J 3PCOB 2K7JA 3SYZA 3M9NB 2HFNA 2BJ3A 3TOQA 2X3GA 5GADI 2B5JA 1X4EA 3ZZOA 5M2PA 4DR5J 3DI6B 1F9HA 3N0VA 1M90T 3HJVA 1YGYA 2XZTB 7AT1B 4PXEA 3HD1A 2FPHX 4TU8A 2NREA 5DQGA 3V4IB 3NCPA 3RB3A 3HCXA 1CQNA 3DC2A 1WC0A 2DITA 1RKJA 4BWMA 2RF2A 4QZVB 4ZVSB 1IM6A 3NS7B 3M2VB 1F2HA 2GC8A 2RHQB 4PG7A 2XGQA 1HBNA 3L3CA 3BGRA 1KOOA 1X8DA 4DZ6A 3IGVA 2XULA 5LJ3Y 3LP2A 2R7QA 1BQNB 4P74A 5CD4H 1PILA 5BYRA 2VUGA 3ZFVA 2HNYA 1IKWA 5D78A 1S97A 2RJZA 2CQ4A 4ELTA 1C1BA 2MY7A 5DS7A 3BGOP 3OR2B 4NRUA 2RQCA 4JI0F 1LEOA 1XQIA 2DEJA 3M30B 1F3VA 4L6V3 2PSZA 2QL9B 4PPZA 4EU0A 3BS9A 3KLFB 4MK7A 3R7NB 4CLSA 5FLXU 2R7WA 4DG1B 1XBWA 4DV1F 3SCJE 4RUAA 1YJNS 3HHLA 4KYZA 4J9NA 3QBCA 1PBUA 2XO6A 5A8KB 1HQ2A 1BLUA 3FEYB 4ZVFA 4B3TJ 1TP7A 4DL7A 3EX7B 1UFKA 1FRIA 2CPZA 1NK8A 4LQ3A 3W9HA 3M2RB 1J5EF 1R8HA 1TMMA 2RUGA 5ETVA 4HTIA 2ZZTA 2VKZG 3SSQA 2XQCA 5GMKa 3IN5A 4C97A 1VIOA 5GAEU 4QQBA 2SXLA 2EFPA 3ZZZA 1X31C 2QSFA 1QJHA 2M8DB 2F9JA 4MTPA 3WZ0A 1HR0F 4ZCMA 3OFGA 3Q24A 2BJ7A 3G8QA 2I2YA 2YQ1A 2FVRA 3QJPA 4WKRA 4NYOA 4OQJA 4DX5A 1N4LA 1B0VA 4ELVA 4ZJLA 2FZKB 3TAQA 1K8AT 3AFGA 4Q8EA 1B99A 4AQYJ 1UA1A 4ED2A 5A8WA 1HNZJ 2UUBF 2DXFA 1R6VA 2KTQA 1BUXA 2N3LA 1FK9B 1S49A 3VCDA 1AZSA 3QQCD 2LXIA 3SV4A 1R0AA 3QT8A 2PGCA 1SC1B 2HZCA 3A12A 3SBMA 3MAQA 5J2PB 2KT2A 3QSIA 3QZ7A 1HHSA 3BM7A 1S48A 3SEOA 5KT4A 4UOFA 2YPZA 3VF0B 5A0YA 1MMNA 4CNZA 5HROA 3EZUA 2E5GA 4KHPF 4L75A 1W7WA 2V9KA 2K06A 2AGOA 4I7FA 5KFOA 2LA6A 3MEEA 1VC5A 2VFVA 1D3WA 1NBEB 1GTHA 1KD1T 5JJBA 4FPIA 1TUWA 1NNDA 5KFXA 4DPXA 4YEAA 4OZ2A 3DOKB 3MPYA 1VLYA 2MY8A 4H4MA 5AE2A 3BDEA 3PRVA 2YX4A 1ZETA 5SUHA 1OY9A 1A7GE 4KH1B 3KUGA 4ZVEA 4DR2J 2WAQD 4DU7A 5F41A 4O4RA 2XC9A 2P2CB 1U1RA 4LR7A 1IR1A 4NMXA 3FZ2A 3NS5A 2ATLA 4K4XA 4WIQA 2R2TA 1TKZA 4PG6A 2UUCF 4NI2A 2ZDOA 1TK0A 1RU1A 2H5JB 1Q16B 3PYGA 3P8BB 1H2UX 5HQMA 2J9DA 1VS3A 3Q0AA 1SKRA 3VAFA 1JLCB 1T03B 1ZOTA 4ZN3A 1KVIA 3BJYA 1SI9A 3BBCA 4WPAA 1YJTA 3GG1A 2KRRA 3HFKA 1LKZA 4PUOA 2MPUA 4RBUA 4FXWA 3IR6B 2XNRA 1B70B 3MMBB 5C7PA 2YY3A 2XMKA 2HHVA 4EO6A 3HLUA 4RPFA 3LALA 1O6XA 2GJFA 5IWAF 1U02A 1RK8A 1RA7A 3DHWC 4RW4B 3KG1A 3DDNA 3D1HA 2QTWA 1KQGB 4KPCA 3Q83A 2CIMA 4LF2A 2CPHA 2W01A 3R5JB 4RU2A 2GVDA 5B0AA 2G2ZA 5THWA 1GX6A 2QYCA 4L3KA 1FJGF 5KT7A 5C42B 3O1LA 1M5SA 1EKRA 4NASA 1U8WA 3ISNC 2XNQA 4F0HA 3AJ1A 3SCKE 3UDVA 4ZVHA 2O5DA 3O2IA 4DLGA 3FSXA 4WFZA 4YN3B 2JSXA 3LW5C 1WORA 1CS4B 4ETZA 3BR9A 3P3DA 2EFQA 3ULHA 2XY7A 5KFEA 2IY5B 1X4HA 2RSQA 3E2EA 2M2BA 1KVJA 2VJVA 4EWTA 1RSCA 1IR2A 3PW5A 2HW3A 3EM1A 4FBUA 2VPZB 1KHVA 4OZ5A 3J7YU 4R5PA 4ID5B 1RWUA 2AYGA 4WU3A 4ZLNA 5CQGA 4X66J 2IFXA 3NAIA 3MM7A 2J0WA 4Q2LA 4OZ3A 2DPJA 1FDDA 1REVB 4I4BA 2UUTA 4YS2A 3MUVP 4LR8A 3OL8A 3M8QA 2IA6A 3IG1A 3GIJA 1CBKA 4ANCA 2JEGA 1JNRB 2ZUGA 3J81j 1H7WA 2CWKA 5FD1A 1FWPA 5E33A 5KFWA 4JV5F 4Y3CA 2OJ3A 2ZFHA 5KFQA 5H1SV 1K9MT 3PFEA 3FKBA 3MI7X 3EMTA 4AFFA 2KXNB 5IFMA 2VOPA 1RWPB 4M5GA 3DLKA 3CF5Q 1HWKA 1KOHA 4KQZA 3UE2A 2IC3B 3Q8QB 2MKYA 2Y8YA 5EX3A 1LNQA 1RWNB 1YITS 1B0PA 1H38A 4FXVA 2PO4A 4O44A 3BYRA 3QFWA 1DZ5A 4P2XA 2V8HA 4ZCIA 3FBFA 2D3ZA 3OBIA 4O3RA 2G9OA 3QIPB 2C2EA 2ZH1A 1S1VB 2ZE2A 3K8VA 4N7TA 5B0BA 4B3SF 4F3MA 4ED5A 2C2ZB 1HW8A 5C25A 1JKHB 1RBOB 2QSWA 4Y65A 2PN6A 4M94A 2JVOA 5HVGA 1I5OB 4Y00A 4YDDB 1IUJA 4CLZA 3NAHA 2C2RA 3AXMA 4HHJA 1U47A 3QJLA 4BCAA 2CJAA 2I9SA 3LO3A 3W3SA 2J0XA 4DFJA 3K5NA 3KLHA 4O3PA 3IXQA 3MOZA 2ASYA 3D66A 2L3MA 3A8EA 3HSGA 3W2VB 2RF2B 4CH0S 3NY0A 1LWXA 4M5LA 1SKUB 1TL1A 1C0UA 2ILYA 1HBNB 4LFCF 1T7PA 4I64A 3BGRB 3DFEA 4CO3A 2UUWA 1QUVA 2LQJA 2R8HA 2HGLA 2XI2A 4NLSA 3LP2B 3TX0A 2Z30B 2ZH6A 3UN3A 3PO4A 2HNYB 1IKWB 1EQMA 2AMCB 3HHEA 1C1BB 1RWVB 3IA0A 3BH6B 4P2MA 1XMQJ 4WZQA 4A8MP 1WTFA 1KQSR 1LV5A 2WB1D 3QT6A 2YKNA 2DYAA 4ZP7A 1F0XA 1T02A 3I31A 2JRSA 4LF7F 3J7AN 3H25A 3DU5A 4EUVA 1P1TA 5F3ZA 1LWEA 1VRTA 2LU2A 4ZP6A 4PEOA 1KR4A 1T9XA 1WHYA 1VJWA 3F56A 3HHLB 3W1YC 1QSYA 1N34F 3JYTA 3LP1A 2HVZA 2KKHA 1T3OA 4ILMA 1EB0A 5I3UA 1DRZA 3OW2R 2IPOB 5L1IA 3MEDA 5AXKA 1ZPWX 2ZBPA 4GC7A 3MCNA 2XTJP 2APOA 5EN1A 3NS6A 2DR7A 4PKDB 1UCNA 1OPIA 4OI1A 1VQ7S 4ZPTR 5K8OA 2YNGB 3TYTA 2HBRB 3PVXA 4DN0A 3EGNA 2WVFA 2QFJA 4KR0B 3ZTOA 4I0WA 2VFTA 2OTLS 2KHDA 5DQHA 1RDRA 4F36A 3DU6A 3NWGA 1H98A 2BW2A 4B17A 3I4PA 2CQCA 2DT9A 3WC2A 3UN2A 3HSJA 1HBOA 4ZLJA 3QT5A 3W5ZA 1IR0A 1N8RT 4F8RA 2DO0A 3M8ZA 1F1BB 2AX0A 2QG9B 4I56A 1S9EA 3L95X 1FDNA 3BEGB 1JXEA 2AZ1A 4DV3J 4L3NA 2OFGX 4LF8J 3MR5A 4YB5A 3JTNA 3KOAA 3MEGA 1RT3A 3HI9A 4LSZB 1K47A 3QGPA 3BSOA 4TLRA 4OZNA 1MN7A 1FFSB 4P2FA 1M1GA 3CJ2A 2FY8A 1U1NA 5A0YB 5HROB 4USIA 2GJIA 1NB2A 3CJ5A 3GSDA 4I7FB 3FVYA 4HL9A 3MEEB 4OYWA 5K8NA 5LSRA 1ZZNA 4WE1A 2QLFB 2OH2A 1IKVA 1FERA 1NDCA 3ITHA 1I94J 5B09A 3MR7A 4H4MB 3KLGA 3HZEA 2MGZA 3D1QA 2XYHB 3NGRA 1U2RA 1C1CA 3R5GA 2WSCC 4I6YA 3NCQA 3C19A 2ZOFA 4WYLA 1BWVA 3PRBA 2DH7A 3OLAA 2K3IA 5I42A 5KFSA 4QPTA 3ZC4A 2GCFA 1MU2A 2D1CA 1TKZB 5E3PA 2XSJA 2A2DA 3TNVA 5LL6d 3PTWA 1VDHA 2C1EB 4NI2B 1IQZA 2LEAA 5HO4A 3TA2A 2KFYA 5EWEA 4DV0F 2GGPA 1NK0A 4FKYA 3AQOA 1UW9A 1V3SA 2CADA 2RQKA 2Y1JA 2CUYA 2J0QD 3Q8VA 4XK8C 5D0HA 1TKXA 9ATCB 2GHWA 4DMZA 3PJWA 1O8BA 4FPRA 2IM3A 3PW4A 1B4SA 2MQNA 4OHZA 4JYAJ 1R89A 3MMCA 4PUOB 3DOMA 1T8EA 2XMWA 2VBZA 2JEJA 1PAUB 4J9PA 3KG0A 1S72S 1TUGB 1NK5A 4LUBA 3GCXP 1KFDA 4K4UA 1NH7A 3QZ8A 4WK1A 4RU9A 1KTVA 4QIVA 3LOUA 5B0GA 2LA4A 3KK2A 4RZRA 2MZSA 3C14A 2Z2LA 1MW7A 1BC6A 1PSDA 3K17A 2GVDB 2OPRA 4DQPA 2DD8S 2BYCA 4IR1A 2W2QP 3R2CJ 3BGLA 2IJNA 1TR0A 3BV8A 3I6PA 4FYVB 2VG6A 2YX7A 3IRWP 1WKJA 4LF6F 4CLYA 3D6MB 2VONA 2K8GA 2R7VA 3R8YA 4RNFA 3JAMY 1EJ7L 2A3JA 2KHCA 3DRSA 3JB9k 1UEVA 4LSNA 2XI3A 5AXNA 4A47A 2IM1A 3OVAA 4QJVA 2GMJA 4DN9A 4JI0J 3QAEA 3ZZRA 2CKWA 5KOWA 4I67A 3KDNA 1UKUA 1WTBA 1GNKA 1WEZA 4ZPVR 2ZH4A 2HFOA 2JEIA 1S5ZA 5ETLA 4PYDA 4NE9C 1IBLF 4R5PB 3OHAA 3VGUA 3FMBA 1CJUA 3A8KA 4ED0A 3V6JA 3GONA 1XC9A 5KFRA 3LGNA 5H9FJ 3KLIA 3Q8RB 1R7IA 4Y0FA 3CO9A 2FJAB 2I8EA 5EX0A 1ACMB 3IG1B 3PW7A 2BQRA 3IR5B 2FTRA 2VICA 2ZJPQ 4NXNF 4O3QA 1NDKA 4K0KF 1J5EJ 2OTJS 4P71A 4PXDA 1QSLA 2XM3A 1HFEL 4QWCA 4IOAQ 2ZWOA 3KHLA 1WI8A 2V2VA 4XPEA 1NSKL 2ZH8A 2CWXA 3UDLA 3CCUS 1PYTA 2ZVSA 3GP9A 4G3IA 2AHOB 4L76A 1FE0A 2M3DA 1FNMA 3DLKB 1VRUA 5IC6B 2BACA 1YKWA 1HR0J 4AUKA 5F8NA 4KKOA 1IBCB 3N79A 3VVUA 4HT7A 2AEMA 4PAAA 1GT8A 4Q45A 5K20B 2H51B 2MSSA 4CLFA 2ZE2B 4FF1A 3CD0A 3MF5A 2HK2A 4Y6IA 5KFAA 3HT3A 1VQ6S 5L1KA 2OLWA 4C98A 3G86A 8RUCA 3JTOA 4QIGA 3ETOA 1TV6A 1JQGA 5C25B 1S1WB 4EGLA 3PJ9A 4CQ1A 1WWHA 1S77D 5KFBA 3BH7B 3M8SA 3V4MA 2ZKUA 4B9LA 3G6YA 5KFIA 3VAIA 2GNKA 3HHLC 3ENWA 2NZCA 3KLHB 4KHPJ 3ICLA 1QE1A 2VFSA 5H9FK 2HHSA 1S99A 3CT9A 2EPIA 1GXUA 3PW2A 4DUYJ 4IG3A 1CJTA 3FFIA 2HSEB 3FZBA 1GX5A 2BJ1A 1HARA 1RTIA 4ECWA 3M32A 4OI3A 4LSLA 2KYXA 1TL1B 1C0UB 4IOBA 3TJ9A 4YQWA 1IQTA 2LCWA 2GQ2A 4Z7YA 1S6PA 2AEJA 1R8CA 2MZ1A 2H3EB 3C2PA 1PGZA 1LW2B 3JQMA 2Z58B 3DMJA 1Y00A 4ZKAA 4G1QB 3PEHA 3LUYA 1FVQA 1NKEA 4IFYA 3GYGA 4PABA 4DDFA 4UT4A 4YR0A 4FVMA 3A13A 3VGTA 3EGZA 2YKNB 3LGMA 2ZWPA 1XNQJ 3NMRA 4NRTA 3TARA 2HHHF 5T7LA 1F6TA 2UUCJ 1LWEB 1VRTB 4MJKA 2CA9A 1RTDA 2W8LA 2EVZA 1S4EA 3R27A 3JYTB 3LP1B 2VA3A 3HHDA 5I3UB 3I0SA 4X4VA 4XAKA 2BDPA 4LRFA 3W8PA 3MEDB 4W98A 4QYZJ 2HIQA 2EK6A 2LECA 1MSWD 2NYIA 4C0HA 2ROGA 4NEZA 4RW8A 2UZAA 1PJ7A 4UQGA 3BREA 4X4PA 2VQFJ 2FJDB 3BBFA 2M88A 2Y1IA 5IWAJ 3HXMA 3EYZA 2D41A 3UW1A 4AXIA 1LK5A 2BJDA 1LXNA 2EC2A 2GW8A 2GVZA 4ANEA 4CZCA 5ETTA 1H0HB 1YBUA 4RLEA 2HBZB 2AJ2A 2UUAF 4JUZA 2HRUA 1RT5A 2VC0A 4KH0B 4ECYA 5KFJA 2AYMA 2DNOA 4OYOA 1ZYQA 5KFVA 5EWGA 3ISZA 4DZDA 3P96A 3BSNA 3M1VA 4OI6A 2MEWA 2FJVA 1WSVA 1HBOB 3EE3A 3MM5A 4H54A 3RZAA 3GR0A 3IAM9 3OSPA 1ZH5A 4UOCA 3HP6A 4HVZA 3M05A 3RGIA 2VL1A 3KG4A 3MEGB 1RT3B 2F8EX 1N5QA 2B9XA 2ZKTA 4LFBF 1HWIA 2L9NA 4ID8A 1PJ6A 2CQPA 3GFZA 1Z2LA 3PDNA 2GHPA 2NPIA 4NCAA 1U25A 4V1Ak 3AY0A 3QO9A 2ILZA 2H4YB 3MMAA 4NPOA 5C2CA 3W5XA 3VWSA 2DIVA 4WE1B 4ELUA 1R43A 1SL2A 4J9OA 4QYZK 1MROA 1D9FA 2QV6A 1UJ6A 3ITHB 3FC9A 4ZIVA 3TZWA 3KLGB 2AJ1A 2MGZB 4HHUA 3VZIA 2WVCA 4DL4A 2R4FA 1C1CB 3EPIA 1OS5A 2XCAA 1U1MA 1RI7A 2COLA 4OX6A 2DNMA 5DM7Q 3GR1A 4GVLA 3BO2A 3ELHA 4P9SA 1OSCA 3HJFA 1X5OA 1MU2B 5IT9Y 4TYBA 2DTJA 3S8SA 4K5RA 3K5LA 3IM9A 1NPRA 2XSJB 2K2PA 2FGCA 1KLMA 2EC0A 5KFUA 4QW8A 4NLVA 2GGPB 2UU9F 1ZM2A 1TKXB 4FYDA 3KWMA 3TUZC 5DRKA 5KFDA 2P8IA 1N0VC 4OYBA 3MMCB 1YI2S 5DDPC 2QMXA 2D74B 1M0SA 3DLEA 5C24A 3SFGA 1RT6B 2C3OA 2H9ZA 1B64A 4OX7A 4USJC 1N88A 5DGAA 4RO0A 3K59A 3TW0A 4Q2MA 1BQXA 4Q43A 4YB1P 2XS5A 1QSSA 5D15A 1F9FA 4QU6A 5I3PA 3N28A 5F8HA 3KK2B 4FS2A 3C14B 3D9BA 4AE5A 4HYKA 4PWDB 1ZAWA 4K5SA 5HLFA 4IH5A 2FQQB 3MD1A 3ADAC 4BLGA 1ULRA 2NCKL 2OPRB 2BBEA 2CQBA 3O5TB 4ERDA 1TVRA 2W8KA 1EETA 3N6MA 5K8MA 2MJNA 2IVMA 4R25A 3K5OA 1QD1A 3KKFA 4IG0A 3D5MA 3OLBA 4IO9Q 1FRHA 2R7SA 3A3PB 4KJIA 3W64A 3DRSB 5M2UA 2KZMA 4LSNB 4R8UA 2DGOA 1SH2A 4J9MA 4KGXB 1KQFB 4MYUA 2J9DE 4Y2CA 3PX4A 3R7SB 2MHNA 2FJEB 3MGJA 3H59A 4X62F 3C16A 1Z2ZA 2GIFA 1DHMA 4LF7J 4ECSA 2M52A 2FGOA 2ZJRQ 1VMBA 1CJUB 5GAHU 4MYTA 1IBMF 5KG3A 3IRXA 3KLIB 1M5KC 2DRAA 1N34J 1EZZB 4M63A 2B7BB 4C8LA 4QPXA 2DXEA 3K58A 1YBTA 2GFFA 1SC4B 1NCLA 4B9UA 5KG1A 1GEHA 4EMDA 3HSZA 1GMWD 2HMIA 1Q95G 1VLOA 2MKHA 4OIXA 4OJ1A 2HAFA 4A8XA 4LF9F 4DR6F 1U6ZA 4JI6F 2HYIB 3GTYX 1PYSB 1F5CA 4IFVA 5A2QY 1NZAA 4AT1B 3DM2A 1G2EA 4P6QA 2FVSA 2ZBQA 2W4PA 1VRUB 2RRBA 1R31A 4WFBQ 4DCPB 4NLYA 5F9LA 1X4DA 4KE5A 3DNCA 1H6KX 4B3OA 2QE5A 4EZ6A 3GZ7A 5EWFA 1O5JA 4AL5A 4G1IA 5ETSA 4OMFG 1WELA 2RIJA 2RUSA 3BN4A 4IQXA 1HQEA 4K50A 2G0CA 3I5BA 4LIRA 2D3OR 1U1KA 3VHQA 3OR1A 1TV6B 2Z2MA 5J2NA 4QCLA 4A8YA 4OHYA 4F04B 1SJ1A 1ROFA 2J7UA 3MMJA 3NKYA 2UVVA 2ZUAA 2KB2A 4HDHA 1HLWA 2ZD1B 3SI8A 2XLIA 3L7PA 1YBAA 2MXYA 4DWIA 2DH9A 1ZS6A 3GPAA 2XGPA 4HDGA 1R6YA 2AJFE 3RU0A 1BY9A 3UO0A 1QE1B 1AROP 4M5JA 5CABA 4IG3B 2MKIA 3FFIB 4OV6A 2NXCA 3KK1B 3L7OA 3CIMA 3M32B 5KT6A 2PA3A 5KT5A 4LSLB 4RW6A 2OEKA 1E6YB 4PQUA 1FVSA 4YMEA 3PJXA 5KAKA 3D3BJ 3EZOA 4U7UK 2IJFA 4NLRA 1S6PB 3VAMA 5HMXA 8ATCB 4LF4F 1CLFA 2FC8A 3CCMS 2JC1A 3TZXA 3FK4A 2NXEA 4I6WA 3CMES 2KT5A 1H2VZ 1C2PA 2ALYB 4IFYB 3PR5B 1MNEA 3SQGA 3ENVA 5I3QA 2E1MC 3RW6A 5D77A 4F2RA 1VJQA 3UCGA 4CO5A 1Q78A 1S12A 1PAEX 4JV0A 4J9QA 4M5DA 4IYQA 2L9WA 3PACA 2AQ4A 5T7LB 3MCOA 2BOAA 1CEZA 2O1PA 4XTTA 5IV3A 4DV0J 3MR2A 1U48A 3G6XA 1D8ZA 2H65B 2VJUA 1Y5NB 3V6HA 1SBRA 1JB0C 2YWEA 3NGTA 1Q5YA 2FZCB 2HIYA 3P5TL 2AF6A 3H90A 4K8RA 1D8YA 3I0SB 1G3OA 4N5SA 1X7VA 4FF3A 1JLEA 3LH2S 1FF2A 5EHHA 1SV5A 3I5CA 4DUZF 1J5OB 1QM9A 3DGPA 4PYAA 5KFPA 2XLKA 1VGYA 2QA2A 3AAWB 3TANA 2E7XA 4RW8B 5GAGI 1HNWF 3EICA 3KJQB 4HI2A 3HD2A 4RBTA 2DNHA 3TQEA 4MFBA 2GVZB 3JSMA 1VQ4S 1QAIA 5F8GA 5LMUF 1RT5B 2AEFA 4WFYA 3MR3A 3AODA 3NGKA 3GMGA 2HQFA 3R6LB 1NHVA 2CJQA 3DLGA 1KRPA 1S4FA 2F8HA 5BR8F 2B6AA 3CCRS 3HKWA 3CD5A 4X84A 1WOPA 4K4WA 1AUSL 2P6TA 4JBCA 2QLBB 3QGHA 4LF6J 2V8GA 3FGVA 3HK2A 4ZHRA 3KJFB 1ZM4A 3MM5B 4CO1A 1GFWB 1R3NA 1B7FA 2R7UA 3CCSS 2I38A 3W8GA 3EVOA 5HVHA 4NMLA 5KT3A 5L9XA 3S1TA 1V5VA 2ZHOA 3P45B 2PE8A 1T05A 2QFIA 4A8KA 1U6BA 4O0IA 2EI5A 2WCXA 4ER8A 2KVIA 3PYDA 2C3MA 4LFAF 3TZYA 3RR7A 1RISA 2PD1A 3QO9B 3TJ8A 1JX4A 1IBLJ 2ZBRA 2QA4S 4NEYA 3MMAB 1W26A 3AT1B 2FY1A 3CJQA 3RAMA 1X5TA 3JSYA 1MROB 4DR3J 4NWBA 2VG7A 4RKUC 2H54B 2IAJA 5KFZA 3IWNC 2C2KB 2P9CA 3M9MB 3HVWA 2HHTA 3IS9A 4WFAQ 2WONA 4V19J 4CP5A 1HYSA 2G4BA 1RBLA 2ZVIA 1NLKL 1T9WA 4ECUA 1RQ0A 5B0EA 3V5RA 1D9DA 2R2UA 3VQSA 4DSKA 3H4BA 1HBUA 4QIFA 2UVWA 1OWXA 3R3TA 4DXLA 3Q8SB 5CAAA 4DEZA 2YQ0A 3J7A1 4NA3A 1LFPA 4DQIA 4UZCA 5HN0A 1SPBP 1NPKA 3DXSX 2D3O1 3DLEB 3GYNA 5C24B 1K0VA 1YQHA 2EXUA 2E1CA 2UP1A 1O0PA 4OX9F 1VQ5S 2V2QA 3MAHA 2YTCA 3DOLA 2KYZA 2FLNA 1PC4A 1WJ9A 1V6HA 3W2WA 3DCAA 3D4JA 3UNYA 5K8PA 3O44A 3HF5A 2NSBA 5HLFB 2DNRA 1Y9OA 3OL9A 4K4SA 4X65F 3DDKA 1TVRB 4HT5A 3CCVS 2BKOA 1CULA 1EETB 1WHWA 3VR1A 3BF4A 4JI2F 5ETMA 1XWLA 3MWBA 4IG0B 4F2SA 1VHFA 1UETA 1H3DA 2DHHA 1RHRB 1YZ7A 3WIUA 2DNGA 1ZTWA 1KC8T 2MKJA 3N01A 2VH7A 2JLGA 1JWWA 3VAKA 3UNGC 1TKDA 2R7OA 4JI3F 2V94A 4DJBA 1A0OB 2VF3A 3MZIA 4HR2A 3C16B 2QJ3A 3K8WA 5DLFA 3KJNB 3AB4B 3RBDA 1VQ8S 4RW7B 1GMWA 2UXBF 1UEUA 1CJKB 5B08A 1NO8A 5T14A 2HHHJ 2AWZA 2AW0A 3LF0A 1HKAA 1SIZA 1S1UA 4FNIA 4C8MA 2DNNA 4JI5J 2LQ8A 2K7KA 1IKYA 1YK9A 1LK7A 1KKHA 2MTLA 5IM0A 2HWIA 4IRDA 5J1NA 2OPPA 3IRXB 2DVIA 4YHHF 3M6WA 2BZ2A 1YJVA 2N7CA 1SC3B 2QL5B 4ECQA 4M5IA 4J9KA 1NK4A 2MQ8A 2Y0BB 1ZA2B 2MKCA 3IO1A 4AL7A 1TL3B 3P4UB 1RAJA 4CT8A 2HMIB 2J76E 4TNOA 2XYPB 3SMZA 4KT0C 2HFZA 1X0FA 3H5XA 2R2SA 1TKTA 3VQTA 4LIWA 2WBMA 1YRTA 1GH8A 3G8TA 3J80Y 2R2RA 4IFVB 1VQYA 1U1QA 4WXOA 2BANB 1RE1B 2VPYB 1WG1A 2R8JA 3DM2B 4OYAA 2CZ9A 2G1DA 2EFGA 2UUAJ 4DL6A 4EBCA 1VQ9S 3OJUA 4R0EA 3W7BA 3LANA 5L8RC 2JVRA 3H98A 3ILIA 2LU1A 5CYQA 3OL6A 4B3OB 2KRBA 1Q5VA 4RUCA 4U7UD 1N5TA 5KG5A 1HMVA 1X9MA 1FDAA 4X4RA 5GMDA 4C4WA 1HQEB 3P5BP 4GKJF 2BOPA 5DLGA 3UDEA 2M5YA 1E6VA 4W90B 3C6TA 2AJ4A 1N48A 3SFUA 3OR1B 1X9WA 4C9DA 4JI4F 2UV8G 2CDRB 1RAAB 2C3UA 1UZHA 2JLEA 3RR8A 4LFBJ 4HACB 1DQAA 1MLAA 1H73A 2V2ZA 1RACB 1U1LA 3NXZA 5D0EA 4TXSA 4FZVA 4DV6J 1Y3KA 4YOEA 1Q8KA 3OL7A 2WTFA 2UXCJ 2MZJA 2PI4A 5LMNF 4I2PB 2FJBB 3PRDA 4NXMF 4X4UA 3FUYA 5KG6A 4RW6B 4PQUB 2EK1A 2AGQA 2CQ1A 2EFNA 2QMWA 3LA0A 4ZOSA 2M7SA 5DQIA 1KP6A 4DV5J 2HQ3A 2PT0A 3OFEA 2DHAA 4A8OA 2RH3A 4HTJA 1T95A 3SQGB 4J7CA 3DLBA 1HWUA 1DTQA 4PWUA 4K2XA 2W9BB 4CH7A 2IMOA 5BXIA 4M5DB 4ED8A 3R97A 2GJ2A 2FIUA 5F8JA 1RWKB 5KFCA 1Q79A 2EG2A 4Q0BA 4X64F 1SH0A 5ETOA 2BE2A 2KZZA 4KGMA 1RYSA 1DARA 1Z4UA 1IKXA 2WB4A 4ZIWA 2Z2YB 3CC7S 5J2MA 2JX2A 2UV8A 4B3MF 3GFXA 1JLEB 1S57A 3JQJA 3RBZA 5T41A 5A8RA 1SV5B 4DQRA 3DGPB 5FDLA 2DGVA 1T9YA 3D54A 2B8QA 4EZ9A 4USKA 2GO8A 3OTOF 2RVJA 2DY9A 3B6BA 2LDYA 2OEMA 3PFOA 3JSMB 4MK8A 2J7KA 1UEKA 2XMAA 2RNEA 2GMLA 4ZJOA 4QWEA 1TFWA 3NNCA 3HFZB 2E66A 3WBZA 4ED7A 3HULA 3C15A 4EI2A 3DLGB 2IDLA 2P9GA 4LRBA 4DR4J 3NNAA 2XHCA 2B6AB 1Z1ZA 1FRKA 3GJTB 4E98A 3NEKA 4BWJA 1FHTA 4FF2A 1VC6A 4EK2A 3LWMA 2BKNA 4ZHRB 2W9AA 1RT1B 2X7IA 2XMVA 5AJ3F 1P6TA 1RB0A 2FHKA 3PYEA 3A8IA 1RYRA 4YR3A 4B3TF 2JFDA 4X62J 1YSJA 5LOQA 1RCXB 3OTCA 1IXKA 1T05B 2J7WA 1AUDA 1X4AA 1JLFA 4DQQA 4DX6A 1L3KA 2DR6A 1NK7A 1Q82T 4G1PA 3FBCA 5GADU 2HS0A 3L9ZA 4O4GA 3CC4S 5KFYA 2FJWA 2VPXB 1IBMJ 3BGUA 2ZH7A 4DS4A 3AD8C 3P49B 2F40A 2LQBA 1N54B 2NS1B 3R5CA 3T9NA 1N33J 2VG7B 2IAJB 4K2JA 4DV2F 1ELOA 1XIQA 1ICEB 2HG4A 3IS9B 3M6UA 3TO8A 2A1BA 1DURA 2WONB 4OFZA 1KONA 2EW9A 4IDKB 4X4TA 2R3VA 5E3RA 4NCBA 3SSSA 4LF9J 3BSCA 4DR6J 4NLPA 4JI6J 4BC7A 1Y5IB 2J9CA 2Z4PA 2MLYA 5A76A 1VQLS 1O51A 4EBDA 2HWTA 5HJXA 1N0UA 3QGGA 1XMOF 2Y1LB 1PIEA 1K1SA 2CQ0A 2B0GA 1HBUB 5EUHA 3DLHA 4ZS6A 1S1TA 2OP5A 2C28A 4IH6A 3AOBA 4N47A 3MURP 2IYIA 4F4YA 1AXQA 3VGVA 1PC5A 4LT6A 2MZQA 1OQ6A 4LR9A 1YVFA 4NZ7A 4JI8J 2PEBA 1T9UA 3G87A 4IUFA 4EYIB 3R2DJ 1KTQA 1JLBA 2P6SA 1FTRA 3OFHA 3UPFA 1RWMB 4C0OC 2W2PP 2MQMA 1FD8A 4FKXA 5ETNA 4L74A 2BMBA 3KNAA 3S6EA 3W60A 1C4AA 1S1XA 2HNDA 1KLNA 4DBQA 3SCLE 3DOLB 1UZDA 2F63A 3F73A 3EWGA 1FKAF 1PJ5A 2G0IA 3CDBA 3M8PA 4ITSA 2VD3A 3RB4A 3W2WB 1WC4A 4CYUA 2HVIA 3EVMA 3FSIA 3T1YJ 2KVQE 2ZITA 3GCWP 1NZ8A 2DR5A 1N32F 2XMJA 1SJRA 1NJYA 4OYXA 1RLCL 1CULB 3T5LA 4N76A 4DSEA 1N36F 5KG4A 3TAMA 3C66A 1RWWB 2NPFA 2W9CB 1S6OA 2M4MA 1CC7A 1R0CB 4DL5A 3TA0A 2VBYA 4DV7J 2XMTA 1YWXA 2XY6A 4RNNA 2Z8QA 1PYOB 2LEPA 1SCJB 4ECVA 4F4XA 2R42A 1DTTA 4BBYA 3IWXA 1S6QA 4EO8A 1RTZA 3A1YG 2F9DA 4WZMA 4J9UE 2CAJA 1FX2A 1Y3JA 3CDEA 1HWLA 2OPSB 3U7JA 1I3OB 2VDHA 4NX9A 1S1UB 3EGVA 3Q8PB 3GFHA 2YNIA 1IKYB 3BKTA 1OY8A 2XMUA 5IM0B 1SXLA 4KBIA 4NLGA 1CJVB 5G0RA 1KFSA 3DKDA 3V4IA 1RTHA 2OPPB 3G6ES 1RADB 2YKMA 4IQMA 1HW9A 5DETA 2ABYA 5F8IA 3I87A 1Q1KA 5D4OA 4ZDNA 2V4RA 4DUZJ 4DF8A 1F60B 2U1AA 1MMLA 5LT5A 3ZTQA 3BB5A 1TKTB 2AZ3A 2V6AA 5M2RA 4PR6A 1Y0HA 3GB0A 4DU8A 3D6TB 4N41A 4ED3A 1BQNA 1B7YB 3G82A 1YX2A 4HHHA 2VQEF 4BC9A 1BD6A 1KVKA 1X9SA 5LMUJ 4F3OA 4F4AA 5KOXA 3J81U 2VFRA 4KGKA 5CYQB 5AE1A 5F0UA 2FJXA 4CTAA 3BKUA 4QIEA 3KLFA 3IBCB 1HMVB 5FLXY 4TLQA 2GAGC 2H5EA 2DO4A 2D9OA 4F4KA 4E2FB 3VAGA 2YNHA 1SVDA 2V67A 2EFOA 1E6VB 1VQPS 3EZ5A 2XMMA 3C6TB 2MB0B 2HQGA 2GV1A 5HSPA 1ZBTA 3J7ZT 2ZC4A 2W24A 2CPYA 5A8KA 1PCAA 5E5NA 3H7HB 4JI1F 3OTDA 2KFZA 1Y10A 2QX0A 1NXIA 3KMSA 3PY8A 4Y2IA 5IT4A 4CO4A 3BQ2A 3T3FA 2Q79A 2WSEC 1X4CA 4PXBA 5HVFA 2FLLA 3JS9A 3FMWA 4JP8A 4EYHB 2BABA 1FKPA 2KFNA 2CDQA 3R1LA 4HI1A 3Q89A 1SKSA 3EUNA 3FBEA 2DCLA 3CD6S 1NSAA 4N77A 2JLFA 3RRKA 2E5HA 3KHGA 4LRDA 3FRYA 4C7QA 2C2NA 2VASA 5LJ5Y 2C3YA 5IQQA 4MT1A 1JK9B 4TN2A 1OJ4A 4WFNQ 3GE9A 4UF4A 1AW0A 2YWGA 4LF5F 1DQ8A 1HIYA 3IP0A 3N6LA 1FESA 4KPYA 2B51A 1RUSA 1DTQB 2G0JA 4ED6A 3T19A 2B5JB 3K89A 2V63A 2AX1A 2ROEA 1B3TA 1JXVA 3AA8A 3QRQA 2MQPA 1FE4A 3VAJA 1IBKJ 1WOSA 1W2IA 4YUDA 4LJMA 4Q0BB 5A6WA 3TEHB 2AV5A 2BE2B 2H48B 4QBUA 2E29A 2NXJA 1XJWB 1VBKA 3OXFA 1Y7PA 1IKXB 1NPPA 4G6VB 4B3RF 1L3TA 1BHNA 4U7CA 2RU9A 2XLJA 5A8RB 2NSCA 4TKTA 1JLQA 4S0MA 4J9RA 5E2QA 3CPWR 3M4XA 2R7TA 4BS2A 3IAS9 4OX9J 5ADZA 2RILA 3KJVA 1U26A 2PC6A 4O3SA 4OJ3A 4XIUA 1AYEA 1TQLA 2HVEA 4Y34A 4LBHA 2OFHX 3G9CA 7FD1A 4DQSA 4WFXA 1NM2A 4A4JA 1XMQF 1VBZA 1U1OA 5J2QA 2WHOA 1QAJA 4X65J 1SL0A 2V2KA 4ECZA 4H4KA 1XEZA 5DG9A 3OVBA 4V19X 2AU0A 3D67A 2BJEA 1MMDA 3HPOA 1X0PA 3U1MA 1EQ0A 5KG7A 1GQEA 3RUBL 5E7OB 2HLTA 3RBEA 3CJTA 4CWBA 9RUBA 4U95A 5ETQA 4ZLPA 3RRHA 2CG4A 1QVFR 5D0RA 4Z37A 2O01C 2E9TA 1ZZFA 4M5KA 3TWZA 4ZPCA 2YWFA 1RAOA 3EXCX 3ZXWA 2DY1A 2O3DA 1YJWS 3CO0P 2CQ2A 3G96A 4NOHA 3CDAA 4A8FA 1VFJA 2GIQA 2F4VF 2CNOB 2C2OB 1JLAA 3UWTA 1T3NA 1MWYA 4DCOB 4LQ9A 4CLUA 4OYPA 1RABB 1T94A 1NAQA 2A6OA 4O4GB 4QW9A 2BW7A 4ZCLA 4UY85 4M8LA 3JSRA 2I6WA 1F2GA 1YJUA 2HVDA 3V6KA 3ZNJ1 3MD3A 1R8AA 2QGFB 3WDOA 2BQUA 3ENQA 5F0WA 2DXDA 1LWCA 3D28A 3I4HX 4RUHA 3M2UA 2VG5A 2DRDA 5A8WB 4DR1J 3DRPA 3N4WA 4WP8A 2HK3A 3QRPA 4DF4A 4E8UA 3RTVA 4OJHA 2NXNA 1AZSB 3IR7B 4ZP8A 4FVCA 1R0AB 1QDUB 2ADBA 2YKPA 3Q2TC 1N5VA 4LF8F 2NXUA 2HZVA 1FTCA 1T9VA 1FRXA 2VDIA 3W66A 3H20A 4M5HA 4F02A 4QWBA 1FNXH 1P9QC 4PZVA 1S1TB 4QWAA 2R8IA 4CLWA 1HBMA 3TUJC 3OD2A 2B43A 2YH0A 2Q6CA 1Y5LB 3BQ1A 4OHXA 1REGX 1LOUA 3WHIA 4GKJJ 1WKKA 4DPUA 4ID5A 4DPTA 4F67A 1SQGA 1B0TA 1JLBB 3HHKA 4KHRA 3QJJA 2E7VA 2IRUA 1WDDA 2J6UA 2Q66A 1FRMA 3QATA 3T5KA 1BQMA 1EHWA 2R8KA 1S1XB 2HNDB 4ICLA 2CPXA 4NLWA 1FXRA 5E3QA 5EDWA 1RZMA 2YWHA 3M8PB 3LTOA 3I9V9 1X5PA 2QT7A 2ASDA 4DPWA 3QIDA 2OUGA 1QLNA 5HANA 4ZP9A 2M70A 3QFHA 3BQ0A 2CYYA 3TX8A 4ZPWR 4WTYA 2LQ9A 5LMNJ 2VB6A 4NXMJ 1VQSA 2BRLA 3T9ZA 2IC3A 3SIPB 2HHXA 2X3DA 3TAMB 3MPWA 3DXBA 2WW8A 2WSFC 1WC6A 5IZHA 2VOOA 1I51B 2IA0A 4WWSA 1G6BA 3N5FA 3PZPA 4Y2KA 1DTTB 4FDFA 3AOAA 2MYFA 2RRAA 1R8PA 2HBQB 2OSQA 4A8SA 5GAEI 2WVBA 2L48A 3B8HA 2DGTA 1JKHA 4FYWB 1MWZA 3UCZP 3FNNA 1A9NB 5CYMA 4NYZA 3A4TA 1P27B 4A8QA 1N5SA 2YNIB 3FCVA 5JMNA 1URNA 1WC3A 4DS5A 3ENAA 1BMQB 4X64J 5CYJA 5G0RB 5HQ8A 1RTHB 2RKIA 2ZBCA 4K7QA 2J9EA 1UVMA 2YKMB 3U02A 5HJYA 2HQDA 1S0NA 2VFUA 2OD4A 3FJ2A 5DO2A 2KH9A 4B3MJ 3M8RA 4B9MA 3EDQB 3CD7A 2AYEA 1RT2A 4M1KA 3H2VE 3W2VA 3M8WA 4QR1A 1S10A 2BRKA 4Z2XA 3TVYA 4MIAA 2Z57B 3H8YA 3CCES 2HGMA 2MQOA 3HVRA 5G4DA 1ZTTA 4DX7A 2C42A 4DUTA 3OTOJ 3ZTSA 3BN7A 3UR0A 3G82B 4C8KA 3AJ2A 1BXNA 4GRSA 1RCOB 1Q8IA 4N56A 1VRQC 3Q86A 3NBPA 5CCLA 2ZNYA 3FSYA 3KNGA 4CTAB 1XNRF 4I2QA 3I82A 4ZPDA 2LXUA 5F8MA 2G1HA 4DV1J 4C2MA 2GQCA 4N8NA 1Q4RA 3OTEA 5CA5A 2LMIA 2XHWA 4J90A 2ZH5A 3MM7B 2YNHB 3LAKA 3TQ1A 5J1EA 1G1XA 1IN0A 5AJ3J 3D1OA 2R7XA 4MAKA 3M8QB 4NLXA 2WVDA 4ETXA 2PMWA 5C5JA 1V5IB 5BJRA 2CZVC 3H5SA 1TK5A 5CCMA 2PFFB 3ZNUA 1WEYA 4CNYA 3IC1A 5HP1A 1FKPB 3A8JA 3HO1A 4WXWA 1X60A 1Q0NA 1SJ4P 3G8SA 1RJJA 4USMA 2DBBA 2BEFA 2UXDF 2MMYA 4K4TA 2YNGA 5HL7Q 1TL7A 1QAYA 3P6YC 2O67A 3T6JA 1JMTA 4IH7A 2NQPA 3D0GE 1HI0P 3KLVA 3R5AA 1WF1A 4O44B 4ZK7M 4MKBA 3Q8UA 4DSIA 4KHMA 2HGNA 3F0NA 3VALA 4KTQA 5LSLA 4DV2J 2DK2A 4Q8FA 4F25A 1WG5A 1DJ0A 3VVTA 3WIVA 2FC9A 1W25A 5CZXA 2UUBJ 2OPQA 4WP9A 1UVLA 2RAQA 2LLZA 4ZVGA 5AE3A 2YQ3A 3JQKA 4CH1A 2H5IB 2RQ4A 3HFVA 1XMOJ 3CCZA 2WBRA 3NCRA 4ATNA 4TVAB 2RT3A 4O3OA 3MM8A 4MKAA 1R27B 1U1PA 4GVBA 1V3ZA 1OYDA 1NJIT 3CXCR 1RAGB 1RWXB 4OI2A 3M9OB 5EGYA 1VR6A 2ZBIA 2WOMA 4DUYF 2CZ4A 3R9LA 1DBDA 2QMUB 2ADCA 3LGHA 2EKNA 3GLJA 1JLQB 5HBMA 1SL1A 3K2YA 2Z2ZA 3KJVB 1F9EB 3RAQA 3EVWA 3V6DA 4RUBA 2RDDA 1XK8A 3Q23A 2B4OA 2E44A 2EEYA 5K9FA 3PO5A 5IV4A 2G13A 2RS8A 5J2QB 4AXJA 4U9RA 1U0HA 1N32J 5ETPA 3J7YI 4DFPA 1XNQF 3W5YA 1A6LA 3QAUA 1N36J 1M5OC 2HVHA 2IMWP 5RUBA 3HKZD 2B9YA 2IM2A 1HPZA 3RJMB 1U09A 2H4WB 5JVHQ 4UW2A 4WK3A 3MM9A 4KAIA 2CPIA 1W2BR 1ZAVA 2BKPA 1RAEB 4CT9A 1WG4A 1R8BA 1CC8A 3NGSA 3CE8A 3MHYA 2E5JA 3IGNA 2XWXA 5A6PA 3H5YA 2DR8A 3TRGA 2H1YA 3GU0A 3KMQA 5FJ4A 2BQ3A 2RD5C 2DH8A 2VQFF 2N4CA 2HPUA 3M6VA 1JLAB 2BXJA 5E3CA 2XG8A 3OJSA 3MECA 3W62A 1UMJA 4HEA9 4J9VA 1MWQA 3Q8YA 2JEFA 3GSIA 2YXLA 3OT9A 1FJGJ 1FFGB 5DZ7A 1FA0A 3HVTA 1EIYB 2IVFB 1T11A 2FVPA 3FCHA 5IXUA 4M95A 2OMLA 1LWCB 3M2UB 2VG5B 4O3NA 3DRPB 3GYXB 2Y9HA 1S9EB 2PIIA 4RNOA 2CNLB 5L1LA 3I56S 1JJ2R 3L4BC 4C3MA 1XR7A 2ZH9A 3E51A 2VQEJ 1OIAA 2XEXA 3HMJG 2RQMA 2YNFA 2ZJQQ 2CQIA 3J7Z5 1TTHB 4KFBA 3MTKA 1U4BA 4W92B 3TR5A 1APSA 3IMQJ 1KN6A 3UI3A 1HBMB 3QT7A 3GIRA 2V69A 1LFWA 3U1NA 2UVUA 3CSKA 2G2YA 2E9RX 4FBTA 2KN4A 2VZ9A 1IKVB 1BQMB 1VQKS 1GTEA 4JI1J 4ZJQA 4PRFA 4ICLB 2AJ0A 4X4SA 3KYLA 3NLCA 2AGPA 4NLTA 4LRCA 2DGQA 4WJBA 2IHR1 5HMWA 4DSJA 4JV5J 3BDPA 3BGFA 5J1PA 5I42B 1RLDA 1YHQS 1KBRA 2ASLA 4O23A 4NYPA 3RBXA 4I6AA 2X1GA 1SKWA 3V2UC 4JB8B 4KY3A 4YP3A 2ZH3A 3PKYA 2FB0A 3NGUA 2CQDA 4CLTA 1CSJA 2PA8D 1L5UA 4DSLA 4CI0B 2DGUA 2N7YA 2W4DA 3CMQA 2QEXS 1AFIA 1UA0A 1UJ5A 2AT1B 4B9SA 4ZITA 1D0EA 3AJDA 3U27A 1KWMA 4ECTA 2I0XA 1S0OA 2M8HA 4ZPBA 4LF5J 2Q3PA 4LREA 5L46A 3DOMB 3PR4A 3GV7B 2FHJD 4B3SJ 2DCUB 3JXOA 4FNHA 1BWEA 2L41A 3ILOA 2W7PA 2M0GB 1FJCA 1PO6A 3I0RA 2FLPA 1S1WA 3TAPA 2MQQA 1Q8LA 1JJCB 3MPUB 5CYMB 3L09A 4CCHA 2OIHA 3NG8A 2FHMA 2CXEA 4RWXA 1PBAA 3BPDA 1EP4A 2FZGB 2GS8A 2RKIB 3MDFA 2HFSA 1AT1B 2D7SA 2DGWA 2HKEA 4B3RJ 3I32A 2DEIA 3T41A 3UFCX 1RAIB 1RT2B 2VG6B 2QN6B 4MH8A 3SCIE 1VQNS 3PIOQ 3D7SB 4LFCJ 1H72C 4QR2A 4ES2A 2DPIA 4P52A 2QIFA 3MFIA 1FD2A 2VPWB 2ZNZA 2GA7A 3JAMU 3RAXA 3THPA 3MUMP 3H40A 1LW2A 4MMOA 4B9NA 2QLJB 3UVJA 4G1QA 3ETMA 1RWOB 3FEXB 5CH7B 1FXLA 3FBBA 4C8ZA 1Y4ZB 4DLEA 1D1UA 1VK3A 3CC2S 4HH1A 4CLPA 4C0BA 3NBPB 3EPGA 2XZDB 2AYBA 3VV2B 5GMEA 3AQPA 4I2QB 5DG7A 5KG0A 1LQ9A 1KHWA 4LRAA 2QA1A 2KG1A 2CPFA 2A2CA 1P1LA 1K0TA 2HS3A 4CLLA 4LF1A 2V5HG 1WACA 3V81A 5J1EB 3D2WA 3HVAA 5D3GA 3G2XA 3ET6A 4PCQA 2MKKA 3SZ2A 2DB1A 2UVRA 3MAAA 1L3SA 2J8AA 3TVKA 3VGSA 3ONQA 1FEEA 4J9LA 4K59A 4LVNP 5HP1B 1HI1A 1NDPA 1VBYA 2F4VJ 1OPZA 4QIWD 4ZVOB 1ZM3A 1TL7B 2NR0A 3B78A 1TAUA 4QR0A 3I5AA 4X4NA 5HK4A 2DNLA 4KKOB 1HHTP 3CJ3A 2HNZA 2ASJA 1L3VA 4H4OA 1JIHA 3MCSA 3UCUP 2JWNA 4FF4A 3ILLA 4USTA 3S7RA 3ZZYA 5K5MA 4P75A 2OPQB 4DCJB 2BJ9A 1K44A 2LKZA 3POTA 1H74A 4YR2A 4CO0A 1WI6A 2HLUA 4C3LA 4H4KC 3RG6A 1NK9A 4QU7A 3SQOP 1FX4A 3D3CJ 3PG9A 2CJKA 1U7LA 3MM8B 4NLDA 4GVBB 4U8VA 2HRTA 1C0TA 1VISA 5DM6Q 2W7OA 1RT7A 2N4DA 2GMHA 2PEHA 3CDUA 4GKKF 1CJTB 2WOMB 1FEHA 3DDIA 1RTIB 3CJSA 4ZVQB 1NMEB 1Q8BA 5F8LA 3CJ4A 3THTA 4CM2A 5HBMB 2CJBA 2ZZMA 2L9DA 2MQLA 4C8NA 4USHA 4J9SA 2J6TA 5U47A 1RP5A 2IM0A 5LXYA 3V6DB 3DMJB 1N56A 4C48A 2RU3A 5HQLA 2KM8B 4X4QA 2PFDA 3MEKA 4WYWA 3PW0A 1F3FA 2B7CB 3DHXA 4P10A 2OAUA 1QVGR 4LBPA 2LDIA 1FXDA 1U0HB 1FO1A 2OHDA 2VA2A 1UTAA 5B0CA 2N82B 3GQCA 4URGA 2FHOB 2DGXA 5SZTA 4X2BA 2W7AA 1HPZB 1XR6A 4NZ6A 4EFAC 3MM9B 3B4MA 1OY6A 1RTDB 1QTMA 2DNYA 4MK9A 4MKYA 2HFUA 2ZH2A 5KFLA 2VIHA 2RDIA 2KI2A 3I55S 4OZ0A 1UP1A 2JOQA 1F5BA 3MUTP 1OMSA 3B82A 2MKSA 1TELA 2AIRB 1LXJA 1RT6A 1YRUA 3UQSA 4Z7CA 4OI0A 2WRMA 1UAWA 1WF0A 1F5AA 3MFHA 1RHMB 4C3KA 3W65A 3MECB 4Q5VA 2Q6BA 2HURA 4J91A 1RHQB 5D8HB 1FWKA 4PWDA 3HHNB 1XN9A 4DL3A 3CNQP 5HI7A 4WU2A 1URRA 1TU0B 1NK6A 4AYBD 2HHPA 4ECRA 2PMHA 3VTIA 3JTPA 3KDOA 1HNIA 3HVTB 3M1VB 5KFTA 4P7VA 3T5HA 2YKAA 4CIOA 3LP0A 4KIAA 2LXFA 4E0DA 6FD1A 3GWCA 3US5A 4F26A 4P72A 1V3RA 3MM6A 2E9ZA 2GHVC 3WX8A 4GO7X 2IDEA 2C3PA 4NLUA 2XCPA 1XR5A 3THVA 3TA1A 2I5JA 4I1TA 2VBWA 4FXDA 1UVNA 4DSFA 1DFDA 2Y0SD 4KGZB 2YNFB 4ILRA 4KFBB 4K4VA 3UR3C 3OXGA 3AD7C 4ZVPB 3TVZA 3CMAS 1XNRJ 1FI4A 3TJAA 1IM4A 1FFWB 1JXLA 4YFUA 5IC4B 1G7CB 1OYEA 3KLEA 1S59A 1YDLA 2QZ8A 3DRRA 1SJ3P 5BYQA 5E0OA 2FVCA 4CRJA 4TYAA 4YY3F 2QO3A 4F4ZA 4OYZA 1S9GA 1C4CA 1RAHB 5KG2A 3L7UA 4DR3F 3JSBA 1FKOA 3OQ2A 5B0DA 4NXNJ 3CGIA 2GO9A 1KEKA 4K0KJ 3BYPA 1UVIA 1QTNB 3D6HB 2ACYA 4B08A 3F41A 4PG4A 4EBEA 2PI5A 2W25A 4ZN1A 1WDTA 4OV1A 2FHJA 2QLXA 2HEKA 1UJ4A 3ILJA 2UXDJ 2Q1LA 5GAGU 5IT9U 5MAOA 1GK8A 1S0MA 1KLMB 1WEXA 4G65A 4U96A 3CIZA 2V0NA 1DY3A 2B4UA 3TI0A 2B9EA 3AA9A 3PKMA 1U0SA 2GZOA 4JI7F 1CG2A 4C11A 2RS2A 1AFJA 5AXMA 1D9AA 4OLPA 2LYVA 4OZ1A 2MJUA 2WW4A 4TQSA 3CJRA 4KC5A 4DPYA 4GMKA 3RW7A 5D0GA 3HDSA 3PXGa 4ED1A 3AD9C 2HQCA 3E8OA 4IKAA 5LXRA 2MSTA 3IFEA 3T5JA 3I0RB 1BGXT 1IVZA 2OD6A 3PYFA 2ZOMA 3TEGA 3X3UA 1S79A 4RR5A 3B4DA 3G4SS 2GX8A 2ZD1A 2YWWA 2BA9A 4RL1A 1EP4B 2V8PA 4WP3A 3D68A 2DIUA 2X1BA 4CDIA 2LP4A 1TK8A 4K4ZA 2W2OP 3HM9A 4GC6A 2NYHA 3KK1A 1RT4A 1E6YA 1H7XA 2DGSA 2WZ1A 4OHWA 3GV5B 2X1FA 2DKOB 4JV1A 2CVEA 3ZTRA 3ISND 2QL7B 4R8UB 4F3QA 2K1RA 1WOOA 3AHPA 1SQFA 4JOUA 3OUYA 3QWUA 2CJYB 3E01A 3CCLS 2BM1A 2HWHA 5KTQA 3UVJB 2J8SA 3TP2A 3SXLA 2MHEA 2B9WA 2NZ4A 4ECXA 1Q86T 2NUHA 5DDQC 3TZZA 3QRRA 3MXHP 3NWRA 3UD5A 2CNKB 4C6AA 1NHKL 3QLHA 1S6UA 2V4JA 4KRWA 2F8MA 3LQVA 3AOCA 1Q81T 4OYMA 4JI5F 2F5GA 3T1AA 1WC1A 3QMQA 2KU7A 2CQHA 2PDAA 1YZ6A 1KSPA 3AH6A 4RNMA 3V81B 3PHTA 1LWFA 5D3GB 2IRYA 4F4WA 4DI6A 3ET6B 2LEBA 3FQKA 2E5LF 4DV4F 4N8OA 4M5NA 3MAAB 1ZPVA 4PG8A 1EAYC 2KJVA 1UL3A 4F0KA 3LAMA 4NA1A 1ITPA 1J5OA 2OGUA 5D4PA 2D9PA 3GJSB 4FYYB 4Y2MA 3NGDA 4UY8T 2R7RA 1U45A 4ILLA 2KO1A 4YB6A 2ZEJA 3PNIA 1RHKB 4I68A 2E5IA 1EX8A 2ZDPA 5KFGA 1UFWA 1UFLA 1U6FA 2MDAA 4NLQA 4P2SA 3G71S 2GIRA 5A2QU 4DR7F 1UWBA 3OXLA 3QNWB 3SDEA 2IBOA 3N6NA 4WCEQ 2ATCB 2E1AA 1YIJS 4OJGA 4BDPA 5E41A 2VC1A 2HNZB 2CNNB 2Q43A 4Q7AA 5JXSA 4UUWA
chains in the Genus database with same CATH topology
1S57A 2B8PA 2HVDA 2NCKL 5IOLA 1EHWA 1B4SA 3Q8UA 4KPCA 2DXFA 4HR2A 1JXVA 3Q83A 3VGSA 1BUXA 3GP9A 3ZTPA 1HHQA 1PAEX 1BE4A 3BH6B 4O0NA 1NSQA 1WKLA 3ZTOA 3EVWA 2ZUAA 1NDPA 2DXEA 4W98A 2DXDA 1KDNA 3EJMA 3FCVA 2DYAA 3ZTQA 3BBBA 3JS9A 1HLWA 4UOGA 3FCWA 1NCLA 2B8QA 3VVTA 3WX8A 4F36A 1NDCA 1VYAA 2AZ3A 3ENAA 3VGVA 2DY9A 3MPDA 3B6BA 3ETMA 4DI6A 3DDIA 3VVUA 1MN9A 4UOHA 1ZS6A 3Q89A 3FBBA 3Q8YA 3BBFA 1U8WA 3FBEA 3FBCA 3GPAA 3NGRA 4ANDA 1S5ZA 1NSPA 4CP5A 3NGTA 4ANCA 4DZ6A 1BHNA 4ANEA 4UOFA 2CWKA 1PKUA 3VGUA 5CABA 4F4AA 4S0MA 1NLKL 3EVOA 1W7WA 4FKXA 3BBCA 3ZTRA 5BXIA 2VU5A 2BX6A 3FKBA 3EMTA 1NDLA 2AZ1A 3VGTA 3B54A 1S59A 3PJ9A 3FC9A 2HURA 1XIQA 1F3FA 1LEOA 4DUTA 1XQIA 1LWXA 2HVEA 3EICA 3ZTSA 5C7PA 1K44A 2BEFA 1F6TA 1MN7A 1WKJA 4EK2A 1HIYA 1NDKA 3BH7B 5CAAA 3NGSA 3EVMA 3G2XA 3DKDA 4FKYA 1WKKA 4WBFA 1UCNA 3R9LA 3PRVA 3EE3A 3L7UA 3Q8VA 3FBFA 4ENOA 4C6AA 3EM1A 1NHKL 3NGUA 3ELHA 3Q86A 1NUEA 1NSKL 1NPKA 1NB2A 1B99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S57 A;  2B8P A;  2HVD A;  2NCK L;  5IOL A;  1EHW A;  1B4S A;  3Q8U A;  4KPC A;  2DXF A;  4HR2 A;  1JXV A;  3Q83 A;  3VGS A;  1BUX A;  3GP9 A;  3ZTP A;  1HHQ A;  1PAE X;  1BE4 A;  3BH6 B;  4O0N A;  1NSQ A;  1WKL A;  3ZTO A;  3EVW A;  2ZUA A;  1NDP A;  2DXE A;  4W98 A;  2DXD A;  1KDN A;  3EJM A;  3FCV A;  2DYA A;  3ZTQ A;  3BBB A;  3JS9 A;  1HLW A;  4UOG A;  3FCW A;  1NCL A;  2B8Q A;  3VVT A;  3WX8 A;  4F36 A;  1NDC A;  1VYA A;  2AZ3 A;  3ENA A;  3VGV A;  2DY9 A;  3MPD A;  3B6B A;  3ETM A;  4DI6 A;  3DDI A;  3VVU A;  1MN9 A;  4UOH A;  1ZS6 A;  3Q89 A;  3FBB A;  3Q8Y A;  3BBF A;  1U8W A;  3FBE A;  3FBC A;  3GPA A;  3NGR A;  4AND A;  1S5Z A;  1NSP A;  4CP5 A;  3NGT A;  4ANC A;  4DZ6 A;  1BHN A;  4ANE A;  4UOF A;  2CWK A;  1PKU A;  3VGU A;  5CAB A;  4F4A A;  4S0M A;  1NLK L;  3EVO A;  1W7W A;  4FKX A;  3BBC A;  3ZTR A;  5BXI A;  2VU5 A;  2BX6 A;  3FKB A;  3EMT A;  1NDL A;  2AZ1 A;  3VGT A;  3B54 A;  1S59 A;  3PJ9 A;  3FC9 A;  2HUR A;  1XIQ A;  1F3F A;  1LEO A;  4DUT A;  1XQI A;  1LWX A;  2HVE A;  3EIC A;  3ZTS A;  5C7P A;  1K44 A;  2BEF A;  1F6T A;  1MN7 A;  1WKJ A;  4EK2 A;  1HIY A;  1NDK A;  3BH7 B;  5CAA A;  3NGS A;  3EVM A;  3G2X A;  3DKD A;  4FKY A;  1WKK A;  4WBF A;  1UCN A;  3R9L A;  3PRV A;  3EE3 A;  3L7U A;  3Q8V A;  3FBF A;  4ENO A;  4C6A A;  3EM1 A;  1NHK L;  3NGU A;  3ELH A;  3Q86 A;  1NUE A;  1NSK L;  1NPK A;  1NB2 A;  1B99 A; 
#chains in the Genus database with same CATH topology
 4H4O B;  5IOL A;  2IBK A;  2KM8 C;  2C2M B;  4KV8 A;  1PG5 B;  3UDC A;  2HRY A;  4DPO A;  2VHG A;  1HNX F;  2CPD A;  1JNZ B;  3LWL A;  3GG0 A;  3E3X A;  5K14 A;  3POT B;  1LW0 A;  2ZOG A;  1U49 A;  2HFV A;  5J2N B;  4CM0 A;  1Q7Y T;  3NP5 A;  3T1H F;  4PWW A;  3R1H A;  3ZO7 A;  3GIK A;  3O8W A;  2J5A A;  3RB6 A;  1YRX A;  1FT8 A;  2AP6 A;  3NNH A;  4U6P A;  4TU9 A;  2L08 A;  3S01 A;  3PIP Q;  3W63 A;  4C8O A;  1C0T B;  2ERR A;  1RT7 B;  2BR0 A;  1RHJ B;  4KO0 A;  1QY7 A;  4DV6 F;  4OYI A;  2ZZN A;  1Q7L B;  1S7H A;  2UXC F;  3C6U A;  5FII A;  3DLJ A;  3CCJ S;  1NU4 A;  3K7R A;  1GXL A;  2DNQ A;  3MPV A;  2KJW A;  4Y2A A;  1SUQ A;  2RML A;  2CRL A;  1VOM A;  4DV5 F;  4IR9 A;  4DX8 H;  1BE4 A;  3RRG A;  3KFW X;  1SC6 A;  5IT0 A;  2A6M A;  4ZCK A;  3CCW A;  3SSR A;  2LQ5 A;  2ZM6 F;  2JHE A;  2JL9 A;  8AT1 B;  2EKY A;  4DFK A;  2XZW A;  3K5M A;  1SJF A;  2M9K A;  5HAO A;  3UN5 A;  2CJ9 A;  4DR5 F;  4AND A;  1ZA1 B;  1XER A;  5GAH I;  1JLG A;  2IYG A;  3CCQ S;  1SJQ A;  2Z56 B;  2UU9 J;  3KK3 A;  3LPE A;  1GMU A;  4GO5 X;  5CHC B;  3KXD A;  3AB2 B;  4PQA A;  1HL6 A;  2JNJ A;  3H42 A;  2A0F B;  1G4C A;  3RB0 A;  2AKW B;  4DL0 C;  1I1G A;  3UD4 P;  4UZB A;  5CD4 A;  2JFK A;  2OO4 A;  2DHG A;  1NEE A;  2W1B A;  1RTJ A;  2P9E A;  4MFB B;  3EGW B;  1FCA A;  2Y8W A;  4P7T A;  5HAT A;  3M7V A;  2CFX A;  4KB7 A;  4AL6 A;  2HAI A;  4M5M A;  3TUI C;  5LSO A;  1VYA A;  2X51 A;  2B4V A;  2HHQ A;  4I69 A;  1T9T A;  3DRX A;  2XYG B;  1TZ0 A;  4DR4 F;  4OLO A;  1VIX A;  2R8G A;  1HNI B;  2KT3 A;  1NJW A;  1IJE B;  5H9E J;  4RW9 A;  3LP0 B;  2O66 A;  4QYR A;  4NCG A;  2NLW A;  4KSE B;  1KQK A;  1WD6 A;  1HQU A;  1RA6 A;  3MM6 B;  2BE7 D;  2V50 A;  2LVW A;  4OZL A;  1FNO A;  1AA1 B;  3CJ8 A;  1M1K T;  2YKO A;  2I5J B;  1I6J A;  2ACM A;  1M5P C;  2F65 A;  2B3T B;  1H2T Z;  4FN5 A;  1GAO A;  4F7V A;  3KUE A;  5L38 A;  4RW7 A;  1S0V A;  1CJK A;  2B8P A;  1TFY A;  1VC0 A;  2A18 A;  2XWY A;  3FDS A;  1X5S A;  1HWJ A;  3KLE B;  3DRR B;  2B56 A;  4U67 Q;  1IWA A;  3BBB A;  1U24 A;  5AT1 B;  4D3G A;  1S9G B;  1RAF B;  3HSD A;  2QA4 G;  3HT0 A;  3H5U A;  1WHX A;  3DN9 A;  1FKO B;  1N33 F;  2E7W A;  2CQG A;  2MLX A;  3IBF B;  1SIW B;  4RNH A;  1TL3 A;  2AJQ A;  2CG8 A;  1CQM A;  2RE1 A;  4AQY F;  3IBW A;  4WKY A;  1HNZ F;  2BVZ A;  2E1P A;  4WII A;  4Q44 A;  1HYS B;  2QLW A;  1OQ3 A;  3B54 A;  3BO3 A;  2F1F A;  2V8D A;  3H0P A;  2IJR A;  2N3O A;  2JH3 A;  4FYX B;  2BAN A;  3C8Y A;  3ZZU A;  3PV8 A;  2YBV A;  2HHU A;  4W4M A;  5H9E K;  2KXF A;  2KG0 A;  3H4D A;  4ENO A;  2HBY B;  1WNE A;  1U8S A;  3C3L A;  4C11 B;  5JVG Q;  5DGB A;  2YH1 A;  1NRK A;  4O0N A;  1N6Q A;  4JI8 F;  1NKB A;  4OI4 A;  3VZH A;  2IRX A;  4L72 B;  5IQ6 A;  1RXO B;  3FCW A;  4C8Y A;  1S76 D;  1RKI A;  3GJR B;  3WQP A;  3A3N B;  3RYL A;  2HHW A;  3K0J A;  4IO1 A;  2CPJ A;  3OHB A;  1NSP A;  3IWL A;  2XB2 D;  4K4Y A;  2W2M P;  2HS4 A;  1N5Y A;  4DR2 F;  5B0F A;  3HX9 A;  1X4F A;  1VQO S;  3EDR B;  1NJZ A;  1FJE B;  4HAC A;  4PG5 A;  2VU5 A;  1NJX A;  1NDL A;  1V9O A;  3AXK A;  4WTO B;  3G6V A;  3T1Y F;  4XDC A;  4LVO P;  2KL8 A;  4GKK J;  2V9W A;  4DOZ A;  1JJ4 A;  3O6Q A;  4ED4 A;  3DYA A;  1WF2 A;  2KXH A;  4I2P A;  4X4O A;  3HZG A;  5DZ6 A;  1HNV A;  2EBG A;  4FS1 A;  1RT4 B;  1EAR A;  2YX1 A;  1OO0 B;  4MIB A;  2WVE A;  1TL5 A;  2FVQ A;  3W9I A;  3QPI A;  2POK A;  4LF4 J;  4DV7 F;  5MLC V;  2BE9 B;  2FLO A;  4TY8 A;  2KDO A;  3CUL A;  2K1R B;  4MIW A;  2DIS A;  4BHQ A;  1VK8 A;  1DLO A;  3OUY B;  1HHQ A;  3E01 B;  3R5D A;  3PHE A;  6FDR A;  5F3T A;  4D3H A;  2D3U A;  3CJK A;  1SQE A;  5E3A A;  2DHS A;  1FRL A;  4URQ U;  3DLL Q;  2JC0 A;  2W9B A;  3QLH B;  2JZ5 A;  4OZJ A;  2RDJ A;  4ZMM A;  3DI6 A;  2V4J B;  2W4C A;  1CPZ A;  4NZ0 A;  3NRB A;  1UPP A;  1YJ9 S;  4NLO A;  2BV3 A;  3DGV A;  4USW A;  3PEJ A;  1TL4 A;  2XS7 A;  2C22 A;  2ZC3 A;  5HMZ A;  4PXC A;  2FD2 A;  1LWF B;  3Q22 A;  7FDR A;  3K57 A;  4ZLL A;  5DDR C;  4OL8 A;  3WC0 A;  1UWA A;  5DJB A;  4YDX A;  1YG0 A;  4WBF A;  3M2V A;  1X4B A;  2C2D A;  3O3L A;  2D69 A;  1HNW J;  2OI2 A;  4DL2 A;  3NOC A;  3M6X A;  1S7I A;  4WF9 Q;  3OV7 A;  4CLK A;  4LBI A;  2QYG A;  3BO4 A;  1J2V A;  1M1H A;  3J80 U;  1SH3 A;  1QAX A;  2EWH A;  1KDN A;  1UWB B;  2DNP A;  2HZA A;  3OR2 A;  3SDE B;  2XY5 A;  3NOG A;  3M30 A;  4HH0 A;  4ZVR B;  3FRZ A;  4UTG A;  1Y11 A;  2VV5 A;  3IM8 A;  3GIL A;  2ZHA A;  5BR8 J;  1RU2 A;  2Y1R I;  1M5V C;  1YJ7 A;  3VAH A;  2CVI A;  2OEJ A;  1PKU A;  2YPY A;  1JJH A;  3CDW A;  4DG1 A;  3GJQ B;  3GIM A;  4KV8 B;  4UUX A;  3BR8 A;  2EG1 A;  4X66 F;  4RX6 A;  1VHI A;  5K14 B;  2VKR A;  4YB7 A;  1RT1 A;  1LW0 B;  4IRC A;  2OKQ A;  1YJR A;  1HD0 A;  5F9N A;  2JJ4 D;  3PX6 A;  3CB4 A;  3PX0 A;  1NKC A;  3QWP A;  3M2R A;  4L73 A;  5DG8 A;  1NUE A;  3OSN A;  4PPD A;  3R6G B;  5BYS A;  4LFA J;  2MLZ A;  4NL5 A;  3OVS A;  2DJW A;  3T6B A;  4B9V A;  1WHV A;  2V34 A;  1FWL A;  4KO0 B;  4ZVU B;  1K73 T;  4CO2 A;  1P9Y A;  3HHL D;  4J5O A;  4TY9 A;  1K1Q A;  1P8G A;  3C6U B;  3CJ0 A;  3W9J A;  3MPD A;  4YY3 J;  1RGV A;  5AXL A;  1GMV A;  1GXT A;  4ALZ A;  2FYX A;  1SUQ B;  2B4P A;  3ZZP A;  3FEZ A;  2AD9 A;  3CTR A;  1VBX A;  3X1L B;  5GVQ A;  1DQ9 A;  1R0B G;  4IDK A;  5I4M A;  3LPY A;  1FK9 A;  1OSD A;  4UQT A;  2EFV A;  2F4F A;  2RRN A;  2QRR A;  4F0M A;  2RHS B;  1NB7 A;  2FDN A;  5J2P A;  4ES1 A;  1JLG B;  1J27 A;  3PM9 A;  4U8Y A;  4A46 A;  3QYY A;  4XPC A;  1IBK F;  3CVK A;  1Q53 A;  4JI7 J;  1S9F A;  3KK3 B;  4DHV A;  5L1J A;  2BM0 A;  1TAQ A;  2Y3Y A;  1ZAX A;  2ALZ A;  2BUN A;  5J2M B;  1NSQ A;  4KGV B;  5KFM A;  1VI7 A;  4TU7 A;  6AT1 B;  3N9U C;  2Z0G A;  3K5P A;  5FDL B;  5CXT A;  1HD1 A;  4RWW A;  4ES3 A;  3DOK A;  1RBA A;  1RTJ B;  2OSR A;  2ROP A;  3I9Z A;  1L3U A;  4P73 A;  4RJV A;  4NA2 A;  3TUP A;  1YTY A;  3OTB A;  3OPK A;  4HKQ A;  5KFN A;  2V8V A;  2EBE A;  3CW2 C;  4B02 A;  3A3O B;  3C15 B;  3N5B A;  3DRY A;  1WSR A;  1IJF B;  2HQI A;  3SV3 A;  5LM7 E;  1TMJ A;  3KUH A;  3MTJ A;  3M8Y A;  4JI2 J;  2BJ8 A;  5JUM A;  4RW9 B;  4ZPA A;  3NL0 A;  1N52 B;  1UW4 A;  2W9C A;  4NCG B;  2PMZ D;  1HA1 A;  1JLC A;  1T03 A;  1HQU B;  3GV8 B;  2QC3 A;  3ZTP A;  2V4Q A;  1T0T V;  1FJ7 A;  1FRJ A;  2RB7 A;  4JI3 J;  4UOG A;  3QGI A;  4A48 A;  3KTQ A;  4TQR A;  3MMB A;  1UPM B;  4RBV A;  5L9N A;  2VBX A;  2YVS A;  1JLF B;  2UXB J;  3H2L A;  5ETR A;  2W2N P;  2OPS A;  4HLB A;  4IOC Q;  1WC5 A;  5D4L A;  2WK4 A;  2I1R A;  4USU A;  4RW4 A;  3BZQ A;  4XDD A;  1NH8 A;  2G2O A;  3I96 A;  3CUN A;  1D09 B;  1WUU A;  3BPS P;  2K3K A;  2BX6 A;  2IVY A;  4URS A;  1CJV A;  4EEY A;  3D6F B;  1XMB A;  5KFK A;  3D0I E;  4YHH J;  4F50 A;  3R5B A;  3GFY A;  1XTZ A;  4ZA1 A;  2DR9 A;  4R0J A;  4LMZ A;  2E5L J;  4J37 A;  2F3J A;  4DFM A;  5C42 A;  4DV4 J;  2YKQ A;  4XO0 A;  2DRB A;  3BKF A;  4OX8 A;  1UVK A;  2J0S D;  3U1L A;  1EKS A;  2XO7 A;  4DR1 F;  1TUV A;  5CZV A;  3H2U B;  2VOD A;  3CED A;  2DNK A;  1CS4 A;  1WKL A;  1YLX A;  4DV3 F;  2IIH A;  5IS2 A;  4DR7 J;  1U2F A;  2XS2 A;  2V68 A;  1KNZ A;  5KFF A;  3MR6 A;  5DDO C;  2DNZ A;  3WX4 A;  3J81 Y;  2ZHB A;  1FDB A;  1X4G A;  3Q2S C;  2LFV A;  1SB6 A;  2XSF A;  2YWK A;  4USV A;  5KFH A;  1MG7 A;  2A10 A;  3GII A;  1UVJ A;  3QSY B;  3F44 A;  4IRK A;  2XBP A;  5ETK A;  1ZM9 A;  1N6Q B;  1CVJ A;  2J6S A;  1HNX J;  1HI8 A;  2P5V A;  3MOJ B;  5B7W A;  3CWJ A;  2MZR A;  1REV A;  2CQ3 A;  1KS2 A;  4JI4 J;  1I94 F;  3KHR A;  3T1H J;  4MKV A;  5ITH A;  4B9T A;  1N5Y B;  1VCT A;  4Y28 C;  2U2F A;  4FP9 A;  3D0H E;  2NUU G;  4JV2 A;  3FQL A;  2JDJ A;  4CYU B;  4UOH A;  3C46 A;  2FUG 9;  1U2C A;  2E1R A;  5L39 A;  1QUP A;  4QOT A;  2F7V A;  3EJM A;  4ZVT B;  3KHH A;  1RHU B;  3DYA B;  3UD3 P;  1M5H A;  5KT2 A;  1DAX A;  3MCM A;  5HMY A;  2GAH C;  1HNV B;  2OMO A;  3OFF A;  1MN9 A;  5D6G A;  4QWD A;  3R7B B;  1VQM S;  3ZZT A;  2OEL A;  2CJX B;  3BSA A;  3ZZ0 A;  4AD6 A;  2CPE A;  1NHU A;  2R9L A;  2MZT A;  1IWG A;  2X1A A;  3W61 A;  1AB8 A;  2GQQ A;  4TY8 B;  1DLO B;  2DHX A;  3QIP A;  4JYA F;  1S1V A;  3CCT A;  1S6Q B;  4A8W A;  5D4N A;  4OHV A;  3CJK B;  3EXY A;  3NMA A;  5C2G A;  2ZM6 J;  3PCO B;  2K7J A;  3SYZ A;  3M9N B;  2HFN A;  2BJ3 A;  3TOQ A;  2X3G A;  5GAD I;  2B5J A;  1X4E A;  3ZZO A;  5M2P A;  4DR5 J;  3DI6 B;  1F9H A;  3N0V A;  1M90 T;  3HJV A;  1YGY A;  2XZT B;  7AT1 B;  4PXE A;  3HD1 A;  2FPH X;  4TU8 A;  2NRE A;  5DQG A;  3V4I B;  3NCP A;  3RB3 A;  3HCX A;  1CQN A;  3DC2 A;  1WC0 A;  2DIT A;  1RKJ A;  4BWM A;  2RF2 A;  4QZV B;  4ZVS B;  1IM6 A;  3NS7 B;  3M2V B;  1F2H A;  2GC8 A;  2RHQ B;  4PG7 A;  2XGQ A;  1HBN A;  3L3C A;  3BGR A;  1KOO A;  1X8D A;  4DZ6 A;  3IGV A;  2XUL A;  5LJ3 Y;  3LP2 A;  2R7Q A;  1BQN B;  4P74 A;  5CD4 H;  1PIL A;  5BYR A;  2VUG A;  3ZFV A;  2HNY A;  1IKW A;  5D78 A;  1S97 A;  2RJZ A;  2CQ4 A;  4ELT A;  1C1B A;  2MY7 A;  5DS7 A;  3BGO P;  3OR2 B;  4NRU A;  2RQC A;  4JI0 F;  1LEO A;  1XQI A;  2DEJ A;  3M30 B;  1F3V A;  4L6V 3;  2PSZ A;  2QL9 B;  4PPZ A;  4EU0 A;  3BS9 A;  3KLF B;  4MK7 A;  3R7N B;  4CLS A;  5FLX U;  2R7W A;  4DG1 B;  1XBW A;  4DV1 F;  3SCJ E;  4RUA A;  1YJN S;  3HHL A;  4KYZ A;  4J9N A;  3QBC A;  1PBU A;  2XO6 A;  5A8K B;  1HQ2 A;  1BLU A;  3FEY B;  4ZVF A;  4B3T J;  1TP7 A;  4DL7 A;  3EX7 B;  1UFK A;  1FRI A;  2CPZ A;  1NK8 A;  4LQ3 A;  3W9H A;  3M2R B;  1J5E F;  1R8H A;  1TMM A;  2RUG A;  5ETV A;  4HTI A;  2ZZT A;  2VKZ G;  3SSQ A;  2XQC A;  5GMK a;  3IN5 A;  4C97 A;  1VIO A;  5GAE U;  4QQB A;  2SXL A;  2EFP A;  3ZZZ A;  1X31 C;  2QSF A;  1QJH A;  2M8D B;  2F9J A;  4MTP A;  3WZ0 A;  1HR0 F;  4ZCM A;  3OFG A;  3Q24 A;  2BJ7 A;  3G8Q A;  2I2Y A;  2YQ1 A;  2FVR A;  3QJP A;  4WKR A;  4NYO A;  4OQJ A;  4DX5 A;  1N4L A;  1B0V A;  4ELV A;  4ZJL A;  2FZK B;  3TAQ A;  1K8A T;  3AFG A;  4Q8E A;  1B99 A;  4AQY J;  1UA1 A;  4ED2 A;  5A8W A;  1HNZ J;  2UUB F;  2DXF A;  1R6V A;  2KTQ A;  1BUX A;  2N3L A;  1FK9 B;  1S49 A;  3VCD A;  1AZS A;  3QQC D;  2LXI A;  3SV4 A;  1R0A A;  3QT8 A;  2PGC A;  1SC1 B;  2HZC A;  3A12 A;  3SBM A;  3MAQ A;  5J2P B;  2KT2 A;  3QSI A;  3QZ7 A;  1HHS A;  3BM7 A;  1S48 A;  3SEO A;  5KT4 A;  4UOF A;  2YPZ A;  3VF0 B;  5A0Y A;  1MMN A;  4CNZ A;  5HRO A;  3EZU A;  2E5G A;  4KHP F;  4L75 A;  1W7W A;  2V9K A;  2K06 A;  2AGO A;  4I7F A;  5KFO A;  2LA6 A;  3MEE A;  1VC5 A;  2VFV A;  1D3W A;  1NBE B;  1GTH A;  1KD1 T;  5JJB A;  4FPI A;  1TUW A;  1NND A;  5KFX A;  4DPX A;  4YEA A;  4OZ2 A;  3DOK B;  3MPY A;  1VLY A;  2MY8 A;  4H4M A;  5AE2 A;  3BDE A;  3PRV A;  2YX4 A;  1ZET A;  5SUH A;  1OY9 A;  1A7G E;  4KH1 B;  3KUG A;  4ZVE A;  4DR2 J;  2WAQ D;  4DU7 A;  5F41 A;  4O4R A;  2XC9 A;  2P2C B;  1U1R A;  4LR7 A;  1IR1 A;  4NMX A;  3FZ2 A;  3NS5 A;  2ATL A;  4K4X A;  4WIQ A;  2R2T A;  1TKZ A;  4PG6 A;  2UUC F;  4NI2 A;  2ZDO A;  1TK0 A;  1RU1 A;  2H5J B;  1Q16 B;  3PYG A;  3P8B B;  1H2U X;  5HQM A;  2J9D A;  1VS3 A;  3Q0A A;  1SKR A;  3VAF A;  1JLC B;  1T03 B;  1ZOT A;  4ZN3 A;  1KVI A;  3BJY A;  1SI9 A;  3BBC A;  4WPA A;  1YJT A;  3GG1 A;  2KRR A;  3HFK A;  1LKZ A;  4PUO A;  2MPU A;  4RBU A;  4FXW A;  3IR6 B;  2XNR A;  1B70 B;  3MMB B;  5C7P A;  2YY3 A;  2XMK A;  2HHV A;  4EO6 A;  3HLU A;  4RPF A;  3LAL A;  1O6X A;  2GJF A;  5IWA F;  1U02 A;  1RK8 A;  1RA7 A;  3DHW C;  4RW4 B;  3KG1 A;  3DDN A;  3D1H A;  2QTW A;  1KQG B;  4KPC A;  3Q83 A;  2CIM A;  4LF2 A;  2CPH A;  2W01 A;  3R5J B;  4RU2 A;  2GVD A;  5B0A A;  2G2Z A;  5THW A;  1GX6 A;  2QYC A;  4L3K A;  1FJG F;  5KT7 A;  5C42 B;  3O1L A;  1M5S A;  1EKR A;  4NAS A;  1U8W A;  3ISN C;  2XNQ A;  4F0H A;  3AJ1 A;  3SCK E;  3UDV A;  4ZVH A;  2O5D A;  3O2I A;  4DLG A;  3FSX A;  4WFZ A;  4YN3 B;  2JSX A;  3LW5 C;  1WOR A;  1CS4 B;  4ETZ A;  3BR9 A;  3P3D A;  2EFQ A;  3ULH A;  2XY7 A;  5KFE A;  2IY5 B;  1X4H A;  2RSQ A;  3E2E A;  2M2B A;  1KVJ A;  2VJV A;  4EWT A;  1RSC A;  1IR2 A;  3PW5 A;  2HW3 A;  3EM1 A;  4FBU A;  2VPZ B;  1KHV A;  4OZ5 A;  3J7Y U;  4R5P A;  4ID5 B;  1RWU A;  2AYG A;  4WU3 A;  4ZLN A;  5CQG A;  4X66 J;  2IFX A;  3NAI A;  3MM7 A;  2J0W A;  4Q2L A;  4OZ3 A;  2DPJ A;  1FDD A;  1REV B;  4I4B A;  2UUT A;  4YS2 A;  3MUV P;  4LR8 A;  3OL8 A;  3M8Q A;  2IA6 A;  3IG1 A;  3GIJ A;  1CBK A;  4ANC A;  2JEG A;  1JNR B;  2ZUG A;  3J81 j;  1H7W A;  2CWK A;  5FD1 A;  1FWP A;  5E33 A;  5KFW A;  4JV5 F;  4Y3C A;  2OJ3 A;  2ZFH A;  5KFQ A;  5H1S V;  1K9M T;  3PFE A;  3FKB A;  3MI7 X;  3EMT A;  4AFF A;  2KXN B;  5IFM A;  2VOP A;  1RWP B;  4M5G A;  3DLK A;  3CF5 Q;  1HWK A;  1KOH A;  4KQZ A;  3UE2 A;  2IC3 B;  3Q8Q B;  2MKY A;  2Y8Y A;  5EX3 A;  1LNQ A;  1RWN B;  1YIT S;  1B0P A;  1H38 A;  4FXV A;  2PO4 A;  4O44 A;  3BYR A;  3QFW A;  1DZ5 A;  4P2X A;  2V8H A;  4ZCI A;  3FBF A;  2D3Z A;  3OBI A;  4O3R A;  2G9O A;  3QIP B;  2C2E A;  2ZH1 A;  1S1V B;  2ZE2 A;  3K8V A;  4N7T A;  5B0B A;  4B3S F;  4F3M A;  4ED5 A;  2C2Z B;  1HW8 A;  5C25 A;  1JKH B;  1RBO B;  2QSW A;  4Y65 A;  2PN6 A;  4M94 A;  2JVO A;  5HVG A;  1I5O B;  4Y00 A;  4YDD B;  1IUJ A;  4CLZ A;  3NAH A;  2C2R A;  3AXM A;  4HHJ A;  1U47 A;  3QJL A;  4BCA A;  2CJA A;  2I9S A;  3LO3 A;  3W3S A;  2J0X A;  4DFJ A;  3K5N A;  3KLH A;  4O3P A;  3IXQ A;  3MOZ A;  2ASY A;  3D66 A;  2L3M A;  3A8E A;  3HSG A;  3W2V B;  2RF2 B;  4CH0 S;  3NY0 A;  1LWX A;  4M5L A;  1SKU B;  1TL1 A;  1C0U A;  2ILY A;  1HBN B;  4LFC F;  1T7P A;  4I64 A;  3BGR B;  3DFE A;  4CO3 A;  2UUW A;  1QUV A;  2LQJ A;  2R8H A;  2HGL A;  2XI2 A;  4NLS A;  3LP2 B;  3TX0 A;  2Z30 B;  2ZH6 A;  3UN3 A;  3PO4 A;  2HNY B;  1IKW B;  1EQM A;  2AMC B;  3HHE A;  1C1B B;  1RWV B;  3IA0 A;  3BH6 B;  4P2M A;  1XMQ J;  4WZQ A;  4A8M P;  1WTF A;  1KQS R;  1LV5 A;  2WB1 D;  3QT6 A;  2YKN A;  2DYA A;  4ZP7 A;  1F0X A;  1T02 A;  3I31 A;  2JRS A;  4LF7 F;  3J7A N;  3H25 A;  3DU5 A;  4EUV A;  1P1T A;  5F3Z A;  1LWE A;  1VRT A;  2LU2 A;  4ZP6 A;  4PEO A;  1KR4 A;  1T9X A;  1WHY A;  1VJW A;  3F56 A;  3HHL B;  3W1Y C;  1QSY A;  1N34 F;  3JYT A;  3LP1 A;  2HVZ A;  2KKH A;  1T3O A;  4ILM A;  1EB0 A;  5I3U A;  1DRZ A;  3OW2 R;  2IPO B;  5L1I A;  3MED A;  5AXK A;  1ZPW X;  2ZBP A;  4GC7 A;  3MCN A;  2XTJ P;  2APO A;  5EN1 A;  3NS6 A;  2DR7 A;  4PKD B;  1UCN A;  1OPI A;  4OI1 A;  1VQ7 S;  4ZPT R;  5K8O A;  2YNG B;  3TYT A;  2HBR B;  3PVX A;  4DN0 A;  3EGN A;  2WVF A;  2QFJ A;  4KR0 B;  3ZTO A;  4I0W A;  2VFT A;  2OTL S;  2KHD A;  5DQH A;  1RDR A;  4F36 A;  3DU6 A;  3NWG A;  1H98 A;  2BW2 A;  4B17 A;  3I4P A;  2CQC A;  2DT9 A;  3WC2 A;  3UN2 A;  3HSJ A;  1HBO A;  4ZLJ A;  3QT5 A;  3W5Z A;  1IR0 A;  1N8R T;  4F8R A;  2DO0 A;  3M8Z A;  1F1B B;  2AX0 A;  2QG9 B;  4I56 A;  1S9E A;  3L95 X;  1FDN A;  3BEG B;  1JXE A;  2AZ1 A;  4DV3 J;  4L3N A;  2OFG X;  4LF8 J;  3MR5 A;  4YB5 A;  3JTN A;  3KOA A;  3MEG A;  1RT3 A;  3HI9 A;  4LSZ B;  1K47 A;  3QGP A;  3BSO A;  4TLR A;  4OZN A;  1MN7 A;  1FFS B;  4P2F A;  1M1G A;  3CJ2 A;  2FY8 A;  1U1N A;  5A0Y B;  5HRO B;  4USI A;  2GJI A;  1NB2 A;  3CJ5 A;  3GSD A;  4I7F B;  3FVY A;  4HL9 A;  3MEE B;  4OYW A;  5K8N A;  5LSR A;  1ZZN A;  4WE1 A;  2QLF B;  2OH2 A;  1IKV A;  1FER A;  1NDC A;  3ITH A;  1I94 J;  5B09 A;  3MR7 A;  4H4M B;  3KLG A;  3HZE A;  2MGZ A;  3D1Q A;  2XYH B;  3NGR A;  1U2R A;  1C1C A;  3R5G A;  2WSC C;  4I6Y A;  3NCQ A;  3C19 A;  2ZOF A;  4WYL A;  1BWV A;  3PRB A;  2DH7 A;  3OLA A;  2K3I A;  5I42 A;  5KFS A;  4QPT A;  3ZC4 A;  2GCF A;  1MU2 A;  2D1C A;  1TKZ B;  5E3P A;  2XSJ A;  2A2D A;  3TNV A;  5LL6 d;  3PTW A;  1VDH A;  2C1E B;  4NI2 B;  1IQZ A;  2LEA A;  5HO4 A;  3TA2 A;  2KFY A;  5EWE A;  4DV0 F;  2GGP A;  1NK0 A;  4FKY A;  3AQO A;  1UW9 A;  1V3S A;  2CAD A;  2RQK A;  2Y1J A;  2CUY A;  2J0Q D;  3Q8V A;  4XK8 C;  5D0H A;  1TKX A;  9ATC B;  2GHW A;  4DMZ A;  3PJW A;  1O8B A;  4FPR A;  2IM3 A;  3PW4 A;  1B4S A;  2MQN A;  4OHZ A;  4JYA J;  1R89 A;  3MMC A;  4PUO B;  3DOM A;  1T8E A;  2XMW A;  2VBZ A;  2JEJ A;  1PAU B;  4J9P A;  3KG0 A;  1S72 S;  1TUG B;  1NK5 A;  4LUB A;  3GCX P;  1KFD A;  4K4U A;  1NH7 A;  3QZ8 A;  4WK1 A;  4RU9 A;  1KTV A;  4QIV A;  3LOU A;  5B0G A;  2LA4 A;  3KK2 A;  4RZR A;  2MZS A;  3C14 A;  2Z2L A;  1MW7 A;  1BC6 A;  1PSD A;  3K17 A;  2GVD B;  2OPR A;  4DQP A;  2DD8 S;  2BYC A;  4IR1 A;  2W2Q P;  3R2C J;  3BGL A;  2IJN A;  1TR0 A;  3BV8 A;  3I6P A;  4FYV B;  2VG6 A;  2YX7 A;  3IRW P;  1WKJ A;  4LF6 F;  4CLY A;  3D6M B;  2VON A;  2K8G A;  2R7V A;  3R8Y A;  4RNF A;  3JAM Y;  1EJ7 L;  2A3J A;  2KHC A;  3DRS A;  3JB9 k;  1UEV A;  4LSN A;  2XI3 A;  5AXN A;  4A47 A;  2IM1 A;  3OVA A;  4QJV A;  2GMJ A;  4DN9 A;  4JI0 J;  3QAE A;  3ZZR A;  2CKW A;  5KOW A;  4I67 A;  3KDN A;  1UKU A;  1WTB A;  1GNK A;  1WEZ A;  4ZPV R;  2ZH4 A;  2HFO A;  2JEI A;  1S5Z A;  5ETL A;  4PYD A;  4NE9 C;  1IBL F;  4R5P B;  3OHA A;  3VGU A;  3FMB A;  1CJU A;  3A8K A;  4ED0 A;  3V6J A;  3GON A;  1XC9 A;  5KFR A;  3LGN A;  5H9F J;  3KLI A;  3Q8R B;  1R7I A;  4Y0F A;  3CO9 A;  2FJA B;  2I8E A;  5EX0 A;  1ACM B;  3IG1 B;  3PW7 A;  2BQR A;  3IR5 B;  2FTR A;  2VIC A;  2ZJP Q;  4NXN F;  4O3Q A;  1NDK A;  4K0K F;  1J5E J;  2OTJ S;  4P71 A;  4PXD A;  1QSL A;  2XM3 A;  1HFE L;  4QWC A;  4IOA Q;  2ZWO A;  3KHL A;  1WI8 A;  2V2V A;  4XPE A;  1NSK L;  2ZH8 A;  2CWX A;  3UDL A;  3CCU S;  1PYT A;  2ZVS A;  3GP9 A;  4G3I A;  2AHO B;  4L76 A;  1FE0 A;  2M3D A;  1FNM A;  3DLK B;  1VRU A;  5IC6 B;  2BAC A;  1YKW A;  1HR0 J;  4AUK A;  5F8N A;  4KKO A;  1IBC B;  3N79 A;  3VVU A;  4HT7 A;  2AEM A;  4PAA A;  1GT8 A;  4Q45 A;  5K20 B;  2H51 B;  2MSS A;  4CLF A;  2ZE2 B;  4FF1 A;  3CD0 A;  3MF5 A;  2HK2 A;  4Y6I A;  5KFA A;  3HT3 A;  1VQ6 S;  5L1K A;  2OLW A;  4C98 A;  3G86 A;  8RUC A;  3JTO A;  4QIG A;  3ETO A;  1TV6 A;  1JQG A;  5C25 B;  1S1W B;  4EGL A;  3PJ9 A;  4CQ1 A;  1WWH A;  1S77 D;  5KFB A;  3BH7 B;  3M8S A;  3V4M A;  2ZKU A;  4B9L A;  3G6Y A;  5KFI A;  3VAI A;  2GNK A;  3HHL C;  3ENW A;  2NZC A;  3KLH B;  4KHP J;  3ICL A;  1QE1 A;  2VFS A;  5H9F K;  2HHS A;  1S99 A;  3CT9 A;  2EPI A;  1GXU A;  3PW2 A;  4DUY J;  4IG3 A;  1CJT A;  3FFI A;  2HSE B;  3FZB A;  1GX5 A;  2BJ1 A;  1HAR A;  1RTI A;  4ECW A;  3M32 A;  4OI3 A;  4LSL A;  2KYX A;  1TL1 B;  1C0U B;  4IOB A;  3TJ9 A;  4YQW A;  1IQT A;  2LCW A;  2GQ2 A;  4Z7Y A;  1S6P A;  2AEJ A;  1R8C A;  2MZ1 A;  2H3E B;  3C2P A;  1PGZ A;  1LW2 B;  3JQM A;  2Z58 B;  3DMJ A;  1Y00 A;  4ZKA A;  4G1Q B;  3PEH A;  3LUY A;  1FVQ A;  1NKE A;  4IFY A;  3GYG A;  4PAB A;  4DDF A;  4UT4 A;  4YR0 A;  4FVM A;  3A13 A;  3VGT A;  3EGZ A;  2YKN B;  3LGM A;  2ZWP A;  1XNQ J;  3NMR A;  4NRT A;  3TAR A;  2HHH F;  5T7L A;  1F6T A;  2UUC J;  1LWE B;  1VRT B;  4MJK A;  2CA9 A;  1RTD A;  2W8L A;  2EVZ A;  1S4E A;  3R27 A;  3JYT B;  3LP1 B;  2VA3 A;  3HHD A;  5I3U B;  3I0S A;  4X4V A;  4XAK A;  2BDP A;  4LRF A;  3W8P A;  3MED B;  4W98 A;  4QYZ J;  2HIQ A;  2EK6 A;  2LEC A;  1MSW D;  2NYI A;  4C0H A;  2ROG A;  4NEZ A;  4RW8 A;  2UZA A;  1PJ7 A;  4UQG A;  3BRE A;  4X4P A;  2VQF J;  2FJD B;  3BBF A;  2M88 A;  2Y1I A;  5IWA J;  3HXM A;  3EYZ A;  2D41 A;  3UW1 A;  4AXI A;  1LK5 A;  2BJD A;  1LXN A;  2EC2 A;  2GW8 A;  2GVZ A;  4ANE A;  4CZC A;  5ETT A;  1H0H B;  1YBU A;  4RLE A;  2HBZ B;  2AJ2 A;  2UUA F;  4JUZ A;  2HRU A;  1RT5 A;  2VC0 A;  4KH0 B;  4ECY A;  5KFJ A;  2AYM A;  2DNO A;  4OYO A;  1ZYQ A;  5KFV A;  5EWG A;  3ISZ A;  4DZD A;  3P96 A;  3BSN A;  3M1V A;  4OI6 A;  2MEW A;  2FJV A;  1WSV A;  1HBO B;  3EE3 A;  3MM5 A;  4H54 A;  3RZA A;  3GR0 A;  3IAM 9;  3OSP A;  1ZH5 A;  4UOC A;  3HP6 A;  4HVZ A;  3M05 A;  3RGI A;  2VL1 A;  3KG4 A;  3MEG B;  1RT3 B;  2F8E X;  1N5Q A;  2B9X A;  2ZKT A;  4LFB F;  1HWI A;  2L9N A;  4ID8 A;  1PJ6 A;  2CQP A;  3GFZ A;  1Z2L A;  3PDN A;  2GHP A;  2NPI A;  4NCA A;  1U25 A;  4V1A k;  3AY0 A;  3QO9 A;  2ILZ A;  2H4Y B;  3MMA A;  4NPO A;  5C2C A;  3W5X A;  3VWS A;  2DIV A;  4WE1 B;  4ELU A;  1R43 A;  1SL2 A;  4J9O A;  4QYZ K;  1MRO A;  1D9F A;  2QV6 A;  1UJ6 A;  3ITH B;  3FC9 A;  4ZIV A;  3TZW A;  3KLG B;  2AJ1 A;  2MGZ B;  4HHU A;  3VZI A;  2WVC A;  4DL4 A;  2R4F A;  1C1C B;  3EPI A;  1OS5 A;  2XCA A;  1U1M A;  1RI7 A;  2COL A;  4OX6 A;  2DNM A;  5DM7 Q;  3GR1 A;  4GVL A;  3BO2 A;  3ELH A;  4P9S A;  1OSC A;  3HJF A;  1X5O A;  1MU2 B;  5IT9 Y;  4TYB A;  2DTJ A;  3S8S A;  4K5R A;  3K5L A;  3IM9 A;  1NPR A;  2XSJ B;  2K2P A;  2FGC A;  1KLM A;  2EC0 A;  5KFU A;  4QW8 A;  4NLV A;  2GGP B;  2UU9 F;  1ZM2 A;  1TKX B;  4FYD A;  3KWM A;  3TUZ C;  5DRK A;  5KFD A;  2P8I A;  1N0V C;  4OYB A;  3MMC B;  1YI2 S;  5DDP C;  2QMX A;  2D74 B;  1M0S A;  3DLE A;  5C24 A;  3SFG A;  1RT6 B;  2C3O A;  2H9Z A;  1B64 A;  4OX7 A;  4USJ C;  1N88 A;  5DGA A;  4RO0 A;  3K59 A;  3TW0 A;  4Q2M A;  1BQX A;  4Q43 A;  4YB1 P;  2XS5 A;  1QSS A;  5D15 A;  1F9F A;  4QU6 A;  5I3P A;  3N28 A;  5F8H A;  3KK2 B;  4FS2 A;  3C14 B;  3D9B A;  4AE5 A;  4HYK A;  4PWD B;  1ZAW A;  4K5S A;  5HLF A;  4IH5 A;  2FQQ B;  3MD1 A;  3ADA C;  4BLG A;  1ULR A;  2NCK L;  2OPR B;  2BBE A;  2CQB A;  3O5T B;  4ERD A;  1TVR A;  2W8K A;  1EET A;  3N6M A;  5K8M A;  2MJN A;  2IVM A;  4R25 A;  3K5O A;  1QD1 A;  3KKF A;  4IG0 A;  3D5M A;  3OLB A;  4IO9 Q;  1FRH A;  2R7S A;  3A3P B;  4KJI A;  3W64 A;  3DRS B;  5M2U A;  2KZM A;  4LSN B;  4R8U A;  2DGO A;  1SH2 A;  4J9M A;  4KGX B;  1KQF B;  4MYU A;  2J9D E;  4Y2C A;  3PX4 A;  3R7S B;  2MHN A;  2FJE B;  3MGJ A;  3H59 A;  4X62 F;  3C16 A;  1Z2Z A;  2GIF A;  1DHM A;  4LF7 J;  4ECS A;  2M52 A;  2FGO A;  2ZJR Q;  1VMB A;  1CJU B;  5GAH U;  4MYT A;  1IBM F;  5KG3 A;  3IRX A;  3KLI B;  1M5K C;  2DRA A;  1N34 J;  1EZZ B;  4M63 A;  2B7B B;  4C8L A;  4QPX A;  2DXE A;  3K58 A;  1YBT A;  2GFF A;  1SC4 B;  1NCL A;  4B9U A;  5KG1 A;  1GEH A;  4EMD A;  3HSZ A;  1GMW D;  2HMI A;  1Q95 G;  1VLO A;  2MKH A;  4OIX A;  4OJ1 A;  2HAF A;  4A8X A;  4LF9 F;  4DR6 F;  1U6Z A;  4JI6 F;  2HYI B;  3GTY X;  1PYS B;  1F5C A;  4IFV A;  5A2Q Y;  1NZA A;  4AT1 B;  3DM2 A;  1G2E A;  4P6Q A;  2FVS A;  2ZBQ A;  2W4P A;  1VRU B;  2RRB A;  1R31 A;  4WFB Q;  4DCP B;  4NLY A;  5F9L A;  1X4D A;  4KE5 A;  3DNC A;  1H6K X;  4B3O A;  2QE5 A;  4EZ6 A;  3GZ7 A;  5EWF A;  1O5J A;  4AL5 A;  4G1I A;  5ETS A;  4OMF G;  1WEL A;  2RIJ A;  2RUS A;  3BN4 A;  4IQX A;  1HQE A;  4K50 A;  2G0C A;  3I5B A;  4LIR A;  2D3O R;  1U1K A;  3VHQ A;  3OR1 A;  1TV6 B;  2Z2M A;  5J2N A;  4QCL A;  4A8Y A;  4OHY A;  4F04 B;  1SJ1 A;  1ROF A;  2J7U A;  3MMJ A;  3NKY A;  2UVV A;  2ZUA A;  2KB2 A;  4HDH A;  1HLW A;  2ZD1 B;  3SI8 A;  2XLI A;  3L7P A;  1YBA A;  2MXY A;  4DWI A;  2DH9 A;  1ZS6 A;  3GPA A;  2XGP A;  4HDG A;  1R6Y A;  2AJF E;  3RU0 A;  1BY9 A;  3UO0 A;  1QE1 B;  1ARO P;  4M5J A;  5CAB A;  4IG3 B;  2MKI A;  3FFI B;  4OV6 A;  2NXC A;  3KK1 B;  3L7O A;  3CIM A;  3M32 B;  5KT6 A;  2PA3 A;  5KT5 A;  4LSL B;  4RW6 A;  2OEK A;  1E6Y B;  4PQU A;  1FVS A;  4YME A;  3PJX A;  5KAK A;  3D3B J;  3EZO A;  4U7U K;  2IJF A;  4NLR A;  1S6P B;  3VAM A;  5HMX A;  8ATC B;  4LF4 F;  1CLF A;  2FC8 A;  3CCM S;  2JC1 A;  3TZX A;  3FK4 A;  2NXE A;  4I6W A;  3CME S;  2KT5 A;  1H2V Z;  1C2P A;  2ALY B;  4IFY B;  3PR5 B;  1MNE A;  3SQG A;  3ENV A;  5I3Q A;  2E1M C;  3RW6 A;  5D77 A;  4F2R A;  1VJQ A;  3UCG A;  4CO5 A;  1Q78 A;  1S12 A;  1PAE X;  4JV0 A;  4J9Q A;  4M5D A;  4IYQ A;  2L9W A;  3PAC A;  2AQ4 A;  5T7L B;  3MCO A;  2BOA A;  1CEZ A;  2O1P A;  4XTT A;  5IV3 A;  4DV0 J;  3MR2 A;  1U48 A;  3G6X A;  1D8Z A;  2H65 B;  2VJU A;  1Y5N B;  3V6H A;  1SBR A;  1JB0 C;  2YWE A;  3NGT A;  1Q5Y A;  2FZC B;  2HIY A;  3P5T L;  2AF6 A;  3H90 A;  4K8R A;  1D8Y A;  3I0S B;  1G3O A;  4N5S A;  1X7V A;  4FF3 A;  1JLE A;  3LH2 S;  1FF2 A;  5EHH A;  1SV5 A;  3I5C A;  4DUZ F;  1J5O B;  1QM9 A;  3DGP A;  4PYA A;  5KFP A;  2XLK A;  1VGY A;  2QA2 A;  3AAW B;  3TAN A;  2E7X A;  4RW8 B;  5GAG I;  1HNW F;  3EIC A;  3KJQ B;  4HI2 A;  3HD2 A;  4RBT A;  2DNH A;  3TQE A;  4MFB A;  2GVZ B;  3JSM A;  1VQ4 S;  1QAI A;  5F8G A;  5LMU F;  1RT5 B;  2AEF A;  4WFY A;  3MR3 A;  3AOD A;  3NGK A;  3GMG A;  2HQF A;  3R6L B;  1NHV A;  2CJQ A;  3DLG A;  1KRP A;  1S4F A;  2F8H A;  5BR8 F;  2B6A A;  3CCR S;  3HKW A;  3CD5 A;  4X84 A;  1WOP A;  4K4W A;  1AUS L;  2P6T A;  4JBC A;  2QLB B;  3QGH A;  4LF6 J;  2V8G A;  3FGV A;  3HK2 A;  4ZHR A;  3KJF B;  1ZM4 A;  3MM5 B;  4CO1 A;  1GFW B;  1R3N A;  1B7F A;  2R7U A;  3CCS S;  2I38 A;  3W8G A;  3EVO A;  5HVH A;  4NML A;  5KT3 A;  5L9X A;  3S1T A;  1V5V A;  2ZHO A;  3P45 B;  2PE8 A;  1T05 A;  2QFI A;  4A8K A;  1U6B A;  4O0I A;  2EI5 A;  2WCX A;  4ER8 A;  2KVI A;  3PYD A;  2C3M A;  4LFA F;  3TZY A;  3RR7 A;  1RIS A;  2PD1 A;  3QO9 B;  3TJ8 A;  1JX4 A;  1IBL J;  2ZBR A;  2QA4 S;  4NEY A;  3MMA B;  1W26 A;  3AT1 B;  2FY1 A;  3CJQ A;  3RAM A;  1X5T A;  3JSY A;  1MRO B;  4DR3 J;  4NWB A;  2VG7 A;  4RKU C;  2H54 B;  2IAJ A;  5KFZ A;  3IWN C;  2C2K B;  2P9C A;  3M9M B;  3HVW A;  2HHT A;  3IS9 A;  4WFA Q;  2WON A;  4V19 J;  4CP5 A;  1HYS A;  2G4B A;  1RBL A;  2ZVI A;  1NLK L;  1T9W A;  4ECU A;  1RQ0 A;  5B0E A;  3V5R A;  1D9D A;  2R2U A;  3VQS A;  4DSK A;  3H4B A;  1HBU A;  4QIF A;  2UVW A;  1OWX A;  3R3T A;  4DXL A;  3Q8S B;  5CAA A;  4DEZ A;  2YQ0 A;  3J7A 1;  4NA3 A;  1LFP A;  4DQI A;  4UZC A;  5HN0 A;  1SPB P;  1NPK A;  3DXS X;  2D3O 1;  3DLE B;  3GYN A;  5C24 B;  1K0V A;  1YQH A;  2EXU A;  2E1C A;  2UP1 A;  1O0P A;  4OX9 F;  1VQ5 S;  2V2Q A;  3MAH A;  2YTC A;  3DOL A;  2KYZ A;  2FLN A;  1PC4 A;  1WJ9 A;  1V6H A;  3W2W A;  3DCA A;  3D4J A;  3UNY A;  5K8P A;  3O44 A;  3HF5 A;  2NSB A;  5HLF B;  2DNR A;  1Y9O A;  3OL9 A;  4K4S A;  4X65 F;  3DDK A;  1TVR B;  4HT5 A;  3CCV S;  2BKO A;  1CUL A;  1EET B;  1WHW A;  3VR1 A;  3BF4 A;  4JI2 F;  5ETM A;  1XWL A;  3MWB A;  4IG0 B;  4F2S A;  1VHF A;  1UET A;  1H3D A;  2DHH A;  1RHR B;  1YZ7 A;  3WIU A;  2DNG A;  1ZTW A;  1KC8 T;  2MKJ A;  3N01 A;  2VH7 A;  2JLG A;  1JWW A;  3VAK A;  3UNG C;  1TKD A;  2R7O A;  4JI3 F;  2V94 A;  4DJB A;  1A0O B;  2VF3 A;  3MZI A;  4HR2 A;  3C16 B;  2QJ3 A;  3K8W A;  5DLF A;  3KJN B;  3AB4 B;  3RBD A;  1VQ8 S;  4RW7 B;  1GMW A;  2UXB F;  1UEU A;  1CJK B;  5B08 A;  1NO8 A;  5T14 A;  2HHH J;  2AWZ A;  2AW0 A;  3LF0 A;  1HKA A;  1SIZ A;  1S1U A;  4FNI A;  4C8M A;  2DNN A;  4JI5 J;  2LQ8 A;  2K7K A;  1IKY A;  1YK9 A;  1LK7 A;  1KKH A;  2MTL A;  5IM0 A;  2HWI A;  4IRD A;  5J1N A;  2OPP A;  3IRX B;  2DVI A;  4YHH F;  3M6W A;  2BZ2 A;  1YJV A;  2N7C A;  1SC3 B;  2QL5 B;  4ECQ A;  4M5I A;  4J9K A;  1NK4 A;  2MQ8 A;  2Y0B B;  1ZA2 B;  2MKC A;  3IO1 A;  4AL7 A;  1TL3 B;  3P4U B;  1RAJ A;  4CT8 A;  2HMI B;  2J76 E;  4TNO A;  2XYP B;  3SMZ A;  4KT0 C;  2HFZ A;  1X0F A;  3H5X A;  2R2S A;  1TKT A;  3VQT A;  4LIW A;  2WBM A;  1YRT A;  1GH8 A;  3G8T A;  3J80 Y;  2R2R A;  4IFV B;  1VQY A;  1U1Q A;  4WXO A;  2BAN B;  1RE1 B;  2VPY B;  1WG1 A;  2R8J A;  3DM2 B;  4OYA A;  2CZ9 A;  2G1D A;  2EFG A;  2UUA J;  4DL6 A;  4EBC A;  1VQ9 S;  3OJU A;  4R0E A;  3W7B A;  3LAN A;  5L8R C;  2JVR A;  3H98 A;  3ILI A;  2LU1 A;  5CYQ A;  3OL6 A;  4B3O B;  2KRB A;  1Q5V A;  4RUC A;  4U7U D;  1N5T A;  5KG5 A;  1HMV A;  1X9M A;  1FDA A;  4X4R A;  5GMD A;  4C4W A;  1HQE B;  3P5B P;  4GKJ F;  2BOP A;  5DLG A;  3UDE A;  2M5Y A;  1E6V A;  4W90 B;  3C6T A;  2AJ4 A;  1N48 A;  3SFU A;  3OR1 B;  1X9W A;  4C9D A;  4JI4 F;  2UV8 G;  2CDR B;  1RAA B;  2C3U A;  1UZH A;  2JLE A;  3RR8 A;  4LFB J;  4HAC B;  1DQA A;  1MLA A;  1H73 A;  2V2Z A;  1RAC B;  1U1L A;  3NXZ A;  5D0E A;  4TXS A;  4FZV A;  4DV6 J;  1Y3K A;  4YOE A;  1Q8K A;  3OL7 A;  2WTF A;  2UXC J;  2MZJ A;  2PI4 A;  5LMN F;  4I2P B;  2FJB B;  3PRD A;  4NXM F;  4X4U A;  3FUY A;  5KG6 A;  4RW6 B;  4PQU B;  2EK1 A;  2AGQ A;  2CQ1 A;  2EFN A;  2QMW A;  3LA0 A;  4ZOS A;  2M7S A;  5DQI A;  1KP6 A;  4DV5 J;  2HQ3 A;  2PT0 A;  3OFE A;  2DHA A;  4A8O A;  2RH3 A;  4HTJ A;  1T95 A;  3SQG B;  4J7C A;  3DLB A;  1HWU A;  1DTQ A;  4PWU A;  4K2X A;  2W9B B;  4CH7 A;  2IMO A;  5BXI A;  4M5D B;  4ED8 A;  3R97 A;  2GJ2 A;  2FIU A;  5F8J A;  1RWK B;  5KFC A;  1Q79 A;  2EG2 A;  4Q0B A;  4X64 F;  1SH0 A;  5ETO A;  2BE2 A;  2KZZ A;  4KGM A;  1RYS A;  1DAR A;  1Z4U A;  1IKX A;  2WB4 A;  4ZIW A;  2Z2Y B;  3CC7 S;  5J2M A;  2JX2 A;  2UV8 A;  4B3M F;  3GFX A;  1JLE B;  1S57 A;  3JQJ A;  3RBZ A;  5T41 A;  5A8R A;  1SV5 B;  4DQR A;  3DGP B;  5FDL A;  2DGV A;  1T9Y A;  3D54 A;  2B8Q A;  4EZ9 A;  4USK A;  2GO8 A;  3OTO F;  2RVJ A;  2DY9 A;  3B6B A;  2LDY A;  2OEM A;  3PFO A;  3JSM B;  4MK8 A;  2J7K A;  1UEK A;  2XMA A;  2RNE A;  2GML A;  4ZJO A;  4QWE A;  1TFW A;  3NNC A;  3HFZ B;  2E66 A;  3WBZ A;  4ED7 A;  3HUL A;  3C15 A;  4EI2 A;  3DLG B;  2IDL A;  2P9G A;  4LRB A;  4DR4 J;  3NNA A;  2XHC A;  2B6A B;  1Z1Z A;  1FRK A;  3GJT B;  4E98 A;  3NEK A;  4BWJ A;  1FHT A;  4FF2 A;  1VC6 A;  4EK2 A;  3LWM A;  2BKN A;  4ZHR B;  2W9A A;  1RT1 B;  2X7I A;  2XMV A;  5AJ3 F;  1P6T A;  1RB0 A;  2FHK A;  3PYE A;  3A8I A;  1RYR A;  4YR3 A;  4B3T F;  2JFD A;  4X62 J;  1YSJ A;  5LOQ A;  1RCX B;  3OTC A;  1IXK A;  1T05 B;  2J7W A;  1AUD A;  1X4A A;  1JLF A;  4DQQ A;  4DX6 A;  1L3K A;  2DR6 A;  1NK7 A;  1Q82 T;  4G1P A;  3FBC A;  5GAD U;  2HS0 A;  3L9Z A;  4O4G A;  3CC4 S;  5KFY A;  2FJW A;  2VPX B;  1IBM J;  3BGU A;  2ZH7 A;  4DS4 A;  3AD8 C;  3P49 B;  2F40 A;  2LQB A;  1N54 B;  2NS1 B;  3R5C A;  3T9N A;  1N33 J;  2VG7 B;  2IAJ B;  4K2J A;  4DV2 F;  1ELO A;  1XIQ A;  1ICE B;  2HG4 A;  3IS9 B;  3M6U A;  3TO8 A;  2A1B A;  1DUR A;  2WON B;  4OFZ A;  1KON A;  2EW9 A;  4IDK B;  4X4T A;  2R3V A;  5E3R A;  4NCB A;  3SSS A;  4LF9 J;  3BSC A;  4DR6 J;  4NLP A;  4JI6 J;  4BC7 A;  1Y5I B;  2J9C A;  2Z4P A;  2MLY A;  5A76 A;  1VQL S;  1O51 A;  4EBD A;  2HWT A;  5HJX A;  1N0U A;  3QGG A;  1XMO F;  2Y1L B;  1PIE A;  1K1S A;  2CQ0 A;  2B0G A;  1HBU B;  5EUH A;  3DLH A;  4ZS6 A;  1S1T A;  2OP5 A;  2C28 A;  4IH6 A;  3AOB A;  4N47 A;  3MUR P;  2IYI A;  4F4Y A;  1AXQ A;  3VGV A;  1PC5 A;  4LT6 A;  2MZQ A;  1OQ6 A;  4LR9 A;  1YVF A;  4NZ7 A;  4JI8 J;  2PEB A;  1T9U A;  3G87 A;  4IUF A;  4EYI B;  3R2D J;  1KTQ A;  1JLB A;  2P6S A;  1FTR A;  3OFH A;  3UPF A;  1RWM B;  4C0O C;  2W2P P;  2MQM A;  1FD8 A;  4FKX A;  5ETN A;  4L74 A;  2BMB A;  3KNA A;  3S6E A;  3W60 A;  1C4A A;  1S1X A;  2HND A;  1KLN A;  4DBQ A;  3SCL E;  3DOL B;  1UZD A;  2F63 A;  3F73 A;  3EWG A;  1FKA F;  1PJ5 A;  2G0I A;  3CDB A;  3M8P A;  4ITS A;  2VD3 A;  3RB4 A;  3W2W B;  1WC4 A;  4CYU A;  2HVI A;  3EVM A;  3FSI A;  3T1Y J;  2KVQ E;  2ZIT A;  3GCW P;  1NZ8 A;  2DR5 A;  1N32 F;  2XMJ A;  1SJR A;  1NJY A;  4OYX A;  1RLC L;  1CUL B;  3T5L A;  4N76 A;  4DSE A;  1N36 F;  5KG4 A;  3TAM A;  3C66 A;  1RWW B;  2NPF A;  2W9C B;  1S6O A;  2M4M A;  1CC7 A;  1R0C B;  4DL5 A;  3TA0 A;  2VBY A;  4DV7 J;  2XMT A;  1YWX A;  2XY6 A;  4RNN A;  2Z8Q A;  1PYO B;  2LEP A;  1SCJ B;  4ECV A;  4F4X A;  2R42 A;  1DTT A;  4BBY A;  3IWX A;  1S6Q A;  4EO8 A;  1RTZ A;  3A1Y G;  2F9D A;  4WZM A;  4J9U E;  2CAJ A;  1FX2 A;  1Y3J A;  3CDE A;  1HWL A;  2OPS B;  3U7J A;  1I3O B;  2VDH A;  4NX9 A;  1S1U B;  3EGV A;  3Q8P B;  3GFH A;  2YNI A;  1IKY B;  3BKT A;  1OY8 A;  2XMU A;  5IM0 B;  1SXL A;  4KBI A;  4NLG A;  1CJV B;  5G0R A;  1KFS A;  3DKD A;  3V4I A;  1RTH A;  2OPP B;  3G6E S;  1RAD B;  2YKM A;  4IQM A;  1HW9 A;  5DET A;  2ABY A;  5F8I A;  3I87 A;  1Q1K A;  5D4O A;  4ZDN A;  2V4R A;  4DUZ J;  4DF8 A;  1F60 B;  2U1A A;  1MML A;  5LT5 A;  3ZTQ A;  3BB5 A;  1TKT B;  2AZ3 A;  2V6A A;  5M2R A;  4PR6 A;  1Y0H A;  3GB0 A;  4DU8 A;  3D6T B;  4N41 A;  4ED3 A;  1BQN A;  1B7Y B;  3G82 A;  1YX2 A;  4HHH A;  2VQE F;  4BC9 A;  1BD6 A;  1KVK A;  1X9S A;  5LMU J;  4F3O A;  4F4A A;  5KOX A;  3J81 U;  2VFR A;  4KGK A;  5CYQ B;  5AE1 A;  5F0U A;  2FJX A;  4CTA A;  3BKU A;  4QIE A;  3KLF A;  3IBC B;  1HMV B;  5FLX Y;  4TLQ A;  2GAG C;  2H5E A;  2DO4 A;  2D9O A;  4F4K A;  4E2F B;  3VAG A;  2YNH A;  1SVD A;  2V67 A;  2EFO A;  1E6V B;  1VQP S;  3EZ5 A;  2XMM A;  3C6T B;  2MB0 B;  2HQG A;  2GV1 A;  5HSP A;  1ZBT A;  3J7Z T;  2ZC4 A;  2W24 A;  2CPY A;  5A8K A;  1PCA A;  5E5N A;  3H7H B;  4JI1 F;  3OTD A;  2KFZ A;  1Y10 A;  2QX0 A;  1NXI A;  3KMS A;  3PY8 A;  4Y2I A;  5IT4 A;  4CO4 A;  3BQ2 A;  3T3F A;  2Q79 A;  2WSE C;  1X4C A;  4PXB A;  5HVF A;  2FLL A;  3JS9 A;  3FMW A;  4JP8 A;  4EYH B;  2BAB A;  1FKP A;  2KFN A;  2CDQ A;  3R1L A;  4HI1 A;  3Q89 A;  1SKS A;  3EUN A;  3FBE A;  2DCL A;  3CD6 S;  1NSA A;  4N77 A;  2JLF A;  3RRK A;  2E5H A;  3KHG A;  4LRD A;  3FRY A;  4C7Q A;  2C2N A;  2VAS A;  5LJ5 Y;  2C3Y A;  5IQQ A;  4MT1 A;  1JK9 B;  4TN2 A;  1OJ4 A;  4WFN Q;  3GE9 A;  4UF4 A;  1AW0 A;  2YWG A;  4LF5 F;  1DQ8 A;  1HIY A;  3IP0 A;  3N6L A;  1FES A;  4KPY A;  2B51 A;  1RUS A;  1DTQ B;  2G0J A;  4ED6 A;  3T19 A;  2B5J B;  3K89 A;  2V63 A;  2AX1 A;  2ROE A;  1B3T A;  1JXV A;  3AA8 A;  3QRQ A;  2MQP A;  1FE4 A;  3VAJ A;  1IBK J;  1WOS A;  1W2I A;  4YUD A;  4LJM A;  4Q0B B;  5A6W A;  3TEH B;  2AV5 A;  2BE2 B;  2H48 B;  4QBU A;  2E29 A;  2NXJ A;  1XJW B;  1VBK A;  3OXF A;  1Y7P A;  1IKX B;  1NPP A;  4G6V B;  4B3R F;  1L3T A;  1BHN A;  4U7C A;  2RU9 A;  2XLJ A;  5A8R B;  2NSC A;  4TKT A;  1JLQ A;  4S0M A;  4J9R A;  5E2Q A;  3CPW R;  3M4X A;  2R7T A;  4BS2 A;  3IAS 9;  4OX9 J;  5ADZ A;  2RIL A;  3KJV A;  1U26 A;  2PC6 A;  4O3S A;  4OJ3 A;  4XIU A;  1AYE A;  1TQL A;  2HVE A;  4Y34 A;  4LBH A;  2OFH X;  3G9C A;  7FD1 A;  4DQS A;  4WFX A;  1NM2 A;  4A4J A;  1XMQ F;  1VBZ A;  1U1O A;  5J2Q A;  2WHO A;  1QAJ A;  4X65 J;  1SL0 A;  2V2K A;  4ECZ A;  4H4K A;  1XEZ A;  5DG9 A;  3OVB A;  4V19 X;  2AU0 A;  3D67 A;  2BJE A;  1MMD A;  3HPO A;  1X0P A;  3U1M A;  1EQ0 A;  5KG7 A;  1GQE A;  3RUB L;  5E7O B;  2HLT A;  3RBE A;  3CJT A;  4CWB A;  9RUB A;  4U95 A;  5ETQ A;  4ZLP A;  3RRH A;  2CG4 A;  1QVF R;  5D0R A;  4Z37 A;  2O01 C;  2E9T A;  1ZZF A;  4M5K A;  3TWZ A;  4ZPC A;  2YWF A;  1RAO A;  3EXC X;  3ZXW A;  2DY1 A;  2O3D A;  1YJW S;  3CO0 P;  2CQ2 A;  3G96 A;  4NOH A;  3CDA A;  4A8F A;  1VFJ A;  2GIQ A;  2F4V F;  2CNO B;  2C2O B;  1JLA A;  3UWT A;  1T3N A;  1MWY A;  4DCO B;  4LQ9 A;  4CLU A;  4OYP A;  1RAB B;  1T94 A;  1NAQ A;  2A6O A;  4O4G B;  4QW9 A;  2BW7 A;  4ZCL A;  4UY8 5;  4M8L A;  3JSR A;  2I6W A;  1F2G A;  1YJU A;  2HVD A;  3V6K A;  3ZNJ 1;  3MD3 A;  1R8A A;  2QGF B;  3WDO A;  2BQU A;  3ENQ A;  5F0W A;  2DXD A;  1LWC A;  3D28 A;  3I4H X;  4RUH A;  3M2U A;  2VG5 A;  2DRD A;  5A8W B;  4DR1 J;  3DRP A;  3N4W A;  4WP8 A;  2HK3 A;  3QRP A;  4DF4 A;  4E8U A;  3RTV A;  4OJH A;  2NXN A;  1AZS B;  3IR7 B;  4ZP8 A;  4FVC A;  1R0A B;  1QDU B;  2ADB A;  2YKP A;  3Q2T C;  1N5V A;  4LF8 F;  2NXU A;  2HZV A;  1FTC A;  1T9V A;  1FRX A;  2VDI A;  3W66 A;  3H20 A;  4M5H A;  4F02 A;  4QWB A;  1FNX H;  1P9Q C;  4PZV A;  1S1T B;  4QWA A;  2R8I A;  4CLW A;  1HBM A;  3TUJ C;  3OD2 A;  2B43 A;  2YH0 A;  2Q6C A;  1Y5L B;  3BQ1 A;  4OHX A;  1REG X;  1LOU A;  3WHI A;  4GKJ J;  1WKK A;  4DPU A;  4ID5 A;  4DPT A;  4F67 A;  1SQG A;  1B0T A;  1JLB B;  3HHK A;  4KHR A;  3QJJ A;  2E7V A;  2IRU A;  1WDD A;  2J6U A;  2Q66 A;  1FRM A;  3QAT A;  3T5K A;  1BQM A;  1EHW A;  2R8K A;  1S1X B;  2HND B;  4ICL A;  2CPX A;  4NLW A;  1FXR A;  5E3Q A;  5EDW A;  1RZM A;  2YWH A;  3M8P B;  3LTO A;  3I9V 9;  1X5P A;  2QT7 A;  2ASD A;  4DPW A;  3QID A;  2OUG A;  1QLN A;  5HAN A;  4ZP9 A;  2M70 A;  3QFH A;  3BQ0 A;  2CYY A;  3TX8 A;  4ZPW R;  4WTY A;  2LQ9 A;  5LMN J;  2VB6 A;  4NXM J;  1VQS A;  2BRL A;  3T9Z A;  2IC3 A;  3SIP B;  2HHX A;  2X3D A;  3TAM B;  3MPW A;  3DXB A;  2WW8 A;  2WSF C;  1WC6 A;  5IZH A;  2VOO A;  1I51 B;  2IA0 A;  4WWS A;  1G6B A;  3N5F A;  3PZP A;  4Y2K A;  1DTT B;  4FDF A;  3AOA A;  2MYF A;  2RRA A;  1R8P A;  2HBQ B;  2OSQ A;  4A8S A;  5GAE I;  2WVB A;  2L48 A;  3B8H A;  2DGT A;  1JKH A;  4FYW B;  1MWZ A;  3UCZ P;  3FNN A;  1A9N B;  5CYM A;  4NYZ A;  3A4T A;  1P27 B;  4A8Q A;  1N5S A;  2YNI B;  3FCV A;  5JMN A;  1URN A;  1WC3 A;  4DS5 A;  3ENA A;  1BMQ B;  4X64 J;  5CYJ A;  5G0R B;  5HQ8 A;  1RTH B;  2RKI A;  2ZBC A;  4K7Q A;  2J9E A;  1UVM A;  2YKM B;  3U02 A;  5HJY A;  2HQD A;  1S0N A;  2VFU A;  2OD4 A;  3FJ2 A;  5DO2 A;  2KH9 A;  4B3M J;  3M8R A;  4B9M A;  3EDQ B;  3CD7 A;  2AYE A;  1RT2 A;  4M1K A;  3H2V E;  3W2V A;  3M8W A;  4QR1 A;  1S10 A;  2BRK A;  4Z2X A;  3TVY A;  4MIA A;  2Z57 B;  3H8Y A;  3CCE S;  2HGM A;  2MQO A;  3HVR A;  5G4D A;  1ZTT A;  4DX7 A;  2C42 A;  4DUT A;  3OTO J;  3ZTS A;  3BN7 A;  3UR0 A;  3G82 B;  4C8K A;  3AJ2 A;  1BXN A;  4GRS A;  1RCO B;  1Q8I A;  4N56 A;  1VRQ C;  3Q86 A;  3NBP A;  5CCL A;  2ZNY A;  3FSY A;  3KNG A;  4CTA B;  1XNR F;  4I2Q A;  3I82 A;  4ZPD A;  2LXU A;  5F8M A;  2G1H A;  4DV1 J;  4C2M A;  2GQC A;  4N8N A;  1Q4R A;  3OTE A;  5CA5 A;  2LMI A;  2XHW A;  4J90 A;  2ZH5 A;  3MM7 B;  2YNH B;  3LAK A;  3TQ1 A;  5J1E A;  1G1X A;  1IN0 A;  5AJ3 J;  3D1O A;  2R7X A;  4MAK A;  3M8Q B;  4NLX A;  2WVD A;  4ETX A;  2PMW A;  5C5J A;  1V5I B;  5BJR A;  2CZV C;  3H5S A;  1TK5 A;  5CCM A;  2PFF B;  3ZNU A;  1WEY A;  4CNY A;  3IC1 A;  5HP1 A;  1FKP B;  3A8J A;  3HO1 A;  4WXW A;  1X60 A;  1Q0N A;  1SJ4 P;  3G8S A;  1RJJ A;  4USM A;  2DBB A;  2BEF A;  2UXD F;  2MMY A;  4K4T A;  2YNG A;  5HL7 Q;  1TL7 A;  1QAY A;  3P6Y C;  2O67 A;  3T6J A;  1JMT A;  4IH7 A;  2NQP A;  3D0G E;  1HI0 P;  3KLV A;  3R5A A;  1WF1 A;  4O44 B;  4ZK7 M;  4MKB A;  3Q8U A;  4DSI A;  4KHM A;  2HGN A;  3F0N A;  3VAL A;  4KTQ A;  5LSL A;  4DV2 J;  2DK2 A;  4Q8F A;  4F25 A;  1WG5 A;  1DJ0 A;  3VVT A;  3WIV A;  2FC9 A;  1W25 A;  5CZX A;  2UUB J;  2OPQ A;  4WP9 A;  1UVL A;  2RAQ A;  2LLZ A;  4ZVG A;  5AE3 A;  2YQ3 A;  3JQK A;  4CH1 A;  2H5I B;  2RQ4 A;  3HFV A;  1XMO J;  3CCZ A;  2WBR A;  3NCR A;  4ATN A;  4TVA B;  2RT3 A;  4O3O A;  3MM8 A;  4MKA A;  1R27 B;  1U1P A;  4GVB A;  1V3Z A;  1OYD A;  1NJI T;  3CXC R;  1RAG B;  1RWX B;  4OI2 A;  3M9O B;  5EGY A;  1VR6 A;  2ZBI A;  2WOM A;  4DUY F;  2CZ4 A;  3R9L A;  1DBD A;  2QMU B;  2ADC A;  3LGH A;  2EKN A;  3GLJ A;  1JLQ B;  5HBM A;  1SL1 A;  3K2Y A;  2Z2Z A;  3KJV B;  1F9E B;  3RAQ A;  3EVW A;  3V6D A;  4RUB A;  2RDD A;  1XK8 A;  3Q23 A;  2B4O A;  2E44 A;  2EEY A;  5K9F A;  3PO5 A;  5IV4 A;  2G13 A;  2RS8 A;  5J2Q B;  4AXJ A;  4U9R A;  1U0H A;  1N32 J;  5ETP A;  3J7Y I;  4DFP A;  1XNQ F;  3W5Y A;  1A6L A;  3QAU A;  1N36 J;  1M5O C;  2HVH A;  2IMW P;  5RUB A;  3HKZ D;  2B9Y A;  2IM2 A;  1HPZ A;  3RJM B;  1U09 A;  2H4W B;  5JVH Q;  4UW2 A;  4WK3 A;  3MM9 A;  4KAI A;  2CPI A;  1W2B R;  1ZAV A;  2BKP A;  1RAE B;  4CT9 A;  1WG4 A;  1R8B A;  1CC8 A;  3NGS A;  3CE8 A;  3MHY A;  2E5J A;  3IGN A;  2XWX A;  5A6P A;  3H5Y A;  2DR8 A;  3TRG A;  2H1Y A;  3GU0 A;  3KMQ A;  5FJ4 A;  2BQ3 A;  2RD5 C;  2DH8 A;  2VQF F;  2N4C A;  2HPU A;  3M6V A;  1JLA B;  2BXJ A;  5E3C A;  2XG8 A;  3OJS A;  3MEC A;  3W62 A;  1UMJ A;  4HEA 9;  4J9V A;  1MWQ A;  3Q8Y A;  2JEF A;  3GSI A;  2YXL A;  3OT9 A;  1FJG J;  1FFG B;  5DZ7 A;  1FA0 A;  3HVT A;  1EIY B;  2IVF B;  1T11 A;  2FVP A;  3FCH A;  5IXU A;  4M95 A;  2OML A;  1LWC B;  3M2U B;  2VG5 B;  4O3N A;  3DRP B;  3GYX B;  2Y9H A;  1S9E B;  2PII A;  4RNO A;  2CNL B;  5L1L A;  3I56 S;  1JJ2 R;  3L4B C;  4C3M A;  1XR7 A;  2ZH9 A;  3E51 A;  2VQE J;  1OIA A;  2XEX A;  3HMJ G;  2RQM A;  2YNF A;  2ZJQ Q;  2CQI A;  3J7Z 5;  1TTH B;  4KFB A;  3MTK A;  1U4B A;  4W92 B;  3TR5 A;  1APS A;  3IMQ J;  1KN6 A;  3UI3 A;  1HBM B;  3QT7 A;  3GIR A;  2V69 A;  1LFW A;  3U1N A;  2UVU A;  3CSK A;  2G2Y A;  2E9R X;  4FBT A;  2KN4 A;  2VZ9 A;  1IKV B;  1BQM B;  1VQK S;  1GTE A;  4JI1 J;  4ZJQ A;  4PRF A;  4ICL B;  2AJ0 A;  4X4S A;  3KYL A;  3NLC A;  2AGP A;  4NLT A;  4LRC A;  2DGQ A;  4WJB A;  2IHR 1;  5HMW A;  4DSJ A;  4JV5 J;  3BDP A;  3BGF A;  5J1P A;  5I42 B;  1RLD A;  1YHQ S;  1KBR A;  2ASL A;  4O23 A;  4NYP A;  3RBX A;  4I6A A;  2X1G A;  1SKW A;  3V2U C;  4JB8 B;  4KY3 A;  4YP3 A;  2ZH3 A;  3PKY A;  2FB0 A;  3NGU A;  2CQD A;  4CLT A;  1CSJ A;  2PA8 D;  1L5U A;  4DSL A;  4CI0 B;  2DGU A;  2N7Y A;  2W4D A;  3CMQ A;  2QEX S;  1AFI A;  1UA0 A;  1UJ5 A;  2AT1 B;  4B9S A;  4ZIT A;  1D0E A;  3AJD A;  3U27 A;  1KWM A;  4ECT A;  2I0X A;  1S0O A;  2M8H A;  4ZPB A;  4LF5 J;  2Q3P A;  4LRE A;  5L46 A;  3DOM B;  3PR4 A;  3GV7 B;  2FHJ D;  4B3S J;  2DCU B;  3JXO A;  4FNH A;  1BWE A;  2L41 A;  3ILO A;  2W7P A;  2M0G B;  1FJC A;  1PO6 A;  3I0R A;  2FLP A;  1S1W A;  3TAP A;  2MQQ A;  1Q8L A;  1JJC B;  3MPU B;  5CYM B;  3L09 A;  4CCH A;  2OIH A;  3NG8 A;  2FHM A;  2CXE A;  4RWX A;  1PBA A;  3BPD A;  1EP4 A;  2FZG B;  2GS8 A;  2RKI B;  3MDF A;  2HFS A;  1AT1 B;  2D7S A;  2DGW A;  2HKE A;  4B3R J;  3I32 A;  2DEI A;  3T41 A;  3UFC X;  1RAI B;  1RT2 B;  2VG6 B;  2QN6 B;  4MH8 A;  3SCI E;  1VQN S;  3PIO Q;  3D7S B;  4LFC J;  1H72 C;  4QR2 A;  4ES2 A;  2DPI A;  4P52 A;  2QIF A;  3MFI A;  1FD2 A;  2VPW B;  2ZNZ A;  2GA7 A;  3JAM U;  3RAX A;  3THP A;  3MUM P;  3H40 A;  1LW2 A;  4MMO A;  4B9N A;  2QLJ B;  3UVJ A;  4G1Q A;  3ETM A;  1RWO B;  3FEX B;  5CH7 B;  1FXL A;  3FBB A;  4C8Z A;  1Y4Z B;  4DLE A;  1D1U A;  1VK3 A;  3CC2 S;  4HH1 A;  4CLP A;  4C0B A;  3NBP B;  3EPG A;  2XZD B;  2AYB A;  3VV2 B;  5GME A;  3AQP A;  4I2Q B;  5DG7 A;  5KG0 A;  1LQ9 A;  1KHW A;  4LRA A;  2QA1 A;  2KG1 A;  2CPF A;  2A2C A;  1P1L A;  1K0T A;  2HS3 A;  4CLL A;  4LF1 A;  2V5H G;  1WAC A;  3V81 A;  5J1E B;  3D2W A;  3HVA A;  5D3G A;  3G2X A;  3ET6 A;  4PCQ A;  2MKK A;  3SZ2 A;  2DB1 A;  2UVR A;  3MAA A;  1L3S A;  2J8A A;  3TVK A;  3VGS A;  3ONQ A;  1FEE A;  4J9L A;  4K59 A;  4LVN P;  5HP1 B;  1HI1 A;  1NDP A;  1VBY A;  2F4V J;  1OPZ A;  4QIW D;  4ZVO B;  1ZM3 A;  1TL7 B;  2NR0 A;  3B78 A;  1TAU A;  4QR0 A;  3I5A A;  4X4N A;  5HK4 A;  2DNL A;  4KKO B;  1HHT P;  3CJ3 A;  2HNZ A;  2ASJ A;  1L3V A;  4H4O A;  1JIH A;  3MCS A;  3UCU P;  2JWN A;  4FF4 A;  3ILL A;  4UST A;  3S7R A;  3ZZY A;  5K5M A;  4P75 A;  2OPQ B;  4DCJ B;  2BJ9 A;  1K44 A;  2LKZ A;  3POT A;  1H74 A;  4YR2 A;  4CO0 A;  1WI6 A;  2HLU A;  4C3L A;  4H4K C;  3RG6 A;  1NK9 A;  4QU7 A;  3SQO P;  1FX4 A;  3D3C J;  3PG9 A;  2CJK A;  1U7L A;  3MM8 B;  4NLD A;  4GVB B;  4U8V A;  2HRT A;  1C0T A;  1VIS A;  5DM6 Q;  2W7O A;  1RT7 A;  2N4D A;  2GMH A;  2PEH A;  3CDU A;  4GKK F;  1CJT B;  2WOM B;  1FEH A;  3DDI A;  1RTI B;  3CJS A;  4ZVQ B;  1NME B;  1Q8B A;  5F8L A;  3CJ4 A;  3THT A;  4CM2 A;  5HBM B;  2CJB A;  2ZZM A;  2L9D A;  2MQL A;  4C8N A;  4USH A;  4J9S A;  2J6T A;  5U47 A;  1RP5 A;  2IM0 A;  5LXY A;  3V6D B;  3DMJ B;  1N56 A;  4C48 A;  2RU3 A;  5HQL A;  2KM8 B;  4X4Q A;  2PFD A;  3MEK A;  4WYW A;  3PW0 A;  1F3F A;  2B7C B;  3DHX A;  4P10 A;  2OAU A;  1QVG R;  4LBP A;  2LDI A;  1FXD A;  1U0H B;  1FO1 A;  2OHD A;  2VA2 A;  1UTA A;  5B0C A;  2N82 B;  3GQC A;  4URG A;  2FHO B;  2DGX A;  5SZT A;  4X2B A;  2W7A A;  1HPZ B;  1XR6 A;  4NZ6 A;  4EFA C;  3MM9 B;  3B4M A;  1OY6 A;  1RTD B;  1QTM A;  2DNY A;  4MK9 A;  4MKY A;  2HFU A;  2ZH2 A;  5KFL A;  2VIH A;  2RDI A;  2KI2 A;  3I55 S;  4OZ0 A;  1UP1 A;  2JOQ A;  1F5B A;  3MUT P;  1OMS A;  3B82 A;  2MKS A;  1TEL A;  2AIR B;  1LXJ A;  1RT6 A;  1YRU A;  3UQS A;  4Z7C A;  4OI0 A;  2WRM A;  1UAW A;  1WF0 A;  1F5A A;  3MFH A;  1RHM B;  4C3K A;  3W65 A;  3MEC B;  4Q5V A;  2Q6B A;  2HUR A;  4J91 A;  1RHQ B;  5D8H B;  1FWK A;  4PWD A;  3HHN B;  1XN9 A;  4DL3 A;  3CNQ P;  5HI7 A;  4WU2 A;  1URR A;  1TU0 B;  1NK6 A;  4AYB D;  2HHP A;  4ECR A;  2PMH A;  3VTI A;  3JTP A;  3KDO A;  1HNI A;  3HVT B;  3M1V B;  5KFT A;  4P7V A;  3T5H A;  2YKA A;  4CIO A;  3LP0 A;  4KIA A;  2LXF A;  4E0D A;  6FD1 A;  3GWC A;  3US5 A;  4F26 A;  4P72 A;  1V3R A;  3MM6 A;  2E9Z A;  2GHV C;  3WX8 A;  4GO7 X;  2IDE A;  2C3P A;  4NLU A;  2XCP A;  1XR5 A;  3THV A;  3TA1 A;  2I5J A;  4I1T A;  2VBW A;  4FXD A;  1UVN A;  4DSF A;  1DFD A;  2Y0S D;  4KGZ B;  2YNF B;  4ILR A;  4KFB B;  4K4V A;  3UR3 C;  3OXG A;  3AD7 C;  4ZVP B;  3TVZ A;  3CMA S;  1XNR J;  1FI4 A;  3TJA A;  1IM4 A;  1FFW B;  1JXL A;  4YFU A;  5IC4 B;  1G7C B;  1OYE A;  3KLE A;  1S59 A;  1YDL A;  2QZ8 A;  3DRR A;  1SJ3 P;  5BYQ A;  5E0O A;  2FVC A;  4CRJ A;  4TYA A;  4YY3 F;  2QO3 A;  4F4Z A;  4OYZ A;  1S9G A;  1C4C A;  1RAH B;  5KG2 A;  3L7U A;  4DR3 F;  3JSB A;  1FKO A;  3OQ2 A;  5B0D A;  4NXN J;  3CGI A;  2GO9 A;  1KEK A;  4K0K J;  3BYP A;  1UVI A;  1QTN B;  3D6H B;  2ACY A;  4B08 A;  3F41 A;  4PG4 A;  4EBE A;  2PI5 A;  2W25 A;  4ZN1 A;  1WDT A;  4OV1 A;  2FHJ A;  2QLX A;  2HEK A;  1UJ4 A;  3ILJ A;  2UXD J;  2Q1L A;  5GAG U;  5IT9 U;  5MAO A;  1GK8 A;  1S0M A;  1KLM B;  1WEX A;  4G65 A;  4U96 A;  3CIZ A;  2V0N A;  1DY3 A;  2B4U A;  3TI0 A;  2B9E A;  3AA9 A;  3PKM A;  1U0S A;  2GZO A;  4JI7 F;  1CG2 A;  4C11 A;  2RS2 A;  1AFJ A;  5AXM A;  1D9A A;  4OLP A;  2LYV A;  4OZ1 A;  2MJU A;  2WW4 A;  4TQS A;  3CJR A;  4KC5 A;  4DPY A;  4GMK A;  3RW7 A;  5D0G A;  3HDS A;  3PXG a;  4ED1 A;  3AD9 C;  2HQC A;  3E8O A;  4IKA A;  5LXR A;  2MST A;  3IFE A;  3T5J A;  3I0R B;  1BGX T;  1IVZ A;  2OD6 A;  3PYF A;  2ZOM A;  3TEG A;  3X3U A;  1S79 A;  4RR5 A;  3B4D A;  3G4S S;  2GX8 A;  2ZD1 A;  2YWW A;  2BA9 A;  4RL1 A;  1EP4 B;  2V8P A;  4WP3 A;  3D68 A;  2DIU A;  2X1B A;  4CDI A;  2LP4 A;  1TK8 A;  4K4Z A;  2W2O P;  3HM9 A;  4GC6 A;  2NYH A;  3KK1 A;  1RT4 A;  1E6Y A;  1H7X A;  2DGS A;  2WZ1 A;  4OHW A;  3GV5 B;  2X1F A;  2DKO B;  4JV1 A;  2CVE A;  3ZTR A;  3ISN D;  2QL7 B;  4R8U B;  4F3Q A;  2K1R A;  1WOO A;  3AHP A;  1SQF A;  4JOU A;  3OUY A;  3QWU A;  2CJY B;  3E01 A;  3CCL S;  2BM1 A;  2HWH A;  5KTQ A;  3UVJ B;  2J8S A;  3TP2 A;  3SXL A;  2MHE A;  2B9W A;  2NZ4 A;  4ECX A;  1Q86 T;  2NUH A;  5DDQ C;  3TZZ A;  3QRR A;  3MXH P;  3NWR A;  3UD5 A;  2CNK B;  4C6A A;  1NHK L;  3QLH A;  1S6U A;  2V4J A;  4KRW A;  2F8M A;  3LQV A;  3AOC A;  1Q81 T;  4OYM A;  4JI5 F;  2F5G A;  3T1A A;  1WC1 A;  3QMQ A;  2KU7 A;  2CQH A;  2PDA A;  1YZ6 A;  1KSP A;  3AH6 A;  4RNM A;  3V81 B;  3PHT A;  1LWF A;  5D3G B;  2IRY A;  4F4W A;  4DI6 A;  3ET6 B;  2LEB A;  3FQK A;  2E5L F;  4DV4 F;  4N8O A;  4M5N A;  3MAA B;  1ZPV A;  4PG8 A;  1EAY C;  2KJV A;  1UL3 A;  4F0K A;  3LAM A;  4NA1 A;  1ITP A;  1J5O A;  2OGU A;  5D4P A;  2D9P A;  3GJS B;  4FYY B;  4Y2M A;  3NGD A;  4UY8 T;  2R7R A;  1U45 A;  4ILL A;  2KO1 A;  4YB6 A;  2ZEJ A;  3PNI A;  1RHK B;  4I68 A;  2E5I A;  1EX8 A;  2ZDP A;  5KFG A;  1UFW A;  1UFL A;  1U6F A;  2MDA A;  4NLQ A;  4P2S A;  3G71 S;  2GIR A;  5A2Q U;  4DR7 F;  1UWB A;  3OXL A;  3QNW B;  3SDE A;  2IBO A;  3N6N A;  4WCE Q;  2ATC B;  2E1A A;  1YIJ S;  4OJG A;  4BDP A;  5E41 A;  2VC1 A;  2HNZ B;  2CNN B;  2Q43 A;  4Q7A A;  5JXS A;  4UUW A; 
#chains in the Genus database with same CATH homology
 1S57 A;  2B8P A;  2HVD A;  2NCK L;  5IOL A;  1EHW A;  1B4S A;  3Q8U A;  4KPC A;  2DXF A;  4HR2 A;  1JXV A;  3Q83 A;  3VGS A;  1BUX A;  3GP9 A;  3ZTP A;  1HHQ A;  1PAE X;  1BE4 A;  3BH6 B;  4O0N A;  1NSQ A;  1WKL A;  3ZTO A;  3EVW A;  2ZUA A;  1NDP A;  2DXE A;  4W98 A;  2DXD A;  1KDN A;  3EJM A;  3FCV A;  2DYA A;  3ZTQ A;  3BBB A;  3JS9 A;  1HLW A;  4UOG A;  3FCW A;  1NCL A;  2B8Q A;  3VVT A;  3WX8 A;  4F36 A;  1NDC A;  1VYA A;  2AZ3 A;  3ENA A;  3VGV A;  2DY9 A;  3MPD A;  3B6B A;  3ETM A;  4DI6 A;  3DDI A;  3VVU A;  1MN9 A;  4UOH A;  1ZS6 A;  3Q89 A;  3FBB A;  3Q8Y A;  3BBF A;  1U8W A;  3FBE A;  3FBC A;  3GPA A;  3NGR A;  4AND A;  1S5Z A;  1NSP A;  4CP5 A;  3NGT A;  4ANC A;  4DZ6 A;  1BHN A;  4ANE A;  4UOF A;  2CWK A;  1PKU A;  3VGU A;  5CAB A;  4F4A A;  4S0M A;  1NLK L;  3EVO A;  1W7W A;  4FKX A;  3BBC A;  3ZTR A;  5BXI A;  2VU5 A;  2BX6 A;  3FKB A;  3EMT A;  1NDL A;  2AZ1 A;  3VGT A;  3B54 A;  1S59 A;  3PJ9 A;  3FC9 A;  2HUR A;  1XIQ A;  1F3F A;  1LEO A;  4DUT A;  1XQI A;  1LWX A;  2HVE A;  3EIC A;  3ZTS A;  5C7P A;  1K44 A;  2BEF A;  1F6T A;  1MN7 A;  1WKJ A;  4EK2 A;  1HIY A;  1NDK A;  3BH7 B;  5CAA A;  3NGS A;  3EVM A;  3G2X A;  3DKD A;  4FKY A;  1WKK A;  4WBF A;  1UCN A;  3R9L A;  3PRV A;  3EE3 A;  3L7U A;  3Q8V A;  3FBF A;  4ENO A;  4C6A A;  3EM1 A;  1NHK L;  3NGU A;  3ELH A;  3Q86 A;  1NUE A;  1NSK L;  1NPK A;  1NB2 A;  1B99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...