1PKUA

Crystal structure of nucleoside diphosphate kinase from rice
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
RMEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSFAQQHYADLSDKPFFPGLVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIRADYAVEVGRNVIHGSDSVDNGKKEIALWFPEGLAEWRSNLHPWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside Diphosphate Kinase I
publication title Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (Oryza sativa L.).
pubmed doi rcsb
source organism Oryza sativa
molecule tags Transferase
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1pkuA00
2ZUAA 4ENOA 1NDLA 4ANCA 3VVTA 3BBCA 3G2XA 3Q89A 4FKXA 1XQIA 3EJMA 5C7PA 3NGTA 1PKUA 2BX6A 3DDIA 3VGTA 1HLWA 1LEOA 3VGVA 5CAAA 3VVUA 4UOGA 1NPKA 3ELHA 1NCLA 3VGSA 1F6TA 4FKYA 3L7UA 3B6BA 3MPDA 2HURA 3ZTPA 3FCWA 1S59A 1NSQA 3PRVA 4F36A 4C6AA 3Q8VA 3DKDA 4O0NA 1NDCA 3FKBA 2AZ1A 4DUTA 2DXFA 4HR2A 4WBFA 4W98A 2AZ3A 2B8PA 2DXEA 1HIYA 3BBBA 3EE3A 3EM1A 3ZTRA 4UOFA 1XIQA 1K44A 3WX8A 1VYAA 3ZTQA 3FC9A 1NHKL 2B8QA 4S0MA 3EVWA 3FBEA 3BBFA 1KDNA 2DYAA 3ETMA 3FCVA 1WKLA 1MN7A 2HVDA 3VGUA 1NSKL 1WKKA 3FBBA 4CP5A 5BXIA 1F3FA 5CABA 2VU5A 3NGSA 1S57A 3EICA 1ZS6A 3EVOA 4DI6A 3NGRA 3B54A 3Q83A 1NDPA 2HVEA 5IOLA 3BH6B 3ZTOA 1WKJA 2DY9A 3FBCA 1NSPA 1PAEX 3Q86A 2BEFA 1LWXA 3GP9A 4DZ6A 4F4AA 1BHNA 4UOHA 4KPCA 3EVMA 1MN9A 1B4SA 1HHQA 2DXDA 3ZTSA 2CWKA 3NGUA 3JS9A 1NLKL 3Q8YA 4ANEA 1BUXA 1UCNA 3R9LA 3Q8UA 1U8WA 1B99A 4EK2A 1BE4A 3PJ9A 1NB2A 3FBFA 1JXVA 3GPAA 2NCKL 1S5ZA 1EHWA 1W7WA 3EMTA 3ENAA 1NDKA 4ANDA 3BH7B 1NUEA
chains in the Genus database with same CATH superfamily
5M2RA 3HSJA 2G4BA 3MAHA 1A0OB 3PYEA 2KJWA 1UW9A 2ZE2A 5ETKA 4ED7A 2A10A 1KOHA 5DZ6A 1RAHB 2XY7A 3VTIA 4OZ3A 2BJ9A 2B9WA 2RKIB 2J0WA 2BQRA 4F4YA 3OPKA 3MAAA 4KY3A 4D3HA 4RBTA 1T9VA 2CJQA 1XR6A 3IAM9 2QLWA 1RWOB 1S7HA 3ICLA 4DR6J 1FJ7A 4K2XA 3I5AA 3F44A 4X4VA 1UPPA 3M05A 3WDOA 2GCFA 3RBEA 2UUTA 3K2YA 1HBMA 4QQBA 3MD3A 3DLGB 4RW9B 1JIHA 1S4FA 3E8OA 4CH0S 3NNCA 2ACYA 4UOHA 4KR0B 3A3OB 2CQDA 3NCQA 2UU9J 4F2SA 4DF4A 2OTLS 4HI2A 5E0OA 2GW8A 1SPBP 2WONA 2YX7A 3EGZA 3PJ9A 4YY3J 4ECWA 1JLBB 1Y5IB 1F5BA 3VAMA 2GIFA 1JMTA 1VLYA 2DGWA 2DHAA 3HPOA 3U1LA 1UFWA 1WOOA 3HJVA 5G0RA 3MUMP 1SKWA 2VODA 3BPSP 4ECXA 1HNIA 4U8YA 3CF5Q 4NL5A 2DNNA 5HI7A 2BV3A 2WRMA 2AWZA 3UDVA 3ZTRA 1NB7A 2VV5A 1FKPB 2V8VA 3DXSX 2XLIA 2WVEA 1S6UA 4X4OA 2JC0A 1VI7A 3O6QA 2BRLA 3RW7A 4XO0A 4JI8F 3DRPA 1QE1A 5DDPC 3PX6A 1MG7A 4B9LA 4DZ6A 1RWPB 2FLLA 4J9QA 2LXUA 4JI1J 1CLFA 2Z8QA 1YRUA 1K73T 5HROA 4RUCA 3KLHB 3JS9A 1P1TA 1LWEB 4KHPJ 4WFNQ 3UDCA 2DIVA 2KH9A 1EETA 1PBUA 2VPZB 5ETOA 2K7KA 3AD7C 2UXCJ 3H2UB 4OZNA 1NK5A 3AB4B 2KG0A 4C8ZA 3IG1A 5KFWA 2XM3A 2J9DE 3CNQP 4CO2A 1RBAA 5AJ3J 1VQMS 4PWDB 3HULA 3CJ8A 5HVHA 4K50A 1JXLA 1F2GA 2UUAF 1WNEA 2DVIA 2IA6A 5AXNA 3R2CJ 5A8WB 2XNQA 1MU2B 1RT6A 3BZQA 3DOKA 1RYSA 4U95A 3D68A 1HQUA 4KGKA 3I5CA 3K59A 1WACA 4NLVA 4L73A 1WI6A 4LBPA 1LXJA 1U25A 2XS7A 4IR1A 3PX0A 1FESA 1CG2A 4FYXB 2R2TA 5J2NA 3K5LA 1RT7B 4B3RF 2W7AA 1GX6A 2LYVA 4LF2A 1BHNA 2CQ3A 4DR1J 3VR1A 2CRLA 3V6JA 2YKNB 1NLKL 1D0EA 1U09A 2QT7A 4WU3A 4DPYA 3GQCA 2EK1A 1Q7YT 2YKAA 2AYMA 5A8RB 4PXCA 3G82A 4WTYA 4JI7F 1TL5A 4FPRA 1XMOF 4LVOP 3T41A 1HWIA 4N8OA 1SV5B 3UD3P 5H9FK 4WCEQ 1S6OA 2SXLA 4ER8A 4X4NA 3CXCR 1S1XB 1CJVA 2PD1A 2CIMA 2LP4A 4DPXA 4ZIVA 2HWTA 4HYKA 4F0KA 3SSQA 2MKJA 3K57A 1NK6A 1TKXB 3OTBA 2X1FA 4FXDA 4I4BA 3DYAA 4I56A 5D3GA 1X5OA 1APSA 4YMEA 5KFGA 4ED6A 1C0UA 2C1EB 3CCZA 4HACA 3IA0A 3EPIA 3AODA 3L4BC 2KT2A 5DS7A 1KHWA 4WE1A 3UN3A 5FIIA 3ILIA 1RU1A 2CXEA 5HJYA 2HHWA 2ZH6A 4ERDA 3W9IA 4AQYF 1RACB 1VLOA 1TELA 3JSMA 2XWXA 3ZTPA 1QLNA 2YPYA 1TV6B 2HFZA 4C6AA 1UKUA 4NZ0A 2R2UA 4ZP8A 4H4OA 1KQSR 3KG4A 1VRQC 1FRHA 1H74A 1RT3A 2HHQA 1VYAA 3QGGA 2NUHA 4FYVB 1GXTA 1YBTA 1OYEA 3CDWA 1SXLA 2C3YA 3KLIA 1DQAA 3U7JA 1R0AB 2W4CA 2V94A 1CULA 5ITHA 3J7ZT 3GFXA 3KK3A 2Q79A 2MZ1A 5HK4A 1SH2A 2CNNB 3MURP 3VQTA 2RE1A 3MM6A 1Q8IA 5IZHA 2KXHA 2X51A 2I2YA 3PYDA 2QLJB 4U6PA 2CQCA 2ZH8A 4DBQA 5LT5A 2LA6A 2LMIA 4NCGB 2RMLA 2XNRA 5BJRA 5H9EJ 4ZVQB 1Q78A 1WORA 4LRFA 4JI8J 2EFGA 1X60A 2ZKUA 5CAAA 2ZM6F 2HG4A 3H90A 1OS5A 1X5SA 3DC2A 5D0EA 2IM1A 3M2UA 2W25A 5HQLA 3W5XA 4ZCIA 1I1GA 5ETPA 3DKDA 2GQQA 4Y2KA 4O3OA 3OL7A 1W2BR 2B8PA 5J2PB 5KG4A 1UL3A 4LSZB 1XWLA 1RDRA 2ZJPQ 2HFNA 4HDGA 4K4ZA 5IM0A 1QAIA 1JLAB 1KLMB 2OEKA 5D15A 1IM6A 2BJ1A 4OZJA 1JJCB 3R2DJ 1FX4A 1U6ZA 5C24B 1SB6A 5DQIA 4LFCF 2RQ4A 4TU7A 3KHHA 1G2EA 2OPQB 1H73A 3OT9A 2E5JA 4USHA 2Z58B 3B82A 3TW0A 3KTQA 4NYOA 5FJ4A 1GQEA 3TA0A 2UUAJ 1M5OC 2R42A 3TX8A 4QBUA 2R8JA 4M5DB 1B0TA 1YBUA 4WZQA 3VF0B 4ED8A 2Z2YB 1NPRA 3HHDA 3N79A 4KFBB 2C28A 3SV3A 3IMQJ 4HTIA 4MTPA 3DDIA 5IT4A 1TVRB 1FRJA 1CC7A 4A46A 1K0VA 3DMJA 4B3RJ 4U96A 3A13A 4IUFA 3HFZB 5C2GA 3VAKA 1NJXA 4RNNA 5F0WA 1T3OA 3IWLA 2HIQA 3FJ2A 3GR0A 1Z1ZA 2AW0A 3TJ9A 2IDLA 2MZQA 3ZTQA 5IXUA 4GO5X 1FNMA 5DDRC 2RQKA 4JI7J 4OI2A 1VJQA 1XMOJ 1AB8A 5KFUA 1HI0P 2DNHA 5CHCB 3CD7A 4RW8A 2D3UA 3BR8A 5LMUF 1S1WB 2ZOMA 1ICEB 1U1LA 1F9FA 1S0NA 3DLEA 1S7IA 1K9MT 1SJRA 2BQ3A 4OZLA 3Q8PB 1YI2S 4NLTA 2C2EA 2HWHA 4OHVA 1RTJB 4DV3F 3BGRB 4J37A 1CQNA 1GAOA 1GH8A 2ZH3A 2W4PA 3SYZA 1YDLA 4LR9A 4UUXA 2XMUA 5ETNA 3SZ2A 4BC7A 4ZN3A 4IFVA 2HGLA 3KMSA 4A8KA 3TZWA 5M2PA 3J7YU 3KK2B 2V9WA 2CNOB 3HMJG 2GVZA 3QLHB 2F65A 5CD4H 1JKHA 4ETZA 5LXRA 3KJQB 3HVWA 2VG5B 1N5TA 3SSRA 4DV6F 4YR3A 4QZVB 2DGSA 1LWFB 1KQKA 4R8UA 3TWZA 3PIPQ 4OLOA 4AQYJ 3A12A 3M8PB 4YDXA 4QWAA 2C3MA 3DLHA 2DY9A 2FJAB 4K7QA 3GP9A 2KFZA 4Y0FA 4FXWA 4IFYB 1WC0A 3BB5A 4P7VA 2EKNA 4L3KA 3IWNC 1FF2A 4CYUB 1RAIB 3PHEA 2YXLA 4C9DA 3VHQA 3RR7A 4C7QA 2PFFB 2G0JA 4YR0A 4CLKA 3VGVA 1HNVB 3KNAA 2UV8G 2RIJA 4X4QA 3PNIA 4ZKAA 1OYDA 5K5MA 1AA1B 4F36A 3ENQA 4LR8A 3CJ5A 3BS9A 2R8GA 1Y5NB 1YKWA 3TZXA 2CPXA 2NPFA 2R9LA 1SL0A 3GJSB 1UVIA 3W61A 3P4UB 3U1NA 1S9FA 3PVXA 4RWXA 3D1HA 4JI6F 5HLFA 4ZVHA 5B7WA 1NJYA 2N82B 3AXKA 3M1VB 5JJBA 2RRBA 1FXLA 2AKWB 2V4RA 3RGIA 2ZHAA 4F02A 2JLEA 1AUDA 4GO7X 1OPZA 3CD0A 1OY9A 2VC1A 3QO9B 4DFMA 3HVTA 4DL6A 1QM9A 2DKOB 1T9XA 1OQ6A 2BACA 4LF5F 3QT8A 1XR5A 4FF2A 2W2PP 4QR2A 4A47A 4QW9A 5HQMA 4YB5A 2W8KA 3M32A 4LFCJ 5I3UB 4OYMA 3MEGA 2DCUB 4HHHA 4RW7A 3BQ0A 4M5IA 4ZVOB 3GV7B 1BQMB 2AT1B 2CZ4A 4M5MA 2RS8A 3TAQA 2A18A 2CQHA 4LJMA 2VICA 1N5SA 2DD8S 2H5IB 2LVWA 1UPMB 2W7PA 2XO6A 3FUYA 1F0XA 5THWA 2F9DA 1ZA1B 4C0BA 3V4IA 1ZS6A 1X9MA 3CJKA 1T7PA 1TTHB 1X7VA 5IS2A 3ZZPA 3KLEB 4NLWA 1AFJA 2LDIA 3BKUA 1WTFA 2R2SA 3JYTB 3OR2B 5IT9Y 4WXWA 3LP0B 2MLXA 2XWYA 4DV4J 4RJVA 1RT4A 2DR8A 2GA7A 1P6TA 3IBFB 3R7NB 4RNHA 3Q22A 2JX2A 3GG0A 2EWHA 4LF6F 4KE5A 3P49B 1PYSB 3DOMA 3HSZA 2J6SA 2MKKA 1RHUB 2CJXB 2J9CA 1FI4A 5LMUJ 2K3IA 3S7RA 1GFWB 1HW9A 2QX0A 1Y4ZB 3C8YA 4C8OA 1R31A 1N36F 2AZ1A 4PZVA 2RT3A 1JLFB 1RAAB 2W01A 4DU8A 5AE3A 5EX0A 2KM8C 4IOBA 1YK9A 1GMWD 4JV2A 3CO0P 3I87A 5T41A 2HKEA 5C5JA 4J9NA 3SDEA 3GJRB 4J7CA 4ZVPB 4UW2A 2BBEA 4L3NA 4A8SA 1N54B 2NLWA 1UVNA 3TANA 2YNHB 3DRRB 1S4EA 1RTHA 3IS9B 4NLDA 3NGKA 4L75A 1SQGA 4B08A 5A8KB 1OIAA 3ISNC 3W65A 2IM3A 3U27A 4DV6J 4O3NA 3MCOA 5GADI 2P6SA 1NDLA 2ASJA 4LT6A 2HAIA 3FEYB 1Q0NA 1RT2B 2VBYA 1CVJA 4OV6A 1DTQA 1KLNA 4F4ZA 3PXGa 4IG0B 3VGSA 4J9OA 1KONA 2F8HA 4GKKF 4GVBA 3S6EA 3OFFA 4XPCA 2XYGB 3O3LA 3OHAA 1U1KA 1RLDA 3LP2B 4DV0F 5E3CA 4ZJQA 3C6UB 2XCAA 2N7CA 3GFYA 3F56A 1ZYQA 4RR5A 3R5DA 2WSFC 4FYYB 2CADA 2V69A 4B9MA 1PSDA 3SV4A 1WKJA 2F8EX 5ETTA 3FRZA 4LFBF 2KO1A 1T95A 5A6WA 2RHSB 4KGVB 2O67A 1IM4A 3M30A 2ZBRA 3FBFA 1OPIA 1VRUB 2VG6B 3MMAB 3RAXA 4JI6J 3J7A1 1H72C 3V2UC 4J91A 1S72S 3HXMA 1NPKA 4NA3A 1RCXB 5FLXU 4EGLA 2IBKA 4C0HA 4EYHB 3SFUA 2Y0SD 2J0SD 2EG2A 2HVIA 1YJ7A 2J9EA 3BKTA 2WOMB 3MCMA 1Y11A 5D0RA 1D8YA 3RAQA 4I0WA 3DLBA 4LF5J 1VBZA 2L08A 1I5OB 4JUZA 4OLPA 4WP3A 3FVYA 1DFDA 5GVQA 4ES3A 3FCHA 2EI5A 2U2FA 3M7VA 1UEKA 3C15B 3CCJS 2DB1A 3KFWX 2RQMA 2UVVA 3M9NB 1D9AA 1UWBA 3K0JA 2CPHA 3CULA 1HI8A 1LOUA 4NLQA 3BGLA 4DX8H 2J76E 3R8YA 4C48A 5F8MA 3GIRA 3E3XA 4PRFA 2ZKTA 1VRTB 2Y0BB 4JV5J 2ROPA 3ENVA 4WFZA 2PFDA 4JV1A 3MECB 4QR1A 3US5A 3V6DB 2VJUA 1G6BA 1PYTA 1MLAA 2HRTA 1JLQB 3FDSA 3CC7S 4Q0BB 5KFLA 3K8WA 3W2VB 2JLGA 2D9OA 2CWXA 2J0QD 1SQFA 2HHHF 5CYMB 4WP9A 1OJ4A 2AIRB 1CJKA 2XSJA 2CJKA 2NXUA 4DG1B 4WXOA 4LF6J 2IRUA 1S0VA 1HWJA 4YHHF 4C8KA 1NSPA 3A4TA 1M5PC 1KVKA 4RW6A 3TUPA 5D4LA 2HW3A 1N36J 2XS5A 2WCXA 5L1JA 1YLXA 3RZAA 2R7SA 3AAWB 3PO4A 1ULRA 1FJGF 2J8AA 3ZNUA 2YKMB 3BH7B 3POTB 1L5UA 4DN9A 2HBQB 1YJWS 5DQGA 1FRKA 1SC1B 4ANCA 1RTIB 2Q1LA 1RQ0A 4MAKA 2F7VA 2KB2A 1T3NA 5CD4A 4DZDA 2FJXA 1FO1A 2HNDA 3JQKA 2BDPA 3P3DA 1U26A 3NNAA 2CPFA 3TA2A 3M6WA 3CCLS 1LXNA 2MZJA 1S6QA 1T9UA 4EU0A 1C0TA 2RF2B 2CJ9A 1FNOA 1PIEA 2GHWA 2WB1D 3H42A 5JVHQ 2ZE2B 2ATLA 4PG7A 1IQZA 3NBPA 5F9LA 1C4CA 1VBKA 1SJ1A 4MYTA 2VA2A 4GKKJ 4B3TF 3QT7A 3MAAB 2AX0A 1SBRA 3PG9A 2QLFB 2H51B 3W9HA 1RGVA 2HQIA 4IQMA 3RYLA 2D74B 3DRSA 2QSWA 2UUWA 1NH7A 1HBMB 3PW7A 4ID5A 4ZPWR 4B3MF 2ZITA 2APOA 2HAFA 4DFPA 4WYWA 2UZAA 1T05A 1U48A 3DRYA 2JEJA 4OJ3A 1CQMA 2AYBA 2EC0A 1N6QB 3D9BA 2B43A 3H0PA 2D3OR 5L1IA 4LFBJ 3R7BB 1K1QA 2WONB 1FE0A 5C42A 2OI2A 4ECQA 3PR5B 4QJVA 3SCIE 4S0MA 5HBMA 3BREA 2EKYA 4MYUA 3PFEA 4FP9A 4WU2A 1IKYA 4DXLA 4ZVEA 1YTYA 2EK6A 4DR7J 5F8LA 2DGUA 5G0RB 3IRXA 4B9UA 5T7LA 1QAYA 1NKCA 1HNIB 4OYZA 3O8WA 3QRQA 1S99A 2IVFB 2WZ1A 3MM7B 4MFBB 1JQGA 3G71S 4KT0C 5DLFA 1ZOTA 1FRXA 2ZWOA 4B9TA 1F2HA 2YNIA 1RCOB 3BM7A 2HHSA 2FLPA 3DM2B 2DHHA 4Q44A 5K8OA 1EHWA 3I9ZA 3MMCB 2EFNA 3DRPB 1QE1B 2FJVA 3SQOP 1YRXA 1NHVA 3HVAA 4YP3A 3QZ8A 4X2BA 4ZP7A 5E3QA 2Y9HA 2V9KA 2IJNA 3UQSA 4I7FA 4J5OA 3NWGA 2V34A 4PQAA 2CG8A 1EETB 5B0CA 5H9FJ 3AY0A 1RTDA 2FHJA 3SQGA 3UD4P 2NR0A 5E5NA 3M4XA 2KN4A 3OFHA 4AL6A 5CYJA 3CCTA 4USUA 1X8DA 4CRJA 4CI0B 2MKHA 2E9ZA 2F63A 2O01C 2VKZG 2ZVSA 2FB0A 2GJFA 2M9KA 2XHWA 1KS2A 1DQ8A 2W7OA 1RT6B 3DOKB 2C3OA 1YX2A 3OW2R 2IM0A 3WBZA 2HHHJ 1N88A 3EZ5A 4L76A 4BWMA 1UW4A 3NAIA 3EVWA 2LQ8A 4IOAQ 3M8WA 3OVAA 3IBCB 4DF8A 2KXFA 2LKZA 5J2NB 2XYHB 1HYSB 2GAHC 3EXYA 2K1RB 4DPUA 2HHUA 3ELHA 1DY3A 4KSEB 4YHHJ 1VIOA 1PCAA 3TEHB 3L95X 1Y0HA 2WB4A 3RRHA 1NDCA 2B6AB 4NASA 3ZXWA 2BW7A 2B9YA 1FJGJ 3G82B 4CTAB 3HZEA 1HPZA 5J2QA 1F9HA 1X4FA 3JSYA 4DDFA 2VF3A 4DR3J 1C1CB 3QAUA 4U7UK 4RNMA 2IMOA 2IFXA 3EICA 4ZJLA 4DI6A 3PV8A 1SL1A 3RB0A 1CJVB 3M2RA 4QPXA 4NZ6A 2Y1RI 3L7OA 4C8NA 1NZAA 1RWNB 2IBOA 3GMGA 4O4GA 2ZD1B 3MR2A 5I4MA 2DNKA 4WTOB 4I64A 1BWVA 3DYAB 5D3GB 4XK8C 3SFGA 4QIVA 1PC4A 2XZTB 1C0UB 4ZJOA 4HACB 2ASLA 3KHLA 1RKIA 3MMBA 4X4TA 2DBBA 4WYLA 4NEYA 4FYDA 1WHVA 1H38A 2A2DA 1NKBA 4WE1B 2DPIA 5SZTA 2UUCF 3T9NA 3D0GE 1P9QC 1KC8T 4LBIA 1YJUA 1PG5B 2W9AA 1NAQA 4LF7F 3BR9A 5L1KA 2WHOA 5KG1A 3EDQB 3R1LA 5A2QU 3RRGA 3AQPA 4U7CA 2QL9B 3JSMB 1S9GA 3FMWA 3TQ1A 3CEDA 5CYQA 2OO4A 3SI8A 2DGVA 2YX4A 1BLUA 4WFXA 3EVMA 1FKOA 4H4OB 1M1HA 1QDUB 4MKVA 3THVA 3VALA 5DJBA 4KGZB 4OYPA 4X64F 2M3DA 4NLOA 3EGWB 1HQEA 2YWWA 3I9V9 2R4FA 1NZ8A 3KLIB 5B0AA 2KVQE 4NI2A 3D1QA 3QGPA 1CULB 2YNFA 2C2MB 1H2VZ 2QL5B 2QSFA 3RBXA 5F8NA 3GSDA 2HURA 4KAIA 4OI6A 2KG1A 1VHIA 4ECYA 2PT0A 3MM6B 3BSNA 4PG5A 1TL3A 4DWIA 1TZ0A 5HSPA 4DUZJ 3A3NB 2NZ4A 2E5LJ 1P8GA 3BO2A 1YZ6A 3QAEA 1S97A 4DSKA 5A0YA 3FBEA 3BBFA 4C8LA 2EFQA 3KLFA 4ZLNA 5IWAF 1S77D 3K58A 2HGNA 5KFXA 3JAMY 3MPWA 1V6HA 1FNXH 3QT6A 3M2UB 4DS4A 1O51A 1WUUA 4FBUA 5KFAA 4OZ5A 2N7YA 4ICLA 2L3MA 1P27B 4RO0A 5IQQA 4CT8A 1R27B 3AJ1A 2CQGA 4NMLA 3HHLC 1LV5A 3C14A 3W63A 2R7WA 1FEHA 1DRZA 2BUNA 5IM0B 2L9WA 1S79A 2VH7A 3DCAA 1HBNA 4JYAF 4I2PB 2G1HA 1EAYC 2UV8A 1NK7A 2DNYA 1Y10A 3H7HB 2M8HA 4DCJB 4IRCA 4DR2F 3UCZP 1KN6A 2UVRA 1VQ5S 1R3NA 1RT5B 1ELOA 1X5TA 2MQNA 4DL2A 2R2RA 1NMEB 1XMBA 2EG1A 4JB8B 2P9EA 1WD6A 1SI9A 3RBDA 1VCTA 4DQIA 2VZ9A 1K44A 1IQTA 2JC1A 4NYPA 1RU2A 4DSLA 2JEIA 3IN5A 4BDPA 1EKSA 3IM9A 1FT8A 5LXYA 4ZLLA 3LQVA 3ILLA 3LGNA 2IRXA 4UY85 2R7VA 2BANA 2KM8B 3DRXA 3QJPA 3DMJB 4FF1A 4WIQA 4X62F 2BEFA 4N5SA 1VQLS 2BMBA 2LFVA 3QFWA 1QSSA 3MR7A 1S10A 4J9MA 2PO4A 2BM1A 2X3GA 3BSCA 1YIJS 1D3WA 3E51A 4NLRA 1RZMA 3MFHA 1ITPA 2G2YA 1CS4A 1WOPA 4C11A 3NNHA 4F67A 4DL7A 4Q7AA 3D6MB 1D1UA 1RKJA 3CE8A 4F4XA 3UI3A 4QYZK 4NCBA 1XQIA 3GCXP 1VQNS 3BF4A 3KK1A 2Y8WA 3U02A 2HGMA 3DLEB 4FXVA 4LF4F 2P6TA 3UNYA 2PDAA 3OL8A 2DHXA 3OXFA 3TNVA 1MMLA 2DY1A 1NO8A 2KI2A 3LPEA 4JI5F 1LWCA 2LCWA 3DLKA 2Y1JA 2XGQA 4ZOSA 4AD6A 2IJRA 3PM9A 2I9SA 4DX5A 1KQGB 4KBIA 1WKLA 3ENWA 3G4SS 4ZCMA 1WHYA 4ID8A 1PAUB 1VQYA 2CDQA 4ZPVR 3PACA 4FN5A 2CG4A 5K14A 4U9RA 4IFVB 4K2JA 3RB6A 1Q53A 5GAGI 2GVZB 1TKTA 1XBWA 4Z2XA 3PZPA 2B4OA 2UUCJ 1JK9B 5LJ3Y 4MJKA 4P71A 3KUGA 2RDJA 4LF7J 1AFIA 2V67A 1F5CA 4LRCA 4LUBA 4CM0A 1RWVB 2BKOA 3G9CA 1UEVA 1C1BA 2KDOA 5HMYA 5E3PA 2BKNA 1AZSA 4P2XA 2WAQD 4I2QA 1ZAXA 2ZWPA 3FKBA 3G86A 1B64A 1XNQF 3W64A 2ROEA 3D6HB 1VS3A 4A8MP 1IN0A 4CCHA 1PYOB 2XCPA 2B3TB 4YQWA 4YB1P 4C3MA 1VK3A 3N9UC 1X0FA 2O66A 4KGMA 3NMAA 2ZNYA 5GAHI 4DR4F 4J90A 2MKSA 1WDTA 3KOAA 1LQ9A 1ZTTA 2UVUA 4A8XA 1RWWB 4P2MA 4N41A 3MM8A 5IFMA 1XNRF 1SUQA 3J80Y 2IJFA 4C0OC 1VK8A 4ZPBA 2W4DA 3T9ZA 1JLEA 4CH7A 2LDYA 4QW8A 2LU2A 5KTQA 2Q43A 4PQUA 5KFHA 5HLFB 1REVA 2QG9B 2R7UA 5E3RA 5EUHA 3M8YA 1DTTA 3CJ3A 3RB4A 4OI4A 5B0FA 2DR7A 4HL9A 1RYRA 3DNCA 1SC3B 3MD1A 2BJEA 4M5HA 2WBMA 3D0IE 4TKTA 1DLOB 4LRAA 3JB9k 1V9OA 1WI8A 2MB0B 2FHKA 4PKDB 3DLGA 4ZLPA 4LQ9A 1U7LA 3H59A 2R8KA 2DH9A 4JYAJ 1RHRB 5HMWA 3PW2A 4DLEA 3M32B 1YITS 2NQPA 2ZVIA 1Z2ZA 4H4KA 2Z0GA 3Q8QB 4DR2J 3CJ0A 4DL3A 1IBCB 3T5HA 4RW7B 2QA4G 3BEGB 5J1PA 4EI2A 1SKSA 5B08A 5F8GA 3LA0A 4EBEA 1U6BA 3T1HJ 4B02A 4KH1B 1NJWA 3WIUA 4Z7CA 2RU3A 2JDJA 4I69A 2ZUAA 3KUHA 4ZVRB 4DFKA 5MLCV 1SH3A 3V4IB 3CJKB 2HBRB 1YGYA 1O0PA 1IJFB 5GAEI 4HTJA 4X62J 1RWUA 3I5BA 1JJ4A 3GU0A 2IA0A 4QYRA 4KC5A 3K5NA 1NK8A 3D28A 4DL5A 1WC5A 3RTVA 1HFEL 3VAJA 2IVYA 1EIYB 3OUYA 3OTDA 1GEHA 4G1QB 3CTRA 2RNEA 2V2VA 5IT9U 2AV5A 3DOMB 5BXIA 2LECA 1B7FA 1EQMA 3AOCA 3IM8A 2G9OA 2ZC4A 1X31C 3QIPB 3JQJA 1H98A 1SKUB 5KFVA 1SJ3P 2PMHA 2ACMA 3SSSA 3ZTSA 2W1BA 4LF4J 4B3OA 2GGPB 4NLPA 3MM5A 2AJ4A 4AFFA 4JI5J 4ZPDA 4CO0A 2VDIA 4PABA 5L39A 1R8AA 1VC0A 3M6UA 3T5LA 4B9NA 3A8IA 1TUVA 4G65A 3TARA 2AGOA 4ZVTB 4P73A 3GIKA 5ETMA 2OHDA 1RE1B 1RTHB 1U49A 5F9NA 2OD4A 2MHNA 1A9NB 1TUWA 2WTFA 2XMWA 3NCPA 2FVCA 1PGZA 3KLVA 1TR0A 2N3OA 3CO9A 2FHOB 2D7SA 2PE8A 3ZZTA 4MK7A 3OFEA 3HT3A 1RT7A 4Y3CA 1U4BA 4I6WA 3MEDA 4QWBA 1F5AA 1DTQB 5F3ZA 2F9JA 2WVBA 3DU6A 4LSNA 1WC6A 2D3ZA 4GKJJ 2CQ1A 3I0RB 4LFAF 2A1BA 5DG7A 4IYQA 3AOBA 5AXLA 2XI3A 2M70A 2BVZA 5IQ6A 4CLTA 4K4YA 4OHWA 1Q7LB 3CJQA 3MTKA 1XNQJ 1NB2A 5KT4A 3J81j 3S1TA 1HBUA 4O44A 1S1XA 1IKXA 4J9KA 4WFAQ 2VFRA 1WC4A 3QWPA 4ILRA 4CO1A 2QRRA 4J9SA 3D6FB 2CPEA 4DR4J 2ZUGA 3LPYA 3B6BA 4M8LA 3J7AN 5DETA 3N0VA 2E44A 2YWFA 4CIOA 3EPGA 2V5HG 2QJ3A 4UZBA 1XNRJ 1EZZB 3M30B 3DU5A 1QTMA 5L8RC 9ATCB 3P5BP 3PEHA 1IR0A 1BXNA 3AFGA 2ZBQA 4H4MA 2H3EB 1LK5A 3FBBA 4R25A 1MSWD 2DNQA 2AGPA 1U45A 1X4DA 2MSTA 4C97A 2VFVA 3HFKA 2HVEA 2CUYA 3W2WA 2HZAA 3UCUP 2M52A 2KFYA 2OPPA 3OJSA 2KT3A 4NPOA 2XS2A 1FE4A 4USTA 3HSGA 1FDDA 2DNZA 3PTWA 4N8NA 2POKA 3MR3A 1V5VA 3ZZZA 4O3SA 2IIHA 3MWBA 2HWIA 4K4XA 4ES1A 2NCKL 1ZAWA 2MKIA 2CAJA 3FEXB 1WF1A 2CQ0A 5E41A 1GXLA 1URRA 3HJFA 2N4DA 4M5KA 4DU7A 1TV6A 3R5GA 5KG3A 1QVGR 2GJ2A 3BJYA 1H3DA 1UWBB 2K8GA 3N5FA 1ZM2A 3M8ZA 2HQ3A 1UFLA 5K8NA 4J9LA 3E01A 1MWYA 2E29A 2DXEA 5DO2A 4NMXA 4KKOA 2CJYB 3OVBA 1QAXA 1AT1B 4B9SA 3W7BA 3VGUA 1FXDA 1UJ4A 3N6NA 3OTCA 1R8CA 1XTZA 5EHHA 3W1YC 5J1EA 3LTOA 1WOSA 3J7Z5 2Q6CA 2PEHA 2J7WA 3AT1B 2F5GA 4ECTA 2CJAA 1QSLA 2RVJA 5LJ5Y 5AE1A 2AD9A 4NRUA 1EKRA 3R97A 3GIJA 4A8OA 2D3O1 4KB7A 3IAS9 2B7BB 1HHSA 1Q5YA 3EMTA 1WEXA 2PGCA 3MI7X 5EX3A 3CCES 3CUNA 1WG5A 1AROP 1XK8A 2BJ8A 3KDOA 5J2PA 2J7KA 4V19X 2OELA 3QNWB 1JLAA 3KJFB 2CDRB 4G3IA 4KRWA 3W60A 4ED5A 2C22A 1TQLA 4UOCA 2XMVA 1N33J 4M63A 3VZHA 4NE9C 3V6KA 2QYCA 4LF1A 2DR6A 1WKKA 5KT5A 1XR7A 1LW0A 1U24A 2RSQA 4DSJA 4BLGA 4HDHA 3WC2A 2HNDB 3Q83A 4CO5A 4OYXA 3GB0A 3BV8A 4DSEA 2W2NP 3X3UA 2IYIA 4UUWA 2DITA 4F0MA 3OLAA 3LO3A 2ZBIA 1RJJA 4IO1A 1NBEB 3CDBA 1B4SA 3PY8A 1F60B 4TYAA 1UFKA 2OFHX 3HHLD 1ZBTA 4UQTA 2B9EA 1S6QB 4YUDA 1RLCL 1C0TB 2OP5A 2B56A 1MMDA 2GIRA 4TNOA 3NBPB 3HDSA 4TVAB 4P6QA 4L72B 1Y9OA 2QGFB 4DPWA 3MCSA 4P2SA 4LFAJ 4O0NA 1R6VA 2AGQA 2CQBA 3OL6A 5KFCA 1CSJA 4NLXA 4X4PA 4P75A 2Z2ZA 2IM2A 3TJAA 4Q8FA 1YBAA 3AH6A 1S1WA 4BC9A 4ID5B 3ETMA 3NAHA 4ATNA 1T05B 1KTVA 3RU0A 4V1Ak 1O8BA 1RAEB 1Q81T 5CQGA 4H54A 2C2DA 2FHJD 5CZXA 2LA4A 4J9PA 3W9JA 1CJTB 3FEZA 1DARA 2M7SA 1WTBA 8ATCB 5HBMB 2DTJA 2VUGA 2J0XA 5HMXA 1JX4A 4XDCA 1IKYB 3PX4A 3HHLB 2BE2A 4HH1A 2V50A 3IRXB 1OY6A 5T7LB 4NLSA 3H40A 4TY8B 3QLHA 2NZCA 1KBRA 2DNLA 5CCLA 4Q45A 2X1BA 4NYZA 2VQFJ 1NH8A 3MOZA 3M6VA 3MM9A 4HHUA 1RABB 1R0CB 3SCJE 3A3PB 4OJGA 2Q66A 4ZIWA 1MROB 1X4BA 1LWFA 5KG7A 4YR2A 2XBPA 3CSKA 5L9NA 4ZA1A 4IH7A 4C2MA 2H5EA 1U47A 5A2QY 4IFYA 1KHVA 4WK1A 2HFSA 3CIZA 4M94A 3NGRA 3QBCA 3K89A 4I7FB 1S9EB 2DRDA 4YB6A 2IMWP 3AQOA 2JOQA 1IKVB 3SQGB 1YZ7A 5L46A 4Y34A 4Y2IA 4XDDA 1RT1A 2H4WB 2OSRA 2GX8A 1WHWA 1RHQB 3VVTA 4E8UA 4C8MA 2HHVA 1PKUA 1T8EA 3GYGA 3CDUA 4IDKA 4CLLA 1HWLA 4KQZA 3MTJA 3RG6A 4DL4A 1E6VB 4CLYA 3H2VE 4RUHA 3T6BA 1B7YB 3DGPA 1U8SA 3BBBA 2DHSA 2QZ8A 3HLUA 2DGXA 4OHZA 3FSXA 4CLZA 5B0GA 3C2PA 2VBZA 4QIWD 1FXRA 3UWTA 3OSNA 2GIQA 2VQEF 4EEYA 3H5UA 3IGNA 2K06A 3O1LA 1FTRA 3NGSA 1VQ8S 4I67A 5AE2A 1TL1A 3QQCD 2MQQA 4P52A 2OPRB 2DH8A 4C98A 1WF2A 2HQCA 1FD8A 2GQ2A 3HHNB 2RRNA 4EBCA 1HPZB 2LLZA 1RBLA 5GADU 4DSIA 3B78A 5B0DA 5KOXA 4DR5F 4RNOA 4FKXA 4ZDNA 3HD1A 3M2RB 3OQ2A 3OXLA 4F3MA 4FKYA 2YH0A 4O4GB 2ZH2A 2VBXA 1CPZA 2GHVC 3JTPA 4EZ9A 5DZ7A 5L1LA 1VIXA 1VFJA 1HQ2A 4CH1A 2AEMA 4MKYA 3P8BB 2HMIA 1NSKL 2ROGA 3BYPA 4GVLA 1U0HA 2ZNZA 3MMBB 3CCUS 4ILMA 1GT8A 2ADCA 1IKWB 1JLCB 4DEZA 2RS2A 2V63A 3AXMA 2PA3A 2ZBCA 4YN3B 3V81A 3PW5A 3R3TA 1RHKB 1AXQA 3UCGA 1RB0A 1QJHA 3CJTA 3D2WA 4WIIA 1UMJA 3S8SA 1L3KA 2DK2A 2FLOA 2KYXA 4AUKA 4YB7A 4DCOB 1S9GB 1D9FA 4LIRA 4ZP9A 2L9NA 2FJDB 4DV4F 3NGTA 2FQQB 3UDEA 1V5IB 3W8GA 3GSIA 4PXDA 1X4EA 4NZ7A 2JFDA 3PRVA 4N47A 2GVDA 5KG6A 4FS1A 1KWMA 5T14A 1HQEB 2NSBA 4L6V3 5D8HB 4LMZA 2Y3YA 4ZK7M 3OTEA 1G1XA 2OPSA 1UVLA 2B8QA 2NREA 2YNFB 2E66A 4QIFA 2Y8YA 5CH7B 3DRRA 2DR9A 4P72A 3GIMA 2BJ7A 3CCQS 4EO6A 1TL3B 2OFGX 3I31A 3PKYA 3FSIA 1HI1A 1KFSA 1RBOB 1MMNA 3MMJA 6FD1A 1BUXA 3NGDA 5A0YB 1RT2A 2BE9B 3R7SB 2HNYB 3KLFB 3CDEA 1RWXB 3SMZA 4CNZA 2E1CA 4RNFA 2PSZA 3G8TA 4PYAA 2IC3B 5KFEA 3RRKA 3A8EA 3BGUA 5EWGA 3PIOQ 4ICLB 3MPUB 3LP2A 5ETSA 3ETOA 1RADB 3VAFA 3W5ZA 4RZRA 5JVGQ 3C14B 1V3ZA 5JMNA 2MQOA 4JI4J 3JAMU 3FMBA 5C25B 1N5YA 1VQ9S 4FF3A 5KFRA 3UN2A 1HBNB 3MR5A 1R8PA 2DNOA 1UZHA 5E2QA 4EZ6A 2ZZNA 4CM2A 2E9RX 4QIGA 2JZ5A 4C3KA 4F4KA 2E1MC 1X9SA 1SJFA 4I6YA 4NA2A 5KG2A 2KXNB 2I5JB 1RAJA 1H6KX 2N3LA 2X1GA 1E6YA 5RUBA 3QFHA 4ETXA 1B0PA 1UVMA 3UFCX 1BY9A 3TI0A 1J27A 2CPYA 2FZGB 5DQHA 4UY8T 1I6JA 2L48A 4D3GA 3M8QB 4ZITA 3DHWC 4WK3A 2GC8A 2QN6B 1S0MA 4OYIA 4ZP6A 4OI1A 2XC9A 3NP5A 1NUEA 1WC3A 3M2VA 1DQ9A 2BANB 2VQEJ 3JSBA 3V4MA 2AYGA 4CLFA 4C3LA 4DPTA 2W9BA 5D4NA 2HPUA 5D6GA 2MQPA 2ZZTA 5ETQA 2OUGA 4WKYA 1VC5A 1FDAA 1UVJA 4F8RA 1U1PA 2GMHA 2C3UA 4AT1B 3DGVA 1RA7A 3TVYA 2EFVA 1ZTWA 2MTLA 4W92B 1Q8KA 3CD5A 3FFIA 1Z4UA 3TUZC 3RB3A 3PKMA 5KFDA 3C15A 1VGYA 2DYAA 2UVWA 4CDIA 1S49A 4Y65A 2ZJRQ 3TYTA 4ZCLA 2ASDA 3P6YC 4CP5A 4DR5J 5GMDA 3KK1B 1T9TA 1K8AT 3D1OA 5IOLA 5IC4B 3RW6A 3BSAA 2FYXA 5E7OB 1NU4A 2XLKA 3LWMA 1VQOS 1LWCB 1VRTA 2YWKA 1S48A 3DLKB 2LQ9A 5KFFA 2ABYA 1HBOB 4IKAA 2J9DA 2DIUA 5CA5A 5K14B 1FWLA 1TKZA 1S1UA 2ZH4A 3W2VA 2ILYA 1TKTB 5M2UA 3FCWA 4JV5F 3BQ2A 1X4HA 3OR1B 4USMA 4X66F 4O3RA 9RUBA 4DG1A 3F73A 3ZZUA 1H7WA 1QUPA 4Q5VA 7FD1A 2XY5A 4ZPAA 1C1BB 3TQEA 2YVSA 1AZSB 4BBYA 4A8YA 4UQGA 2GMLA 2DH7A 4QOTA 3RBZA 4J9UE 2QFIA 1VJWA 1BMQB 3M8RA 1H2TZ 4I2QB 1L3UA 4QWDA 8AT1B 2FPHX 4WKRA 4ZS6A 1HMVA 1QTNB 4OYOA 2Z2MA 1JXVA 4F3QA 5KFSA 3Q23A 4AL5A 4USKA 1SCJB 2ALYB 1XERA 2PMWA 3ITHA 4V19J 4R5PA 3VZIA 3FSYA 1HR0F 2BOPA 3DOLA 5DG9A 1U1QA 1F6TA 8RUCA 1U2CA 1HNXF 2FGCA 3ZZOA 3U1MA 3LAMA 2MDAA 5DM6Q 2I8EA 2RF2A 2FC9A 5AT1B 3JSRA 1JLEB 3G6XA 1ACMB 3THTA 4PQUB 1REVB 1HNZF 2M5YA 4HEA9 2VFSA 1DTTB 1EP4A 3J80U 2YQ3A 2B4VA 3UR3C 1UETA 3CCVS 2K2PA 1S57A 3QSYB 2B7CB 4CT9A 4OJHA 2HSEB 3H5XA 4DSFA 2MKYA 1REGX 4XAKA 2KKHA 2XZDB 3MFIA 1SL2A 3MXHP 2A0FB 2W9CA 1VBXA 1Z2LA 4A48A 5L9XA 2YBVA 3FGVA 2CQ2A 5I3QA 2BW2A 4HT7A 1Q95G 5ETLA 4ENOA 1N6QA 4B9VA 3B8HA 2OMOA 4OI0A 1BQNB 2MKCA 2ASYA 5ETRA 4HKQA 3A1YG 4P7TA 5DDQC 4C8YA 2MPUA 4PYDA 3FQKA 4QU7A 4A4JA 4TLRA 1FHTA 1N4LA 3BDPA 1WELA 5KFKA 2WVDA 4OMFG 4U7UD 2H5JB 4OX8A 4I68A 4Q2LA 3LW5C 3OVSA 1FDNA 3H20A 1X5PA 7FDRA 4Q43A 1OSDA 1S1VA 2IAJA 4NRTA 2AJ0A 1MN7A 1CEZA 2Z4PA 4ELUA 3P96A 3MM7A 4MFBA 2UXDF 1VC6A 3LALA 3EGVA 5LSLA 2CVEA 4ED0A 2HQFA 2DRAA 4ECUA 2XEXA 2HYIB 2YY3A 1FJEB 1V3RA 2VL1A 3DM2A 4DS5A 3A8KA 3Q24A 1Y7PA 4AE5A 3A8JA 1HL6A 4DR7F 4Y6IA 2HVHA 3MMCA 1RP5A 1EB0A 4PCQA 3W8PA 1AUSL 1R7IA 4PXBA 2QIFA 4KTQA 3OUYB 1C4AA 2V2KA 4FZVA 4NX9A 5HQ8A 4LRBA 1NDKA 2HVZA 4YEAA 1IUJA 3PFOA 1TL7A 2P5VA 1HA1A 2OSQA 2N4CA 2P8IA 3GTYX 2ZHOA 1RSCA 5EDWA 3IRWP 2AJ2A 1WEYA 4B3OB 4IR9A 3MM5B 1D09B 2FY8A 1QY7A 2B5JA 1P1LA 3QRPA 3SXLA 2YH1A 4X4RA 2J7UA 5KT3A 3T5JA 1Q16B 3KG0A 4MIBA 3D3BJ 3FC9A 2D69A 1TMJA 4ED2A 1MWZA 4ED3A 1HD0A 3MR6A 3OHBA 5KFQA 1KTQA 1N48A 2C2OB 5KG0A 2RUSA 2MLZA 5D77A 2AF6A 4X66J 1RHMB 3DI6A 3EXCX 2FGOA 3GYXB 2ZDPA 4XPEA 4X65F 4MH8A 1GK8A 4ITSA 4UTGA 1DJ0A 1HYSA 2K1RA 2GQCA 5DG8A 3MEDB 2HFVA 1K47A 2HS0A 4W90B 1U02A 5KOWA 2BKPA 3C16A 4LSNB 3TOQA 3GIIA 1X4GA 2G0IA 2B6AA 1W26A 2RD5C 4DJBA 2YQ0A 3BKFA 4OV1A 4CTAA 1IBMF 3X1LB 2UP1A 5IT0A 5KFIA 2OGUA 3NWRA 3CCWA 1C1CA 2J8SA 3TVKA 2VONA 1KEKA 3H4DA 1B3TA 1HBUB 3BGOP 4O44B 1SKRA 2LU1A 1IKXB 1VQ6S 3KKFA 4PG8A 3JQMA 2Q6BA 2PN6A 2DO0A 2ATCB 3TUJC 3K7RA 1HR0J 2AU0A 1NDPA 2M88A 2ZD1A 2OJ3A 5HATA 2HFUA 1N56A 4DL0C 2R7OA 1HNXJ 1FWPA 4DR3F 1WG4A 2OD6A 3VCDA 2O5DA 3TUIC 3EUNA 2V8HA 1KD1T 1K0TA 1J5OA 3LUYA 4H4MB 3H98A 1S1TA 3BN7A 1RA6A 1HNZJ 2E5GA 1Y00A 2YKOA 4Z37A 3G2XA 4IG3A 2BRKA 5C7PA 1PO6A 2FJEB 3W2WB 1YVFA 2YNGB 1M5SA 3N4WA 4ZVFA 3I55S 2OPPB 2VFTA 5C2CA 4USWA 3OFGA 3KMQA 3QSIA 4BCAA 1NHUA 2NUUG 3H5SA 1TK5A 1RK8A 4DQPA 5SUHA 2PI4A 2LQBA 1KNZA 3QZ7A 4CLPA 5K9FA 1ZPWX 2FZKB 3R27A 2AEJA 1KDNA 1FRLA 2ZJQQ 2WSEC 4G6VB 1FRIA 4KIAA 1N52B 1YHQS 3L3CA 2W24A 1LFPA 1S6PA 4LVNP 2XI2A 3E01B 4KPCA 3ZZYA 4K4TA 4IOCQ 1RTZA 4ZN1A 2CWKA 3LGMA 5HVGA 2E5HA 4KKOB 3NOGA 1TKDA 4OYAA 4ED4A 3V6HA 1F9EB 3SIPB 1SIWB 1TFWA 2VJVA 3FQLA 2R7RA 3O44A 1M1GA 5J1EB 2UXDJ 3TAMA 3H25A 3T19A 2FVSA 5KFZA 1QAJA 1SQEA 5BYQA 4F4WA 4NEZA 3NEKA 2HRYA 1ZAVA 3LANA 2DXFA 3QGHA 4TLQA 3EE3A 4PG6A 2DNPA 4UOFA 4TU8A 1J2VA 4Y28C 3R6LB 2HLTA 3CIMA 1JNRB 4KV8A 2IY5B 3MEEA 2HHXA 1RHJB 2BJDA 2B0GA 1NJZA 4DUZF 3NL0A 2E5LF 5FDLA 2PI5A 2V2ZA 5JXSA 2PEBA 3FBCA 4IH6A 4MMOA 5GAGU 5F3TA 1NPPA 3UE2A 3KJNB 4I2PA 2VOOA 4AXJA 4X4UA 3EWGA 1D8ZA 5LOQA 3ILOA 5HROB 1GMVA 3P5TL 3MAQA 1LW0B 1RT5A 4B3SF 2E1AA 3GV8B 5A6PA 1U2RA 2R7XA 3Q2SC 4ZHRA 4DHVA 2ZHBA 3AD8C 2VG7A 4J9RA 3CWJA 3IO1A 3IG1B 2KL8A 3IP0A 4LF8F 3MF5A 3CJ4A 3D3CJ 1Y5LB 3RR8A 2OEJA 4TY9A 3HF5A 1XEZA 3QWUA 4ALZA 1AYEA 3TA1A 2WW4A 3IWXA 4HI1A 1UA1A 2HZCA 1KP6A 4X65J 1FDBA 3G8SA 4QIEA 4NXMF 2OTJS 1F1BB 2I38A 1OQ3A 1W2IA 2E9TA 4K59A 3I96A 1T94A 1HQUB 5GAHU 1H7XA 2RUGA 2ZH9A 1URNA 4F25A 3WIVA 2BE7D 1S76D 3C66A 4DUYF 1RWMB 1IBMJ 5D4PA 4JI0F 1N5VA 5AXMA 4LBHA 2JHEA 1JJ2R 3I4PA 1TFYA 2CFXA 2YKPA 3VWSA 2FJBB 3EJMA 3QJJA 1HLWA 1QSYA 5KG5A 4PPDA 3WX4A 1C2PA 2AZ3A 5LMNF 2JVRA 3WX8A 3ZZRA 3B4DA 1JWWA 2BE2B 1WC1A 2V8GA 2HEKA 3ZNJ1 2YWGA 4KGXB 3C46A 4OYWA 3OLBA 4IRKA 1XMQF 1KR4A 2VASA 4NXNF 3MM9B 1QVFR 1RUSA 3E2EA 1LW2A 2FIUA 4RU9A 4MT1A 3TO8A 3UDLA 4EUVA 1VQPS 2KFNA 1JLGA 1MNEA 2QLBB 4KO0A 2DT9A 1B99A 1BE4A 4LQ3A 2H1YA 1Y3JA 2OEMA 2OMLA 2BQUA 1W7WA 3KHGA 2R8IA 3GILA 3C6TA 4UZCA 5F8HA 1WHXA 1FK9A 3M8SA 1ZM3A 5GAEU 2QE5A 3HSDA 1IJEB 5K20B 2XMKA 4A8FA 4ECRA 2EPIA 1FX2A 1T03A 1WF0A 5K8PA 1DURA 2V0NA 2WBRA 2ZEJA 2HNZA 3O2IA 1RT1B 2R8HA 2XSFA 3CMAS 1TMMA 4DQRA 3W62A 1RISA 1IWGA 1NM2A 4FVMA 1RT3B 5HP1A 4IDKB 3HT0A 2RAQA 4CLWA 1RAGB 2JEFA 4NA1A 1SJ4P 3PCOB 1U1MA 2QA4S 3MEKA 3DGPB 3HHEA 3CW2C 2Z2LA 3TEGA 4ANEA 4K0KF 4ILLA 1VQ7S 3KK3B 1YJVA 4YS2A 4RL1A 2ZM6J 5KFBA 4ELVA 1TAUA 5LL6d 2QEXS 1WWHA 4DQSA 1FEEA 1M5HA 2HHPA 4ZVSB 2WSCC 3UO0A 1TL1B 4UOGA 3MGJA 2HHTA 1CJUA 2ZH7A 1NK4A 4Z7YA 3KJVA 4CWBA 1WEZA 2YPZA 3KUEA 1DLOA 2AJQA 3TJ8A 2NXNA 2CNKB 3AA9A 2W8LA 4ELTA 1Q8BA 3CDAA 3UVJA 2R7TA 4FNIA 4TU9A 1SJQA 3TRGA 4B3SJ 4O3QA 3I0SA 1TL4A 5GMEA 2KZZA 5H1SV 4F26A 2UUBF 4NCAA 3B54A 2RILA 5LSRA 2F40A 5FD1A 5D0GA 1H0HB 4USVA 5BYSA 1VR6A 4O0IA 1WDDA 1XN9A 3ADAC 3CCMS 3LP1A 3NKYA 4LF8J 3UN5A 1GTEA 3OSPA 2LQ5A 2C42A 2V6AA 2CZVC 1WSVA 2HMIB 3AOAA 5HMZA 2DRBA 4DV2F 1U0HB 1U0SA 4NXMJ 4F3OA 3S01A 2MJNA 2OAUA 3T1HF 1QUVA 2XMAA 1FVQA 3DLJA 4JV0A 2GHPA 5EN1A 3KXDA 1G4CA 1RWKB 2JRSA 2HRUA 3HFVA 2HBYB 4OFZA 3NY0A 4DUYJ 3V81B 3F0NA 2W2OP 1YSJA 2V4JA 2P9GA 4LSLA 4G1QA 2ZFHA 4PUOA 4JI0J 1H2UX 1HKAA 2CKWA 2C2KB 3B4MA 4IRDA 3MPVA 3DHXA 3QIPA 5J2MA 3MUVP 1UWAA 5DRKA 3NMRA 5F8JA 1I94F 4HT5A 2GGPA 3J81Y 4NLYA 2GVDB 4DV3J 1KSPA 4A8QA 3R6GB 2DEIA 3N28A 5ETVA 3H2LA 2DISA 4RW8B 2U1AA 3NGUA 4HH0A 1O5JA 5KT6A 5KFOA 3TVZA 2OPSB 5LMNJ 1HNWF 5IV3A 3NOCA 1NRKA 2J6UA 3BGFA 1UZDA 4ANDA 2K3KA 1N0UA 2R7QA 4W4MA 1FD2A 3ZC4A 4CLSA 4EYIB 3MDFA 3BO3A 1XMQJ 3D4JA 4NOHA 1WSRA 3GG1A 3FZBA 4NXNJ 1NCLA 1KVIA 2XULA 3BYRA 3HO1A 4WJBA 2IDEA 3CJ2A 2WVFA 1NKEA 5F41A 2WK4A 2RDDA 1HWKA 1OY8A 4RPFA 1JKHB 2JSXA 3I0RA 2XMJA 5CABA 3CD6S 3THPA 3GR1A 2EBGA 2H9ZA 2KU7A 3NG8A 4R8UB 2NYIA 4DQQA 1N5YB 1YQHA 4QWCA 4ED1A 2B4PA 3NLCA 4GKJF 3QGIA 4E98A 2A6MA 3N6LA 3T6JA 3LH2S 2MGZA 3ENAA 2W2QP 4ZPCA 1T02A 3TZZA 5KFNA 2GS8A 1PJ5A 4IO9Q 1E6YB 2FVRA 4U8VA 4F0HA 3VGTA 3GE9A 3DXBA 2UXBF 2EEYA 5IV4A 3VAHA 3KLGA 2AX1A 3KNGA 1ZA2B 3CGIA 3R5BA 2KHDA 5I42A 3ET6A 1YJ9S 2E1PA 4K0KJ 4MIWA 2I6WA 3ZFVA 1N5QA 4U67Q 4NLUA 3M2VB 3GYNA 1FCAA 1YG0A 4RW4A 2W9BB 2ZOFA 1MWQA 3QPIA 4OZ2A 2MZTA 4Y2MA 2VDHA 3JXOA 1NK9A 4I1TA 2BZ2A 2PMZD 2FTRA 1I51B 2MYFA 2RKIA 4MK9A 3LF0A 5B0BA 2COLA 1CBKA 3FFIB 2F1FA 4DV5F 1RI7A 1UJ6A 3AD9C 5L38A 1TUGB 5KFYA 1PJ7A 2DR5A 3RJMB 1KFDA 4O23A 2G0CA 2F3JA 5IC6B 5DM7Q 3HVTB 1HW8A 1R6YA 2Y1IA 2F4VF 3WC0A 4P10A 2UUBJ 4RW9A 4N77A 5F0UA 3GLJA 4MIAA 4ECZA 2CPIA 2BYCA 1EARA 1FA0A 1A7GE 3J7YI 5E33A 2A2CA 4W98A 1HIYA 5J1NA 4FNHA 2LQJA 1S0OA 3MEGB 2VKRA 2CPDA 2B4UA 2M0GB 4DV2J 2VBWA 1FVSA 1JLBA 3PEJA 5KT7A 1TKZB 1S1UB 4QWEA 5F8IA 4CNYA 5KFPA 4AYBD 1TU0B 2M4MA 5HO4A 3R5JB 2L41A 2DO4A 4O3PA 3EGNA 2AMCB 2HS3A 2JJ4D 1BC6A 2HQGA 3QT5A 3EYZA 3BQ1A 1R8BA 3KDNA 2JFKA 2QA1A 2YTCA 2PIIA 1FKPA 2FUG9 3IGVA 4JI3F 2PC6A 3HVRA 1RT4B 3Q89A 4PEOA 4F50A 3W66A 1ZH5A 3VAIA 2C2NA 5B09A 2AJFE 1I94J 1SH0A 3L7PA 2O3DA 4HHJA 3NXZA 1HMVB 3D5MA 4ES2A 3KLHA 2E1RA 4F2RA 1LWEA 1OO0B 1HNWJ 3SCLE 1R43A 2L9DA 2P2CB 1D9DA 3ITHB 3HX9A 4FS2A 4R5PB 2FJWA 3DOLB 5EWFA 1N33F 4F04B 3R5AA 3PR4A 3PO5A 4URQU 3SDEB 4KHRA 4PWDA 1GTHA 4PWUA 1MN9A 1SC4B 3UW1A 3GV5B 2DXDA 3Q8YA 2MJUA 1NJIT 2JEGA 1P9YA 2QC3A 2VD3A 5A8WA 4WPAA 2DHGA 5KT2A 1EP4B 2EXUA 1MU2A 3HZGA 1YJRA 2XO7A 4ZCKA 1X0PA 2H65B 2QMXA 1VHFA 1F3VA 3VAGA 1YWXA 4IH5A 1R89A 2E5IA 4DV0J 3HP6A 3K5OA 1HWUA 3M9OB 4WZMA 3D67A 2W9CB 3CMES 3QJLA 1JNZB 5CCMA 4WBFA 2YKNA 2VPWB 4GVBB 2O1PA 3UR0A 1RXOB 1UA0A 3F41A 4UF4A 5A8RA 4ZPTR 3LAKA 2Z30B 1UEUA 4PXEA 1CJTA 2OLWA 5DGAA 2UXBJ 1SV5A 2K7JA 2OIHA 4OHXA 3GJQB 1LKZA 4OX9F 4USJC 6AT1B 1ZZNA 3HHLA 2KRBA 4OHYA 1U2FA 3VV2B 2XY6A 3PW0A 2YWHA 3T5KA 3IR6B 3Q8UA 1FJCA 2ZC3A 2IVMA 1SIZA 3R5CA 1HARA 5D4OA 1S1VB 3JTNA 2IAJB 2XMMA 3M6XA 4TY8A 2CQ4A 2RJZA 1TKXA 2NXCA 5CXTA 3ISZA 1KQFB 5D0HA 2F4FA 5B0EA 1MROA 2R3VA 1T11A 1T0TV 3CT9A 2V4QA 2HLUA 1SVDA 1VQ4S 2C3PA 1NSQA 4Q2MA 2WVCA 2CZ9A 5KFTA 1PC5A 4HR2A 1X9WA 2E7XA 2EFOA 4IQXA 2YWEA 2VQFF 4DV5J 4DLGA 2ZOGA 3TAPA 1AW0A 1TL7B 3D6TB 3MOJB 2MQLA 3QATA 2IYGA 1TK8A 1S9EA 3DLLQ 3CJSA 3HK2A 3NRBA 4AXIA 4JP8A 3O5TB 2F4VJ 2MHEA 1IKVA 3G6ES 4RBUA 1KVJA 3ILJA 3AA8A 4F4AA 2B5JB 3Q8RB 3D54A 4QR0A 2DJWA 2VOPA 1U1OA 4PAAA 3MZIA 2QMWA 3R9LA 2C2RA 3VQSA 3MHYA 2WW8A 2FZCB 1UP1A 1XC9A 1E6VA 4YOEA 3GFZA 1NEEA 2KZMA 1R0AA 4CO4A 1LEOA 2G1DA 2NXEA 2EW9A 1EJ7L 3MPYA 2ERRA 1TK0A 1OSCA 4DX6A 6FDRA 4RX6A 3DI6B 5HVFA 3K5MA 2GAGC 4TQRA 3GJTB 4DMZA 5HJXA 2J5AA 1N32F 3W5YA 4RWWA 4QPTA 2FHMA 1OWXA 2ZBPA 3D0HE 3QRRA 2VC0A 3C16B 3V5RA 2NS1B 4JI3J 3IC1A 4NCGA 1WJ9A 2OPRA 2MEWA 1CJKB 2XSJB 4GRSA 2KJVA 4H4KC 2JWNA 4CLUA 3ZTOA 3EX7B 2E7WA 4NWBA 4KYZA 1M5KC 1Q1KA 5G4DA 1M5VC 4LRDA 4RW6B 2GFFA 3D66A 3HKWA 4XIUA 5DGBA 3OTOF 4OL8A 3QIDA 1KLMA 4BS2A 5CZVA 3AHPA 3UPFA 2CA9A 4LR7A 2B51A 2KHCA 5C24A 4OQJA 3VVUA 4EFAC 4J9VA 2B9XA 2OPQA 4CQ1A 3KYLA 4USIA 4M1KA 2HZVA 3WHIA 3TZYA 3HD2A 4RBVA 1UVKA 1J5OB 3EM1A 2I1RA 1S1TB 2MSSA 2XG8A 2D1CA 2GMJA 3C19A 2DGQA 3ZZ0A 2DEJA 2JNJA 2P9CA 4M5DA 2QMUB 4IG3B 3Q0AA 1IKWA 1JLCA 4B3TJ 2NXJA 2EBEA 4R0JA 3G96A 3N6MA 1IBLF 3QMQA 1YRTA 2FY1A 2GO9A 4KFBA 4WP8A 4KHMA 4PG4A 4WWSA 1PAEX 1A6LA 2HIYA 3I6PA 1TVRA 3QYYA 2BR0A 3EZUA 5H9EK 4DOZA 2HFOA 2NYHA 4B3MJ 2QA2A 3NS7B 3DN9A 4E2FB 2HK3A 4OIXA 2XGPA 1S6PB 2BX6A 4XTTA 4OX6A 4JI2F 4LIWA 3DRSB 5JUMA 1SC6A 4OX9J 2RH3A 5A76A 2JL9A 2GJIA 3DFEA 2IHR1 3CJRA 3KG1A 3FZ2A 3PDNA 3N01A 2J6TA 3CMQA 1RTJA 4HLBA 3BGRA 1T9WA 3OBIA 5C42B 5ADZA 3TAMB 2RQCA 5GMKa 4R0EA 2QL7B 3PRDA 2GNKA 3SBMA 1OMSA 4K4VA 1FERA 1G7CB 3FRYA 1Q4RA 2HNYA 3H8YA 1ZZFA 5AXKA 3K17A 3KK2A 1XJWB 1DAXA 3I56S 4ZMMA 4KV8B 2IC3A 3IR7B 2HS4A 3MEEB 1N34F 4M5NA 4PPZA 2VG5A 1S5ZA 1VISA 1U1RA 4Y2CA 5FDLB 4EMDA 2MZSA 3PYFA 2YNIB 4X4SA 1Q8LA 1FRMA 4O4RA 3OJUA 4M5GA 5C25A 1U1NA 3OL9A 3M8PA 2DNGA 3WQPA 3ISND 1GMUA 3C3LA 1L3SA 2MY7A 3OV7A 5KFJA 1W25A 1Y3KA 2QTWA 1VQKS 1K1SA 1B0VA 2I5JA 2DNMA 2BJ3A 4CO3A 4CYUA 4RLEA 1HHTP 4Q8EA 4JI4F 2KT5A 4OJ1A 1RTDB 4ZHRB 4GMKA 2VG7B 2G13A 2Y1LB 3BPDA 2OKQA 3GFHA 4RU2A 5DDOC 3HM9A 2M8DB 3NCRA 4K4SA 3M8QA 3MUTP 4RUBA 1BQXA 1HNVA 1BGXT 3CB4A 4FVCA 1BD6A 2CVIA 1Q5VA 1R0BG 2VB6A 4ZVGA 5LSOA 4L74A 1UCNA 1DZ5A 1PJ6A 1G3OA 5EGYA 1N32J 2YX1A 2CPJA 1VDHA 1X4AA 3T1AA 1L3VA 1KOOA 1ZM4A 5EWEA 1Q86T 2XB2D 4P2FA 3BBCA 2RB7A 2BXJA 2KVIA 3T1YF 2EC2A 1O6XA 5KAKA 4ZVUB 3M1VA 2H4YB 3AB2B 2D9PA 1EX8A 1S59A 1GNKA 2Z56B 3WZ0A 3T3FA 2RU9A 1JXEA 5U47A 2XYPB 2DGTA 3PHTA 2AHOB 3QO9A 3OTOJ 2BM0A 4URGA 4LREA 1ROFA 4BHQA 3HHKA 3IBWA 4YDDB 3JTOA 4KJIA 2A3JA 3HKZD 3Q2TC 5BR8F 5J2QB 1IXKA 3BH6B 5LM7E 3G6VA 4Y00A 1WG1A 4FF4A 5I3UA 3Q86A 2XQCA 3TP2A 4YFUA 4OZ0A 4EO8A 3ULHA 5HN0A 1DHMA 1HD1A 1IR2A 2MQMA 2FD2A 1ZM9A 1HHQA 1HBOA 3G8QA 3RUBL 3P45B 1I3OB 2EFPA 2FVPA 1VMBA 2QO3A 2FLNA 1BQMA 3NS6A 2JLFA 2IRYA 3I32A 3SEOA 2MQ8A 3EDRB 1PBAA 1IVZA 3BO4A 2DPJA 3FK4A 1FFWB 4A8WA 2ZH1A 4WFBQ 1IBLJ 3OR1A 4DV1F 4DV7F 1Q82T 2CYYA 1LW2B 4K4UA 2NPIA 4M5JA 2X3DA 4QU6A 2XHCA 4UT4A 3KLEA 2AP6A 2D41A 2LXFA 1LFWA 1JLGB 5HANA 4KO0B 2Q3PA 2PA8D 3JYTA 3OR2A 2ZDOA 3LP0A 2ADBA 3C6TB 1NHKL 1IBKF 4KH0B 1FK9B 3FCVA 3H4BA 2HVDA 4FDFA 4Y2AA 4GC6A 4B17A 4PWWA 3UNGC 3OXGA 1J5EF 1T03B 4M95A 2ZZMA 4X64J 4JI2J 4CZCA 5I3PA 2HNZB 5CYQB 2XZWA 2AQ4A 3I4HX 2DCLA 4MKBA 1KKHA 4OI3A 4GC7A 2VIHA 1JLFA 1FKOB 2VHGA 3PRBA 3GPAA 1UJ5A 1LK7A 5HP1B 2V8PA 2DGOA 4K8RA 1M90T 4DFJA 1U6FA 3NS5A 4LF9F 3DDKA 2IPOB 3G6YA 2I0XA 4NI2B 3W3SA 3MPDA 2MZRA 1N8RT 1PILA 4MK8A 2YNHA 5IWAJ 2F8MA 2CJBA 1V3SA 4DUTA 3HI9A 4JOUA 3CCSS 2MMYA 1IR1A 3IS9A 5BYRA 2FC8A 4E0DA 3LWLA 1N34J 5A8KA 2V8DA 4TN2A 2KTQA 2XTJP 3K8VA 3GCWP 3PYGA 4WFYA 4K4WA 1CJUB 1YJTA 2G2ZA 4FPIA 3KJVB 2GV1A 1VBYA 2V2QA 1NNDA 4G1IA 4IG0A 2AYEA 2OH2A 1GXUA 3I82A 4URSA 2ALZA 3AJDA 3UVJB 1X4CA 4K5RA 4P74A 2YQ1A 3G87A 2C2ZB 4C4WA 4EK2A 1BQNA 1TP7A 4DR6F 3PJXA 1B70B 2VPXB 4QYZJ 3I0SB 3BSOA 2HK2A 4EBDA 3KWMA 1NK0A 3C6UA 1FFSB 2ILZA 3GWCA 4N56A 3RAMA 1MW7A 1GMWA 3LP1B 4OZ1A 3IR5B 4N76A 2UU9F 1VOMA 2FVQA 2VA3A 2KRRA 4K5SA 5K8MA 1XIQA 4OYBA 2CPZA 3GONA 4DN0A 4I6AA 4YY3F 2M2BA 3FNNA 3UD5A 3MCNA 5FLXY 3SCKE 2RDIA 3TX0A 4G1PA 4KPYA 4DX7A 3LGHA 4BWJA 2QV6A 1VRUA 2VG6A 1F3FA 4FYWB 2V68A 3MMAA 4EWTA 2GO8A 3KHRA 3IXQA 1CC8A 3T1YJ 1UTAA 4HVZA 2V4JB 1LWXA 4LSLB 4JBCA 3CVKA 4M5LA 3D7SB 3CC4S 2CQIA 3OD2A 2LEPA 4PUOB 1JJHA 2HBZB 1YJNS 3CC2S 3HCXA 3GZ7A 2WOMA 2X1AA 1RAFB 3Q8SB 5HAOA 2AJ1A 3IFEA 2QFJA 2CQPA 3R1HA 2W2MP 2KYZA 4ECSA 5J2MB 2XMTA 2JH3A 1UAWA 1KRPA 4ECVA 1CS4B 2LXIA 4C11B 4NLGA 5HL7Q 7AT1B 3L9ZA 3CPWR 1Q79A 5BR8J 1JB0C 3L7UA 1ZPVA 1QD1A 4JI1F 5E3AA 2DNRA 5DLGA 4DPOA 1RAOA 2XLJA 4TQSA 4KHPF 2RHQB 2QYGA 2X7IA 1NSAA 4N7TA 3J81U 2HQDA 1GX5A 2UXCF 2JVOA 3CCRS 2BOAA 1FTCA 3PJWA 3LOUA 2QLXA 4AL7A 2VU5A 5AJ3F 4P9SA 4DV1J 4DV7J 3EVOA 5KFMA 3MECA 2EVZA 4RUAA 1IWAA 3TR5A 4X84A 2RRAA 1FWKA 3V6DA 3EZOA 2E7VA 1JLQA 1EQ0A 4Q0BA 4MKAA 1T9YA 3ZO7A 1U8WA 1DBDA 3H5YA 1S12A 3PW4A 2YKQA 3DDNA 1M0SA 4OX7A 5CYMA 4FBTA 5MAOA 2H48B 1IBKJ 2LEAA 1TAQA 1M1KT 2Z57B 1J5EJ 2A6OA 2NSCA 3BN4A 4F7VA 4DR1F 4PR6A 2FDNA 3Q8VA 2VFUA 2G2OA 2VPYB 2MLYA 1LNQA 2MGZB 3K5PA 3ONQA 2BABA 4TXSA 2AEFA 2BA9A 1L3TA 3AJ2A 2ZH5A 2MY8A 2YKMA 1ZETA 1BWEA 3L09A 3POTA 1RTIA 3KLGB 1FFGB 4RKUC 4LF9J 4TYBA 3N5BA 2CNLB 4QCLA 1FKAF 1VQSA 2H54B 5I42B 5D78A 1R8HA 3ET6B 2LEBA 4DCPB 2GZOA 3BDEA 2YNGA 3MM8B 2MXYA 1NXIA 4ZLJA 1SUQB 4WF9Q 1N0VC 4RW4B 3M9MB
chains in the Genus database with same CATH topology
2ZUAA 4ENOA 1NDLA 4ANCA 3VVTA 3BBCA 3G2XA 3Q89A 4FKXA 1XQIA 3EJMA 5C7PA 3NGTA 1PKUA 2BX6A 3DDIA 3VGTA 1HLWA 1LEOA 3VGVA 5CAAA 3VVUA 4UOGA 1NPKA 3ELHA 1NCLA 3VGSA 1F6TA 4FKYA 3L7UA 3B6BA 3MPDA 2HURA 3ZTPA 3FCWA 1S59A 1NSQA 3PRVA 4F36A 4C6AA 3Q8VA 3DKDA 4O0NA 1NDCA 3FKBA 2AZ1A 4DUTA 2DXFA 4HR2A 4WBFA 4W98A 2AZ3A 2B8PA 2DXEA 1HIYA 3BBBA 3EE3A 3EM1A 3ZTRA 4UOFA 1XIQA 1K44A 3WX8A 1VYAA 3ZTQA 3FC9A 1NHKL 2B8QA 4S0MA 3EVWA 3FBEA 3BBFA 1KDNA 2DYAA 3ETMA 3FCVA 1WKLA 1MN7A 2HVDA 3VGUA 1NSKL 1WKKA 3FBBA 4CP5A 5BXIA 1F3FA 5CABA 2VU5A 3NGSA 1S57A 3EICA 1ZS6A 3EVOA 4DI6A 3NGRA 3B54A 3Q83A 1NDPA 2HVEA 5IOLA 3BH6B 3ZTOA 1WKJA 2DY9A 3FBCA 1NSPA 1PAEX 3Q86A 2BEFA 1LWXA 3GP9A 4DZ6A 4F4AA 1BHNA 4UOHA 4KPCA 3EVMA 1MN9A 1B4SA 1HHQA 2DXDA 3ZTSA 2CWKA 3NGUA 3JS9A 1NLKL 3Q8YA 4ANEA 1BUXA 1UCNA 3R9LA 3Q8UA 1U8WA 1B99A 4EK2A 1BE4A 3PJ9A 1NB2A 3FBFA 1JXVA 3GPAA 2NCKL 1S5ZA 1EHWA 1W7WA 3EMTA 3ENAA 1NDKA 4ANDA 3BH7B 1NUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZUA A;  4ENO A;  1NDL A;  4ANC A;  3VVT A;  3BBC A;  3G2X A;  3Q89 A;  4FKX A;  1XQI A;  3EJM A;  5C7P A;  3NGT A;  1PKU A;  2BX6 A;  3DDI A;  3VGT A;  1HLW A;  1LEO A;  3VGV A;  5CAA A;  3VVU A;  4UOG A;  1NPK A;  3ELH A;  1NCL A;  3VGS A;  1F6T A;  4FKY A;  3L7U A;  3B6B A;  3MPD A;  2HUR A;  3ZTP A;  3FCW A;  1S59 A;  1NSQ A;  3PRV A;  4F36 A;  4C6A A;  3Q8V A;  3DKD A;  4O0N A;  1NDC A;  3FKB A;  2AZ1 A;  4DUT A;  2DXF A;  4HR2 A;  4WBF A;  4W98 A;  2AZ3 A;  2B8P A;  2DXE A;  1HIY A;  3BBB A;  3EE3 A;  3EM1 A;  3ZTR A;  4UOF A;  1XIQ A;  1K44 A;  3WX8 A;  1VYA A;  3ZTQ A;  3FC9 A;  1NHK L;  2B8Q A;  4S0M A;  3EVW A;  3FBE A;  3BBF A;  1KDN A;  2DYA A;  3ETM A;  3FCV A;  1WKL A;  1MN7 A;  2HVD A;  3VGU A;  1NSK L;  1WKK A;  3FBB A;  4CP5 A;  5BXI A;  1F3F A;  5CAB A;  2VU5 A;  3NGS A;  1S57 A;  3EIC A;  1ZS6 A;  3EVO A;  4DI6 A;  3NGR A;  3B54 A;  3Q83 A;  1NDP A;  2HVE A;  5IOL A;  3BH6 B;  3ZTO A;  1WKJ A;  2DY9 A;  3FBC A;  1NSP A;  1PAE X;  3Q86 A;  2BEF A;  1LWX A;  3GP9 A;  4DZ6 A;  4F4A A;  1BHN A;  4UOH A;  4KPC A;  3EVM A;  1MN9 A;  1B4S A;  1HHQ A;  2DXD A;  3ZTS A;  2CWK A;  3NGU A;  3JS9 A;  1NLK L;  3Q8Y A;  4ANE A;  1BUX A;  1UCN A;  3R9L A;  3Q8U A;  1U8W A;  1B99 A;  4EK2 A;  1BE4 A;  3PJ9 A;  1NB2 A;  3FBF A;  1JXV A;  3GPA A;  2NCK L;  1S5Z A;  1EHW A;  1W7W A;  3EMT A;  3ENA A;  1NDK A;  4AND A;  3BH7 B;  1NUE A; 
#chains in the Genus database with same CATH topology
 5M2R A;  3HSJ A;  2G4B A;  3MAH A;  1A0O B;  3PYE A;  2KJW A;  1UW9 A;  2ZE2 A;  5ETK A;  4ED7 A;  2A10 A;  1KOH A;  5DZ6 A;  1RAH B;  2XY7 A;  3VTI A;  4OZ3 A;  2BJ9 A;  2B9W A;  2RKI B;  2J0W A;  2BQR A;  4F4Y A;  3OPK A;  3MAA A;  4KY3 A;  4D3H A;  4RBT A;  1T9V A;  2CJQ A;  1XR6 A;  3IAM 9;  2QLW A;  1RWO B;  1S7H A;  3ICL A;  4DR6 J;  1FJ7 A;  4K2X A;  3I5A A;  3F44 A;  4X4V A;  1UPP A;  3M05 A;  3WDO A;  2GCF A;  3RBE A;  2UUT A;  3K2Y A;  1HBM A;  4QQB A;  3MD3 A;  3DLG B;  4RW9 B;  1JIH A;  1S4F A;  3E8O A;  4CH0 S;  3NNC A;  2ACY A;  4UOH A;  4KR0 B;  3A3O B;  2CQD A;  3NCQ A;  2UU9 J;  4F2S A;  4DF4 A;  2OTL S;  4HI2 A;  5E0O A;  2GW8 A;  1SPB P;  2WON A;  2YX7 A;  3EGZ A;  3PJ9 A;  4YY3 J;  4ECW A;  1JLB B;  1Y5I B;  1F5B A;  3VAM A;  2GIF A;  1JMT A;  1VLY A;  2DGW A;  2DHA A;  3HPO A;  3U1L A;  1UFW A;  1WOO A;  3HJV A;  5G0R A;  3MUM P;  1SKW A;  2VOD A;  3BPS P;  4ECX A;  1HNI A;  4U8Y A;  3CF5 Q;  4NL5 A;  2DNN A;  5HI7 A;  2BV3 A;  2WRM A;  2AWZ A;  3UDV A;  3ZTR A;  1NB7 A;  2VV5 A;  1FKP B;  2V8V A;  3DXS X;  2XLI A;  2WVE A;  1S6U A;  4X4O A;  2JC0 A;  1VI7 A;  3O6Q A;  2BRL A;  3RW7 A;  4XO0 A;  4JI8 F;  3DRP A;  1QE1 A;  5DDP C;  3PX6 A;  1MG7 A;  4B9L A;  4DZ6 A;  1RWP B;  2FLL A;  4J9Q A;  2LXU A;  4JI1 J;  1CLF A;  2Z8Q A;  1YRU A;  1K73 T;  5HRO A;  4RUC A;  3KLH B;  3JS9 A;  1P1T A;  1LWE B;  4KHP J;  4WFN Q;  3UDC A;  2DIV A;  2KH9 A;  1EET A;  1PBU A;  2VPZ B;  5ETO A;  2K7K A;  3AD7 C;  2UXC J;  3H2U B;  4OZN A;  1NK5 A;  3AB4 B;  2KG0 A;  4C8Z A;  3IG1 A;  5KFW A;  2XM3 A;  2J9D E;  3CNQ P;  4CO2 A;  1RBA A;  5AJ3 J;  1VQM S;  4PWD B;  3HUL A;  3CJ8 A;  5HVH A;  4K50 A;  1JXL A;  1F2G A;  2UUA F;  1WNE A;  2DVI A;  2IA6 A;  5AXN A;  3R2C J;  5A8W B;  2XNQ A;  1MU2 B;  1RT6 A;  3BZQ A;  3DOK A;  1RYS A;  4U95 A;  3D68 A;  1HQU A;  4KGK A;  3I5C A;  3K59 A;  1WAC A;  4NLV A;  4L73 A;  1WI6 A;  4LBP A;  1LXJ A;  1U25 A;  2XS7 A;  4IR1 A;  3PX0 A;  1FES A;  1CG2 A;  4FYX B;  2R2T A;  5J2N A;  3K5L A;  1RT7 B;  4B3R F;  2W7A A;  1GX6 A;  2LYV A;  4LF2 A;  1BHN A;  2CQ3 A;  4DR1 J;  3VR1 A;  2CRL A;  3V6J A;  2YKN B;  1NLK L;  1D0E A;  1U09 A;  2QT7 A;  4WU3 A;  4DPY A;  3GQC A;  2EK1 A;  1Q7Y T;  2YKA A;  2AYM A;  5A8R B;  4PXC A;  3G82 A;  4WTY A;  4JI7 F;  1TL5 A;  4FPR A;  1XMO F;  4LVO P;  3T41 A;  1HWI A;  4N8O A;  1SV5 B;  3UD3 P;  5H9F K;  4WCE Q;  1S6O A;  2SXL A;  4ER8 A;  4X4N A;  3CXC R;  1S1X B;  1CJV A;  2PD1 A;  2CIM A;  2LP4 A;  4DPX A;  4ZIV A;  2HWT A;  4HYK A;  4F0K A;  3SSQ A;  2MKJ A;  3K57 A;  1NK6 A;  1TKX B;  3OTB A;  2X1F A;  4FXD A;  4I4B A;  3DYA A;  4I56 A;  5D3G A;  1X5O A;  1APS A;  4YME A;  5KFG A;  4ED6 A;  1C0U A;  2C1E B;  3CCZ A;  4HAC A;  3IA0 A;  3EPI A;  3AOD A;  3L4B C;  2KT2 A;  5DS7 A;  1KHW A;  4WE1 A;  3UN3 A;  5FII A;  3ILI A;  1RU1 A;  2CXE A;  5HJY A;  2HHW A;  2ZH6 A;  4ERD A;  3W9I A;  4AQY F;  1RAC B;  1VLO A;  1TEL A;  3JSM A;  2XWX A;  3ZTP A;  1QLN A;  2YPY A;  1TV6 B;  2HFZ A;  4C6A A;  1UKU A;  4NZ0 A;  2R2U A;  4ZP8 A;  4H4O A;  1KQS R;  3KG4 A;  1VRQ C;  1FRH A;  1H74 A;  1RT3 A;  2HHQ A;  1VYA A;  3QGG A;  2NUH A;  4FYV B;  1GXT A;  1YBT A;  1OYE A;  3CDW A;  1SXL A;  2C3Y A;  3KLI A;  1DQA A;  3U7J A;  1R0A B;  2W4C A;  2V94 A;  1CUL A;  5ITH A;  3J7Z T;  3GFX A;  3KK3 A;  2Q79 A;  2MZ1 A;  5HK4 A;  1SH2 A;  2CNN B;  3MUR P;  3VQT A;  2RE1 A;  3MM6 A;  1Q8I A;  5IZH A;  2KXH A;  2X51 A;  2I2Y A;  3PYD A;  2QLJ B;  4U6P A;  2CQC A;  2ZH8 A;  4DBQ A;  5LT5 A;  2LA6 A;  2LMI A;  4NCG B;  2RML A;  2XNR A;  5BJR A;  5H9E J;  4ZVQ B;  1Q78 A;  1WOR A;  4LRF A;  4JI8 J;  2EFG A;  1X60 A;  2ZKU A;  5CAA A;  2ZM6 F;  2HG4 A;  3H90 A;  1OS5 A;  1X5S A;  3DC2 A;  5D0E A;  2IM1 A;  3M2U A;  2W25 A;  5HQL A;  3W5X A;  4ZCI A;  1I1G A;  5ETP A;  3DKD A;  2GQQ A;  4Y2K A;  4O3O A;  3OL7 A;  1W2B R;  2B8P A;  5J2P B;  5KG4 A;  1UL3 A;  4LSZ B;  1XWL A;  1RDR A;  2ZJP Q;  2HFN A;  4HDG A;  4K4Z A;  5IM0 A;  1QAI A;  1JLA B;  1KLM B;  2OEK A;  5D15 A;  1IM6 A;  2BJ1 A;  4OZJ A;  1JJC B;  3R2D J;  1FX4 A;  1U6Z A;  5C24 B;  1SB6 A;  5DQI A;  4LFC F;  2RQ4 A;  4TU7 A;  3KHH A;  1G2E A;  2OPQ B;  1H73 A;  3OT9 A;  2E5J A;  4USH A;  2Z58 B;  3B82 A;  3TW0 A;  3KTQ A;  4NYO A;  5FJ4 A;  1GQE A;  3TA0 A;  2UUA J;  1M5O C;  2R42 A;  3TX8 A;  4QBU A;  2R8J A;  4M5D B;  1B0T A;  1YBU A;  4WZQ A;  3VF0 B;  4ED8 A;  2Z2Y B;  1NPR A;  3HHD A;  3N79 A;  4KFB B;  2C28 A;  3SV3 A;  3IMQ J;  4HTI A;  4MTP A;  3DDI A;  5IT4 A;  1TVR B;  1FRJ A;  1CC7 A;  4A46 A;  1K0V A;  3DMJ A;  4B3R J;  4U96 A;  3A13 A;  4IUF A;  3HFZ B;  5C2G A;  3VAK A;  1NJX A;  4RNN A;  5F0W A;  1T3O A;  3IWL A;  2HIQ A;  3FJ2 A;  3GR0 A;  1Z1Z A;  2AW0 A;  3TJ9 A;  2IDL A;  2MZQ A;  3ZTQ A;  5IXU A;  4GO5 X;  1FNM A;  5DDR C;  2RQK A;  4JI7 J;  4OI2 A;  1VJQ A;  1XMO J;  1AB8 A;  5KFU A;  1HI0 P;  2DNH A;  5CHC B;  3CD7 A;  4RW8 A;  2D3U A;  3BR8 A;  5LMU F;  1S1W B;  2ZOM A;  1ICE B;  1U1L A;  1F9F A;  1S0N A;  3DLE A;  1S7I A;  1K9M T;  1SJR A;  2BQ3 A;  4OZL A;  3Q8P B;  1YI2 S;  4NLT A;  2C2E A;  2HWH A;  4OHV A;  1RTJ B;  4DV3 F;  3BGR B;  4J37 A;  1CQN A;  1GAO A;  1GH8 A;  2ZH3 A;  2W4P A;  3SYZ A;  1YDL A;  4LR9 A;  4UUX A;  2XMU A;  5ETN A;  3SZ2 A;  4BC7 A;  4ZN3 A;  4IFV A;  2HGL A;  3KMS A;  4A8K A;  3TZW A;  5M2P A;  3J7Y U;  3KK2 B;  2V9W A;  2CNO B;  3HMJ G;  2GVZ A;  3QLH B;  2F65 A;  5CD4 H;  1JKH A;  4ETZ A;  5LXR A;  3KJQ B;  3HVW A;  2VG5 B;  1N5T A;  3SSR A;  4DV6 F;  4YR3 A;  4QZV B;  2DGS A;  1LWF B;  1KQK A;  4R8U A;  3TWZ A;  3PIP Q;  4OLO A;  4AQY J;  3A12 A;  3M8P B;  4YDX A;  4QWA A;  2C3M A;  3DLH A;  2DY9 A;  2FJA B;  4K7Q A;  3GP9 A;  2KFZ A;  4Y0F A;  4FXW A;  4IFY B;  1WC0 A;  3BB5 A;  4P7V A;  2EKN A;  4L3K A;  3IWN C;  1FF2 A;  4CYU B;  1RAI B;  3PHE A;  2YXL A;  4C9D A;  3VHQ A;  3RR7 A;  4C7Q A;  2PFF B;  2G0J A;  4YR0 A;  4CLK A;  3VGV A;  1HNV B;  3KNA A;  2UV8 G;  2RIJ A;  4X4Q A;  3PNI A;  4ZKA A;  1OYD A;  5K5M A;  1AA1 B;  4F36 A;  3ENQ A;  4LR8 A;  3CJ5 A;  3BS9 A;  2R8G A;  1Y5N B;  1YKW A;  3TZX A;  2CPX A;  2NPF A;  2R9L A;  1SL0 A;  3GJS B;  1UVI A;  3W61 A;  3P4U B;  3U1N A;  1S9F A;  3PVX A;  4RWX A;  3D1H A;  4JI6 F;  5HLF A;  4ZVH A;  5B7W A;  1NJY A;  2N82 B;  3AXK A;  3M1V B;  5JJB A;  2RRB A;  1FXL A;  2AKW B;  2V4R A;  3RGI A;  2ZHA A;  4F02 A;  2JLE A;  1AUD A;  4GO7 X;  1OPZ A;  3CD0 A;  1OY9 A;  2VC1 A;  3QO9 B;  4DFM A;  3HVT A;  4DL6 A;  1QM9 A;  2DKO B;  1T9X A;  1OQ6 A;  2BAC A;  4LF5 F;  3QT8 A;  1XR5 A;  4FF2 A;  2W2P P;  4QR2 A;  4A47 A;  4QW9 A;  5HQM A;  4YB5 A;  2W8K A;  3M32 A;  4LFC J;  5I3U B;  4OYM A;  3MEG A;  2DCU B;  4HHH A;  4RW7 A;  3BQ0 A;  4M5I A;  4ZVO B;  3GV7 B;  1BQM B;  2AT1 B;  2CZ4 A;  4M5M A;  2RS8 A;  3TAQ A;  2A18 A;  2CQH A;  4LJM A;  2VIC A;  1N5S A;  2DD8 S;  2H5I B;  2LVW A;  1UPM B;  2W7P A;  2XO6 A;  3FUY A;  1F0X A;  5THW A;  2F9D A;  1ZA1 B;  4C0B A;  3V4I A;  1ZS6 A;  1X9M A;  3CJK A;  1T7P A;  1TTH B;  1X7V A;  5IS2 A;  3ZZP A;  3KLE B;  4NLW A;  1AFJ A;  2LDI A;  3BKU A;  1WTF A;  2R2S A;  3JYT B;  3OR2 B;  5IT9 Y;  4WXW A;  3LP0 B;  2MLX A;  2XWY A;  4DV4 J;  4RJV A;  1RT4 A;  2DR8 A;  2GA7 A;  1P6T A;  3IBF B;  3R7N B;  4RNH A;  3Q22 A;  2JX2 A;  3GG0 A;  2EWH A;  4LF6 F;  4KE5 A;  3P49 B;  1PYS B;  3DOM A;  3HSZ A;  2J6S A;  2MKK A;  1RHU B;  2CJX B;  2J9C A;  1FI4 A;  5LMU J;  2K3I A;  3S7R A;  1GFW B;  1HW9 A;  2QX0 A;  1Y4Z B;  3C8Y A;  4C8O A;  1R31 A;  1N36 F;  2AZ1 A;  4PZV A;  2RT3 A;  1JLF B;  1RAA B;  2W01 A;  4DU8 A;  5AE3 A;  5EX0 A;  2KM8 C;  4IOB A;  1YK9 A;  1GMW D;  4JV2 A;  3CO0 P;  3I87 A;  5T41 A;  2HKE A;  5C5J A;  4J9N A;  3SDE A;  3GJR B;  4J7C A;  4ZVP B;  4UW2 A;  2BBE A;  4L3N A;  4A8S A;  1N54 B;  2NLW A;  1UVN A;  3TAN A;  2YNH B;  3DRR B;  1S4E A;  1RTH A;  3IS9 B;  4NLD A;  3NGK A;  4L75 A;  1SQG A;  4B08 A;  5A8K B;  1OIA A;  3ISN C;  3W65 A;  2IM3 A;  3U27 A;  4DV6 J;  4O3N A;  3MCO A;  5GAD I;  2P6S A;  1NDL A;  2ASJ A;  4LT6 A;  2HAI A;  3FEY B;  1Q0N A;  1RT2 B;  2VBY A;  1CVJ A;  4OV6 A;  1DTQ A;  1KLN A;  4F4Z A;  3PXG a;  4IG0 B;  3VGS A;  4J9O A;  1KON A;  2F8H A;  4GKK F;  4GVB A;  3S6E A;  3OFF A;  4XPC A;  2XYG B;  3O3L A;  3OHA A;  1U1K A;  1RLD A;  3LP2 B;  4DV0 F;  5E3C A;  4ZJQ A;  3C6U B;  2XCA A;  2N7C A;  3GFY A;  3F56 A;  1ZYQ A;  4RR5 A;  3R5D A;  2WSF C;  4FYY B;  2CAD A;  2V69 A;  4B9M A;  1PSD A;  3SV4 A;  1WKJ A;  2F8E X;  5ETT A;  3FRZ A;  4LFB F;  2KO1 A;  1T95 A;  5A6W A;  2RHS B;  4KGV B;  2O67 A;  1IM4 A;  3M30 A;  2ZBR A;  3FBF A;  1OPI A;  1VRU B;  2VG6 B;  3MMA B;  3RAX A;  4JI6 J;  3J7A 1;  1H72 C;  3V2U C;  4J91 A;  1S72 S;  3HXM A;  1NPK A;  4NA3 A;  1RCX B;  5FLX U;  4EGL A;  2IBK A;  4C0H A;  4EYH B;  3SFU A;  2Y0S D;  2J0S D;  2EG2 A;  2HVI A;  1YJ7 A;  2J9E A;  3BKT A;  2WOM B;  3MCM A;  1Y11 A;  5D0R A;  1D8Y A;  3RAQ A;  4I0W A;  3DLB A;  4LF5 J;  1VBZ A;  2L08 A;  1I5O B;  4JUZ A;  4OLP A;  4WP3 A;  3FVY A;  1DFD A;  5GVQ A;  4ES3 A;  3FCH A;  2EI5 A;  2U2F A;  3M7V A;  1UEK A;  3C15 B;  3CCJ S;  2DB1 A;  3KFW X;  2RQM A;  2UVV A;  3M9N B;  1D9A A;  1UWB A;  3K0J A;  2CPH A;  3CUL A;  1HI8 A;  1LOU A;  4NLQ A;  3BGL A;  4DX8 H;  2J76 E;  3R8Y A;  4C48 A;  5F8M A;  3GIR A;  3E3X A;  4PRF A;  2ZKT A;  1VRT B;  2Y0B B;  4JV5 J;  2ROP A;  3ENV A;  4WFZ A;  2PFD A;  4JV1 A;  3MEC B;  4QR1 A;  3US5 A;  3V6D B;  2VJU A;  1G6B A;  1PYT A;  1MLA A;  2HRT A;  1JLQ B;  3FDS A;  3CC7 S;  4Q0B B;  5KFL A;  3K8W A;  3W2V B;  2JLG A;  2D9O A;  2CWX A;  2J0Q D;  1SQF A;  2HHH F;  5CYM B;  4WP9 A;  1OJ4 A;  2AIR B;  1CJK A;  2XSJ A;  2CJK A;  2NXU A;  4DG1 B;  4WXO A;  4LF6 J;  2IRU A;  1S0V A;  1HWJ A;  4YHH F;  4C8K A;  1NSP A;  3A4T A;  1M5P C;  1KVK A;  4RW6 A;  3TUP A;  5D4L A;  2HW3 A;  1N36 J;  2XS5 A;  2WCX A;  5L1J A;  1YLX A;  3RZA A;  2R7S A;  3AAW B;  3PO4 A;  1ULR A;  1FJG F;  2J8A A;  3ZNU A;  2YKM B;  3BH7 B;  3POT B;  1L5U A;  4DN9 A;  2HBQ B;  1YJW S;  5DQG A;  1FRK A;  1SC1 B;  4ANC A;  1RTI B;  2Q1L A;  1RQ0 A;  4MAK A;  2F7V A;  2KB2 A;  1T3N A;  5CD4 A;  4DZD A;  2FJX A;  1FO1 A;  2HND A;  3JQK A;  2BDP A;  3P3D A;  1U26 A;  3NNA A;  2CPF A;  3TA2 A;  3M6W A;  3CCL S;  1LXN A;  2MZJ A;  1S6Q A;  1T9U A;  4EU0 A;  1C0T A;  2RF2 B;  2CJ9 A;  1FNO A;  1PIE A;  2GHW A;  2WB1 D;  3H42 A;  5JVH Q;  2ZE2 B;  2ATL A;  4PG7 A;  1IQZ A;  3NBP A;  5F9L A;  1C4C A;  1VBK A;  1SJ1 A;  4MYT A;  2VA2 A;  4GKK J;  4B3T F;  3QT7 A;  3MAA B;  2AX0 A;  1SBR A;  3PG9 A;  2QLF B;  2H51 B;  3W9H A;  1RGV A;  2HQI A;  4IQM A;  3RYL A;  2D74 B;  3DRS A;  2QSW A;  2UUW A;  1NH7 A;  1HBM B;  3PW7 A;  4ID5 A;  4ZPW R;  4B3M F;  2ZIT A;  2APO A;  2HAF A;  4DFP A;  4WYW A;  2UZA A;  1T05 A;  1U48 A;  3DRY A;  2JEJ A;  4OJ3 A;  1CQM A;  2AYB A;  2EC0 A;  1N6Q B;  3D9B A;  2B43 A;  3H0P A;  2D3O R;  5L1I A;  4LFB J;  3R7B B;  1K1Q A;  2WON B;  1FE0 A;  5C42 A;  2OI2 A;  4ECQ A;  3PR5 B;  4QJV A;  3SCI E;  4S0M A;  5HBM A;  3BRE A;  2EKY A;  4MYU A;  3PFE A;  4FP9 A;  4WU2 A;  1IKY A;  4DXL A;  4ZVE A;  1YTY A;  2EK6 A;  4DR7 J;  5F8L A;  2DGU A;  5G0R B;  3IRX A;  4B9U A;  5T7L A;  1QAY A;  1NKC A;  1HNI B;  4OYZ A;  3O8W A;  3QRQ A;  1S99 A;  2IVF B;  2WZ1 A;  3MM7 B;  4MFB B;  1JQG A;  3G71 S;  4KT0 C;  5DLF A;  1ZOT A;  1FRX A;  2ZWO A;  4B9T A;  1F2H A;  2YNI A;  1RCO B;  3BM7 A;  2HHS A;  2FLP A;  3DM2 B;  2DHH A;  4Q44 A;  5K8O A;  1EHW A;  3I9Z A;  3MMC B;  2EFN A;  3DRP B;  1QE1 B;  2FJV A;  3SQO P;  1YRX A;  1NHV A;  3HVA A;  4YP3 A;  3QZ8 A;  4X2B A;  4ZP7 A;  5E3Q A;  2Y9H A;  2V9K A;  2IJN A;  3UQS A;  4I7F A;  4J5O A;  3NWG A;  2V34 A;  4PQA A;  2CG8 A;  1EET B;  5B0C A;  5H9F J;  3AY0 A;  1RTD A;  2FHJ A;  3SQG A;  3UD4 P;  2NR0 A;  5E5N A;  3M4X A;  2KN4 A;  3OFH A;  4AL6 A;  5CYJ A;  3CCT A;  4USU A;  1X8D A;  4CRJ A;  4CI0 B;  2MKH A;  2E9Z A;  2F63 A;  2O01 C;  2VKZ G;  2ZVS A;  2FB0 A;  2GJF A;  2M9K A;  2XHW A;  1KS2 A;  1DQ8 A;  2W7O A;  1RT6 B;  3DOK B;  2C3O A;  1YX2 A;  3OW2 R;  2IM0 A;  3WBZ A;  2HHH J;  1N88 A;  3EZ5 A;  4L76 A;  4BWM A;  1UW4 A;  3NAI A;  3EVW A;  2LQ8 A;  4IOA Q;  3M8W A;  3OVA A;  3IBC B;  4DF8 A;  2KXF A;  2LKZ A;  5J2N B;  2XYH B;  1HYS B;  2GAH C;  3EXY A;  2K1R B;  4DPU A;  2HHU A;  3ELH A;  1DY3 A;  4KSE B;  4YHH J;  1VIO A;  1PCA A;  3TEH B;  3L95 X;  1Y0H A;  2WB4 A;  3RRH A;  1NDC A;  2B6A B;  4NAS A;  3ZXW A;  2BW7 A;  2B9Y A;  1FJG J;  3G82 B;  4CTA B;  3HZE A;  1HPZ A;  5J2Q A;  1F9H A;  1X4F A;  3JSY A;  4DDF A;  2VF3 A;  4DR3 J;  1C1C B;  3QAU A;  4U7U K;  4RNM A;  2IMO A;  2IFX A;  3EIC A;  4ZJL A;  4DI6 A;  3PV8 A;  1SL1 A;  3RB0 A;  1CJV B;  3M2R A;  4QPX A;  4NZ6 A;  2Y1R I;  3L7O A;  4C8N A;  1NZA A;  1RWN B;  2IBO A;  3GMG A;  4O4G A;  2ZD1 B;  3MR2 A;  5I4M A;  2DNK A;  4WTO B;  4I64 A;  1BWV A;  3DYA B;  5D3G B;  4XK8 C;  3SFG A;  4QIV A;  1PC4 A;  2XZT B;  1C0U B;  4ZJO A;  4HAC B;  2ASL A;  3KHL A;  1RKI A;  3MMB A;  4X4T A;  2DBB A;  4WYL A;  4NEY A;  4FYD A;  1WHV A;  1H38 A;  2A2D A;  1NKB A;  4WE1 B;  2DPI A;  5SZT A;  2UUC F;  3T9N A;  3D0G E;  1P9Q C;  1KC8 T;  4LBI A;  1YJU A;  1PG5 B;  2W9A A;  1NAQ A;  4LF7 F;  3BR9 A;  5L1K A;  2WHO A;  5KG1 A;  3EDQ B;  3R1L A;  5A2Q U;  3RRG A;  3AQP A;  4U7C A;  2QL9 B;  3JSM B;  1S9G A;  3FMW A;  3TQ1 A;  3CED A;  5CYQ A;  2OO4 A;  3SI8 A;  2DGV A;  2YX4 A;  1BLU A;  4WFX A;  3EVM A;  1FKO A;  4H4O B;  1M1H A;  1QDU B;  4MKV A;  3THV A;  3VAL A;  5DJB A;  4KGZ B;  4OYP A;  4X64 F;  2M3D A;  4NLO A;  3EGW B;  1HQE A;  2YWW A;  3I9V 9;  2R4F A;  1NZ8 A;  3KLI B;  5B0A A;  2KVQ E;  4NI2 A;  3D1Q A;  3QGP A;  1CUL B;  2YNF A;  2C2M B;  1H2V Z;  2QL5 B;  2QSF A;  3RBX A;  5F8N A;  3GSD A;  2HUR A;  4KAI A;  4OI6 A;  2KG1 A;  1VHI A;  4ECY A;  2PT0 A;  3MM6 B;  3BSN A;  4PG5 A;  1TL3 A;  4DWI A;  1TZ0 A;  5HSP A;  4DUZ J;  3A3N B;  2NZ4 A;  2E5L J;  1P8G A;  3BO2 A;  1YZ6 A;  3QAE A;  1S97 A;  4DSK A;  5A0Y A;  3FBE A;  3BBF A;  4C8L A;  2EFQ A;  3KLF A;  4ZLN A;  5IWA F;  1S77 D;  3K58 A;  2HGN A;  5KFX A;  3JAM Y;  3MPW A;  1V6H A;  1FNX H;  3QT6 A;  3M2U B;  4DS4 A;  1O51 A;  1WUU A;  4FBU A;  5KFA A;  4OZ5 A;  2N7Y A;  4ICL A;  2L3M A;  1P27 B;  4RO0 A;  5IQQ A;  4CT8 A;  1R27 B;  3AJ1 A;  2CQG A;  4NML A;  3HHL C;  1LV5 A;  3C14 A;  3W63 A;  2R7W A;  1FEH A;  1DRZ A;  2BUN A;  5IM0 B;  2L9W A;  1S79 A;  2VH7 A;  3DCA A;  1HBN A;  4JYA F;  4I2P B;  2G1H A;  1EAY C;  2UV8 A;  1NK7 A;  2DNY A;  1Y10 A;  3H7H B;  2M8H A;  4DCJ B;  4IRC A;  4DR2 F;  3UCZ P;  1KN6 A;  2UVR A;  1VQ5 S;  1R3N A;  1RT5 B;  1ELO A;  1X5T A;  2MQN A;  4DL2 A;  2R2R A;  1NME B;  1XMB A;  2EG1 A;  4JB8 B;  2P9E A;  1WD6 A;  1SI9 A;  3RBD A;  1VCT A;  4DQI A;  2VZ9 A;  1K44 A;  1IQT A;  2JC1 A;  4NYP A;  1RU2 A;  4DSL A;  2JEI A;  3IN5 A;  4BDP A;  1EKS A;  3IM9 A;  1FT8 A;  5LXY A;  4ZLL A;  3LQV A;  3ILL A;  3LGN A;  2IRX A;  4UY8 5;  2R7V A;  2BAN A;  2KM8 B;  3DRX A;  3QJP A;  3DMJ B;  4FF1 A;  4WIQ A;  4X62 F;  2BEF A;  4N5S A;  1VQL S;  2BMB A;  2LFV A;  3QFW A;  1QSS A;  3MR7 A;  1S10 A;  4J9M A;  2PO4 A;  2BM1 A;  2X3G A;  3BSC A;  1YIJ S;  1D3W A;  3E51 A;  4NLR A;  1RZM A;  3MFH A;  1ITP A;  2G2Y A;  1CS4 A;  1WOP A;  4C11 A;  3NNH A;  4F67 A;  4DL7 A;  4Q7A A;  3D6M B;  1D1U A;  1RKJ A;  3CE8 A;  4F4X A;  3UI3 A;  4QYZ K;  4NCB A;  1XQI A;  3GCX P;  1VQN S;  3BF4 A;  3KK1 A;  2Y8W A;  3U02 A;  2HGM A;  3DLE B;  4FXV A;  4LF4 F;  2P6T A;  3UNY A;  2PDA A;  3OL8 A;  2DHX A;  3OXF A;  3TNV A;  1MML A;  2DY1 A;  1NO8 A;  2KI2 A;  3LPE A;  4JI5 F;  1LWC A;  2LCW A;  3DLK A;  2Y1J A;  2XGQ A;  4ZOS A;  4AD6 A;  2IJR A;  3PM9 A;  2I9S A;  4DX5 A;  1KQG B;  4KBI A;  1WKL A;  3ENW A;  3G4S S;  4ZCM A;  1WHY A;  4ID8 A;  1PAU B;  1VQY A;  2CDQ A;  4ZPV R;  3PAC A;  4FN5 A;  2CG4 A;  5K14 A;  4U9R A;  4IFV B;  4K2J A;  3RB6 A;  1Q53 A;  5GAG I;  2GVZ B;  1TKT A;  1XBW A;  4Z2X A;  3PZP A;  2B4O A;  2UUC J;  1JK9 B;  5LJ3 Y;  4MJK A;  4P71 A;  3KUG A;  2RDJ A;  4LF7 J;  1AFI A;  2V67 A;  1F5C A;  4LRC A;  4LUB A;  4CM0 A;  1RWV B;  2BKO A;  3G9C A;  1UEV A;  1C1B A;  2KDO A;  5HMY A;  5E3P A;  2BKN A;  1AZS A;  4P2X A;  2WAQ D;  4I2Q A;  1ZAX A;  2ZWP A;  3FKB A;  3G86 A;  1B64 A;  1XNQ F;  3W64 A;  2ROE A;  3D6H B;  1VS3 A;  4A8M P;  1IN0 A;  4CCH A;  1PYO B;  2XCP A;  2B3T B;  4YQW A;  4YB1 P;  4C3M A;  1VK3 A;  3N9U C;  1X0F A;  2O66 A;  4KGM A;  3NMA A;  2ZNY A;  5GAH I;  4DR4 F;  4J90 A;  2MKS A;  1WDT A;  3KOA A;  1LQ9 A;  1ZTT A;  2UVU A;  4A8X A;  1RWW B;  4P2M A;  4N41 A;  3MM8 A;  5IFM A;  1XNR F;  1SUQ A;  3J80 Y;  2IJF A;  4C0O C;  1VK8 A;  4ZPB A;  2W4D A;  3T9Z A;  1JLE A;  4CH7 A;  2LDY A;  4QW8 A;  2LU2 A;  5KTQ A;  2Q43 A;  4PQU A;  5KFH A;  5HLF B;  1REV A;  2QG9 B;  2R7U A;  5E3R A;  5EUH A;  3M8Y A;  1DTT A;  3CJ3 A;  3RB4 A;  4OI4 A;  5B0F A;  2DR7 A;  4HL9 A;  1RYR A;  3DNC A;  1SC3 B;  3MD1 A;  2BJE A;  4M5H A;  2WBM A;  3D0I E;  4TKT A;  1DLO B;  4LRA A;  3JB9 k;  1V9O A;  1WI8 A;  2MB0 B;  2FHK A;  4PKD B;  3DLG A;  4ZLP A;  4LQ9 A;  1U7L A;  3H59 A;  2R8K A;  2DH9 A;  4JYA J;  1RHR B;  5HMW A;  3PW2 A;  4DLE A;  3M32 B;  1YIT S;  2NQP A;  2ZVI A;  1Z2Z A;  4H4K A;  2Z0G A;  3Q8Q B;  4DR2 J;  3CJ0 A;  4DL3 A;  1IBC B;  3T5H A;  4RW7 B;  2QA4 G;  3BEG B;  5J1P A;  4EI2 A;  1SKS A;  5B08 A;  5F8G A;  3LA0 A;  4EBE A;  1U6B A;  3T1H J;  4B02 A;  4KH1 B;  1NJW A;  3WIU A;  4Z7C A;  2RU3 A;  2JDJ A;  4I69 A;  2ZUA A;  3KUH A;  4ZVR B;  4DFK A;  5MLC V;  1SH3 A;  3V4I B;  3CJK B;  2HBR B;  1YGY A;  1O0P A;  1IJF B;  5GAE I;  4HTJ A;  4X62 J;  1RWU A;  3I5B A;  1JJ4 A;  3GU0 A;  2IA0 A;  4QYR A;  4KC5 A;  3K5N A;  1NK8 A;  3D28 A;  4DL5 A;  1WC5 A;  3RTV A;  1HFE L;  3VAJ A;  2IVY A;  1EIY B;  3OUY A;  3OTD A;  1GEH A;  4G1Q B;  3CTR A;  2RNE A;  2V2V A;  5IT9 U;  2AV5 A;  3DOM B;  5BXI A;  2LEC A;  1B7F A;  1EQM A;  3AOC A;  3IM8 A;  2G9O A;  2ZC4 A;  1X31 C;  3QIP B;  3JQJ A;  1H98 A;  1SKU B;  5KFV A;  1SJ3 P;  2PMH A;  2ACM A;  3SSS A;  3ZTS A;  2W1B A;  4LF4 J;  4B3O A;  2GGP B;  4NLP A;  3MM5 A;  2AJ4 A;  4AFF A;  4JI5 J;  4ZPD A;  4CO0 A;  2VDI A;  4PAB A;  5L39 A;  1R8A A;  1VC0 A;  3M6U A;  3T5L A;  4B9N A;  3A8I A;  1TUV A;  4G65 A;  3TAR A;  2AGO A;  4ZVT B;  4P73 A;  3GIK A;  5ETM A;  2OHD A;  1RE1 B;  1RTH B;  1U49 A;  5F9N A;  2OD4 A;  2MHN A;  1A9N B;  1TUW A;  2WTF A;  2XMW A;  3NCP A;  2FVC A;  1PGZ A;  3KLV A;  1TR0 A;  2N3O A;  3CO9 A;  2FHO B;  2D7S A;  2PE8 A;  3ZZT A;  4MK7 A;  3OFE A;  3HT3 A;  1RT7 A;  4Y3C A;  1U4B A;  4I6W A;  3MED A;  4QWB A;  1F5A A;  1DTQ B;  5F3Z A;  2F9J A;  2WVB A;  3DU6 A;  4LSN A;  1WC6 A;  2D3Z A;  4GKJ J;  2CQ1 A;  3I0R B;  4LFA F;  2A1B A;  5DG7 A;  4IYQ A;  3AOB A;  5AXL A;  2XI3 A;  2M70 A;  2BVZ A;  5IQ6 A;  4CLT A;  4K4Y A;  4OHW A;  1Q7L B;  3CJQ A;  3MTK A;  1XNQ J;  1NB2 A;  5KT4 A;  3J81 j;  3S1T A;  1HBU A;  4O44 A;  1S1X A;  1IKX A;  4J9K A;  4WFA Q;  2VFR A;  1WC4 A;  3QWP A;  4ILR A;  4CO1 A;  2QRR A;  4J9S A;  3D6F B;  2CPE A;  4DR4 J;  2ZUG A;  3LPY A;  3B6B A;  4M8L A;  3J7A N;  5DET A;  3N0V A;  2E44 A;  2YWF A;  4CIO A;  3EPG A;  2V5H G;  2QJ3 A;  4UZB A;  1XNR J;  1EZZ B;  3M30 B;  3DU5 A;  1QTM A;  5L8R C;  9ATC B;  3P5B P;  3PEH A;  1IR0 A;  1BXN A;  3AFG A;  2ZBQ A;  4H4M A;  2H3E B;  1LK5 A;  3FBB A;  4R25 A;  1MSW D;  2DNQ A;  2AGP A;  1U45 A;  1X4D A;  2MST A;  4C97 A;  2VFV A;  3HFK A;  2HVE A;  2CUY A;  3W2W A;  2HZA A;  3UCU P;  2M52 A;  2KFY A;  2OPP A;  3OJS A;  2KT3 A;  4NPO A;  2XS2 A;  1FE4 A;  4UST A;  3HSG A;  1FDD A;  2DNZ A;  3PTW A;  4N8N A;  2POK A;  3MR3 A;  1V5V A;  3ZZZ A;  4O3S A;  2IIH A;  3MWB A;  2HWI A;  4K4X A;  4ES1 A;  2NCK L;  1ZAW A;  2MKI A;  2CAJ A;  3FEX B;  1WF1 A;  2CQ0 A;  5E41 A;  1GXL A;  1URR A;  3HJF A;  2N4D A;  4M5K A;  4DU7 A;  1TV6 A;  3R5G A;  5KG3 A;  1QVG R;  2GJ2 A;  3BJY A;  1H3D A;  1UWB B;  2K8G A;  3N5F A;  1ZM2 A;  3M8Z A;  2HQ3 A;  1UFL A;  5K8N A;  4J9L A;  3E01 A;  1MWY A;  2E29 A;  2DXE A;  5DO2 A;  4NMX A;  4KKO A;  2CJY B;  3OVB A;  1QAX A;  1AT1 B;  4B9S A;  3W7B A;  3VGU A;  1FXD A;  1UJ4 A;  3N6N A;  3OTC A;  1R8C A;  1XTZ A;  5EHH A;  3W1Y C;  5J1E A;  3LTO A;  1WOS A;  3J7Z 5;  2Q6C A;  2PEH A;  2J7W A;  3AT1 B;  2F5G A;  4ECT A;  2CJA A;  1QSL A;  2RVJ A;  5LJ5 Y;  5AE1 A;  2AD9 A;  4NRU A;  1EKR A;  3R97 A;  3GIJ A;  4A8O A;  2D3O 1;  4KB7 A;  3IAS 9;  2B7B B;  1HHS A;  1Q5Y A;  3EMT A;  1WEX A;  2PGC A;  3MI7 X;  5EX3 A;  3CCE S;  3CUN A;  1WG5 A;  1ARO P;  1XK8 A;  2BJ8 A;  3KDO A;  5J2P A;  2J7K A;  4V19 X;  2OEL A;  3QNW B;  1JLA A;  3KJF B;  2CDR B;  4G3I A;  4KRW A;  3W60 A;  4ED5 A;  2C22 A;  1TQL A;  4UOC A;  2XMV A;  1N33 J;  4M63 A;  3VZH A;  4NE9 C;  3V6K A;  2QYC A;  4LF1 A;  2DR6 A;  1WKK A;  5KT5 A;  1XR7 A;  1LW0 A;  1U24 A;  2RSQ A;  4DSJ A;  4BLG A;  4HDH A;  3WC2 A;  2HND B;  3Q83 A;  4CO5 A;  4OYX A;  3GB0 A;  3BV8 A;  4DSE A;  2W2N P;  3X3U A;  2IYI A;  4UUW A;  2DIT A;  4F0M A;  3OLA A;  3LO3 A;  2ZBI A;  1RJJ A;  4IO1 A;  1NBE B;  3CDB A;  1B4S A;  3PY8 A;  1F60 B;  4TYA A;  1UFK A;  2OFH X;  3HHL D;  1ZBT A;  4UQT A;  2B9E A;  1S6Q B;  4YUD A;  1RLC L;  1C0T B;  2OP5 A;  2B56 A;  1MMD A;  2GIR A;  4TNO A;  3NBP B;  3HDS A;  4TVA B;  4P6Q A;  4L72 B;  1Y9O A;  2QGF B;  4DPW A;  3MCS A;  4P2S A;  4LFA J;  4O0N A;  1R6V A;  2AGQ A;  2CQB A;  3OL6 A;  5KFC A;  1CSJ A;  4NLX A;  4X4P A;  4P75 A;  2Z2Z A;  2IM2 A;  3TJA A;  4Q8F A;  1YBA A;  3AH6 A;  1S1W A;  4BC9 A;  4ID5 B;  3ETM A;  3NAH A;  4ATN A;  1T05 B;  1KTV A;  3RU0 A;  4V1A k;  1O8B A;  1RAE B;  1Q81 T;  5CQG A;  4H54 A;  2C2D A;  2FHJ D;  5CZX A;  2LA4 A;  4J9P A;  3W9J A;  1CJT B;  3FEZ A;  1DAR A;  2M7S A;  1WTB A;  8ATC B;  5HBM B;  2DTJ A;  2VUG A;  2J0X A;  5HMX A;  1JX4 A;  4XDC A;  1IKY B;  3PX4 A;  3HHL B;  2BE2 A;  4HH1 A;  2V50 A;  3IRX B;  1OY6 A;  5T7L B;  4NLS A;  3H40 A;  4TY8 B;  3QLH A;  2NZC A;  1KBR A;  2DNL A;  5CCL A;  4Q45 A;  2X1B A;  4NYZ A;  2VQF J;  1NH8 A;  3MOZ A;  3M6V A;  3MM9 A;  4HHU A;  1RAB B;  1R0C B;  3SCJ E;  3A3P B;  4OJG A;  2Q66 A;  4ZIW A;  1MRO B;  1X4B A;  1LWF A;  5KG7 A;  4YR2 A;  2XBP A;  3CSK A;  5L9N A;  4ZA1 A;  4IH7 A;  4C2M A;  2H5E A;  1U47 A;  5A2Q Y;  4IFY A;  1KHV A;  4WK1 A;  2HFS A;  3CIZ A;  4M94 A;  3NGR A;  3QBC A;  3K89 A;  4I7F B;  1S9E B;  2DRD A;  4YB6 A;  2IMW P;  3AQO A;  2JOQ A;  1IKV B;  3SQG B;  1YZ7 A;  5L46 A;  4Y34 A;  4Y2I A;  4XDD A;  1RT1 A;  2H4W B;  2OSR A;  2GX8 A;  1WHW A;  1RHQ B;  3VVT A;  4E8U A;  4C8M A;  2HHV A;  1PKU A;  1T8E A;  3GYG A;  3CDU A;  4IDK A;  4CLL A;  1HWL A;  4KQZ A;  3MTJ A;  3RG6 A;  4DL4 A;  1E6V B;  4CLY A;  3H2V E;  4RUH A;  3T6B A;  1B7Y B;  3DGP A;  1U8S A;  3BBB A;  2DHS A;  2QZ8 A;  3HLU A;  2DGX A;  4OHZ A;  3FSX A;  4CLZ A;  5B0G A;  3C2P A;  2VBZ A;  4QIW D;  1FXR A;  3UWT A;  3OSN A;  2GIQ A;  2VQE F;  4EEY A;  3H5U A;  3IGN A;  2K06 A;  3O1L A;  1FTR A;  3NGS A;  1VQ8 S;  4I67 A;  5AE2 A;  1TL1 A;  3QQC D;  2MQQ A;  4P52 A;  2OPR B;  2DH8 A;  4C98 A;  1WF2 A;  2HQC A;  1FD8 A;  2GQ2 A;  3HHN B;  2RRN A;  4EBC A;  1HPZ B;  2LLZ A;  1RBL A;  5GAD U;  4DSI A;  3B78 A;  5B0D A;  5KOX A;  4DR5 F;  4RNO A;  4FKX A;  4ZDN A;  3HD1 A;  3M2R B;  3OQ2 A;  3OXL A;  4F3M A;  4FKY A;  2YH0 A;  4O4G B;  2ZH2 A;  2VBX A;  1CPZ A;  2GHV C;  3JTP A;  4EZ9 A;  5DZ7 A;  5L1L A;  1VIX A;  1VFJ A;  1HQ2 A;  4CH1 A;  2AEM A;  4MKY A;  3P8B B;  2HMI A;  1NSK L;  2ROG A;  3BYP A;  4GVL A;  1U0H A;  2ZNZ A;  3MMB B;  3CCU S;  4ILM A;  1GT8 A;  2ADC A;  1IKW B;  1JLC B;  4DEZ A;  2RS2 A;  2V63 A;  3AXM A;  2PA3 A;  2ZBC A;  4YN3 B;  3V81 A;  3PW5 A;  3R3T A;  1RHK B;  1AXQ A;  3UCG A;  1RB0 A;  1QJH A;  3CJT A;  3D2W A;  4WII A;  1UMJ A;  3S8S A;  1L3K A;  2DK2 A;  2FLO A;  2KYX A;  4AUK A;  4YB7 A;  4DCO B;  1S9G B;  1D9F A;  4LIR A;  4ZP9 A;  2L9N A;  2FJD B;  4DV4 F;  3NGT A;  2FQQ B;  3UDE A;  1V5I B;  3W8G A;  3GSI A;  4PXD A;  1X4E A;  4NZ7 A;  2JFD A;  3PRV A;  4N47 A;  2GVD A;  5KG6 A;  4FS1 A;  1KWM A;  5T14 A;  1HQE B;  2NSB A;  4L6V 3;  5D8H B;  4LMZ A;  2Y3Y A;  4ZK7 M;  3OTE A;  1G1X A;  2OPS A;  1UVL A;  2B8Q A;  2NRE A;  2YNF B;  2E66 A;  4QIF A;  2Y8Y A;  5CH7 B;  3DRR A;  2DR9 A;  4P72 A;  3GIM A;  2BJ7 A;  3CCQ S;  4EO6 A;  1TL3 B;  2OFG X;  3I31 A;  3PKY A;  3FSI A;  1HI1 A;  1KFS A;  1RBO B;  1MMN A;  3MMJ A;  6FD1 A;  1BUX A;  3NGD A;  5A0Y B;  1RT2 A;  2BE9 B;  3R7S B;  2HNY B;  3KLF B;  3CDE A;  1RWX B;  3SMZ A;  4CNZ A;  2E1C A;  4RNF A;  2PSZ A;  3G8T A;  4PYA A;  2IC3 B;  5KFE A;  3RRK A;  3A8E A;  3BGU A;  5EWG A;  3PIO Q;  4ICL B;  3MPU B;  3LP2 A;  5ETS A;  3ETO A;  1RAD B;  3VAF A;  3W5Z A;  4RZR A;  5JVG Q;  3C14 B;  1V3Z A;  5JMN A;  2MQO A;  4JI4 J;  3JAM U;  3FMB A;  5C25 B;  1N5Y A;  1VQ9 S;  4FF3 A;  5KFR A;  3UN2 A;  1HBN B;  3MR5 A;  1R8P A;  2DNO A;  1UZH A;  5E2Q A;  4EZ6 A;  2ZZN A;  4CM2 A;  2E9R X;  4QIG A;  2JZ5 A;  4C3K A;  4F4K A;  2E1M C;  1X9S A;  1SJF A;  4I6Y A;  4NA2 A;  5KG2 A;  2KXN B;  2I5J B;  1RAJ A;  1H6K X;  2N3L A;  2X1G A;  1E6Y A;  5RUB A;  3QFH A;  4ETX A;  1B0P A;  1UVM A;  3UFC X;  1BY9 A;  3TI0 A;  1J27 A;  2CPY A;  2FZG B;  5DQH A;  4UY8 T;  1I6J A;  2L48 A;  4D3G A;  3M8Q B;  4ZIT A;  3DHW C;  4WK3 A;  2GC8 A;  2QN6 B;  1S0M A;  4OYI A;  4ZP6 A;  4OI1 A;  2XC9 A;  3NP5 A;  1NUE A;  1WC3 A;  3M2V A;  1DQ9 A;  2BAN B;  2VQE J;  3JSB A;  3V4M A;  2AYG A;  4CLF A;  4C3L A;  4DPT A;  2W9B A;  5D4N A;  2HPU A;  5D6G A;  2MQP A;  2ZZT A;  5ETQ A;  2OUG A;  4WKY A;  1VC5 A;  1FDA A;  1UVJ A;  4F8R A;  1U1P A;  2GMH A;  2C3U A;  4AT1 B;  3DGV A;  1RA7 A;  3TVY A;  2EFV A;  1ZTW A;  2MTL A;  4W92 B;  1Q8K A;  3CD5 A;  3FFI A;  1Z4U A;  3TUZ C;  3RB3 A;  3PKM A;  5KFD A;  3C15 A;  1VGY A;  2DYA A;  2UVW A;  4CDI A;  1S49 A;  4Y65 A;  2ZJR Q;  3TYT A;  4ZCL A;  2ASD A;  3P6Y C;  4CP5 A;  4DR5 J;  5GMD A;  3KK1 B;  1T9T A;  1K8A T;  3D1O A;  5IOL A;  5IC4 B;  3RW6 A;  3BSA A;  2FYX A;  5E7O B;  1NU4 A;  2XLK A;  3LWM A;  1VQO S;  1LWC B;  1VRT A;  2YWK A;  1S48 A;  3DLK B;  2LQ9 A;  5KFF A;  2ABY A;  1HBO B;  4IKA A;  2J9D A;  2DIU A;  5CA5 A;  5K14 B;  1FWL A;  1TKZ A;  1S1U A;  2ZH4 A;  3W2V A;  2ILY A;  1TKT B;  5M2U A;  3FCW A;  4JV5 F;  3BQ2 A;  1X4H A;  3OR1 B;  4USM A;  4X66 F;  4O3R A;  9RUB A;  4DG1 A;  3F73 A;  3ZZU A;  1H7W A;  1QUP A;  4Q5V A;  7FD1 A;  2XY5 A;  4ZPA A;  1C1B B;  3TQE A;  2YVS A;  1AZS B;  4BBY A;  4A8Y A;  4UQG A;  2GML A;  2DH7 A;  4QOT A;  3RBZ A;  4J9U E;  2QFI A;  1VJW A;  1BMQ B;  3M8R A;  1H2T Z;  4I2Q B;  1L3U A;  4QWD A;  8AT1 B;  2FPH X;  4WKR A;  4ZS6 A;  1HMV A;  1QTN B;  4OYO A;  2Z2M A;  1JXV A;  4F3Q A;  5KFS A;  3Q23 A;  4AL5 A;  4USK A;  1SCJ B;  2ALY B;  1XER A;  2PMW A;  3ITH A;  4V19 J;  4R5P A;  3VZI A;  3FSY A;  1HR0 F;  2BOP A;  3DOL A;  5DG9 A;  1U1Q A;  1F6T A;  8RUC A;  1U2C A;  1HNX F;  2FGC A;  3ZZO A;  3U1M A;  3LAM A;  2MDA A;  5DM6 Q;  2I8E A;  2RF2 A;  2FC9 A;  5AT1 B;  3JSR A;  1JLE B;  3G6X A;  1ACM B;  3THT A;  4PQU B;  1REV B;  1HNZ F;  2M5Y A;  4HEA 9;  2VFS A;  1DTT B;  1EP4 A;  3J80 U;  2YQ3 A;  2B4V A;  3UR3 C;  1UET A;  3CCV S;  2K2P A;  1S57 A;  3QSY B;  2B7C B;  4CT9 A;  4OJH A;  2HSE B;  3H5X A;  4DSF A;  2MKY A;  1REG X;  4XAK A;  2KKH A;  2XZD B;  3MFI A;  1SL2 A;  3MXH P;  2A0F B;  2W9C A;  1VBX A;  1Z2L A;  4A48 A;  5L9X A;  2YBV A;  3FGV A;  2CQ2 A;  5I3Q A;  2BW2 A;  4HT7 A;  1Q95 G;  5ETL A;  4ENO A;  1N6Q A;  4B9V A;  3B8H A;  2OMO A;  4OI0 A;  1BQN B;  2MKC A;  2ASY A;  5ETR A;  4HKQ A;  3A1Y G;  4P7T A;  5DDQ C;  4C8Y A;  2MPU A;  4PYD A;  3FQK A;  4QU7 A;  4A4J A;  4TLR A;  1FHT A;  1N4L A;  3BDP A;  1WEL A;  5KFK A;  2WVD A;  4OMF G;  4U7U D;  2H5J B;  4OX8 A;  4I68 A;  4Q2L A;  3LW5 C;  3OVS A;  1FDN A;  3H20 A;  1X5P A;  7FDR A;  4Q43 A;  1OSD A;  1S1V A;  2IAJ A;  4NRT A;  2AJ0 A;  1MN7 A;  1CEZ A;  2Z4P A;  4ELU A;  3P96 A;  3MM7 A;  4MFB A;  2UXD F;  1VC6 A;  3LAL A;  3EGV A;  5LSL A;  2CVE A;  4ED0 A;  2HQF A;  2DRA A;  4ECU A;  2XEX A;  2HYI B;  2YY3 A;  1FJE B;  1V3R A;  2VL1 A;  3DM2 A;  4DS5 A;  3A8K A;  3Q24 A;  1Y7P A;  4AE5 A;  3A8J A;  1HL6 A;  4DR7 F;  4Y6I A;  2HVH A;  3MMC A;  1RP5 A;  1EB0 A;  4PCQ A;  3W8P A;  1AUS L;  1R7I A;  4PXB A;  2QIF A;  4KTQ A;  3OUY B;  1C4A A;  2V2K A;  4FZV A;  4NX9 A;  5HQ8 A;  4LRB A;  1NDK A;  2HVZ A;  4YEA A;  1IUJ A;  3PFO A;  1TL7 A;  2P5V A;  1HA1 A;  2OSQ A;  2N4C A;  2P8I A;  3GTY X;  2ZHO A;  1RSC A;  5EDW A;  3IRW P;  2AJ2 A;  1WEY A;  4B3O B;  4IR9 A;  3MM5 B;  1D09 B;  2FY8 A;  1QY7 A;  2B5J A;  1P1L A;  3QRP A;  3SXL A;  2YH1 A;  4X4R A;  2J7U A;  5KT3 A;  3T5J A;  1Q16 B;  3KG0 A;  4MIB A;  3D3B J;  3FC9 A;  2D69 A;  1TMJ A;  4ED2 A;  1MWZ A;  4ED3 A;  1HD0 A;  3MR6 A;  3OHB A;  5KFQ A;  1KTQ A;  1N48 A;  2C2O B;  5KG0 A;  2RUS A;  2MLZ A;  5D77 A;  2AF6 A;  4X66 J;  1RHM B;  3DI6 A;  3EXC X;  2FGO A;  3GYX B;  2ZDP A;  4XPE A;  4X65 F;  4MH8 A;  1GK8 A;  4ITS A;  4UTG A;  1DJ0 A;  1HYS A;  2K1R A;  2GQC A;  5DG8 A;  3MED B;  2HFV A;  1K47 A;  2HS0 A;  4W90 B;  1U02 A;  5KOW A;  2BKP A;  3C16 A;  4LSN B;  3TOQ A;  3GII A;  1X4G A;  2G0I A;  2B6A A;  1W26 A;  2RD5 C;  4DJB A;  2YQ0 A;  3BKF A;  4OV1 A;  4CTA A;  1IBM F;  3X1L B;  2UP1 A;  5IT0 A;  5KFI A;  2OGU A;  3NWR A;  3CCW A;  1C1C A;  2J8S A;  3TVK A;  2VON A;  1KEK A;  3H4D A;  1B3T A;  1HBU B;  3BGO P;  4O44 B;  1SKR A;  2LU1 A;  1IKX B;  1VQ6 S;  3KKF A;  4PG8 A;  3JQM A;  2Q6B A;  2PN6 A;  2DO0 A;  2ATC B;  3TUJ C;  3K7R A;  1HR0 J;  2AU0 A;  1NDP A;  2M88 A;  2ZD1 A;  2OJ3 A;  5HAT A;  2HFU A;  1N56 A;  4DL0 C;  2R7O A;  1HNX J;  1FWP A;  4DR3 F;  1WG4 A;  2OD6 A;  3VCD A;  2O5D A;  3TUI C;  3EUN A;  2V8H A;  1KD1 T;  1K0T A;  1J5O A;  3LUY A;  4H4M B;  3H98 A;  1S1T A;  3BN7 A;  1RA6 A;  1HNZ J;  2E5G A;  1Y00 A;  2YKO A;  4Z37 A;  3G2X A;  4IG3 A;  2BRK A;  5C7P A;  1PO6 A;  2FJE B;  3W2W B;  1YVF A;  2YNG B;  1M5S A;  3N4W A;  4ZVF A;  3I55 S;  2OPP B;  2VFT A;  5C2C A;  4USW A;  3OFG A;  3KMQ A;  3QSI A;  4BCA A;  1NHU A;  2NUU G;  3H5S A;  1TK5 A;  1RK8 A;  4DQP A;  5SUH A;  2PI4 A;  2LQB A;  1KNZ A;  3QZ7 A;  4CLP A;  5K9F A;  1ZPW X;  2FZK B;  3R27 A;  2AEJ A;  1KDN A;  1FRL A;  2ZJQ Q;  2WSE C;  4G6V B;  1FRI A;  4KIA A;  1N52 B;  1YHQ S;  3L3C A;  2W24 A;  1LFP A;  1S6P A;  4LVN P;  2XI2 A;  3E01 B;  4KPC A;  3ZZY A;  4K4T A;  4IOC Q;  1RTZ A;  4ZN1 A;  2CWK A;  3LGM A;  5HVG A;  2E5H A;  4KKO B;  3NOG A;  1TKD A;  4OYA A;  4ED4 A;  3V6H A;  1F9E B;  3SIP B;  1SIW B;  1TFW A;  2VJV A;  3FQL A;  2R7R A;  3O44 A;  1M1G A;  5J1E B;  2UXD J;  3TAM A;  3H25 A;  3T19 A;  2FVS A;  5KFZ A;  1QAJ A;  1SQE A;  5BYQ A;  4F4W A;  4NEZ A;  3NEK A;  2HRY A;  1ZAV A;  3LAN A;  2DXF A;  3QGH A;  4TLQ A;  3EE3 A;  4PG6 A;  2DNP A;  4UOF A;  4TU8 A;  1J2V A;  4Y28 C;  3R6L B;  2HLT A;  3CIM A;  1JNR B;  4KV8 A;  2IY5 B;  3MEE A;  2HHX A;  1RHJ B;  2BJD A;  2B0G A;  1NJZ A;  4DUZ F;  3NL0 A;  2E5L F;  5FDL A;  2PI5 A;  2V2Z A;  5JXS A;  2PEB A;  3FBC A;  4IH6 A;  4MMO A;  5GAG U;  5F3T A;  1NPP A;  3UE2 A;  3KJN B;  4I2P A;  2VOO A;  4AXJ A;  4X4U A;  3EWG A;  1D8Z A;  5LOQ A;  3ILO A;  5HRO B;  1GMV A;  3P5T L;  3MAQ A;  1LW0 B;  1RT5 A;  4B3S F;  2E1A A;  3GV8 B;  5A6P A;  1U2R A;  2R7X A;  3Q2S C;  4ZHR A;  4DHV A;  2ZHB A;  3AD8 C;  2VG7 A;  4J9R A;  3CWJ A;  3IO1 A;  3IG1 B;  2KL8 A;  3IP0 A;  4LF8 F;  3MF5 A;  3CJ4 A;  3D3C J;  1Y5L B;  3RR8 A;  2OEJ A;  4TY9 A;  3HF5 A;  1XEZ A;  3QWU A;  4ALZ A;  1AYE A;  3TA1 A;  2WW4 A;  3IWX A;  4HI1 A;  1UA1 A;  2HZC A;  1KP6 A;  4X65 J;  1FDB A;  3G8S A;  4QIE A;  4NXM F;  2OTJ S;  1F1B B;  2I38 A;  1OQ3 A;  1W2I A;  2E9T A;  4K59 A;  3I96 A;  1T94 A;  1HQU B;  5GAH U;  1H7X A;  2RUG A;  2ZH9 A;  1URN A;  4F25 A;  3WIV A;  2BE7 D;  1S76 D;  3C66 A;  4DUY F;  1RWM B;  1IBM J;  5D4P A;  4JI0 F;  1N5V A;  5AXM A;  4LBH A;  2JHE A;  1JJ2 R;  3I4P A;  1TFY A;  2CFX A;  2YKP A;  3VWS A;  2FJB B;  3EJM A;  3QJJ A;  1HLW A;  1QSY A;  5KG5 A;  4PPD A;  3WX4 A;  1C2P A;  2AZ3 A;  5LMN F;  2JVR A;  3WX8 A;  3ZZR A;  3B4D A;  1JWW A;  2BE2 B;  1WC1 A;  2V8G A;  2HEK A;  3ZNJ 1;  2YWG A;  4KGX B;  3C46 A;  4OYW A;  3OLB A;  4IRK A;  1XMQ F;  1KR4 A;  2VAS A;  4NXN F;  3MM9 B;  1QVF R;  1RUS A;  3E2E A;  1LW2 A;  2FIU A;  4RU9 A;  4MT1 A;  3TO8 A;  3UDL A;  4EUV A;  1VQP S;  2KFN A;  1JLG A;  1MNE A;  2QLB B;  4KO0 A;  2DT9 A;  1B99 A;  1BE4 A;  4LQ3 A;  2H1Y A;  1Y3J A;  2OEM A;  2OML A;  2BQU A;  1W7W A;  3KHG A;  2R8I A;  3GIL A;  3C6T A;  4UZC A;  5F8H A;  1WHX A;  1FK9 A;  3M8S A;  1ZM3 A;  5GAE U;  2QE5 A;  3HSD A;  1IJE B;  5K20 B;  2XMK A;  4A8F A;  4ECR A;  2EPI A;  1FX2 A;  1T03 A;  1WF0 A;  5K8P A;  1DUR A;  2V0N A;  2WBR A;  2ZEJ A;  2HNZ A;  3O2I A;  1RT1 B;  2R8H A;  2XSF A;  3CMA S;  1TMM A;  4DQR A;  3W62 A;  1RIS A;  1IWG A;  1NM2 A;  4FVM A;  1RT3 B;  5HP1 A;  4IDK B;  3HT0 A;  2RAQ A;  4CLW A;  1RAG B;  2JEF A;  4NA1 A;  1SJ4 P;  3PCO B;  1U1M A;  2QA4 S;  3MEK A;  3DGP B;  3HHE A;  3CW2 C;  2Z2L A;  3TEG A;  4ANE A;  4K0K F;  4ILL A;  1VQ7 S;  3KK3 B;  1YJV A;  4YS2 A;  4RL1 A;  2ZM6 J;  5KFB A;  4ELV A;  1TAU A;  5LL6 d;  2QEX S;  1WWH A;  4DQS A;  1FEE A;  1M5H A;  2HHP A;  4ZVS B;  2WSC C;  3UO0 A;  1TL1 B;  4UOG A;  3MGJ A;  2HHT A;  1CJU A;  2ZH7 A;  1NK4 A;  4Z7Y A;  3KJV A;  4CWB A;  1WEZ A;  2YPZ A;  3KUE A;  1DLO A;  2AJQ A;  3TJ8 A;  2NXN A;  2CNK B;  3AA9 A;  2W8L A;  4ELT A;  1Q8B A;  3CDA A;  3UVJ A;  2R7T A;  4FNI A;  4TU9 A;  1SJQ A;  3TRG A;  4B3S J;  4O3Q A;  3I0S A;  1TL4 A;  5GME A;  2KZZ A;  5H1S V;  4F26 A;  2UUB F;  4NCA A;  3B54 A;  2RIL A;  5LSR A;  2F40 A;  5FD1 A;  5D0G A;  1H0H B;  4USV A;  5BYS A;  1VR6 A;  4O0I A;  1WDD A;  1XN9 A;  3ADA C;  3CCM S;  3LP1 A;  3NKY A;  4LF8 J;  3UN5 A;  1GTE A;  3OSP A;  2LQ5 A;  2C42 A;  2V6A A;  2CZV C;  1WSV A;  2HMI B;  3AOA A;  5HMZ A;  2DRB A;  4DV2 F;  1U0H B;  1U0S A;  4NXM J;  4F3O A;  3S01 A;  2MJN A;  2OAU A;  3T1H F;  1QUV A;  2XMA A;  1FVQ A;  3DLJ A;  4JV0 A;  2GHP A;  5EN1 A;  3KXD A;  1G4C A;  1RWK B;  2JRS A;  2HRU A;  3HFV A;  2HBY B;  4OFZ A;  3NY0 A;  4DUY J;  3V81 B;  3F0N A;  2W2O P;  1YSJ A;  2V4J A;  2P9G A;  4LSL A;  4G1Q A;  2ZFH A;  4PUO A;  4JI0 J;  1H2U X;  1HKA A;  2CKW A;  2C2K B;  3B4M A;  4IRD A;  3MPV A;  3DHX A;  3QIP A;  5J2M A;  3MUV P;  1UWA A;  5DRK A;  3NMR A;  5F8J A;  1I94 F;  4HT5 A;  2GGP A;  3J81 Y;  4NLY A;  2GVD B;  4DV3 J;  1KSP A;  4A8Q A;  3R6G B;  2DEI A;  3N28 A;  5ETV A;  3H2L A;  2DIS A;  4RW8 B;  2U1A A;  3NGU A;  4HH0 A;  1O5J A;  5KT6 A;  5KFO A;  3TVZ A;  2OPS B;  5LMN J;  1HNW F;  5IV3 A;  3NOC A;  1NRK A;  2J6U A;  3BGF A;  1UZD A;  4AND A;  2K3K A;  1N0U A;  2R7Q A;  4W4M A;  1FD2 A;  3ZC4 A;  4CLS A;  4EYI B;  3MDF A;  3BO3 A;  1XMQ J;  3D4J A;  4NOH A;  1WSR A;  3GG1 A;  3FZB A;  4NXN J;  1NCL A;  1KVI A;  2XUL A;  3BYR A;  3HO1 A;  4WJB A;  2IDE A;  3CJ2 A;  2WVF A;  1NKE A;  5F41 A;  2WK4 A;  2RDD A;  1HWK A;  1OY8 A;  4RPF A;  1JKH B;  2JSX A;  3I0R A;  2XMJ A;  5CAB A;  3CD6 S;  3THP A;  3GR1 A;  2EBG A;  2H9Z A;  2KU7 A;  3NG8 A;  4R8U B;  2NYI A;  4DQQ A;  1N5Y B;  1YQH A;  4QWC A;  4ED1 A;  2B4P A;  3NLC A;  4GKJ F;  3QGI A;  4E98 A;  2A6M A;  3N6L A;  3T6J A;  3LH2 S;  2MGZ A;  3ENA A;  2W2Q P;  4ZPC A;  1T02 A;  3TZZ A;  5KFN A;  2GS8 A;  1PJ5 A;  4IO9 Q;  1E6Y B;  2FVR A;  4U8V A;  4F0H A;  3VGT A;  3GE9 A;  3DXB A;  2UXB F;  2EEY A;  5IV4 A;  3VAH A;  3KLG A;  2AX1 A;  3KNG A;  1ZA2 B;  3CGI A;  3R5B A;  2KHD A;  5I42 A;  3ET6 A;  1YJ9 S;  2E1P A;  4K0K J;  4MIW A;  2I6W A;  3ZFV A;  1N5Q A;  4U67 Q;  4NLU A;  3M2V B;  3GYN A;  1FCA A;  1YG0 A;  4RW4 A;  2W9B B;  2ZOF A;  1MWQ A;  3QPI A;  4OZ2 A;  2MZT A;  4Y2M A;  2VDH A;  3JXO A;  1NK9 A;  4I1T A;  2BZ2 A;  2PMZ D;  2FTR A;  1I51 B;  2MYF A;  2RKI A;  4MK9 A;  3LF0 A;  5B0B A;  2COL A;  1CBK A;  3FFI B;  2F1F A;  4DV5 F;  1RI7 A;  1UJ6 A;  3AD9 C;  5L38 A;  1TUG B;  5KFY A;  1PJ7 A;  2DR5 A;  3RJM B;  1KFD A;  4O23 A;  2G0C A;  2F3J A;  5IC6 B;  5DM7 Q;  3HVT B;  1HW8 A;  1R6Y A;  2Y1I A;  2F4V F;  3WC0 A;  4P10 A;  2UUB J;  4RW9 A;  4N77 A;  5F0U A;  3GLJ A;  4MIA A;  4ECZ A;  2CPI A;  2BYC A;  1EAR A;  1FA0 A;  1A7G E;  3J7Y I;  5E33 A;  2A2C A;  4W98 A;  1HIY A;  5J1N A;  4FNH A;  2LQJ A;  1S0O A;  3MEG B;  2VKR A;  2CPD A;  2B4U A;  2M0G B;  4DV2 J;  2VBW A;  1FVS A;  1JLB A;  3PEJ A;  5KT7 A;  1TKZ B;  1S1U B;  4QWE A;  5F8I A;  4CNY A;  5KFP A;  4AYB D;  1TU0 B;  2M4M A;  5HO4 A;  3R5J B;  2L41 A;  2DO4 A;  4O3P A;  3EGN A;  2AMC B;  2HS3 A;  2JJ4 D;  1BC6 A;  2HQG A;  3QT5 A;  3EYZ A;  3BQ1 A;  1R8B A;  3KDN A;  2JFK A;  2QA1 A;  2YTC A;  2PII A;  1FKP A;  2FUG 9;  3IGV A;  4JI3 F;  2PC6 A;  3HVR A;  1RT4 B;  3Q89 A;  4PEO A;  4F50 A;  3W66 A;  1ZH5 A;  3VAI A;  2C2N A;  5B09 A;  2AJF E;  1I94 J;  1SH0 A;  3L7P A;  2O3D A;  4HHJ A;  3NXZ A;  1HMV B;  3D5M A;  4ES2 A;  3KLH A;  2E1R A;  4F2R A;  1LWE A;  1OO0 B;  1HNW J;  3SCL E;  1R43 A;  2L9D A;  2P2C B;  1D9D A;  3ITH B;  3HX9 A;  4FS2 A;  4R5P B;  2FJW A;  3DOL B;  5EWF A;  1N33 F;  4F04 B;  3R5A A;  3PR4 A;  3PO5 A;  4URQ U;  3SDE B;  4KHR A;  4PWD A;  1GTH A;  4PWU A;  1MN9 A;  1SC4 B;  3UW1 A;  3GV5 B;  2DXD A;  3Q8Y A;  2MJU A;  1NJI T;  2JEG A;  1P9Y A;  2QC3 A;  2VD3 A;  5A8W A;  4WPA A;  2DHG A;  5KT2 A;  1EP4 B;  2EXU A;  1MU2 A;  3HZG A;  1YJR A;  2XO7 A;  4ZCK A;  1X0P A;  2H65 B;  2QMX A;  1VHF A;  1F3V A;  3VAG A;  1YWX A;  4IH5 A;  1R89 A;  2E5I A;  4DV0 J;  3HP6 A;  3K5O A;  1HWU A;  3M9O B;  4WZM A;  3D67 A;  2W9C B;  3CME S;  3QJL A;  1JNZ B;  5CCM A;  4WBF A;  2YKN A;  2VPW B;  4GVB B;  2O1P A;  3UR0 A;  1RXO B;  1UA0 A;  3F41 A;  4UF4 A;  5A8R A;  4ZPT R;  3LAK A;  2Z30 B;  1UEU A;  4PXE A;  1CJT A;  2OLW A;  5DGA A;  2UXB J;  1SV5 A;  2K7J A;  2OIH A;  4OHX A;  3GJQ B;  1LKZ A;  4OX9 F;  4USJ C;  6AT1 B;  1ZZN A;  3HHL A;  2KRB A;  4OHY A;  1U2F A;  3VV2 B;  2XY6 A;  3PW0 A;  2YWH A;  3T5K A;  3IR6 B;  3Q8U A;  1FJC A;  2ZC3 A;  2IVM A;  1SIZ A;  3R5C A;  1HAR A;  5D4O A;  1S1V B;  3JTN A;  2IAJ B;  2XMM A;  3M6X A;  4TY8 A;  2CQ4 A;  2RJZ A;  1TKX A;  2NXC A;  5CXT A;  3ISZ A;  1KQF B;  5D0H A;  2F4F A;  5B0E A;  1MRO A;  2R3V A;  1T11 A;  1T0T V;  3CT9 A;  2V4Q A;  2HLU A;  1SVD A;  1VQ4 S;  2C3P A;  1NSQ A;  4Q2M A;  2WVC A;  2CZ9 A;  5KFT A;  1PC5 A;  4HR2 A;  1X9W A;  2E7X A;  2EFO A;  4IQX A;  2YWE A;  2VQF F;  4DV5 J;  4DLG A;  2ZOG A;  3TAP A;  1AW0 A;  1TL7 B;  3D6T B;  3MOJ B;  2MQL A;  3QAT A;  2IYG A;  1TK8 A;  1S9E A;  3DLL Q;  3CJS A;  3HK2 A;  3NRB A;  4AXI A;  4JP8 A;  3O5T B;  2F4V J;  2MHE A;  1IKV A;  3G6E S;  4RBU A;  1KVJ A;  3ILJ A;  3AA8 A;  4F4A A;  2B5J B;  3Q8R B;  3D54 A;  4QR0 A;  2DJW A;  2VOP A;  1U1O A;  4PAA A;  3MZI A;  2QMW A;  3R9L A;  2C2R A;  3VQS A;  3MHY A;  2WW8 A;  2FZC B;  1UP1 A;  1XC9 A;  1E6V A;  4YOE A;  3GFZ A;  1NEE A;  2KZM A;  1R0A A;  4CO4 A;  1LEO A;  2G1D A;  2NXE A;  2EW9 A;  1EJ7 L;  3MPY A;  2ERR A;  1TK0 A;  1OSC A;  4DX6 A;  6FDR A;  4RX6 A;  3DI6 B;  5HVF A;  3K5M A;  2GAG C;  4TQR A;  3GJT B;  4DMZ A;  5HJX A;  2J5A A;  1N32 F;  3W5Y A;  4RWW A;  4QPT A;  2FHM A;  1OWX A;  2ZBP A;  3D0H E;  3QRR A;  2VC0 A;  3C16 B;  3V5R A;  2NS1 B;  4JI3 J;  3IC1 A;  4NCG A;  1WJ9 A;  2OPR A;  2MEW A;  1CJK B;  2XSJ B;  4GRS A;  2KJV A;  4H4K C;  2JWN A;  4CLU A;  3ZTO A;  3EX7 B;  2E7W A;  4NWB A;  4KYZ A;  1M5K C;  1Q1K A;  5G4D A;  1M5V C;  4LRD A;  4RW6 B;  2GFF A;  3D66 A;  3HKW A;  4XIU A;  5DGB A;  3OTO F;  4OL8 A;  3QID A;  1KLM A;  4BS2 A;  5CZV A;  3AHP A;  3UPF A;  2CA9 A;  4LR7 A;  2B51 A;  2KHC A;  5C24 A;  4OQJ A;  3VVU A;  4EFA C;  4J9V A;  2B9X A;  2OPQ A;  4CQ1 A;  3KYL A;  4USI A;  4M1K A;  2HZV A;  3WHI A;  3TZY A;  3HD2 A;  4RBV A;  1UVK A;  1J5O B;  3EM1 A;  2I1R A;  1S1T B;  2MSS A;  2XG8 A;  2D1C A;  2GMJ A;  3C19 A;  2DGQ A;  3ZZ0 A;  2DEJ A;  2JNJ A;  2P9C A;  4M5D A;  2QMU B;  4IG3 B;  3Q0A A;  1IKW A;  1JLC A;  4B3T J;  2NXJ A;  2EBE A;  4R0J A;  3G96 A;  3N6M A;  1IBL F;  3QMQ A;  1YRT A;  2FY1 A;  2GO9 A;  4KFB A;  4WP8 A;  4KHM A;  4PG4 A;  4WWS A;  1PAE X;  1A6L A;  2HIY A;  3I6P A;  1TVR A;  3QYY A;  2BR0 A;  3EZU A;  5H9E K;  4DOZ A;  2HFO A;  2NYH A;  4B3M J;  2QA2 A;  3NS7 B;  3DN9 A;  4E2F B;  2HK3 A;  4OIX A;  2XGP A;  1S6P B;  2BX6 A;  4XTT A;  4OX6 A;  4JI2 F;  4LIW A;  3DRS B;  5JUM A;  1SC6 A;  4OX9 J;  2RH3 A;  5A76 A;  2JL9 A;  2GJI A;  3DFE A;  2IHR 1;  3CJR A;  3KG1 A;  3FZ2 A;  3PDN A;  3N01 A;  2J6T A;  3CMQ A;  1RTJ A;  4HLB A;  3BGR A;  1T9W A;  3OBI A;  5C42 B;  5ADZ A;  3TAM B;  2RQC A;  5GMK a;  4R0E A;  2QL7 B;  3PRD A;  2GNK A;  3SBM A;  1OMS A;  4K4V A;  1FER A;  1G7C B;  3FRY A;  1Q4R A;  2HNY A;  3H8Y A;  1ZZF A;  5AXK A;  3K17 A;  3KK2 A;  1XJW B;  1DAX A;  3I56 S;  4ZMM A;  4KV8 B;  2IC3 A;  3IR7 B;  2HS4 A;  3MEE B;  1N34 F;  4M5N A;  4PPZ A;  2VG5 A;  1S5Z A;  1VIS A;  1U1R A;  4Y2C A;  5FDL B;  4EMD A;  2MZS A;  3PYF A;  2YNI B;  4X4S A;  1Q8L A;  1FRM A;  4O4R A;  3OJU A;  4M5G A;  5C25 A;  1U1N A;  3OL9 A;  3M8P A;  2DNG A;  3WQP A;  3ISN D;  1GMU A;  3C3L A;  1L3S A;  2MY7 A;  3OV7 A;  5KFJ A;  1W25 A;  1Y3K A;  2QTW A;  1VQK S;  1K1S A;  1B0V A;  2I5J A;  2DNM A;  2BJ3 A;  4CO3 A;  4CYU A;  4RLE A;  1HHT P;  4Q8E A;  4JI4 F;  2KT5 A;  4OJ1 A;  1RTD B;  4ZHR B;  4GMK A;  2VG7 B;  2G13 A;  2Y1L B;  3BPD A;  2OKQ A;  3GFH A;  4RU2 A;  5DDO C;  3HM9 A;  2M8D B;  3NCR A;  4K4S A;  3M8Q A;  3MUT P;  4RUB A;  1BQX A;  1HNV A;  1BGX T;  3CB4 A;  4FVC A;  1BD6 A;  2CVI A;  1Q5V A;  1R0B G;  2VB6 A;  4ZVG A;  5LSO A;  4L74 A;  1UCN A;  1DZ5 A;  1PJ6 A;  1G3O A;  5EGY A;  1N32 J;  2YX1 A;  2CPJ A;  1VDH A;  1X4A A;  3T1A A;  1L3V A;  1KOO A;  1ZM4 A;  5EWE A;  1Q86 T;  2XB2 D;  4P2F A;  3BBC A;  2RB7 A;  2BXJ A;  2KVI A;  3T1Y F;  2EC2 A;  1O6X A;  5KAK A;  4ZVU B;  3M1V A;  2H4Y B;  3AB2 B;  2D9P A;  1EX8 A;  1S59 A;  1GNK A;  2Z56 B;  3WZ0 A;  3T3F A;  2RU9 A;  1JXE A;  5U47 A;  2XYP B;  2DGT A;  3PHT A;  2AHO B;  3QO9 A;  3OTO J;  2BM0 A;  4URG A;  4LRE A;  1ROF A;  4BHQ A;  3HHK A;  3IBW A;  4YDD B;  3JTO A;  4KJI A;  2A3J A;  3HKZ D;  3Q2T C;  5BR8 F;  5J2Q B;  1IXK A;  3BH6 B;  5LM7 E;  3G6V A;  4Y00 A;  1WG1 A;  4FF4 A;  5I3U A;  3Q86 A;  2XQC A;  3TP2 A;  4YFU A;  4OZ0 A;  4EO8 A;  3ULH A;  5HN0 A;  1DHM A;  1HD1 A;  1IR2 A;  2MQM A;  2FD2 A;  1ZM9 A;  1HHQ A;  1HBO A;  3G8Q A;  3RUB L;  3P45 B;  1I3O B;  2EFP A;  2FVP A;  1VMB A;  2QO3 A;  2FLN A;  1BQM A;  3NS6 A;  2JLF A;  2IRY A;  3I32 A;  3SEO A;  2MQ8 A;  3EDR B;  1PBA A;  1IVZ A;  3BO4 A;  2DPJ A;  3FK4 A;  1FFW B;  4A8W A;  2ZH1 A;  4WFB Q;  1IBL J;  3OR1 A;  4DV1 F;  4DV7 F;  1Q82 T;  2CYY A;  1LW2 B;  4K4U A;  2NPI A;  4M5J A;  2X3D A;  4QU6 A;  2XHC A;  4UT4 A;  3KLE A;  2AP6 A;  2D41 A;  2LXF A;  1LFW A;  1JLG B;  5HAN A;  4KO0 B;  2Q3P A;  2PA8 D;  3JYT A;  3OR2 A;  2ZDO A;  3LP0 A;  2ADB A;  3C6T B;  1NHK L;  1IBK F;  4KH0 B;  1FK9 B;  3FCV A;  3H4B A;  2HVD A;  4FDF A;  4Y2A A;  4GC6 A;  4B17 A;  4PWW A;  3UNG C;  3OXG A;  1J5E F;  1T03 B;  4M95 A;  2ZZM A;  4X64 J;  4JI2 J;  4CZC A;  5I3P A;  2HNZ B;  5CYQ B;  2XZW A;  2AQ4 A;  3I4H X;  2DCL A;  4MKB A;  1KKH A;  4OI3 A;  4GC7 A;  2VIH A;  1JLF A;  1FKO B;  2VHG A;  3PRB A;  3GPA A;  1UJ5 A;  1LK7 A;  5HP1 B;  2V8P A;  2DGO A;  4K8R A;  1M90 T;  4DFJ A;  1U6F A;  3NS5 A;  4LF9 F;  3DDK A;  2IPO B;  3G6Y A;  2I0X A;  4NI2 B;  3W3S A;  3MPD A;  2MZR A;  1N8R T;  1PIL A;  4MK8 A;  2YNH A;  5IWA J;  2F8M A;  2CJB A;  1V3S A;  4DUT A;  3HI9 A;  4JOU A;  3CCS S;  2MMY A;  1IR1 A;  3IS9 A;  5BYR A;  2FC8 A;  4E0D A;  3LWL A;  1N34 J;  5A8K A;  2V8D A;  4TN2 A;  2KTQ A;  2XTJ P;  3K8V A;  3GCW P;  3PYG A;  4WFY A;  4K4W A;  1CJU B;  1YJT A;  2G2Z A;  4FPI A;  3KJV B;  2GV1 A;  1VBY A;  2V2Q A;  1NND A;  4G1I A;  4IG0 A;  2AYE A;  2OH2 A;  1GXU A;  3I82 A;  4URS A;  2ALZ A;  3AJD A;  3UVJ B;  1X4C A;  4K5R A;  4P74 A;  2YQ1 A;  3G87 A;  2C2Z B;  4C4W A;  4EK2 A;  1BQN A;  1TP7 A;  4DR6 F;  3PJX A;  1B70 B;  2VPX B;  4QYZ J;  3I0S B;  3BSO A;  2HK2 A;  4EBD A;  3KWM A;  1NK0 A;  3C6U A;  1FFS B;  2ILZ A;  3GWC A;  4N56 A;  3RAM A;  1MW7 A;  1GMW A;  3LP1 B;  4OZ1 A;  3IR5 B;  4N76 A;  2UU9 F;  1VOM A;  2FVQ A;  2VA3 A;  2KRR A;  4K5S A;  5K8M A;  1XIQ A;  4OYB A;  2CPZ A;  3GON A;  4DN0 A;  4I6A A;  4YY3 F;  2M2B A;  3FNN A;  3UD5 A;  3MCN A;  5FLX Y;  3SCK E;  2RDI A;  3TX0 A;  4G1P A;  4KPY A;  4DX7 A;  3LGH A;  4BWJ A;  2QV6 A;  1VRU A;  2VG6 A;  1F3F A;  4FYW B;  2V68 A;  3MMA A;  4EWT A;  2GO8 A;  3KHR A;  3IXQ A;  1CC8 A;  3T1Y J;  1UTA A;  4HVZ A;  2V4J B;  1LWX A;  4LSL B;  4JBC A;  3CVK A;  4M5L A;  3D7S B;  3CC4 S;  2CQI A;  3OD2 A;  2LEP A;  4PUO B;  1JJH A;  2HBZ B;  1YJN S;  3CC2 S;  3HCX A;  3GZ7 A;  2WOM A;  2X1A A;  1RAF B;  3Q8S B;  5HAO A;  2AJ1 A;  3IFE A;  2QFJ A;  2CQP A;  3R1H A;  2W2M P;  2KYZ A;  4ECS A;  5J2M B;  2XMT A;  2JH3 A;  1UAW A;  1KRP A;  4ECV A;  1CS4 B;  2LXI A;  4C11 B;  4NLG A;  5HL7 Q;  7AT1 B;  3L9Z A;  3CPW R;  1Q79 A;  5BR8 J;  1JB0 C;  3L7U A;  1ZPV A;  1QD1 A;  4JI1 F;  5E3A A;  2DNR A;  5DLG A;  4DPO A;  1RAO A;  2XLJ A;  4TQS A;  4KHP F;  2RHQ B;  2QYG A;  2X7I A;  1NSA A;  4N7T A;  3J81 U;  2HQD A;  1GX5 A;  2UXC F;  2JVO A;  3CCR S;  2BOA A;  1FTC A;  3PJW A;  3LOU A;  2QLX A;  4AL7 A;  2VU5 A;  5AJ3 F;  4P9S A;  4DV1 J;  4DV7 J;  3EVO A;  5KFM A;  3MEC A;  2EVZ A;  4RUA A;  1IWA A;  3TR5 A;  4X84 A;  2RRA A;  1FWK A;  3V6D A;  3EZO A;  2E7V A;  1JLQ A;  1EQ0 A;  4Q0B A;  4MKA A;  1T9Y A;  3ZO7 A;  1U8W A;  1DBD A;  3H5Y A;  1S12 A;  3PW4 A;  2YKQ A;  3DDN A;  1M0S A;  4OX7 A;  5CYM A;  4FBT A;  5MAO A;  2H48 B;  1IBK J;  2LEA A;  1TAQ A;  1M1K T;  2Z57 B;  1J5E J;  2A6O A;  2NSC A;  3BN4 A;  4F7V A;  4DR1 F;  4PR6 A;  2FDN A;  3Q8V A;  2VFU A;  2G2O A;  2VPY B;  2MLY A;  1LNQ A;  2MGZ B;  3K5P A;  3ONQ A;  2BAB A;  4TXS A;  2AEF A;  2BA9 A;  1L3T A;  3AJ2 A;  2ZH5 A;  2MY8 A;  2YKM A;  1ZET A;  1BWE A;  3L09 A;  3POT A;  1RTI A;  3KLG B;  1FFG B;  4RKU C;  4LF9 J;  4TYB A;  3N5B A;  2CNL B;  4QCL A;  1FKA F;  1VQS A;  2H54 B;  5I42 B;  5D78 A;  1R8H A;  3ET6 B;  2LEB A;  4DCP B;  2GZO A;  3BDE A;  2YNG A;  3MM8 B;  2MXY A;  1NXI A;  4ZLJ A;  1SUQ B;  4WF9 Q;  1N0V C;  4RW4 B;  3M9M B; 
#chains in the Genus database with same CATH homology
 2ZUA A;  4ENO A;  1NDL A;  4ANC A;  3VVT A;  3BBC A;  3G2X A;  3Q89 A;  4FKX A;  1XQI A;  3EJM A;  5C7P A;  3NGT A;  1PKU A;  2BX6 A;  3DDI A;  3VGT A;  1HLW A;  1LEO A;  3VGV A;  5CAA A;  3VVU A;  4UOG A;  1NPK A;  3ELH A;  1NCL A;  3VGS A;  1F6T A;  4FKY A;  3L7U A;  3B6B A;  3MPD A;  2HUR A;  3ZTP A;  3FCW A;  1S59 A;  1NSQ A;  3PRV A;  4F36 A;  4C6A A;  3Q8V A;  3DKD A;  4O0N A;  1NDC A;  3FKB A;  2AZ1 A;  4DUT A;  2DXF A;  4HR2 A;  4WBF A;  4W98 A;  2AZ3 A;  2B8P A;  2DXE A;  1HIY A;  3BBB A;  3EE3 A;  3EM1 A;  3ZTR A;  4UOF A;  1XIQ A;  1K44 A;  3WX8 A;  1VYA A;  3ZTQ A;  3FC9 A;  1NHK L;  2B8Q A;  4S0M A;  3EVW A;  3FBE A;  3BBF A;  1KDN A;  2DYA A;  3ETM A;  3FCV A;  1WKL A;  1MN7 A;  2HVD A;  3VGU A;  1NSK L;  1WKK A;  3FBB A;  4CP5 A;  5BXI A;  1F3F A;  5CAB A;  2VU5 A;  3NGS A;  1S57 A;  3EIC A;  1ZS6 A;  3EVO A;  4DI6 A;  3NGR A;  3B54 A;  3Q83 A;  1NDP A;  2HVE A;  5IOL A;  3BH6 B;  3ZTO A;  1WKJ A;  2DY9 A;  3FBC A;  1NSP A;  1PAE X;  3Q86 A;  2BEF A;  1LWX A;  3GP9 A;  4DZ6 A;  4F4A A;  1BHN A;  4UOH A;  4KPC A;  3EVM A;  1MN9 A;  1B4S A;  1HHQ A;  2DXD A;  3ZTS A;  2CWK A;  3NGU A;  3JS9 A;  1NLK L;  3Q8Y A;  4ANE A;  1BUX A;  1UCN A;  3R9L A;  3Q8U A;  1U8W A;  1B99 A;  4EK2 A;  1BE4 A;  3PJ9 A;  1NB2 A;  3FBF A;  1JXV A;  3GPA A;  2NCK L;  1S5Z A;  1EHW A;  1W7W A;  3EMT A;  3ENA A;  1NDK A;  4AND A;  3BH7 B;  1NUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...