1PL0A

Crystal structure of human atic in complex with folate-based inhibitor, bw2315u89uc
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
589
structure length
589
Chain Sequence
GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Human Bifunctional Enzyme Aminoimidazole-4-carboxamide Ribonucleotide Transformylase/IMP Cyclohydrolase in Complex with Potent Sulfonyl-containing Antifolates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 201
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pl0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pl0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A02
2X8WA 1CS0A 1PKXA 1B93A 1PL0A 1CE8A 1M6VA 1WO8A 2B1GA 1C30A 1BXRA 1A9XA 5H3LA 2IU3A 2XW6A 3ZZMA 4A1OA 1EGHA 1ZCZA 1VMDA 2YVQA 1S8AA 4EHIA 1P4RA 1JDBB 2B1IA 1C3OA 1OZ0A 1THZA 1S89A 1M9NA 1G8MA 1IK4A 1KEEA 1T36A 2IU0A
chains in the Genus database with same CATH superfamily
2H52A 1ZX3A 3LY7A 4J10A 3AJAA 3GCWA 4AHCA 4DUYO 3L8ZA 3ONDA 3RIHA 1U8AA 5JARA 3RJTA 3SXJA 4LWZA 2R9AA 2QTHA 2RKWA 3ESDA 1NBEA 5HSGA 4A0QA 4E11A 3IUQA 1XWIA 3H16A 3UENA 2EIJB 4AJ4A 4AY3A 3UN1A 3TK1A 5EE3A 2JGJA 5IHXA 1MB3A 1YR6A 2W6ZA 4Q16A 1T9ZA 1IB0A 1N1MA 2C3PA 2A3RA 4BZWA 5AJXA 4BW5A 4RL6A 1R0BA 5B2ZA 1E2KA 3EMDA 4OJYA 1DAOA 3C3EA 3MNFA 5KU7A 2BGGA 2NZVG 3DFMA 3ZZUA 3EFEA 4K6FA 5C5DA 4CEIA 1KBQA 4N76A 1SCJA 1I4WA 2WB4A 1CBUA 3W5HA 1OA0A 4LF6O 1YBMA 2ZE6A 3GRCA 4MP3A 4R05A 3EEIA 5THXA 2E3JA 5BR8O 1I5OA 5DXJA 5CN0A 3AETB 3C4VA 3CLRC 5IN5A 3RUHA 5AVRA 1FEZA 3GVHA 4B6OA 2Q27A 1N9ZA 2VHEA 1DNPA 3LFTA 3VMFA 4TRMA 3ZWOA 1FDSA 1KQNA 1DO8A 5IJ0B 2OBBA 4F56A 2UYHA 4MSMA 5HDBB 1Z38A 2IV2X 1PRYA 1RM4A 1SKAA 2FPGA 3B7GA 4BLTA 3JCZA 3FAZA 4ZIRA 1KOGA 1QFJA 1DQYA 1PR1A 5JNLA 3I9OA 4EHDA 5BNIA 4TMWA 1K08A 1VHDA 3EXG2 1QP4A 5ISMA 1XCBA 1QQ7A 2A3QA 3ZD8A 3D7LA 2RBGA 3G8BA 3NXKA 1ZRNA 3RUIA 4N7JA 4MW5A 1PV4A 1ZVQA 3LHIA 3E4CA 5L3CA 3KL4A 2X8JA 3G88A 2IGBA 4R0NA 4UVEA 3HJFA 2XKKA 1XK6A 3E8FA 4OF4A 4FDVA 4CKWB 1EB8A 4Y2TA 1M6VB 3UMJA 4PX9A 2ZYSA 2CVHA 3UVEA 3BDAA 1RI1A 1TZJA 3CCUV 2DQ4A 2P0EA 1WCWA 2XDQB 4UU8A 3TDKA 1TIPA 1UBJS 5EBWC 1YT5A 2EJRA 4QHYA 3ZWPA 5DSTA 4PYIA 1JLRA 2VWGA 3HG7A 3WGNA 3R44A 2P9GA 4JKIA 2H4YA 3CX7A 3BQNB 4KVAA 5BOSA 3NDBB 3W3ZB 4A82A 1S2MA 2P8RA 3ZCTA 1CP3A 1KBHA 1Z8DA 5A9GA 3H6GA 3IVMA 4X8LA 1ZD9A 4D41A 4CNBA 4HWRA 4D8WA 4NCNA 1RLOA 1E2EA 1FQJA 4OH1A 1Z83A 2P68A 4MWEA 4PPFA 5L7YA 1NI4B 4BUCA 4ZDJA 1HV8A 4EFEA 3HGTA 5BN5B 4DBLC 1U2EA 2DPHA 2BFCB 3PD1A 2I99A 3PIDA 1RZVA 2ECPA 4N40A 3A6LA 1V55B 4RS4A 4X1YA 1OXKB 4INPA 1NT4A 1LK0A 2EKPA 2INGX 3AP1A 5DV9A 1Z0ZA 4B32A 4XFJA 4BNJA 3PX3A 2Z57A 5K3BA 2C07A 1S8NA 1UJ5A 1C8KA 3A1NA 3IAEA 3PKZA 1UM9B 4X1KA 4RKWA 3NX4A 3R9WA 3W5SA 1WL8A 3QLTA 4LCEA 2HFJA 1H2KA 5G1NA 4QHSA 4UCVA 1HZZA 2DHEA 3K2IA 3FB5C 3FBWA 4P2ZA 1YRQA 2WE8A 4UVIA 5ED0A 4KXRA 1DAKA 2UXBB 3KVVA 2X3FA 1VJCA 4KH0A 3OVMA 1RXCA 4EW2A 5ITZB 4GKKB 3WNQA 4B44A 1IHOA 3S44A 3QJGA 5FNZA 3AUJB 3H5LA 2XNDA 4JX9A 3N8KA 1GEEA 3BSYA 3OIYA 4RKRA 4CWAA 1M5TA 1GM7A 4X6XA 4DQ0A 5L4SA 4ZD6A 3UG7A 2VPIA 3TBFA 1EXWA 1OKKD 3WWCA 1JDSA 3LBYA 1Q7GA 2X19A 2YY6A 2G7MC 2O8FB 3DXRA 3SSNA 3VZSA 1UIRA 2HEIA 5CCEA 4EMBA 1KJJA 1PK7A 1VL6A 3ZQ6A 5KDOA 2D7CA 2NNWB 1QMGA 3LQFA 3CZAA 4OU5A 2O5CA 3Q4HA 2FW0A 3ELBA 2PW9A 2DF8A 1RYFA 4IS2A 4LX8A 4FVMA 1L1EA 5B3JC 1CZUA 4PS1A 1J9ZA 1J5XA 2GFIA 2VKQA 2A0KA 2I3GA 1M1KW 3MWFA 4FFMA 1D6NA 4FGUA 3V2HA 4CM7A 1XQWA 1IXYA 1L1FA 4Q4DA 5AVVA 1JBEA 1V11A 2AJBA 1E32A 4LBVA 3G17A 2ZJ3A 5CLQA 1ZM3A 5IC5A 1JWLA 4R83A 3T95A 4DJFC 5FD8A 3SYRA 3QTCA 2W83A 3H2YA 4O2AF 4BFSA 1E2BA 1DOAA 4F6CA 1JFRA 1HXHA 3ZOKA 4L5BA 5CD1A 5DB4A 2EX3A 1VE7A 2LZ0A 4MI1A 1PQPA 1CYDA 2ZRDA 4DABA 2IH1C 1CUVA 2RIPA 1RLUA 5C2OA 2FN4A 3ZXUB 4Q9JA 1C41A 2ZI9A 3SVLA 1M2OB 1ZLYA 2K9PA 2YEVA 4QUEA 4RETA 5AXCA 1DX4A 3BD8A 4OP2A 3WNVA 1NYTA 2AH5A 1PX2A 4A4DA 4Z2AA 3NH6A 4G0MA 1SETA 4ND8B 2BHLA 5MGNA 4GHWA 4PLZA 5JS8A 5FNVF 2FP4A 3A6HA 3I53A 1CDDA 4MICA 3G9QA 4U2KA 1Z63A 3C3KA 4D74A 4GM0A 2J6HA 1SVSA 4D80A 1RRCA 5ALIA 1JVSA 1VLHA 4D6TH 1U2RA 3B3AA 3HKBA 4G65A 4JVMA 2O9JA 2TSYB 3NHYA 3GEBA 4PEVA 2Y66A 5HQ3A 4MW3A 2A94A 3LT5A 4OHKA 2QN9A 2C5LA 3HI4A 3PQDA 4CCYB 3E8HA 3NYQA 2H54A 4FGLA 4QEKA 5LQMA 3BFKA 4D81A 5LIPA 3RIEA 1BEUB 3IXQA 4CF3A 4IDNA 3CVXA 2FGKA 3G5LA 4XLTA 5JYBA 1II8A 2W7TA 2ZI3A 4HYTA 4CTJA 1ISFA 5FL7D 4UBJA 3KTFA 1NF2A 2R8XA 2DERA 3RBZA 1OCRC 5K1XA 1RZUA 2B8WA 4X61A 5ALYA 3AF4A 1E3JA 3DC6A 1M67A 1Z4KA 1A8IA 3FUVA 4M0PA 2GAFA 3FPLA 5ALVA 2LE0A 3BT7A 4KYVA 1W5BA 5LUAA 1UKZA 2NQ2C 2XX3A 3V6LA 4POOA 4C7MA 5DTIA 3MUOA 1CY8A 4X71A 4QYTA 2OGSA 3WYNA 2EINC 4LF6B 1EM8B 1JJOA 2H85A 3GQBA 2C9YA 4HDMB 2SBTA 2YDEA 2HRCA 2I4NA 2DFLA 2CEKA 4LYHA 1TJ4A 2PLFA 4RE5A 4YLEA 3TXQA 4ZP1A 2XNCA 4KQFA 3WV5A 2IIQA 4W5QA 2VTBB 1YKGA 4PYMA 5FWYB 2X0JA 1CE8A 2P9TA 4LHWA 1J5PA 2C8VA 1XLTA 3S3XA 4AYXA 1KIFA 2PR7A 3ENZA 4UNNA 1EGMB 3K1YA 4Y2QA 2ZJFA 3KCYA 4QT4A 4W9NC 3JYCA 4ILGC 4QNNA 3HTXA 3CWZA 1T5IA 3TSWA 3BHJA 2W2MA 2FW6A 3G0CA 5ALLA 3E2MA 4D4LA 4LDJA 1TE2A 3A3OA 1TYBE 4CM1A 3EZYA 2J09A 2NVUB 3A1DA 3DQZA 1Y4ZA 4WCEV 1WA5A 5CIQA 1T2EA 5DBHX 3WFJA 4JJ6A 4O4JA 4HLNA 4PAMA 1NVUQ 4JP5A 1MNQA 4R1OA 5ERGB 1OB5A 1ENPA 2PUWA 3BF8A 2B3JA 1BCSA 2XF2A 2PVSA 4TT3A 4WNCA 2P4UA 2P2SA 2JAPA 4FOPA 3WYFA 1LB1B 5JANA 2ZU6A 3VR1A 2NTVA 1SVIA 2AF3C 1XO1A 4RAIA 3LNTA 4PZYA 3JWEA 2NLJC 4PN3A 3L46A 3Q7QA 1Y8QB 1XN1A 1FP6A 4OCLB 1RMQA 1H38A 3RHTA 2DEUA 2FMUA 1CULC 4QUDA 2Q9BA 1GKYA 3CMCO 3P27A 3LYUA 1FYEA 1K2VN 5B1DA 3RFXA 1QBZA 3WLEA 5KTKA 1VE1A 4IV8A 5CGZA 5BRJA 3SWWA 2XZPA 5FPKA 3AEXA 4ZCPA 3BTVA 4UM9D 4ARIA 1STOA 1E94E 3FPAA 1VQ4V 2J9YB 2VPPA 5F7OA 3SC6A 3Q3IA 1CNFA 1ZHHA 2WRZA 1UXJA 4P5EA 3QEJA 5KHJA 2P30A 3GMDA 3RVOA 3N07A 1O8BA 2AMVA 1U94A 4CL8A 1XHEA 5IKXA 3GLUA 5U9CA 2D5AA 2I6SA 5AT1A 3IEVA 4Q15A 3SYLA 3N9IA 2FJ0A 4NBVA 4G28B 2X5OA 4PG5A 2WINI 2JLVA 3EOZA 3TVYA 2F43G 1X0XA 2H18A 2NQ8A 3B6ZA 3CEPB 2DPXA 3SEZA 3Q10A 2KSDA 4NOMA 5DH9A 3N2GA 2BZ0A 5EPUA 1K6EA 2BFBA 2HAEA 2R6JA 2R8PA 4MV0A 4YWJA 3L01A 4DMGA 3NUGA 1FDRA 2C77A 5JSFA 2NG1A 4IUCS 3N6RA 5EEHA 3UUFA 1MC4A 4IIFA 4PBRA 3FX7A 1GNLA 5EBLC 5IYZF 4JGGA 1K68A 2X8JB 3FNGA 4OLJA 3UWKA 3F5QA 1JB9A 2GFQA 4F06A 3ZRSA 3L71H 1RLIA 5DI9A 2SKCA 2QM8A 2WJAA 2NSDA 5E1BA 1P8JA 1SKUA 4IO0A 1TLFA 3GP3A 1AS2A 3EVTA 2YR0A 4BFWA 2JJ1A 3UG6A 2I7XA 4BN0A 5KKAA 3LUFA 4MDYA 5HZMA 3OO0A 4WOPA 1QHYA 1JYEA 4MSQA 4ZD4A 4D3YA 1EP3B 2ZIAA 3AX6A 1F06A 3FOCA 3GC6A 2JFOA 4MR9A 4PZ9A 4BLOA 4P0PB 3W78A 3WLMA 2VDVE 4R71A 1OMOA 4LRYA 1Z7GA 4QRIA 5F7JA 2WIKA 4GP6A 5AW2A 1A9XA 1OLUB 4B2LA 4LWPA 4YAWA 5TB5A 4I9GA 2E1PA 4HFNA 3PEYA 4QOFA 2ES4A 4MUYA 1YB4A 1PGPA 1A8SA 4RTRA 3ZDRA 1NTKH 1V7CA 1GKUB 3CE9A 5AKLA 4E7PA 1ZS9A 1YDHA 3PYLA 2G1KA 2CUZA 2P4KA 1VHJA 4S1WA 4G2KA 2PGIA 4JVSB 1GR0A 3G8YA 5EY5B 3QUSA 4OHBA 2OHIA 1FX1A 3AB8A 3P5SA 4RZHA 4WZAA 1QFZA 4AG6A 3KZXA 3JARA 2PR2A 1U04A 5LYJB 4BKOA 3U3KA 4RQFA 2NV6A 2JIZG 2XRYA 5FTWA 4CCWA 2HRRA 2NYRA 1H8ED 1SB8A 4AQYB 2E5FA 4YP1A 3WLFA 2FWNA 4ARZB 4B74A 3U3JA 1W2BU 1R37A 3BD7A 3JTEA 3WK9A 4EB0A 1U3TA 2HDOA 4QE7A 2XSZA 1B4DA 3I32A 2QE7G 3OLCX 5LA6F 3TDNA 4DPKA 3AY0A 1TEZA 4IF4A 4UM5A 2CDRA 1AK1A 4YDSA 1CT9A 1NZ6A 2BFNA 2CMGA 4MV7A 3L8DA 1EFUA 4UM7A 4BVBA 5AUOB 1QGAA 2H0RA 1RB7A 1A76A 1ECJA 3QVGB 4XM2A 4A0SA 3M1AA 2ZYTX 4B08A 3QWFA 2XUFA 2ZNRA 1HLGA 3L7CA 4MYSA 1CVRA 3NXSA 2FN9A 2OZPA 3AUUA 3JVVA 5E7JA 5IKEA 2R8BA 2P11A 2O8EA 3EZXA 4DV5B 1P19A 2Q5EA 2VJPA 2X41A 1DIAA 2D5LA 4GYKA 1SXHA 4GW3A 2EP5A 3VOSA 2F55A 1D2NA 4NJMB 4GI1A 1GZDA 1FS6A 9ABPA 1CUDA 2EZOA 3U60B 2GHRA 1R3LC 1HG0A 1XZQA 1G6HA 3HBJA 5E8JA 2WLSA 2Q6OA 3K9BA 4XSHA 2R70A 2HDHA 1E3TA 1GLVA 1NUAA 2C4UA 1XE3A 3A4IA 3SBXA 3OKFA 2J5RA 3OU7A 4GEKA 3ZG6A 5BQOA 5BWNA 4IEFB 1RMTA 1A50B 1G8AA 1QPGA 1L5OA 4RLSA 1H2EA 4DK0A 3QXSA 3DKPA 4MP8A 4OJKA 3RAFC 4LE1A 2C9DA 3W34A 1II8B 1YZLA 5HFJA 1W85A 3ZDYB 5L4NA 3O5AA 1H2LA 3HXOA 5IP5A 3H9JA 3BMNB 4IVRA 2B3DA 3JVDA 1V16A 4HTFA 3TNDA 3RT9A 4FQ5A 4MRRA 4FMDF 5EQDA 1M2VA 1GFIA 3IKMB 1ORIA 5I48A 1K4YA 2HPVA 2I71A 4ARVA 2NOAA 2H2DA 4EVSA 1SVNA 2QRGA 2CNWD 1EEXB 1W2GA 2LR0A 3AERB 4OBBA 4UNRA 1ECFA 1SUCA 3PUYA 4FFDA 5DX0A 3ACCA 1KI7A 4PFQA 1M73E 1U0NA 4G07A 4BLPA 4NV0A 1RRVA 1JHOA 1PLLA 4FDTA 5E9WA 3W5IA 1AU9A 1BDHA 2HQBA 1CP2A 4FC6A 2FMHA 4ND8A 2W90A 2GZ1A 4RPJA 1YJ9V 2H5LA 4QBKA 1AZTA 5LGTA 1TVKB 3T7CA 2CWDA 2WPNA 1EX7A 2XT9A 2ZRIA 3KVOA 4DDTA 4G81A 3CP1A 1T6NA 2QKYA 3AEYA 4II3A 3AG3C 3TE6A 4AIRA 1X7ZA 2W2QA 1NMQA 1X39A 4FE4A 2Q5LA 2PQ2A 4IV0A 4OFZA 4YPFA 5ITSA 2VSXA 4DRYA 5BSFA 3QPBA 1C9DB 5L3VA 1U96A 1XZCA 1C9MA 4UCOA 1Y8CA 3LH5A 2A1IA 3BC1A 1N34O 4PGMA 4RUFA 1ZBDA 1ZWLA 2PKYX 3O8OB 3R09A 4TOIA 4JOQA 1WIWA 1JHPA 3IV6A 2I6FA 4WV3A 4ZPJA 3V7WA 1OFHA 2F43A 4A0FA 1T25A 4MRMA 3SBOA 4BP8A 4BPBA 5I4KA 2XMZA 2PH3A 3RR2A 3WYGA 4KSYA 2YYZA 4V0OA 5IEBA 1IWOA 4EYEA 3E2EA 5HNKA 1JXQA 1HNXO 4TL8A 4Y9TA 4COKA 2GAOA 2H7CA 5KHGA 1VPEA 2UVPB 5KVVA 3TETA 1R9NA 2HX1A 2X6BA 3M7IA 3AYXB 4HXEB 4OJQA 3V4RA 1H8HA 1UBKS 3E83A 2VNJA 5B1BB 3LT1A 2JAWA 3P9SA 4TLBA 4DB4A 1ZLXA 1LK5A 3WX0A 4I50F 4YRFA 5D5HA 4AUNA 1MABG 1Z33A 3OD4A 2VHCA 3OCXA 3VRHA 1C7IA 2VJLA 4C4ZA 4R3WA 3AG5A 3RADC 1QJ4A 2HJRA 4A0HA 4QBTA 5BN3A 2DVMA 2HJ9A 3GLIE 1ETHA 4EECA 3LUHA 4ZDKA 3N28A 3L1HA 4QX6A 1DU4A 2ORYA 1Q7TA 5A1TA 5ADHA 2R7AA 1L0LH 3BERA 3ICEA 1I9CA 2FPKA 2MINA 1BFKA 1S02A 1PT6A 1YS6A 5AHOA 1F0PA 2DKFA 1KIAA 1IU9A 1OCEA 2DWOA 4UFZA 2IW5A 1NN1A 3L7AA 2YIBD 5C7LO 2R85A 3L7OA 5JSZA 2IZ7A 1N2CE 3SR0A 4G1BA 5BT9A 3WA6A 3WSVA 5HW0A 5KZMB 3ANMA 2O3TA 1SHTX 3A28A 3PSHA 1KMIY 2C9BA 4RF4A 1AURA 2NUAA 3PNSA 1MO3A 3KJHA 4KUEA 4EGCB 5KOYA 2OCCC 3H05A 1WHTB 2KYRA 1K5DA 4S0XA 5CT9A 2DQZA 2J3MA 2ZQMA 3AIIA 1YB6A 1F4LA 1ZVMA 4RM3A 3D7MA 4CI0B 2IYVA 4RXMA 2EYUA 3IVXA 3H5OA 3ZI0A 3A11A 4K81B 1ARZA 2PUJA 2OTCA 1OI0A 2JK0A 1JMKC 2GHQA 1VSTA 3CBGA 4O4LB 3L05A 3QA3E 4W99A 2XAUA 2YZMA 4DDKA 2XPCA 3E7XA 4RLHA 4BNWA 2RAUA 2RHBA 3K57A 3F7TA 2CV0A 3QVXA 4D0SA 1ORTA 3G1UA 1FC0A 4BE4A 3OI7A 3GQBB 3SYTA 1CQIB 1TKAA 3RRXA 1FYFA 3S2UA 3VAAA 3W2FA 4IFBA 1AKYA 3U7RA 4PTZA 4QDJA 2DM6A 3QW4B 4JN6B 1JEJA 3PTZA 3TLKA 1TJYA 3AU8A 3LF2A 4NOJA 3RIMA 1JG1A 1AQIA 3HU1A 1BROA 5B30A 2WZQA 3K4PA 5C80A 3HACA 1L6RA 2ZK7A 1BX1A 2VWPA 4OD0A 1XP5A 3GLFA 1EBBA 1M5UA 1B42A 2CV2A 4JAVC 2ZRGA 2KS6A 1UFKA 4IRUB 3FZGA 4IIUA 4YUZA 4L3OA 5DEDA 3AVPA 3TTYA 1CNMA 1BS1A 2UXDO 4DCCA 1S9HA 2JIZD 4NU8X 2IPXA 4RHUA 2HY7A 4YVFA 4OI1A 2JEXA 3JD4A 5EGSA 3PNOA 1L4GA 2O2YA 2ZM6B 3BL5A 5CVCA 1D1SA 3GHYA 4DV3B 2P9ZA 4FCWA 1FRFS 2XRMA 2Y4TA 1P1RA 4ICGA 1KK0A 1ZKDA 2JCVA 2UYGA 3DMHA 1OXXK 4ND3A 2R0QC 1LPSA 1F8YA 5DNCA 1QV9A 1CLUA 1QUFA 1KH3A 2QW0X 4MO9A 1PQ4A 4ESEA 1TLLA 3DJYA 1V25A 3VR6H 1X1TA 3T1NA 1I24A 2HREA 3I1FA 3K15A 4LMRA 4BMCA 2HLPA 2OHVA 5HJEA 2FSFA 4EPWA 4MUBA 2Z2IA 1P9WA 2B3ZA 1UANA 2H3HA 2G9UA 2M6RA 4CUJA 2O0MA 1CQWA 1FU8A 3HU2A 2AQ8A 1HLPA 2JARA 1OLXB 2BV3A 1TQHA 4YCJA 2JAOA 5A7GA 2G5TA 2B37A 4XX0A 2PPVA 5FB3A 1C3EA 2PRKA 3JARB 3CJRA 4WXRA 2Y9MB 4BC0A 3JTMA 1KI8A 4ZYWA 4JC4A 1BU5A 3ABMB 2P7IA 3OJLA 4FYXA 1HT2E 5FTKA 4QUKA 3N7TA 1T9KA 1XG5A 3S55A 4B6GA 1N7JA 3JD3A 2A9OA 3I6MA 4DWJA 2GM9A 2A5DA 2BUBA 3H1FA 3A2MA 2VBCA 2Q3FA 2G82A 2R62A 4UNSA 3HUEA 1CYEA 1DELA 1G4UR 3PXCX 1M7GA 3SJAA 5DYNA 2JLCA 3NBZC 4HNAA 2CXQA 3UC9A 3SZLA 3LQ4A 4IIXA 4WACA 9MHTA 1AKTA 1UQUA 4X65B 4YCLA 1UJMA 1NW8A 1OROA 3QIVA 2WAOA 4J41A 2JLQA 3B2QA 4I9UA 2HD4A 3W2HA 3JASA 2A5YB 2C97A 2VQSA 2XAAA 3JPYA 3CEHA 4KXYA 2F4VB 1HH4A 4NBRA 3TAXA 2FKNA 3E89A 3ABSB 4D9IA 1ZM4A 3ROEA 2OBYA 2ZRLA 2JIRA 2J45A 3DUFB 4NESA 3TB4A 1FBNA 2AOXA 3PCXA 3I37X 1L7AA 3L93A 4EABA 1MG0A 4PLTA 2BE9A 3IUNA 4NJMA 4EHLA 4EKNB 4BN4A 1B8OA 1H22A 3BCCH 1L7QA 1J2UA 3AUXA 4H3SA 3SBGA 2O8EB 2O7NA 4HAXA 3DVLA 4N7RA 3EBPA 1RXUA 2IEDA 1L8QA 3NAZA 4WOJA 4RFSA 1V71A 2H3EA 2W2XA 3QTTA 5DF1A 3BXXA 4PZEA 2WJVA 4V39A 3R6WA 4CGZA 2REXB 2JEOA 4AK9A 3BFJA 4A03A 5IT9N 1P2FA 2PD4A 1DQNA 4D6YA 2GAAA 1WB7A 1QHHB 2LD4A 1Z82A 1KJ8A 1V37A 3EHEA 4MJ7A 4EBBA 1N5LA 4R9NA 1Q1ZA 4IFEA 1XZ8A 2HRZA 4ZK6A 5DCAJ 1XZHA 2ZB4A 2VZ8A 3INNA 4P7GA 3E9YA 1T0PA 4IEIA 5KTNA 1SQBH 1GUFA 3TF5A 3ZDAA 5B1AC 1DC4A 4Q3BA 2H7VA 2ABWA 2OBXA 1N2CA 2Y2VA 3ABZA 4JB2A 3JCUZ 1MX5A 1CY7A 5KHIA 1S8FA 4REMA 1HFJA 2PN1A 4IIYA 5FXMA 3SFVA 3W2EA 1USVA 2ZRHA 1EA5A 2YMLA 4FD2A 5FPYA 3FCYA 3OQHA 1QE0A 3PENA 1M6NA 2V9PA 3IVCA 3NIGB 4IX1A 5DSXA 1U9IA 3GT3A 1UBMS 3GWZA 4C3VA 3JY6A 4PLGA 2FB5A 4GT1A 1XNGA 2C88A 2RBKA 2OXCA 1G6OA 2C4TA 2SHKA 1SK9A 5AG2A 1YR3A 1F7VA 2K87A 3K05A 1DINA 5KNDH 2HO4A 4B33A 1RAAA 3A6DA 3WDMA 4YMLA 4HJXA 2H8PC 2NSHA 2XADA 3OEHA 4A26A 3ELDA 4IWNA 1QXSA 1U3UA 2YWJA 3PQ4A 4MCHA 4UUJC 3IHLA 4IH9A 3UAXA 5DCWA 4UARA 4Q93A 3H11B 4LSMA 1ZIXA 4JQYA 4REQA 3OZXA 5EIXA 3CS5A 1KMMA 2Q29A 2Q6VA 1AP6A 3A6GA 3ML0A 1XRJA 3P4UA 4EKIA 2IV3A 3I5XA 1XEXA 1NWHA 1XZPA 1HNWB 2P8JA 5DWDA 4Y7DA 3CCJV 2Q8PA 3FMVA 2X5KO 1Z6PA 3I39X 3EULA 2AZDA 2ACWA 3I2IA 2X13A 4X90A 4WN3A 2P4VA 4PRZA 1D4AA 4RTQA 2X3YA 2IBSA 5HKOA 2ZQYA 2ALJA 1G63A 3OPYI 2ONZA 2Q4OA 1SUWA 1DE0A 4J16C 1MORA 1Q0ZA 3CPWU 3KC2A 5JEDA 2UYCA 1Y7TA 3RT1A 5ADWA 2CB9A 3FR8A 4GZLA 3UY4A 2EG9A 4FGKA 3NIFB 1O6ZA 1QHEA 3AR5A 4DLRA 1F51A 4IIVA 3H0KA 3WFZA 3GJ5A 1YNOA 3A1TA 5KKCA 4AY2A 1XTKA 2QUHA 2A5GA 2JKZA 2XCRB 5AM1A 1E7QA 4L5YA 1TD1A 2Y4NA 4WDRA 1WN5A 2JBHA 2O7RA 4PV7A 4MYDA 1SULA 2X0RA 1E2NA 4S1PA 1L1QA 1ZC3A 4JJZA 3DZKA 1RKBA 2RAVA 1H9AA 1X3LA 3E9MA 2Z3VA 3I8XA 4LTMA 3NOQA 3JD2A 3VSEA 2WDZA 4EITA 4EZBA 3B3FA 1GRJA 4JK3A 4ABYA 2C7OA 4Z53A 2Q3BA 4ZVUA 2GUZA 4W7IA 2MINB 4EPVA 4UM9B 1XZLA 3PLNA 2IXGA 4ZQHA 1J9EA 2O5VA 2QHXA 3KDSE 5DJ5A 3TLEA 4UTVA 3QX8A 3FMPB 4KFMA 4QLAA 3A6PC 3ZX4A 1WVGA 3RTBA 4CG2A 3QTBA 5JASA 2HVKC 4CYMA 1CQZA 5CNMA 5IH3A 4DWVA 1KZ9A 1M2GA 3WIUA 1HQYE 1R88A 3F6BX 4YRKA 4NHEA 3K9WA 2B1IA 3HN6A 2WTEA 2G36A 1Y3CE 3KBOA 3K9FC 1CTTA 1IJKA 4OXNA 1K89A 2EEZA 1JEOA 3Q8WA 1EA7A 4JLWA 2ZDQA 2J85A 3PD7A 1E7SA 4O2LA 2WFLB 5HUQA 4JD5A 5CB0A 1I36A 2OEPA 5I3CA 3LY5A 1R50A 3PCRB 5CXXA 4YRZA 4XDYA 4BLRA 3QX9A 3FAVA 1FJ2A 3PNLA 1I6KA 1E64A 1TA0A 2PT7A 5DHFA 3U5TA 2VXBA 4LF7B 5B3SB 4UULA 1EUQA 2H1RA 5AMXA 2FCAA 4N0PA 3CSUA 3GAAA 2OE2A 5A0FA 1P1CA 2Q2NA 3IAYA 5CW6A 1P2BA 1WSAA 3LBNA 5KPDA 3EVGA 5TS2A 1U8EA 5JRJA 5LMUO 2WF6A 2UVDA 3QVOA 1XRNA 4KIJA 4FILA 5L3SB 4EZEA 4OBWA 1NQVA 1K73W 1V3QE 3TPFA 2HUNA 4OPHA 2C5AA 2FSPA 1R6UA 2J7PD 5I8ZA 3ZIAA 2CMFA 4DILA 4F4DA 1WP8A 3OQOA 1KQFA 3IUJA 2FSHA 1QVGU 4RXUA 2IOHA 2GRJA 2YXEA 4BQFA 1G2QA 1DXOA 1KYXA 1P45A 2X86A 2ZJ4A 4PPQA 4RVHA 4XIJA 3RUEA 5KJ1A 1UX0A 1K86A 4YYEA 3H1JH 3H13A 5J2TF 4CMIB 2H06A 3KALA 4M53A 1LBQA 1NSYA 4F3WA 4P0TA 1E4VA 3HZRA 3IQGX 5PGMA 3FLBA 5LGNA 2HG5C 1CUBA 1KC3A 1X2EA 2H08A 2KJQA 2RH9B 2VDWB 2VF5X 5B1SA 3CVWA 1NBAA 3EISA 4H44B 4I9NA 4IY1A 1KMHB 4ESOA 2CVPA 1WZCA 2F1HA 4TM8A 2CGEA 2R79A 3I9KA 1M2VB 4MB0A 1FNDA 3CNQS 3L72H 2DCMA 3W8DA 2QMUA 2N0SA 1SXJD 1WSWA 1CUYA 1Y0BA 1N2IA 1VSUA 2ZTMA 3PDJA 4UATA 3X0DA 4D2IA 5JBNA 5LQNA 3SYPA 4CR6A 4RTOA 5JC8A 4KIUA 2ZSHA 4ZOEA 2C3YA 2QVXX 4GFDA 1QVZA 2O2ZA 4MW8A 5KNBD 1RQNA 2JA1A 2XCUA 3FVTA 4O0MA 4QQFA 1U3CA 2RGGA 4BO6A 3SPXA 4I7ZB 5JRDS 1CJKC 1E2JA 2VJYA 1AN9A 1S7CA 1WXGA 3V8EA 4AP5A 3ND5A 1GMGA 2J30A 1KQGA 4DMKA 5C8DA 1KYOF 2DMXA 2F9LA 3G9ZA 5CT5A 5F7ZA 2B8TA 4RYLA 1FFGA 4F72A 5DLDA 1ZNWA 5I01A 3EWAA 3D8RA 3G8QA 3W5UA 1T9BA 2PXXA 5KPJA 1DAEA 2WNIA 1D7OA 5AHWA 4HMPA 2GBOA 4F6RB 4S24A 3W6OA 4E70A 1KQSU 1N8NA 4EENA 2CXUA 1WDTA 1COWD 1KEZA 4TL6A 2MOKA 2EQAA 2XVMA 5GM2A 1E9VA 4Y2PA 1T3LA 3I0NA 4CLXA 2H9YA 4L57A 2RKOA 3EMBA 2IZ5A 2BM1A 5G3YA 4DA4A 4REQB 4Q6WA 4EG2A 4Z0TA 2GV9A 5DHPA 3FI0A 3RS4A 2OQVA 2ZIGA 3DZHA 1D8AA 1WDLA 4KVFA 1XHZA 4CKXA 3SZMA 1LJ8A 4XTRA 4CBVA 5FF9A 3CG4A 3R3SA 4J6EA 3C3JA 4JT9A 2XQGA 3FMIA 4UU1A 1JWBB 3PPYA 4RMIA 1ID8A 2QRHA 5A6SB 1Q86W 1J06A 2ZDGA 1NBHA 4UASA 2Q6KA 3UEOA 1USGA 3M4NA 2QQFA 1M6VA 3LPLA 4IDAA 3R0VA 1DV1A 4J4BA 1UBCA 3IUSA 5LKRA 1NZDA 3BH0A 4FXOA 2OD2A 1AZSC 4ZVQA 1NVTA 5B1HA 3R3UA 1YJ5A 1Y5LA 3SZUA 3UWDA 1N25A 1NVXQ 1GN4A 2RGYA 1GGKA 1E60A 3M1IA 4IDQA 4LSWA 4UHDA 5KYVA 1KWGA 1IB6A 3C3YA 2ZULA 4FLVA 2W6IA 1U99A 2X0FA 1V5EA 1QH8B 3FTNA 4B3HA 4JGSA 3RVZA 3GJSA 4ML3A 3OE7A 2P90A 3KB1A 2XIJA 4KC0A 4P81A 4YCAA 5LR6A 2CGNA 1FPMA 4CE6A 4CZZA 4ZJPA 2XVAA 2YV3A 4BJ5A 3SF0A 1BXRB 4XCVA 4DLWA 5FV4A 4CQNA 3BABA 1Y7PA 5L3GA 3FI9A 4AUKA 1G5QA 2WYIA 5HHTA 1AF7A 1AQ6A 1Q17A 5AICA 5AW6A 4MQ4A 3ND9A 4QJ5A 4WI1A 3GBPA 1QHXA 1L7OA 2CXXA 3REQB 3ZKWB 4G67A 4ZEMA 1FP7A 1G6KA 1TADA 4L2IA 4URVR 1A5BB 3PT9A 1UBLS 2GMWA 4H7PA 2Y1DA 1L8AA 4YNBA 3ETEA 1G66A 1BXGB 1IEXA 1ORWA 1WTAA 2XD4A 3D6FA 4E21A 4DV0O 1D4FA 1E6MA 2ZXWB 1C7JA 1EBOA 2WPDD 2YNMC 5FJJA 2EX1A 5K8LA 4BGVA 5K0SA 3FH0A 1NXWA 1DBRA 1GIAA 1A04A 1JX9A 2DWDC 3CIOA 3PF8A 3V8QA 4P4GA 3HXLA 3ZZTA 4IYIA 2Q3LA 4A8PA 4C4SA 4UVBA 2JFVA 1Y6XA 1E2LA 4NZ9A 5L7WA 1S6YA 2ZREA 3AV0B 2Z43A 3KZ1E 3DNFA 4OAOA 4PVDA 1FX0B 3AZQA 3AJRA 4CXMA 2N42A 2Q3MA 1ZX1A 3E0XA 3QVSA 4Y9RA 5WRFA 4M0KA 4X1KB 3W2IA 3ASOB 2CBGA 2GOYA 4NCJA 4I3HA 2J41A 4P54A 3A9TA 1QF9A 2VYND 4KN8A 4DLYA 4WLFA 2QM4A 2QUAA 3HDHA 1HYGA 3GZ4A 4B35A 1V6CA 3ICQB 2X5JO 3P2KA 4RVNA 1KJIA 2CVFA 4AZ3A 5LP6B 4MWBA 3K5OA 1GSAA 3TLZA 3TE7A 1IPFA 4LVNA 3KQKA 4QPNA 4BRUA 2OD7A 2JHPA 3AHFA 4YDRA 4C0QC 3W1EA 3M34A 1HQCA 3A26A 5BUQA 1WUYA 1EMDA 2Y0CA 3FM9A 3FAVB 3RVSA 2PMEA 4CN8A 3ZY3A 5K3CA 3SYNA 1FDOA 4D42A 2X4IA 3EEQA 2QRVA 2JZNA 2JGMA 3TBHA 1R3UA 1U3VA 1WM1A 3R6DA 2BGRA 4MYHA 1NWCA 1GFZA 4QQKA 1SBCA 4I9FA 4HF7A 1VSBA 2CNDA 3Q98A 4DAOA 4DZZA 1LDGA 2H9AA 3M0EA 2AEEA 1ACMA 4GL2A 4YRSA 1GZ3A 1O9BA 3AETA 1LSOA 4YJKA 4YX9A 4BKRA 5C3MA 4CIBA 3TR5A 1E3MA 1EFRD 3R5JA 4UVCA 5FLXA 3VPSA 1FDTA 3JRWA 3PPIA 4WW0A 1VG9B 4YAOA 4JODA 1HLDA 3VKVA 3IPXA 3LQ2A 2OZKA 4NVRA 3FCEA 5ICFA 1UPBA 3FAKA 3OHPA 3W5VA 4ER7A 2FWMX 4FGZA 2R8RA 5AKKA 1GEGA 5CFRA 2ZETA 3OQNA 1M0EA 4EHAA 3AFNA 5EP1A 1R5OA 5FA5A 5BV7A 1I08A 1V5GA 3QHPA 1P0PA 4ZWNA 1FZTA 3VU9A 3BORA 4Y1FA 1Q83A 3UOGA 1MG1A 5BN4B 3CCMV 1XD9A 1YQUA 4AECA 5SY4A 2NVOA 2E74B 2AD1A 5IULC 1YBHA 1TRKA 3DBOB 3WL7A 4H0LB 1EGVB 1N0WA 2C1XA 4AN4A 3A1CA 2CUKA 2JHGA 4QOGA 3I2GA 4HZUB 3L7KA 3CRMA 3HPQA 1J0AA 3MSCA 4M7OA 4X92A 4JKYA 5ANRB 3RODA 3QE0A 3TCKA 5ITVA 3K0HA 4LAFA 3TR0A 1FAFA 2Q4DA 2IH3C 1J0XO 3DF9A 5GONB 4L85A 3UV7A 5JAZA 4FR2A 4U8HA 3FOFC 2WM3A 1BYIA 1M2OA 3MT7A 1NQUA 1VG0B 3IBSA 4UFOA 1VYTA 4X41A 3DLBA 5EXSA 3WRWA 2YWFA 4FCCA 3M9WA 2CTRA 1R8SA 1FSGA 4QU9A 1YQXA 2B9VA 2IYWA 4C4YA 4KRXA 5DP2A 2M6LA 1NKVA 2G6TA 5J59A 4C4OA 1JEQB 4HBGA 2PSSA 3MTIA 4H1VA 2GLXA 4Y2GA 1W1WA 2GCEA 4NBTA 4OCNA 1KPHA 2H5IA 1BHAA 5AESA 3VPFA 3IIJA 2XGOA 4NABA 4R8MA 1EK2A 1SA0A 4Q3DA 3MS4A 4XQ9A 4CI9A 1EINA 1YJQA 3LUBA 3OTIA 2A9RA 1IVSA 1S5LZ 1KNXA 1P18A 1RWPA 2Q5FA 1Z0AA 1VA5A 3C1OA 3D3NA 3I9V6 3OF3A 3B9QA 1PNKA 2VHTA 4FBGA 4CCYA 4YP5A 5JMOA 3MG9A 3DMDA 4RD2A 3SYOA 5TQVA 1FJHA 4PC3A 3FXAA 3TMYA 2QWRB 2NYVA 2FHSA 1EFPB 4R6WA 4TUYF 3IAHA 3IE2A 3HUTA 1M76A 3ZJYA 1P33A 1ML3A 3KKYA 2H2AA 1FXSA 4X00A 4MUGA 1IZ3A 1BJRE 1HE3A 2YC2C 4X20A 2YIVX 3CW9A 3IMKA 1GSOA 4JLKA 4HYYA 3U3MA 3KWJA 4CF4A 5JXIA 1SQVH 3OPQA 2RI1A 3SE0A 3F6PA 3QO8A 5TVKA 4UFNA 1QP7A 2CDBA 1U9JA 3R5FA 4MMZB 2GWRA 4FJ0A 4XAQA 4I4NA 2UZIR 1U7DA 1X4TA 2R72A 1ZXXA 3KUCA 4ZARA 5IXSA 4IZOA 1DZIA 1D9XA 3WGGA 3FPHA 3TRKA 2JGKA 2GILA 2WT8A 1RTTA 1A5AB 5DVZA 2ZTUA 4IR7A 2HFKA 3PHLA 1R4MB 4DR1B 1TJPB 2FUCA 2H4FA 2HMWA 1WKBA 4AZ3B 5I7WA 5JISA 3F9CA 2VDLB 4E32A 1XK7A 3VAZA 1ZU5A 2NT4A 3AESB 5H5JA 3W3AH 3YASA 4DNXA 2G08A 1K4KA 2WWRA 1M57B 1T9GR 4TTQA 3GJ8A 2KB1A 3AG6A 3U4QA 4KPGA 4INOA 8ATCA 1E2QA 2CF6A 4MIOA 3AM3A 1L8XA 1SQ6A 4W7HA 5C8YA 2CD7A 3OLWA 3ADPA 3OTOB 2QP9X 3CVUA 1B74A 1UFQA 2H2GA 3IAAA 5A4DA 3KQLA 4JZKA 2YRWA 4INJA 4BLQA 1OT3A 1QFYA 3FYHA 2LBPA 3O31A 2OZVA 2YJGA 3PUVA 5CLIA 1ZJJA 5TT0A 3MWYW 2EFCB 3DBVO 2P69A 1C30B 2PX5A 1CQXA 1K7CA 3F49S 5I7RA 2PFSA 2X23A 3CY6A 1MXFA 2IYFA 4LOHA 4OSOA 1IN6A 4PO8A 4X7BA 3G2IA 5H68A 4E3WA 1JQDA 3EXHA 4IOLA 3KR9A 4UZEA 1X42A 5CLGA 2CJXA 1J95A 4EARA 3CRAA 2PUSA 1W96A 1M66A 4GQIA 2WUVA 1MRZA 1UT6A 3DV9A 5F78A 1E77A 1RRPA 4GE3A 1KO8A 1L5NA 1YRAA 4ZN6A 5AW8A 4MRNA 1Y1RA 4EA8A 1QTNA 1YDEA 3CZCA 2CDYA 1ZGZA 5A3SA 1KBZA 5E4YA 3GDGA 1SOAA 2E48A 3ZC3A 5KOHB 1SOVA 3H6HA 3IT0A 4FN4A 4YAIA 3OZVA 2LCFA 2R1VA 2GNAA 1T1SA 3VR5A 4B6SA 1C9EA 1VRCA 2ISCA 1Z88A 4BDSA 4I14A 2AXNA 5DULA 2R5NA 2OXTA 1Z5GA 1ECLA 3LDUA 2BFEA 2VP9A 4DNOA 2Z08A 2YVKA 2WTXA 3BMQB 3FJYA 4M1WA 1B1CA 1MG5A 2DUMA 2FKXA 2DQ3A 2WWWA 4XWGA 4O2BB 2JI8A 2HTFA 5ALTA 3WA7A 1Q3TA 3PVCA 4MWSA 2WG0A 3ASOC 5D8DA 3N8DA 1QAQA 3TCNA 3ZGOA 5B55A 2O0JA 4FE3A 5M2QA 1ZY2A 4ND1A 4WKPA 4EGSA 5DSZA 4DIFA 2C42A 4KO1S 3IQDB 2H07A 1KB9F 1VYVA 2ZSJA 4EUHA 1YS7A 2JNWA 3WGLA 4I9HA 1Q6IA 3GRVA 1XQ9A 3C5CA 4LMAA 1I7DA 3S5JA 3D1LA 2OQIA 3GAMA 2JDIA 3WWEA 3RVBA 1P7BA 3JWPA 3QLVA 2ZAMA 3BIFA 3KV3O 1YZ3A 1DC3A 4N6GA 2BEVA 3RF7A 2ZRQA 1DOZA 3OUUA 3R5XA 1Z17A 2HA2A 3FMOB 2CMHA 2XJ9A 3N2LA 4R3NA 5B36A 4KNYA 2CHFA 2KE5A 4FLZA 2B4QA 1ODJA 4I2VA 3CLVA 1RQRA 1M0TA 1TM2A 4QICA 4U5XA 4UHKA 5DGIA 3SHFA 3U39A 4G41A 4X66B 3SJQC 1FU7A 3IUBA 4JUIA 3BH1A 3O26A 1KI9A 4HL6A 1GO3F 3VX3A 3FNHA 1BH6A 2IHYA 4N21A 4Z1VA 2I3ZA 1Q2UA 1YFJA 2A6PA 1HYHA 1OHHD 1WY5A 2FQXA 3L8MA 1T9GS 3IS3A 1P7YA 3B13B 1OC4A 4DWWA 1HRKA 3GA0A 5KWEA 3AYZB 3VH4A 2O8DA 3DCNA 1G1XB 1QIFA 1BTOA 4JLUA 1R4AA 3FWYA 4DKXA 3E3AA 3GEHA 2YVLA 1GCAA 2QJTA 2WYVA 3HA5A 3TD9A 3COVA 4U8GA 5E1AC 3BX1A 3LT0A 1CF9A 4FFRA 1WMFA 1SHJA 3PG5A 1J21A 1RADA 1UPFA 2C03A 2H1VA 1B3QA 2IHTA 3EXEA 1IE3A 5D3KA 5EUBA 3V1KA 4J0HA 4C06A 4DREA 5L3BA 2R6GA 3K70D 3PN1A 1KNQA 3NHUA 3ZX5A 4QTZA 1TPZA 1VBNA 1M8JA 1BE3H 1BRMA 1U8CB 3OTOO 3QLUA 1QORA 1LW6E 5HJ7A 2NZJA 3ABKB 5HFLA 3K53A 4KXXA 2H16A 2WP0A 3PVSA 3N8NA 3KCXA 3TZBA 1P62B 3ZHVA 4ZZIA 2JJYA 2VJMA 3A9RA 4B6RA 4YJDA 1Y6ZA 2LV8A 2Y0BA 4P7JA 3LECA 2H1FA 1ZMRA 4F8EA 5KTTA 2H4HA 5E9AA 3PDIA 3B36A 3KYDB 4Q12A 2F8TA 3NB0A 1W88A 3OAAA 3QH4A 4MIKA 1KIMA 3I6ZA 2JJ2D 3E5NA 4KKXB 1D2CA 5ALEA 3Q9SA 3SQNA 1KVRA 3TIIA 4F7OA 3BB4A 3HJGA 2X0DA 4UQLA 2PUCA 3EGEA 3KQMA 4LGYA 4H4DA 1QLHA 2XMDA 3RWRD 2X2FA 3D36A 3ZRXA 1QANA 3B5EA 4XIIA 2JBAA 2XNSA 3RSSA 1VGQA 4QFTA 3DKKA 4ZYLA 5ARDA 1UFOA 2C31A 3C70A 3L1UA 4JJFA 1V55C 1ODIA 3FPJA 2RI0A 3VBBA 3HYSA 3PQCA 3FOEC 3FDZA 1EG2A 1YITV 1L5HA 4JC5A 2GPYA 1IHPA 2CMDA 1V3UA 4URXR 1BQZA 2RHJA 3PFCA 1RHJA 4AS1A 1GO2A 4BBJA 4EFMA 1XUQA 1FMTA 4JU9A 5CRIA 2WHYA 1I7FA 3SJ7A 2IPLA 1NJ1A 1WCXA 4QXAA 4AROA 1X7WA 1SN7A 2AZ0A 1WUKS 3DV2A 3L0SA 4JJAA 1QRDA 4LQDA 4BOYA 1KEEB 4DN6A 3BEOA 2QYSA 3NWOA 3BCHA 1BQ0A 2AZMA 3ZDBA 2FNAA 1Z37A 2Q9UA 5KYXA 3HVJA 2G71A 3H2GA 4S1TA 2OO3A 3DEYX 4PXAA 5E6RB 1I94B 3FIJA 3V7UA 5EMNA 4ES6A 1OWMA 4V38A 3I6YA 4BATA 5BYBA 3C7DB 2CYBA 3RZVA 2GZSA 4A5OA 4RDXA 4U0KA 3P94A 5BR8B 4LUCA 4MUIA 2YIJA 1QH1A 4NEGA 1M54A 2G77B 1AQJA 16PKA 2Q73A 4LQ4A 5EMKA 4MI6A 1BN7A 1E8NA 4WD3A 3KKLA 3PPVA 5F1KA 6REQB 1W35A 4HDRB 1AY0A 1WXDA 2VJOA 2RHWA 2EIMC 4OJTA 4MROA 5CT6A 1BSMA 1JEDA 4QJFB 1VTKA 4L74A 5AI0A 5AUQA 3BWCA 3IJ5A 1E92A 3EARA 3N53A 4Y8VA 2XB2A 1WUHS 4OCZA 3A3KA 2VNIA 1VL8A 2ZJZA 3QPAA 2JGRA 4M1EA 4WY8A 4I9QA 5DZSA 5B1YA 5KB3A 1QAOA 1MP0A 3HCNA 5F5XA 1PV0A 3H1HH 1O6FA 3M5PA 8OHMA 3IMCA 1CZKA 1TQ4A 1U0OC 2B1GA 2ASEA 3B8NA 4JLJA 3KOXA 1NXPA 4P3OA 3I1YA 4J9YB 3IJPA 3C24A 2YQ4A 4YS6A 5JCOA 5CA0B 2DWQA 2OHOA 2PGOA 4QREA 2ON6A 3V1YA 3EUWA 4F4IA 2HHAA 2ORWA 3DMRA 4CEHA 1K7FB 3FGNA 4RJIA 4OB8A 4UBOA 1BHBA 2XB8A 2YINC 1U8UA 3QTLA 4B5KA 1EVJA 1ZRHA 1AHPA 2G70A 1B0ZA 1I1NA 3KU4A 3TKLA 1NBWB 3QV2A 4AIIA 4OUDB 3SMVA 5KYUB 1XZKA 1E3DA 1NP6A 1J2JA 1FYVA 2RHLA 1N77A 1GQ2A 3BHNA 4MLZA 1S2OA 5AYVA 1QX4A 1TMOA 5EG5A 3D4OA 3HB9A 4MUEA 2AC7A 1JAXA 2C94A 4LJLA 1PJTA 1JA0A 3F7NA 3M5DA 1RW4A 1N4AA 2D2FA 3EF0A 1YVUA 1VP9A 2ADMA 2UAGA 1GD1O 3EW9A 4JT8A 4PG7A 3NRBA 3CXHF 4M8SA 3KHTA 2VP2A 4TWZA 4W5JA 1O4WA 1NQTA 3ZXYA 5L51A 5FTLA 3CLKA 3M8AA 3HSSA 4GXQA 3GPDG 1JUDA 3I8OA 1GKKA 1GL3A 3C6MA 4YJGA 4ZFNA 5KHKA 5JQWA 5DXAA 1UFVA 1ES9A 1PDOA 4JYCA 2WR8A 2G9NA 2ZDIC 3ZEAA 2PFGA 4KQHA 4AG3A 1RYBA 4WNYA 1XMOB 1A7UA 3FHJA 1P4RA 3FGZA 2O2EA 1NMXA 3JSNA 2J0QA 4MV4A 1TO6A 3RYTC 3ANLA 3QI2A 2H2IA 5EMLA 2F95B 1FL9A 1Z8HA 3LPNA 3T9FA 2WJ4A 3S27A 2WLIA 4L3VA 1M2WA 4C2BA 1MLDA 4FM2A 1KJZA 1JR2A 1K2WA 5EE9A 3JQBA 1JNYA 3PIRA 4YIOA 3EVBA 2O7SA 3O94A 1KP2A 1PFGA 1UINA 2O8VA 2OT3B 3KYCA 4WLEA 1Z8NA 4DPLA 3ABOB 3T1QA 1GZ4A 2GVZC 2OB2A 5CEEA 4EVIA 1LFDB 2BFCA 3I58A 2RMKB 1P7GA 3EGIA 3FVVA 3I52A 8ABPA 5E7IA 4XJXA 3D3JA 1L8LA 4CCSA 4FOLA 2XV1A 2XDAA 1T10A 2YDXA 4ZC8A 3B8MA 3H5NA 3Q9UA 1RHKA 1EN5A 1XU4A 1WUTA 3OZGA 4DLUA 4XGQA 5TMBA 2GZDA 2WHRA 3C41J 1E1LA 4PSAA 1E9FA 1RYNA 1H0SA 4M46A 2JBWA 4WK6A 4LH6A 1WNSA 4YRQA 4C4AA 4O4HA 5K8UA 1Z3AA 1EFPA 5I5GA 2BP7A 1XBTA 3L7NA 2WWIA 3ISJA 2VP6A 4NSNA 5CG2A 2PU7A 5ES3A 1F5SA 2AZTA 2J4FA 3WNDA 1T2AA 3K6SA 4UPEA 5KHOC 1XAHA 2XB9A 2NPFA 1QDUA 1RSOB 1NU8A 1EFVA 4QEDA 3VR4D 2CW5A 3MQ2A 4KQ9A 4EVQA 1DTSA 2GARA 1AXEA 4OV6B 5DLPA 2GPNA 4H0CA 4LN1A 1YL6A 2QN3A 4KKVA 1SQGA 1KK1A 3S81A 1ADYA 3DZBA 4G56A 1MD9A 2Z8YM 1YR9A 2JF0A 2ZIZA 2XAJA 4OLHA 4QYSA 3VOBA 2CUNA 1ORHA 3RN4A 3LOPA 4BQPA 4LP8A 2B8NA 2PGLA 1NVGA 2PCJA 3N2YA 3VOUA 1CIVA 2FEKA 2PG3A 4J0CA 1GHTA 2JEZA 3LA6A 1WU8A 5TF4A 3RASA 5KLVH 2C1EA 1BWSA 4HSGA 4TN1A 1J33A 2QTVA 6ADHA 5IC6A 1XREA 2WLLB 1Q0PA 1TXGA 1URPA 1XV5A 2GAIA 2ZE5A 4QPJA 2IUEA 3PE3A 3TMKA 2J31A 1V8OA 3ZU2A 2XDYA 3ITDA 2H5JA 2C2AA 3M8KA 4D97A 4OYLA 4TKUA 1TVEA 4KO3S 4X6LA 1IG0A 5DECA 1PD0A 3EY9A 4YONB 5FTMA 3ZIDA 4GH5A 1KRWA 2W6IG 3MBKA 3N2EA 4XKJA 2V9ZA 2P1DA 4N6OA 4CTMA 4OLBA 4IDPA 3O8LA 4XIGS 3ZHBA 2RHTA 4KXFB 4WHMA 2XE7A 1X9IA 4TWRA 1ZBQA 2R1TB 4RZUA 3UJHA 1WULS 5F9MA 4KITB 4WZBA 4KQ6A 4YC7A 3HWX1 3OLYA 4EY8A 2HIGA 1WNTA 4CKYA 1PZGA 3W5DA 4YREA 4P2GA 5KYUA 3SX4A 1EUDA 4M22A 1SO8A 1JFLA 1Z3CA 3OFND 5LL6Y 1R8XA 2QL7A 1SCQA 3RFCA 1IL0A 3UGQA 2UZAA 5D01A 2BT4A 4R5MA 5HKBA 3A3YA 3NKFA 3H2BA 3GFVA 1BXRA 3V32A 2VTDA 1YCFA 4D9KA 1WBBA 4EEQA 3BPZA 1O94C 3GJQA 1O2DA 1W7AA 2WWVD 5C4IA 4M49A 2FWPA 4MVQA 3WXMA 2QY9A 3SZGA 4YAJA 4F2HA 5JNWA 4J7XA 5E0OA 2PXAA 4CTKA 1YCIA 1SUDA 4QUAA 1BGYH 1O03A 3E9NA 1AJNA 2ID4A 4PAWA 1TEVA 4R54A 4WESB 3DW3X 5EWJB 3U0VA 3V4SA 1W48A 1X9HA 2IODA 3FETA 3NCHA 5D86A 4E88A 4CUZA 1YZYA 4DE5A 1E1QG 2RGNA 3U4AA 4LF5O 4ZREA 3U1TA 4A73A 2PUHA 2MDTA 5DHRA 2FLVA 5JV5A 4RA6B 4F12A 3ZQ4A 5LIRA 3HWWA 5SICE 1TCBA 4M9RA 2FPRA 5GWXA 4EB8A 1XROA 3GD7A 1JQKA 3WLKX 5LUBA 4B9AA 3ADBA 1DOHA 1CIPA 1SAYA 3SZOA 4EYGA 5GTDA 4HDRA 4Q9LA 1WEHA 4LHEA 2G80A 3VTFA 5EJFA 3R9XB 4G0ZA 2XEXA 2ZXFA 5KTPA 3WGJA 3ZRWA 1U9IC 3C8HA 1WMAA 1KERA 2D8AA 4QAQA 2AJDA 4KFSA 5IT0A 3ZMUA 2KLHA 4UHFA 2EIMB 2O2SA 1CJSA 3B8FA 2P75A 4REOA 5AXAA 2VYNA 1A8QA 2ZBRA 3I55V 2YC0A 2GQ0A 4QGPA 2W8BA 5HJ5A 1NVVQ 2OCXA 2QDXA 2AMFA 2YZGA 1PUJA 3OJ6A 1I2BA 2HJSA 1KZ6A 2WABA 3JXEA 4IGKA 4XDZA 1HDCA 3SG0A 1MIOB 3NALA 4BMNA 3JPWA 3LO8A 4CDRA 1M1UA 3RFTA 2P77A 3UK7A 5A3RA 2VWKA 2YSUB 3OJFA 1Z2CA 2AOUA 2GA8A 2JEUA 2DOKA 3PC2A 1R5NA 1W4AA 3T15A 3HDJA 1E1NA 3ETCA 1P80A 1CP9A 1MJGM 3CC8A 4KZKA 1A9TA 2FPPB 3IEUA 1C9KA 3RRMA 1AS0A 3H0EA 1QTRA 1RWWA 5JDIA 1NHGA 4R0VA 2QZSA 1Z4JA 1ZJYA 4AG5A 1RE0A 4PCUA 4HB4A 4D8TA 3MXTA 3NHKA 3JAWB 1QHSA 4D4JA 5BR4A 3ILVA 1C0PA 1CRWG 2YMPA 3NG1A 3THYA 4DUGD 4LZLA 2HSDA 5FOTA 1D4ZA 2VZ0A 2HF8A 3M6IA 1YASA 3U11A 4DB2A 2OA0A 2R2GA 4NP6A 4Q1FA 5H02A 4C0WA 3QEBZ 3QU7A 4MMXB 1V4BA 2E0IA 4BIOA 1PUXA 2XGMA 1GPLA 1KI6B 1NV8A 4X8AA 1HF3A 3P5BA 4MGZR 3LDCA 4NTYA 1SKMA 3JX9A 1SNYA 4N23A 4WGGA 4ALNA 4BMDA 3TW6A 2Q3JA 4CV0A 1ML4A 4Z86A 3F7OA 4RFSB 2IUUA 1FSPA 2K7ZA 4QGHA 3W1VA 5AFSA 1VP3A 5F5LA 1JIJA 3ZBQA 4R40A 3BA9A 2PO5A 4ERXA 1DAGA 3QEMB 5M7EA 3LKZA 3QITA 2F3UA 4AJJA 1OTYA 4QPJC 2W6JA 2DHQA 3U7QB 4XUCA 2PUEA 1HNNA 1U6JA 4PAGA 2QA5A 2W6ID 1OYOA 4LHYA 1M9NA 1P77A 3RHSA 1BSVA 1T8YA 3M5CA 3HXMA 3H9BA 3V46A 3QRWA 3WG9A 3KQHA 2NR5A 5CM2Z 1N9GB 2JL1A 2REOA 3LBAA 4O2AB 1GV1A 2ZYAA 3TNLA 3VISA 1YTFB 4BFVA 3GPCA 4OHYA 1JSLA 1QRRA 2VDRB 3R7BA 3KQPA 1JFFB 2A4KA 1BW9B 3EC7A 1U11A 2ZJOA 3RWMB 4B83A 3LBIA 5LA6A 1YZFA 3DDCA 3M83A 1VKOA 2GO1A 1T1IA 3C3SA 2H57A 3A25A 2UU9B 2BFDB 3D1VA 2P2CA 3PRHA 4K9PA 1PW5A 4CLDA 3QHQA 2V3CC 2AGVA 3ECSA 5JT1A 5A6VA 1LQUA 1TDJA 3IPYA 1AZWA 2HMTA 4BFXA 3L8YA 1AKWA 2B34A 5FOSA 1BVRA 1Q95A 5K99A 4RVSA 2C9CA 3F8SA 1OXBB 2GUZB 1LF5A 1T2VA 1DBIA 121PA 2MIIA 2X2EA 3IAUA 5EQTA 4ZCSA 2IYAA 2W48A 5DMXA 1NJ6A 2I8LA 3O0TA 4ZT5A 1Y3FE 2PTMA 3CLHA 4G84A 2Z8XA 1B00A 3A2LA 3ZD7A 3C6ZA 3L5OA 1E6CA 1PLKA 5JFTA 4HHEA 3UXMA 3CD6V 3O95A 4PYRA 2JRLA 4LDAA 5IU6A 1TQDA 1IUOA 1T4CB 2AHOA 4ZO7A 3SQLA 3WI7A 3AXTA 3UJ8A 2VI5A 3FFWA 3NGLA 1J8MF 3ZV6A 4RTSA 1UK8A 2B7CA 2VJCA 4DC1A 4IAOA 3GWKC 5TGDA 1AI6A 3FB6C 2PA3A 4QBHA 3AWIA 5DIFA 2G4CA 3R23A 1E6UA 2CDNA 3M5WA 5KHHA 1Z0IA 3QO5A 5LB2A 3KYCB 1U28A 2OT5A 1VQKV 1JU4A 3TCUA 1ZM9A 2ECOA 2FB9A 2FK8A 3C48A 5DO9A 4MT8A 5T4HA 3U81A 4IHJA 3LO5A 3HGQA 2IL1A 4HAIA 5ICMA 4MAMA 5AI8A 1HYQA 4PSVA 1TUGA 2E5LO 4HLUA 1W6RA 2BP7B 3KHUA 1SZDA 4H6XA 4I3GA 3RGGA 4OQPA 5TJHA 4B6JA 1I2MA 1LBEA 3M6UA 2V7BA 3PCTA 2JLZA 1S5JA 2OCPA 3H2ZA 3K0AB 3RQSA 1P0QA 2A33A 1PS9A 1A2BA 3NTQA 4WBNB 1NSTA 2PMBA 1EGAA 5ENDA 1RC1A 3G8CA 1YTLA 5AI9A 3AIMA 2FOXA 1LX6A 5ALSA 3E9EA 4Q24A 1GXSA 1R10A 2JI9A 5JJ5A 3CCRV 5JG7A 5AW4A 5TMPA 1AJQA 3NT2A 1QNLA 2XKJE 5KX5A 1C3OA 5HTKA 3ZCVA 5HKAA 4UQOA 2D3WA 1HFKA 2F59A 4FP9A 3CSDA 1FFTB 1BFUA 3WMRA 1ISGA 2Z5VA 2WOOA 3FCCA 3UCSC 1ZRSA 2HXSA 3SQMA 3PUIA 1E1CA 3K96A 4Y7CA 5IJZA 1W5EA 4K3VA 3MCZA 2DYRC 2IEZA 3QYJA 3NPAA 2MSLA 2WUEA 2BKEA 1BA2A 2PD6A 4XIFA 2GEKA 3HB0A 1GK9A 3GLTA 5D00A 2Z2KA 3UWMA 2VATA 3C45A 4Q7QA 5KAPA 1H2YA 5FBQB 1ZONA 3FY4A 1PU2A 5DFAA 1VECA 3WB0A 4R16A 3VC1A 2A9JA 2F3TA 3CLTC 1E0AA 4GKKO 2WFLA 5TRTA 2FVXA 3UMFA 5IEJA 2ZZKA 3EA0A 2UYYA 3IEXA 5IVDA 1FRQA 1ZITA 4WERA 1MAHA 1ZVVA 3NIDB 3TAHA 1PJ3A 4HWOA 1R3DA 5A62A 4KWHA 4G5XA 2QMEA 2VQEB 1AKUA 1GLNA 2YNMA 3R6LA 3FPGA 4N3GA 2YFYA 4PAOA 5GJCA 4E46A 1HZZC 2ECKA 1M1NB 2AYYA 2D5IA 5DW3A 3RU3A 4U7OA 4YA6A 1K5HA 4MDFA 5K8VA 2PZEA 3W77A 1ILWA 1Z08A 1OX6A 2QA4V 3M81A 2O8FA 1SC6A 4Q20A 2OWDA 1F1BA 3BMNA 2PLAA 1VF5B 3K08A 2IBZH 4PYNA 3KNZA 3N7UA 4X3OA 2XW6A 4ONEA 2BLLA 5COAA 3DT9A 4MVWA 4B48A 1M1YE 5CBGA 1CB0A 4WZBE 1CD5A 2Y3IA 3AQ4A 5DYWA 3RTEA 3TFOA 4TRJA 5GOZA 1BC5A 2ZITA 4ZQFA 1L5GB 2QTBA 3ZCRA 3IDSA 4ZAXA 5A5VA 3K0CA 3GJ4A 2A5JA 4HGQA 4HSEA 1C7QA 2ZXWC 4KQGA 4YJFA 1YJCA 4AF6A 4M98A 4XI9A 2DLDA 4G25A 2QE6A 3P2OA 1GQSA 1JVNA 1MOPA 1MC8A 2WA2A 1P1JA 3LXUX 3U44A 1YVWA 3LKVA 4RDCA 3A31A 3LFHA 2R9IA 3MHHC 1VLZA 1G5TA 2HBQA 4OHCA 4WFHA 2AG1A 3QLJA 4HDSB 2WWHA 3WRVA 3DHVA 3S0JA 5KVSA 2ZYVX 5AJUA 4Z8XA 3IJEB 2Y69C 4XVRA 4CEIB 4P4TA 2NTEA 4FWBA 3P4XA 4HH4A 3D4LA 2JD2A 4NI5A 1E8DA 4Q02A 1ZJ4A 1UUFA 1L0BA 2V3VA 1FFCA 2PH5A 3RG2A 1EK1A 4QOIA 3D8HA 3PNQA 4TTAA 4B45A 3HC7A 3OZFA 5EHIA 1NP3A 3DXXA 4J1TA 5EHXA 3RUDA 3JQ8B 1Z2EA 3ANSA 3V9AA 4US1R 6Q21A 3H01A 4J1SA 1BGXT 3MBOA 3TM4A 4JI2B 4JZ2A 2RB5A 2CLHB 2UXDB 2EAUA 4ZVPA 1OI2A 3S8YA 3OO1A 4R7GA 1FSZA 2ZJ7A 1DARA 5DTMA 2GJSA 5E7MA 3QE9Y 6NULA 3UV6A 3NHFA 1DIHA 1Y7IA 2BGUA 3A6ZA 3HZOA 4RSHA 3TXXA 3VKUA 2WWYA 1W36B 2QZZA 2Q2WA 4IXDA 4LOKA 3UF0A 3N39C 4OHFA 4AP6A 3HP7A 4QECA 2OORC 1O0CA 1A98A 1CUJA 5COBA 4GUNA 4JEIA 4MRPA 2FG7C 4MRAA 3TMAA 2R87A 3VGPA 4YT5A 3HP1A 2VNHA 3KD3A 2F17A 4HNRA 2G88A 3ZHRA 4E2XA 3KYDA 3AM1A 1RWMA 2RSLA 3ORHA 5BXQC 1X1AA 4MVUA 1QQ5A 1W9MA 2GPBA 4LJKA 1UADA 4V24A 5I47A 5A9SA 1K4CC 5KEIA 1UBGA 1K9MW 4BWFB 5A03A 3G5UA 4FSDA 1BD4A 2ST1A 4QARA 4C7XA 1P4AA 1W36C 4R1NA 1V16B 3DC5A 3TM5A 4GLXA 4KLRA 2YOFA 2VN8A 4X85A 3WE7A 3P30A 4IJKA 4ZALA 4E5UA 1I6WA 4WFGA 3WK4A 1L5YA 1R6KA 1YTFD 4LG1A 3M9XA 2PX0A 1HQDA 2XQKA 3TOZA 5DTQA 4CNQA 5KHLB 3NP7A 4K1RA 2YUTA 1JDBC 2GD0A 4CH3A 2XQFA 1L7XA 4R51A 4RQUA 4ZQIA 1E2GA 4IX9A 1W75A 2GYWA 2WIJA 1I3LA 3SBEA 3OA2A 3AG3B 2YJNA 3KE8A 3TOSA 3WWPA 3NETA 2ZT6A 5IM5A 3ZVKA 3AVWA 2NYTA 1EXMA 2QOEA 4P3NA 1F9AA 4U6QA 3I09A 5FI3A 3HY4A 4EFDA 4EO7A 4YV0A 3ADOA 3QK7A 1R5BA 3DTVB 1PAUA 3HK2A 4YAGA 5T57A 1DFIA 3D2BA 4Q3OA 5SY6A 1VF6A 4NQRA 1QDEA 3RJ9A 3RVYA 2C99A 4QPKA 3RS3A 1YE8A 4L08A 5NLLA 1J9GA 3UA3A 2W5UA 1GPH1 3AR8A 3FPFA 2Q0XA 2VYVD 3C8MA 4RA6A 4F3RA 3OJ0A 1LC0A 4LFAB 2B2NA 2L18A 1VYUA 2JLAA 2V6JA 2RE8A 3F98A 3F4KA 4JMPA 3CISA 1H69A 1SKYE 3VJMA 3LD9A 1QQCA 1UPGA 1XRQA 2IHJA 3JVIA 4FM9A 1BG6A 2WHPA 5KMGB 2Y93A 3WBKA 5IH7A 3G5AA 3G2LA 2IYOA 1KC8W 1SD2A 2Q0AA 3RSHA 3KEQA 4ZAWA 4E12A 1WVMA 5CFZA 1GA1A 2FFJA 2OKGA 4AX4A 1D5CA 4FMDB 3EZFA 2NSLA 4C5CA 2CN1A 2E5LB 4Z3DA 2C4WA 1AMOA 1YVRA 2ZUEA 1NY6A 3DLCA 3NVDA 4QATA 4EY6A 1PT9A 1Y3IA 3HRIA 3N8IA 4RYDA 5J1TB 1L4BA 3KJFA 4PQGA 1GYPA 5DNYB 1H23A 1QOZA 4Q6BA 4WZBB 4F2GA 1BQ3A 1E3LA 2O3SA 2PZKA 2QN7A 4CU2A 4D6XA 1COZA 2NXNA 2ZVPX 3FDXA 4FHFA 3V42A 4EQ6B 5KYWB 3ESQA 1O57A 1QGUB 1H66A 1O97D 5JRZA 4C07A 2WHEA 3ZUPA 4D7SA 1X7YA 1XJWA 1RBQA 2ESRA 2IPNA 2E5WA 3KB8A 5DYTA 3C3AA 3QFCA 4LCNA 2LGWA 1Z75A 2HLNA 3C14C 2JRCA 1VP7A 3IPRA 2AFHB 3EIOA 3GNSA 4Z9XA 2Z58A 1Y42X 1N7GA 2IWHA 2G76A 4WCDA 4DJJA 2YZNA 1GUAA 2HF9A 1DSSG 2Q1TA 2RK4A 3LNCA 4HQFA 1UBOS 3SAJA 4UMEA 1WEKA 3MQFA 3NHPA 2QLLA 4GF5A 1KAHA 1NRJB 1WY7A 5DPMA 1NE7A 2HLDD 4HZUA 5HIMA 4BWGA 3HNRA 3EIWA 1Z47A 4CF5A 3SPHA 2YWCA 1T3SA 4DO2A 2IOYA 3I12A 4JR2A 5K4HA 4O5AA 3WTBA 4R41A 3VHXA 1KWKA 1VHTA 3PHHA 5A4IS 2EIJC 3GJ6A 2QGFA 3LNMB 4YRBA 2IWRA 2MSNA 1QVFU 2PUVA 4JYPA 3QFSA 4ZV4A 1GGJA 3PP8A 1H2GA 1VJDA 1A4UA 1C2YA 1FRZA 3OAAD 4WKCA 5DM2A 4ZGGA 5JLJA 2KKSA 4E94A 3UQ8A 3TJRA 2J33A 3HUUA 3EGWA 4NKRA 3RQIA 1VJTA 1Y3HA 4RKYA 5IF3A 1RPOA 2X7RB 2AQHA 4YFVA 4CGYA 2HJDA 3A36A 4YPOA 3CRRA 4U1RA 2BI8A 1Y5IA 1JALA 2FUKA 2ZIOA 1CS0A 1NATA 1NYRA 1KK3A 3MJHA 4FSXA 4BQRA 4DDUA 2UVPA 2R44A 5AM2A 2P65A 4V02A 1SCNE 3IE0A 1PZHA 2PBLA 3LCRA 1EN4A 1DEXA 2BEKA 2CWWA 2NT3A 2OB1A 3F5MA 3M6AA 4OHXA 2PUTA 1RFLA 2I2BA 5LDGA 5LL6P 1GSIA 1UWCA 5KJ6A 1CHNA 5CDYA 1RWBA 4MNTA 5AM5A 4HQOA 4BZXA 4CTOA 2W2LD 5DI3A 2DLNA 5CK4A 1DDGA 3BWVA 1RJGA 1I3KA 2RMKA 2V58A 2EKLA 4M8LA 1YAHA 4MUFA 5JXGA 3U2QA 1F2DA 1AGPA 4J2OA 4NCKA 1JR3A 1N3BA 1E62A 1MW8X 1PVVA 4KO8A 1CC1S 1GAQA 1ZN8A 3PL5A 4NNOA 4P3KA 3MWLA 3EGXB 3ZKWA 2W4LA 4MVJM 1B43A 1JQAA 2WVAA 1XRMA 3K9NA 3O4IA 4YUVA 3VJLA 2FR8A 3HB1A 2X1LA 1SXQA 2NLOA 4PO3X 4TRRA 3GOQA 5EJ8A 2I5PO 1XHXA 4B3TO 3GLQA 3IR6A 4KBGA 5LMNB 1OOEA 3CX8A 2X6CA 4L16A 1TVCA 4OSPA 3I8SA 1DQSA 1GL9B 4UJ3A 5DHAA 4C03A 3COZA 5HE9A 1LBSA 1G2PA 3IO5A 3KUKA 3U4IA 4DSNA 4K9MA 4EL5A 1C8BA 1NF3A 4LRTB 1N5IA 2CJWA 3LFUA 2L19A 2X9LA 1UDXA 4I6GA 3EFOB 4X8HA 2XNJA 1SG0A 5ESDA 1QC5B 2IPMA 4KHPB 2VZLA 2WTBA 4JQZA 3WMFA 4E4TA 3BMXA 4LWOA 5F33A 1UEJA 3CN9A 4JI1B 1G8PA 3P0HA 2IOFA 3NEJA 3T5PA 1RLMA 1TJNA 3WDLA 1PX0A 5F5NA 4FW8A 4IL6Z 1P7VA 1TC1A 3RU7A 4QBIA 1IM5A 2OPHA 3IEPA 4JS0A 3VOAA 2WU8A 2GCGA 2IZZA 2XXAA 4HOYA 1EFAA 2Z98A 3O1HB 4XQ0A 1FXWA 2FMKA 3CX6A 3AJDA 3F46A 4IP0A 1EUYA 5E3HA 3I9V1 4PC7A 3PSAA 2DFNA 2H6EA 5CPBA 3I9NA 4HAVA 2CLCX 3STZC 1DC6A 1GNSA 3TNYA 3H4VA 4R2IA 1ZMOA 4PONA 4DIMA 2JG3A 1IOVA 5LB4A 1GV0A 2GHIA 2V3WA 3HLKA 1SUPA 1W34A 1II9A 4O8CA 3BZBA 1I4TD 5DX8A 3UK0A 3H1BA 3ORSA 3LCUA 3R0IA 4YCCA 1K5GA 2POCA 2ODPA 3ZCXA 1U4NA 4BEWA 2P78A 4M6WB 5K03A 1CHDA 1VE5A 2AOTB 1NQOA 5EIFA 3IILA 3SGLA 5FPOA 5HE8A 4BAGA 1LNSA 4Q18A 3JAMN 4XWWA 4NJEA 1AQLA 2ZJ1A 4ND4A 3E05A 4FIZA 1YR7A 3HDTA 1RTKA 5D7NA 1XQ6A 2BFDA 2DJIA 2AD5A 1H3NA 1X38A 2C84A 4MLDA 4NE7A 1ZH4A 4RK1A 4WK2B 3ZK9A 3ZWYA 5K4GA 1G6Q1 3CNOA 3WBJA 4A91A 5CLJA 1E5XA 4PGHA 5E4JA 4NZZA 3H87A 5F1OA 2XCLA 1APBA 4WX2B 4XCQA 4XXHA 2YWXA 4LSGA 1KKLA 1DF5A 1FXWF 4CLRA 1N2SA 1F2UB 1XYYA 1H6DA 3PQ3A 1B2RA 1EDOA 1AGYA 2XUZA 2GHTA 5CIYA 1UMBA 4DEXA 2OC9A 2WJZB 3HU5A 1XTZA 2DWUA 1FB5A 4RKEA 4CDNA 4XOIA 5A3JA 3VZPA 1GT91 1DJOA 3F7VC 3CTMA 4HCJA 1OH7A 2VHVA 2ZAGA 4LYFA 1VCOA 3UZUA 3WICA 4WTOA 4RHYA 2WWFA 1M2FA 1XA3A 4KFCA 1Z7EA 4ZEWA 2NQTA 4RF2A 1OI3A 3QE4A 5TX7A 5H70A 1XMVA 2BBSA 4O4LF 4A23A 1EEHA 5D7BA 1IHYA 1Q19A 4IVNA 2XUPA 4NDZA 4ETIA 1QO7A 3VU3A 3ICVA 1Y80A 4PZCA 4W1RA 1B76A 5EZQA 4TYYA 3L74H 3B6EA 1NBME 2B2CA 1ZK2A 4WL0A 3FPBA 4B8ZA 5IVHA 2HIAA 1NM5A 4H6WA 2QDKA 1H3FA 1ENZA 3QLVC 5AVXA 2HP8A 1AB3A 3LZDA 2QTZA 1NVFA 4IDDA 3W7SA 5HGJA 4DC0A 2CB0A 4OJNA 1ETUA 2KI5A 1K3UB 5E6SB 3WLSA 1B16A 1NC1A 4UCQA 4EEXA 4CUKA 5M34A 1XMPA 2I62A 3GDOA 3K7EA 1VF6C 3T9AA 3DUWA 4GNRA 1HE5A 1TYEB 4W63A 1ZUNB 2QIPA 3X1ZA 2BR5A 4B17A 4C21A 2R4TA 1XEXB 2PZGA 1OLUA 3B70A 2HQ1A 1GVNB 3JQ6A 2R1ZA 3D0KA 4HB0A 5ECYA 1TU0A 3TG8A 1W8DA 2VYFA 4FK8A 3DWIA 1UCFA 4GGOA 3DFZA 3TTXA 4DIEA 2L35A 3FG9A 3NWPA 3X43A 4R01A 3PC6A 2FTKE 4WA7A 5IYZA 3AEUB 1U9YA 2ZWIA 4B7AA 4FLFA 5AKZA 4G0NA 2JFFA 3LCJA 3W4JA 3M4JA 4D96A 2AUMA 3ZQJA 4EAQA 5U4QA 3NZEA 4J3FA 4B7EA 1XEWX 3BE6A 3P71T 1D04A 1F0KA 2C83A 5MFZA 1R8YA 1EGHA 1G5RA 1QG4A 4JI8O 1ZZGA 2REQA 3J7TA 4GZ5A 5CMLA 4YXFA 5IZCA 1MU0A 1YU6A 2G0TA 3WL3A 1KQPA 4GYWA 3ML1A 4O0LA 1R0YA 2R6CA 4DV7B 3F5FA 2EWMA 4NJOA 1J6UA 4JJGA 4P30A 4I5GA 5ALOA 2GD2A 3KTDA 4FXPA 5B3LA 2J5XA 2VUIB 3O1LA 3H8WA 4E5YA 1EM6A 4CMCA 3L0IB 1IZ0A 2H48A 3RUCA 1MCZA 5LYYA 3NBMA 3DVSX 1E9DA 3DEFA 3GVCA 2D1SA 4UCXA 1WD7A 4Q9KA 1UDRA 5LWQA 4FHEA 2JIPA 4R7CA 1XFAA 4JAAA 3QFTA 4KP4A 2ODWA 1G21A 4HLDA 3ZVRA 3KZIZ 3ENWA 3LYHA 1SBHA 1TAEA 4JI4B 2WSYB 3IIEA 1YBVA 3NCTA 5EXPA 5FIUA 3BXFA 2GPSA 4OQ4A 2ZEJA 3R2NA 3LDGA 1DT5A 4RD6A 1CZRA 5FQNA 4NYKA 1I13A 4JJ7A 3VNSA 1TEHA 1TFUA 1VRVA 5LXTF 2LNDA 3E58A 3JQBC 3JQFA 2O8CB 5DWVA 4GOMD 3OZDA 2WAXA 2WLKA 1T4MA 3EJWA 3HR0A 1AK9A 1YFZA 3NASA 5C7YA 3ELYA 1ZUHA 3SSMA 4DMMA 3SSOA 1UOOA 1RC8A 4QUJA 1ODLA 1SXPA 3DE0X 3HS3A 1RIIA 2R66A 2FW9A 1EDZA 4JYMA 3KQVA 3AVXA 1XDWA 3E6AA 3PWKA 4F96A 5AVUA 3E03A 4N0MA 4XEHA 2BKLA 1V7QA 3F3MA 3GWGA 3HJNA 3KPJA 3RUFA 1AO0A 3UXYA 5B4TA 1T36A 2Z2YA 4BP1A 1N1EA 1R9MA 2WM8A 2ZBFA 2RB4A 3B51X 4P4SA 3WK8A 4TMKA 7REQB 3THXA 2APJA 1DQZA 1OI7A 2WMDA 4PLHA 4FFBB 4QTXA 3VDXA 4UVDA 1Z5PA 3OQIB 4G1VA 5JQGF 4Z51A 1F3OA 2I67A 4FYVA 1A0OA 2I65A 1G20A 3FHOA 2I4LA 3W5BA 4FWTA 3UNXA 4QXRA 5GAJA 1JECA 1U2GA 2FN8A 4QYWA 5EMJA 1JI3A 3TIFA 4B85A 4EMUA 2QBYA 1UOPA 1D0VA 3BWDD 3G2JA 2X5XA 5CA1A 3GIDA 3ACDA 1T4BA 1HQKA 4QXPA 5LQJA 4KHZA 5ELXA 4DJEC 3CC7V 3EGCA 1ONSA 2W37A 1W30A 4U00A 4AJIA 1IN4A 3K0GA 2XE8A 3WC4A 1U7HA 1YS1X 4JLMA 2ZCJA 2YICA 4UCTA 2WT9A 1M1ZA 2IKQA 4RIGA 1E61A 5EK0A 2WWXA 3URMA 3LC1O 4QZVA 2EJTA 4V0MA 1E2UA 3JRNA 4ZVKA 2HU5A 1EE9A 3VYTB 3ZTWA 2HC9A 4DLNA 4M8KA 4G5YA 4P34A 4Q9AA 4ER5A 4HNVA 1NR5A 5L3EA 2P5OA 2FDXA 1QSGA 2MR5A 2G63A 4NX2A 3ZWVA 5HCUA 5LN1A 2YZ7A 4UBKA 2AHYA 4BNHA 2QRKA 1C80A 2WPDA 3AJEA 4I4TB 4FU0A 3NEAA 4ESHA 4AJNA 4V0RA 2PO7A 2OV8A 1A95A 4DZRA 3JR3A 4GR4A 1O6GA 3KCQA 1L4KA 3NNNA 4FQ7A 1F5NA 1UJBA 3N8GA 3NKVA 4GWGA 2YV2A 1RPJA 3MPZA 3SR3A 2BGIA 4M6WA 4C0KA 3HVIA 4AJLA 4Y2RA 2MJLA 2MW2B 1Z4OA 1X8KA 3R3JA 2XXBA 2BM8A 1FS4A 4OHMA 5B57C 1HGXA 4KRGA 2ZAOA 2CFSA 3PXBA 4LH7A 1JDZA 2NV0A 3V7YA 3EXEB 3K72B 2DQYA 3HEBA 3SHTA 1XYGA 1B41A 1Y1TA 2GN8A 3LUPA 5TEWA 1Y89A 3PLRA 2B92A 4KLAA 1Q0QA 2ZR2A 3KAPA 4RQTA 3W5JA 2CHGA 4I1OA 3GFOA 3K58A 3NAGA 2G25A 1W1UA 5IDXA 3HVRA 1PS0A 3GH3A 4EATA 2F2TA 5C8YF 3DOUA 3ZH9B 5CBKA 4CHGA 5KYTA 1C0IA 1L0NH 1Y33E 2QP4A 4WCFB 1LBHA 3N86A 4RNDB 2QZ4A 5KSPA 1CUIA 1UKEA 2CNBA 4RTNA 3IKTA 2JAQA 3WYAA 1I7PA 5DNEA 3QEAZ 1IRIA 5CVJA 5AOAA 2ZRMA 3CX4A 4PX2A 1PPJH 4XD7A 3AK1A 4B0PA 2UZ1A 4R2WA 2HK6A 3PVZA 3A3PA 2C9OA 4JSRA 4EUFA 3TGUH 1A5ZA 4JFRA 1FPQA 2QK4A 3EMVA 4RVOA 1NA5A 2EJVA 5ALHA 1H4VB 4J90A 1PF7E 2Z6UA 4B2YA 1NJGA 1BE1A 2V74B 1R18A 1UKAA 2HU8A 1KYZA 3KTAB 4QWMA 2J7PA 1GG5A 5FPSA 3JWJA 1HC7A 1C1DA 3IO3A 1CDOA 2LDXA 1S0UA 2YZKA 3D4BA 5AHKA 2CLMB 3AZPA 4NS1A 3ZZMA 2POQX 2I76A 5EXEA 5JMPA 1LW7A 1XVAA 3TINA 1X92A 4G86A 2O0KA 4C2UA 4Q1BA 1XC7A 3P9XA 1DC7A 2PS1A 1U7UA 2ZBVA 4MR7A 3JQFC 5H82A 4W5TA 1I1OA 4CFZA 1LRLA 4OI2A 1DKOA 3LPDA 3PUZA 1BN6A 3DEZA 4LJSA 1KMNA 4W5NA 3GLHB 1GKIA 2QR3A 3GUYA 5GVSA 4QYIA 1JHUA 3DBHB 4LHVA 5CGQB 1USIA 4MV3A 1YSBA 4OX9Y 2AK3A 1KH1A 2V1DA 4GNKA 5CX1A 5BUSA 2RDCA 3AIKA 3VUEA 1Q1BA 3H83A 5AJVB 4K46A 3GLKA 1T9CA 1XNHA 2O06A 3DG9A 3PHCA 4ALIA 1DBQA 1RRKA 4OGFA 1GLGA 5K3AA 4EHBA 1DX6A 1Z7WA 5FWDA 2FSUA 1SWWA 4EELA 3G6WA 1J07A 1YB5A 3A6FA 5JZ9A 1IXMA 2XWJI 3PQ5A 2NUTA 1TIYA 2QZ9A 1MAVA 1QR2A 3TSYA 5L9AA 2QYTA 2GZAA 3H86A 1I2CA 1NFRA 2HJFC 2YFQA 3CUEF 3KRTA 1XZAA 5EJ5A 4Q47A 5B5EZ 3Q4HB 1FPOA 1XEAA 2NACA 3IPLA 3LUJA 5LBUA 2AI1A 3V8VA 2GDJA 4NB5A 1G3RA 5KNBA 2I7TA 1QK4A 4URWR 2DC1A 3WO1A 1Y74B 1POWA 3FBTA 3PRYA 5GTIZ 2L42A 1JLKA 1GT6A 2QRJA 1FYDA 3LUCA 5EWMA 2ZZNA 1EKXA 3AOGA 4NPHA 3WAGA 1AJPA 4UXHA 1UP4A 4KK4A 1L6IA 2JFUA 1L9KA 4C04A 2IDJA 5DT2A 1NBMG 3PR2B 4I0XB 2IDKA 3K9AA 2NO5A 1IIRA 2ZYWX 3QWBA 4FZ3A 3QJ5A 2IHZA 2GZMA 2XXJA 3PDCA 4YRAA 4R68A 1N0NA 2PRSA 2PSJA 2CAZC 5EAIA 3UQZA 1LUWA 4X62O 2UUBB 5JVDF 3WP0A 3GLGA 1R5JA 2OO7A 3VHLB 1BGVA 1OTHA 5P8WA 3WMEA 4HV4A 5M04A 1R3JC 1K6JA 1KKCA 3DZIA 4IV5A 4BMZA 1A8UA 1NVVR 2X6QA 1QTIA 2JFNA 3OOSA 4IXMA 4C0SA 2RIRA 5JZVA 5KSOA 3DD5A 2QIOA 4V0SA