1PL0A

Crystal structure of human atic in complex with folate-based inhibitor, bw2315u89uc
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
589
structure length
589
Chain Sequence
GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Crystal Structures of Human Bifunctional Enzyme Aminoimidazole-4-carboxamide Ribonucleotide Transformylase/IMP Cyclohydrolase in Complex with Potent Sulfonyl-containing Antifolates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
total genus 201
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pl0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pl0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A02
1P4RA 1BXRA 2B1GA 1M6VA 1PL0A 4EHIA 2B1IA 1C30A 2X8WA 1B93A 1VMDA 4A1OA 1S89A 1OZ0A 1S8AA 1A9XA 2IU0A 1M9NA 1C3OA 1JDBB 2YVQA 1CE8A 3ZZMA 1ZCZA 5H3LA 1CS0A 1PKXA 1WO8A 1IK4A 1KEEA 1THZA 1EGHA 2XW6A 2IU3A 1G8MA 1T36A
chains in the Genus database with same CATH superfamily
2VAMA 4OSOA 2I99A 2UYQA 2UUOA 4KXMA 1Q95A 1LH0A 4Z99A 2WSSA 4JJGA 4D8XA 3MHPA 2FZGA 4PA7A 3S3WA 2WHPA 4ZT5A 5TV2A 3QXJA 5LKAA 2H0QA 5BT8A 3HG7A 3PUZA 1CUCA 4XQEA 3D3JA 5IHPA 3I2IA 4IDHA 4O1HA 4IJKA 3KL2A 4YMSA 4XIGS 1QK5A 3RFCA 2PWBA 1WCWA 2D0PB 2KQXA 1AILA 1TJ5A 1ZWLA 4NZOA 1J1UA 4LFCO 2QWPB 1KO5A 3DO6A 3ELYA 2R4UA 1MZVA 2M32A 2VXCA 3GPIA 3UT6A 1UC4B 3HZRA 4CLDA 3N6RA 4KGZA 4M7RA 2HX1A 3H2GA 4RPIA 5JFGA 2JFNA 1YTFB 1OFHA 1VYHA 4P5EA 3PXGA 2JEUA 3D3WB 5HW0A 3NHSA 1TLFA 2QNBA 4PX5A 4KITB 1KWKA 3DYBA 1GGVA 2OE2A 1SG6A 2ZJ7A 1GN4A 3L41A 2GD1O 1KYVA 1SBHA 2QTLA 1ILEA 4EI8A 1D2CA 4I4TB 2FSGA 1IRXA 2DFLA 5H3CA 5DM70 2WABA 3HYRA 2VUTA 4WXPA 5LHHA 2CEAA 2NLOA 3J81N 1U4SA 1OCZC 3ZE1B 3IYLW 3UK2A 4ZARA 4TKZA 1O54A 1BMFA 5KAFZ 4JA2A 1AHPA 1M10A 2BISA 2WA1A 2GK7A 4OI2A 4NMXB 1M6HA 2AV6A 3IEKA 3VTAA 3F73A 5FPKA 1E1QD 1Z17A 5F4BA 2GTHA 2I65A 2FR0A 1TK3A 3IQHX 1I7SB 1V9LA 1IMOA 1HX7A 3LCVB 2YWBA 1V6SA 4Q15A 3TAUA 3LTEA 4RX1A 1ELOA 5JYCA 2F67A 5J4KA 2XMZA 1NVUQ 3PTAA 1OWOA 3SJAC 3HBFA 3D8TA 4I1UA 5TS2A 2WBLC 2I2XB 5H6QA 2ZRAA 3MWLA 4ETIA 3WLLA 3ZY5A 1W36B 1GT6A 2QSAA 4RPCA 4KLNA 4ARUA 4MTGA 1LBHA 1OX5A 4CZ2A 3CSUA 1CUIA 1CR4A 1I80A 3HVKA 3AEQB 3QVLA 4F4CA 1Q74A 4QTUB 4CCAA 1N9GA 1XLTC 1RR6A 1H2BA 4RK6A 2XZDA 3GROA 1DO8A 3JQAB 4IBOA 5DW3A 1VPVA 2RONA 3KLBA 4EYKA 2JGEA 3HY4A 1Y89A 3ZDDA 2IFTA 3CLHA 4EPWA 4UUNA 3CC2V 3AY7A 4LSWA 5HOEA 2IU4A 5EERA 2FY8A 2Z4RA 3DWIA 5ALWA 9ABPA 1Q0LA 3AH8A 4DEYA 2YWRA 2EZPA 1DT5A 1ZESA 2ATXA 4ESVA 2PN1A 2HFKA 1OVGA 3I23A 4JXZA 4P3KA 2OO3A 4J76A 1SOMA 1AJNA 2FOXA 4FLFA 4OXXA 4YC7A 4CMIA 1SA0B 4GI3A 4ZZ1A 2F9LA 3EGWA 3O8CA 4NCBA 4EG8A 4Y7CA 3L82B 4R9UC 3ABOB 1C7JA 4MHTA 2ZD9A 1C3XA 2AEMA 2IHBA 3CPHA 1M1NB 4I6GA 1D7OA 3A3PA 4QTXA 3ND6A 4QBGB 1RI2A 3AP3A 3G2MA 3DM9B 4GE0A 1NUHA 5CVEA 2Q28A 3N0RA 3N8GA 4OLHA 1CX9B 3V4VB 4FQ8A 4G65A 4MXDA 2XE8A 5DM6V 3HQ4O 1FYFA 2QWOB 4ER5A 3N5KA 3OAAD 4EECA 1ZN8A 1QLEB 5G40A 2NU7A 1N0NA 5JZBA 3BWXA 3K0GA 5LQKA 4QU5A 2A3QA 4CFYA 3N2EA 5FL7A 4MRAA 1ZRHA 4MA0A 4E5PA 1L7AA 4DLSA 5I7OA 3AV3A 4RAOA 4WQMA 3HRHA 4JCCA 1AA9A 3UA4A 2WLLA 1CE8A 1E6KA 3T5AA 5LQSA 2IUTA 4IIBA 1LPNA 2A0UA 2IEZA 3D54D 3GIDA 4MMXB 2ZUDA 3KPYA 4Q34A 1ST3A 2J0UB 4J1QA 3BMNA 1ATZA 4I9HA 2NTJA 4DIOA 4KQ1A 4B0PA 4FC6A 3ZHBA 2SKEA 2FPKA 5CLJA 3SLKA 2HJSA 4MDHA 2HRRA 1HR0B 2JCGA 1YB6A 3MBOA 1DC6A 4JV5O 2XRYA 3WLIA 4L9AA 2AJBA 1A9SA 2P4VA 3IBYA 4PINA 3C14C 3PFIA 2Z98A 1BYUA 5KDDA 4AROA 1XD8A 4D96A 3EBOA 5K0EA 4WKGA 2PMWB 3LGSA 1X2EA 2IHYA 5CP8A 3Q6MA 5IK2A 4J7XA 4REQB 4NZ9A 1N3IA 4KN8A 4C03A 4YRBA 4X1IB 3R6GA 1Z4KA 4N5MA 4R71A 3DONA 4O29A 5CT4A 4B4KA 4LFAB 3U1VA 4CU2A 4PIVA 3QGMA 4KMSA 1PG5A 4PIPA 1Q0PA 2XV1A 3QF7A 3C74A 2P8RA 3IBCA 4YMWA 4FN5A 1ECCA 2IDMA 4HADA 4OXSA 1AQUA 3QMVA 4KSBA 2P6PA 1S96A 3ICXA 3LNMB 2N3ZA 4ID9A 3SJAA 5GVSA 2CF6A 1DJNA 1E6EA 2DWOA 1DCKA 3L0ZA 2PPVA 1E60A 5GQSA 4X1OA 1UEJA 4IDEA 1MEOA 1MCZA 1XNRB 3KVYA 3LHDA 1FDRA 1P4HA 1V11B 3ZWDA 1FK8A 2AYYA 2BOVA 3Q4HA 4QOEA 4XOIA 2R6CA 4NXNO 1IXRC 4JBYA 4I1OA 3X2FA 1XLTA 2GAOA 3DCYA 2OCIA 3H2YA 4ER7A 1MOQA 4PHCA 3S8MA 4L6CA 3MCTA 3E9YA 3H84A 5F1OA 4IGAA 2A84A 3EDMA 5F64A 4FFWA 4DTCA 1HM5A 4TMVA 2XD9A 5BSTA 3M1LA 1UIMA 4ASUA 3LV8A 3FIUA 2QL5A 4FYWA 3N0TA 1A8HA 2JGRA 1BMFG 3QITA 1FPMA 4PS0A 1G3UA 4LBYA 4FPPA 1VYVA 3VI3B 1YVEI 3EFFK 2QW8A 5AIAA 1QXSA 4G1VA 2EV9A 3NHUA 4YUZA 1XA3A 2Q4BA 2QUBA 5E7IA 3U17A 3VMFA 3I5MA 1O6GA 3UG7A 2JGFA 4P35A 5C4MA 4QDKA 4KV7A 4GKKO 1MEJA 1QRSA 2RIRA 2QTBA 3FW1A 1ZC3A 3L06A 4L5JA 2WF5A 4N9QA 3LLMA 3GJQA 4B8ZA 4YS6A 1TA0A 3ZDQA 5B12A 1FQKA 1M1UA 2R9RB 2HGZA 4TYPA 5EIEA 5J2TF 1SOUA 3A7DA 1NMSA 3V00A 5CG1A 4WL0A 4V0KA 2ZKIA 1F9EA 4AJ1A 4JGGA 3ZCSA 4JQOA 3U0VA 1KE1A 4KREA 4DZZA 2ZXFA 3F4LA 1EBUA 3LSTA 2OECA 2P35A 2WIDA 4UAJA 2N9UA 2IA5A 2WMNB 3QVJA 3AR9A 3NNNA 2V3VA 1PVOA 4PV1B 3DNFA 1NR7A 3AHJA 3R23A 2C4KA 1JKMA 4Z54A 3JATA 5K6AC 3CF4G 5DXAA 3FMOB 4I6EA 3UG6A 1JHPA 5IKOA 3COSA 4JK3A 4W1RA 4G3MA 3KELA 1UCFA 2G6TA 2M98A 1F06A 3R2NA 3WL7A 4JZ2A 1KYOF 5ABPA 3RVYA 3B2NA 1ZMTA 3EPPA 3FFWA 1PBNA 4AJLA 1J0CA 1RP3B 4G0QA 1IBRA 2I4NA 2QZ4A 2AK3A 4S3MA 4WV3A 5LP6B 2PBFA 1F6WA 3CH5A 5IF3A 1RJ9A 5AIBA 1EDEA 3SR3A 3PDJA 4FFBA 2LDXA 4ZO6A 1XNGA 4B7AA 3E7DA 5L6MB 4L4YA 4DCJA 4ZGBA 1KI6A 4XVRA 2H4JA 2Z3GA 4K0KB 3HM9A 1XQ9A 1P33A 4EPYA 3JWHA 2Z3VA 1YIJV 2EJTA 3O82A 3ZUPA 1X86B 1N2OA 2YY5A 2LKCA 4JJKA 5EJ9A 1W4CA 4B34A 3U31A 5JATA 5BPFA 1YIOA 1NC1A 2KG7A 3DV0B 1XMOO 2IYVA 2Q4TA 1QYIA 4D56A 3OZIA 4JPRA 2FKAA 4WDRA 1RRKA 2XXAB 1L5NA 2GN8A 3I05A 5BWBA 1J9EA 4M86A 4B7KA 1E7YA 3L40A 1BO6A 4RTLA 3FUVA 3IP7A 1RHJA 3MJSA 1XHLA 5AWFC 1NJGA 4BLOA 2D00A 2AKEA 4PO9A 1T3ZA 1LXCA 2UUBO 5ALLA 4XWYA 4EM6A 1Q2XA 3VPHA 1GPWB 1J8QA 1GPDG 3WL8A 1UOPA 5CVTA 1MD9A 1K2WA 4K8ZA 1YZFA 2N47A 2VDUE 3C3JA 1GA1A 3KEGA 4XJTA 2FQ1A 1H2HA 3KQTA 5IZCC 1GD1O 4U9UA 4JUIA 1O97C 1VB5A 1EB9A 3NASA 1T9GR 2DHCA 1ISGA 4R2HA 4AJKA 3JSNA 3MAGA 2VTBB 1CJVC 2QTCA 3OZCA 3M9WA 1NH2D 1GFSA 1PR3A 2FMUA 4NOMA 3EGVA 5MN4A 1WHSB 3WMFA 2RGYA 3D6HA 1QHEA 1T4CB 4NLLA 4L9RA 1U6KA 2VYQA 1PV0A 3OF5A 1N6IA 4M0EA 1KDRA 5DT9A 5FPTA 3KJIA 4FGKA 2YDYA 5F5LA 3BGSA 1Y5MA 3IHKA 4A0RA 3KFVA 2A0KA 3WTBA 4JI5B 3GAZA 2O96A 1U7PA 1VE3A 4GSLA 2IF2A 2AFRA 4DT1A 2EF0A 1Q6YA 1DBSA 2LFSA 4FB5A 4FHFA 3ZRWB 3V2UA 1Z2GA 4DB2A 4HQRA 4DQ0A 3C6ZA 3SSAA 2FRDC 1MFPA 1XB2A 1GQ2A 2JC3A 2TECE 4ZCTA 1KY4A 1V48A 3H1BA 1IURA 4CLRB 5H70A 3UOAB 5FJJA 2FPGA 4QLBA 4Z7QB 2QD4A 3GFBA 3N2YA 5M2QA 2IUYA 3DTNA 2QMYA 2CLMB 3UMMA 4B3JA 2BKXA 2ERXA 4PLPA 2YXNA 3H9VA 3D3NA 1L9KA 2RHWA 1K8YB 3DO5A 4LWPA 4BVHA 1P0FA 3EFOA 1YCGA 1N2GA 1KKLA 4PC7A 1QZZA 1N6OA 4WERA 4FOPA 3FGZA 3RHZA 2NXCA 2ZUFA 4GYYA 2VWKA 3IP3A 4PFJA 4LRSB 2NV0A 4G5FA 2PMEA 4RS3A 1FMLA 1CFZA 1R66A 5CW1A 5LA6F 5IDQA 3L71H 4Z51A 4I08A 1M0WA 3QLEA 3EMKA 3KM0A 1D3AA 2Q2VA 3L1VA 1UJ4A 4RZXA 3A36A 4B9AA 1RKBA 3FETA 1OI0A 1RQ7A 1EXDA 3JY6A 5DNYB 4RTMA 2BGKA 1H0KA 1GNVA 2BLLA 2O6HA 4M1ZA 1KQNA 2V9ZA 3EVTA 4OHRA 3TZ6A 2LXNA 4XSVA 2GEUA 3ISJA 3ZYCA 1Q22A 3QF4B 2B2CA 1NLFA 1OGIA 2V7VA 5CDHA 4EZBA 1XTSA 5DOVA 3PBKA 4RTJA 2FTKA 2O8EA 3NANA 1G16A 2PWPA 3QEOA 4K1LA 2EAUA 5KHHA 3GDGA 4J4HA 3PDHA 5EC2C 1KVUA 5HEKA 5ECDA 3G2QA 3X44A 1EESA 4F4LA 3OQNA 2IYEA 3RVSA 4S1VA 1ZJ5A 5CR9A 1RWBA 4XIIA 1X0VA 2ZIOA 2UZ4A 5DTEA 4H08A 1RYZA 1H4SA 5LP1A 2JGDA 2WT8A 2DBYA 2P62A 4R69A 3Q0TA 2HEIA 4RESA 1MG1A 3RSGA 2NO1A 1VI6A 3EW9A 4YRKA 4Q47A 1RT9A 3DZ8A 5AVVA 3DT6A 5HRUA 4OI1A 3X1JA 2FZVA 2KCQA 2D06A 3LBFA 1L5HA 1OI4A 1JFSA 3WQHA 3S2GA 4KITC 1TLTA 2RGEA 3T3DA 1J1IA 5JAOA 4PLGA 4E5VA 4ZAFA 2DWDC 4C78A 4FNGA 4DV0B 2ZG6A 3K15A 4GPIB 5TPZA 5FTLA 3L7MA 1SU7A 2PLRA 1M6VB 3WBJA 4PZUA 4K6MA 2XMDA 4Z7NB 3D2CA 2JAXA 2V3WA 5IZCA 2BJWA 4N54A 4CFSA 1LBTA 4IUBS 2IH3C 4GIBA 2A9JA 3EHDA 4URZR 1V71A 2A86A 4C7VA 3HWWA 3X1XA 4J03A 1TA8A 3EVDA 3GZ4A 1A2KC 4MUXA 2OIEA 1X1EA 3HXOA 4D9BA 2OEPA 1PWZA 4L28A 4YV0A 1NBEA 4OLFA 3KEFA 5DLEA 4JC4A 1QYCA 5BSKA 3PICA 4YXWA 4C6TA 1TGVA 1EJ0A 1LLUA 3AM1A 4Q05A 4FSDA 2AG1A 4INPA 3J80A 2BZ0A 1X80A 2ZXUA 3HDGA 3QFCA 3FAKA 1RM1B 3HZHA 1UWLA 4X94A 3ASNB 4PEVA 1A32A 4ERNA 3H1PA 4LDZA 5E79Z 4ZQBA 4BNGA 4HFJA 2JFFA 1WMBA 2FRDA 2CXPA 1KXZA 3PGJA 2QSYA 2VDMB 2XUJA 4OHWA 2YUTA 3TSZA 4FNAA 4RPLA 5L4SA 2R751 1VHWA 3ABRB 3WLJA 2ZRCA 3EPLA 2O6LA 2QLTA 4A15A 4HTFB 1Z7GA 1UOQA 5ETJA 5JYBA 2JJ2G 3ISTA 3HYCA 1N75A 1NVBA 2CVFA 1LRLA 1JZTA 1O58A 3E70C 1TYZA 2OCCB 3MHSC 2V9CA 2W2VA 5KTYA 2GXQA 1F8XA 2Q6OA 2YWXA 2BCCH 4L4ZA 1RXWA 3PWTA 3MCWA 2AF3C 1EE1A 3SS9X 3W4IA 2GCNA 2BMVA 2X77A 1O96A 4XJVA 1WA5A 2V7EA 3KQUA 4JI3O 4CXMA 2RHHA 4JCOA 2WPDA 4WX2B 2V55B 3CLTD 1T6ZA 4UEJA 1D6MA 1JQDA 4RPKA 2QYHA 3EGEA 2HY7A 3RH0A 4W4TA 4RNCA 4X97A 4NONA 3K20A 5EXTA 2Q4DA 2H63A 3JQ7B 4MLCA 4F9FA 3BCRA 3IC7A 5K01A 3WBFA 2HNBA 1ZUHA 5CD1A 3FWKA 2UVPA 3BF7A 2VSFA 2JD1A 5K4AA 5CPFA 2HYIC 1QLEC 1II9A 2FB9A 3KUUA 5AVJA 3ZHTA 2ZJOA 4PPYA 3ROXA 4R7TA 3JYOA 3ADKA 2C4HA 1B0PA 4ETNA 4AIIA 5INTA 1I51A 4G4GA 1KJ8A 1QH8B 1SBZA 1I5XA 2JEZA 5HK8A 1H05A 1CE8B 3THWA 2I6UA 4MAFA 2Q7HA 2R47A 1XNRO 1K8QA 1WVMA 3FNQA 1N8NA 1LR1A 4B3MO 4UHCA 1GG9A 2IEDA 4FCCA 2E76B 3AKCA 4FJCC 2O3RA 3C1UA 1ZD4A 4H77A 3SJQC 1T8YA 2J7PA 3BMNB 3CCFA 1DEHA 1RTKA 1ZD5A 2YICA 1PJTA 1PVVA 2QRPA 3STTA 3AL0C 3L8ZA 2RHTA 3K5HA 3OLZA 4R1SA 4QYWA 4AUKA 3OCVA 3TRJA 3X1YA 3MT8A 3NAQA 1FJGB 4J2TA 1PNKA 3D3WA 3IPLA 1CIPA 4P7KA 3CZPA 4E5YA 2O7NA 1QQ6A 4FZ0A 2X0LA 3K0HA 1MJ5A 1N5JA 1B8VA 1WZ2A 4I4TA 3AF1A 2A9RA 1NRIA 4NWIA 1Y9EA 3HADA 2NPOA 1ZGBA 3PFHA 1OCZB 2CHUA 1YRWA 1J2RA 1J95A 3TX6A 1KPHA 5EIWA 2ZJ4A 3PPYA 2ZJYA 1FS6A 5AYVA 2ZE5A 4DM3A 3ZIUA 4MRNA 3OLYA 4XARA 3FSJX 3LPDA 1KEPA 1DQSA 2X13A 3RYIA 2I2AA 4QYXA 4KNYA 1QE5A 4Q93A 1WD5A 1P1FA 2VK8A 3T3PB 2P9CA 1IE3A 4ZI2A 1EE9A 3WLTA 1RWPA 2PANA 5IPFA 4DPLA 1NZFA 4OUDA 1Q11A 4LSZA 2BTQA 3KTOA 3QNMA 3GLSA 2OXFA 4ABMA 3Q9UA 3P97A 5JNWA 2R85A 3RW9A 4HRXA 3RF7A 5B58C 1DJMA 3ILXA 1ZN7A 3VZRA 1B1CA 2GPWA 4X8OA 1U7DA 5KZMB 5T3UA 4OQYA 3ZG6A 4DWVA 3MC1A 5M7EA 1ZMRA 3D31A 5L7TA 1N78A 3CE9A 1TDJA 3JQAA 4C14A 1ZCZA 3WYFA 4YV7A 3FMGA 4C22A 1KIAA 4MEAA 3Q3HA 4PU0A 1JTKA 1E4OA 3DZCA 4LOJA 1BH2A 4IFBA 3I2HA 1K5SA 5C52B 2BYTA 3RIMA 3NALA 1NXSA 1M8FA 4Z53A 1SXQA 4RDIA 1CETA 3GLHA 2AJTA 4ARVA 2B7CA 4G5HA 2YRWA 1VDMA 2BSQA 4FLZA 5LUBA 2A1UB 4PX9A 5FPRA 1ZLZA 1F60A 1FVOA 4B31A 3IVMA 5EJ8A 5BSMA 1VL0A 4PZYA 1B14A 3GVXA 3AETA 1NJSA 4QVIA 4S2EA 4CZZA 1JFLA 3FAVB 1WOYA 1SA0A 1TJ3A 1G66A 4N5LA 2PYIA 2EBWA 1FYXA 1ZRMA 1NNLA 3GLFB 4II3A 3G6BA 1W49A 3GEMA 4MQ5A 4YXWG 2ZPTX 2ECQA 4L08A 5HZMA 4KXWA 1ZABA 3GEBA 3R0QA 3IKTA 1M1NA 3NOXA 4H4EA 1NBIA 2AFIA 4NU8X 2ZWPA 3DLIA 4YDQA 2GZHA 1Z3IX 1OTHA 1DKRA 3CRW1 1WXDA 3WX0A 2A79B 3CCCA 1C1XA 2MYUA 1ZK3A 1HP8A 5FYDA 2ZRBA 4CFZA 5CK5A 2MIIA 1DBQA 3IQZA 3K2QA 1BHBA 3DDWA 1KOFA 1DTEA 3WMRA 2QEQA 1IY0A 1ZVJA 4L9SA 1XJ0A 1V45E 2IWHA 4CF6A 5JD6A 2VK2A 1GPAA 3VNSA 3B1ZA 4NJMB 4BZZA 4AO6A 3UJ7A 5ALSA 1T9ZA 3O8QB 4Y2JA 2DFNA 1US6A 4I6JA 3JYNA 2F8LA 3KB8A 4KLCA 3E82A 2CSXA 2EERA 2CJXA 4PRKA 3JQDA 5H59A 2YHSA 1CLEA 5TNXA 3L93A 3M70A 1UT5A 4BGDC 1OV4A 2C99A 3WJ1A 3B3AA 2I34A 2L6LA 2J0UA 1RJ9B 3H5VA 5LP6C 3H18A 2XZOA 5BORA 4BQRA 4UVIA 4OHVA 8ATCA 1T5SA 3MMZA 1RPOA 1KZHA 3QX8A 2GAAA 3BVOA 1P74A 2AHOA 3AXTA 4BGIA 4PS1A 3JSAA 4JI1B 1T4GA 4WY8A 3R44A 5JS2A 4PO1A 3D3IA 5JH7A 3LBNA 3BVPA 4ZCRA 4Z5XA 1J49A 2VP3A 5AKGA 3KTFA 4RY0A 3EYAA 2OQ2A 4YV2A 1JI3A 1MVOA 2IBZH 1C14A 4A0SA 3JTMA 1V3QE 4PG4A 4DMCA 4HEA1 2LJ2A 3HA7A 4Q03A 3ZWMA 3K5MA 1JIKA 3ZTYA 4A0QA 3HJAA 2V0CA 4MVMA 1U9YA 5BSFA 1LK7A 4PCVA 4LQCA 2DAPA 3UBTA 1PL8A 5KSOA 3VDQA 1EK5A 1TUGA 1U9IC 2ZRHA 4OQ4A 5FORA 1GIAA 1DG1G 4UE3S 5KJ6A 5JJCA 2X7HA 1JKXA 1GP2A 3LBYA 1E79D 4Q4AA 2G8LA 1J9GA 1L6IA 3IBGA 3VVBA 1VLHA 5B1YA 4CMKA 3ND8A 4BFWA 4G41A 2EFDB 1KSGA 4XASA 3PRYA 4FI3C 4P98A 4KR2A 3IELA 5LGUA 1MA1A 3MTIA 4MGEA 1IFXA 5I9SA 2HF8A 3FE2A 4BJ5A 4BDSA 1DLJA 3MRVA 2YXDA 1CQJB 4X65B 4BUZA 2B94A 4BNMA 1SU6A 2NNWB 1N2BA 1C9NA 3F0TA 3UV6A 4B71A 5FWDA 4G9EA 4KFMA 1J39A 3CXHF 2XTAA 1F4LA 1P80A 4NNJA 1U9ZA 4J0KA 4KXNA 4QJ5A 2J30A 5EJIA 3QUQA 4IOMA 3M81A 3R24A 4R8CA 4NV3A 3CZMA 4OD0A 1GRCA 3ZH9B 1RXUA 4XB2A 2AG0A 2FUEA 2QDKA 2HEGA 1OAOC 5ALKA 1SZXA 3CWZA 2YWEA 4QHSA 2B3TA 2NSLA 3ZV3A 5MGBA 1K8AW 3MLAA 2VDJA 3FR8A 1WXWA 3NYIA 5ALHA 5H3LA 3Q5GA 2FUG1 3AK4A 2IW3A 3VTZA 4DT1B 1GA4A 1LK5A 3VQYA 2EFJA 3WDLA 1O03A 3WR5A 4BLTA 5ALIA 1ZW1A 1QZXA 2PZBA 4ZD6A 1SXJD 4KUMA 1C9JA 5E38A 3QVGB 3T7CA 1BQZA 3E7WA 4D02A 3OLVA 4I9UA 4S1NA 4H44B 5K8IA 2C9MA 1Z2EA 2BZSA 1F8FA 1BG6A 2FPGB 2V03A 3MB8A 3ROQA 2GXUA 3MYRA 2GZ3A 1VG0B 4HWSA 4F92B 4YQYA 3WWPA 4C08A 4GQAA 3ETLA 4Z4CA 1LJ8A 4QGBA 2GVDC 2Q21A 3GAAA 3WGLA 3EFOB 4IFEA 1CPYA 2R65A 1UMDB 3OOYA 4WW0A 4Z86A 1CQWA 3HJTA 3IE2A 3NOQA 4NR0A 3P8ZA 5KEIA 1NYQA 1ZHHA 1MB4A 1P31A 2NO7A 1VCMA 4BYMA 1UAGA 2QVLA 5K09A 2FWIA 2OWDA 2MSWA 1DAOA 2M6SA 4DV0O 4NXNB 1J0DA 3LVRE 3LK7A 3IIJA 1AHHA 1QCCA 2QHXA 4ZEMA 1NVEA 4NDZA 5JDCA 4PN7A 2NX8A 4RANA 3VX8A 4U3JA 3QQPA 1QO9A 1KKUA 2GBIA 4MI3A 3M83A 1KVSA 3WLEA 2VP5A 2INGX 4GWLA 1WUYA 2HMWA 3FBTA 4AJIA 1PJAA 4X45A 1RLIA 5I7HA 2ADQB 4LZLA 1PKEA 5TGTA 1RPZA 1PW5A 4BGDA 1P2GA 1VZ3A 1YQTA 2J33A 4KQGA 4EHBA 1P2UA 4LMAA 3LT0A 4GP9A 3WIEA 5LP6A 5IN5A 4QUAA 2H1IA 1Y6ZA 1M9NA 3ZW9A 1EZ4A 3B2QA 2AFHB 3SHTA 4ZKDA 2QTAA 1XILA 4HQOA 5THQA 3NRCA 3ZYZA 1NOIA 5JCZA 3VKWA 3OKAA 2EQBA 3CWQA 1LNZA 4N40A 3E1KA 1VJCA 4OJTA 1R0KA 1DQYA 5LHIA 2JGDB 2ZBGA 2WIBA 5CJJA 3IDOA 3HBLA 4ZTZB 2BUCA 1HL3A 3DV0A 1WSBA 1N2HA 1VHDA 1GNLA 1DTWB 5HFJA 2ZZNA 3B1VA 3RFFA 1KJYA 4JASA 3E9DA 4KTTE 1PNVA 4KO4S 5EJ7A 4JJIA 1O1YA 3ZDZB 1UF9A 1U9IA 2YJGA 3O90A 4NFLA 4UXNA 1WDTA 3EY9A 5K0ZA 3GG9A 3KB1A 2PUSA 1YF2A 1FVHA 1ZGZA 2QAJA 2FRVA 4A73A 3NH6A 2CVHA 3RU2A 1GL9B 4AJNA 4BV9A 3Q41A 2CTWA 3PVCA 2CTQA 1BQ4A 3T4EA 3A4IA 3PQ7A 2HJ9A 1QIIA 5FNVA 5EE5B 3L8HA 4NZPA 3ANLA 5AOVA 4Q66C 3KVOA 3GLIE 4XWKA 2OZLA 4XDLA 4ES6A 2I2CA 2IQIA 2VTBA 5KINB 5FT9A 3ABTA 1I7PA 1WHSA 1J0BA 4N6NA 2XBLA 5L3FA 5C34B 5KAIZ 1T4CA 4C0LA 2L17A 3RKUA 3NHBA 1EFTA 4ZODA 4CIXA 3IPCA 1I4OA 3V5NA 3UMSA 1HYQA 2YIJA 4A1FA 3LW7A 1OXBB 4LHVA 5E6RA 4H3VA 4Y6LA 3AG4C 3B8NA 1VE1A 2CGEA 3W8RA 3CMMA 5TE9A 3IO3A 4X84A 3ABUA 5CFNA 1E8DA 3CCQV 1JBQA 2QMEA 1R1BA 4M76B 4DF3A 1ZGAA 1P3DA 4CMJA 5IJ9A 4DA9A 1EX7A 2ZE7A 4LJ7A 2OM6A 2OOSA 4AX4A 4CLRA 1NJFA 4I9NA 5JS6A 5F7JA 2Q7OE 4PYOA 2DETA 3ZJTA 2UUBB 2DFKB 2VNSA 1R9MA 2OCBA 4J0EA 2D8MA 2ZDQA 4JEUA 5CNIA 1Z5WA 1T3HA 1AGNA 3BWCA 4FM0A 1PWXA 2WWVD 3DKRA 1V0JA 1FJGO 3CPJB 5JS8A 3KWJA 4JYBA 3HC7A 5KVQA 1O96B 4L85A 1XOUA 2O2HA 4F9GA 3I01A 3AC0A 1UBGA 4MMZB 2XJ9A 3MW8A 4C7UA 3FVQA 2YHIB 4YMLA 1ODTC 3OCYA 2FQXA 3PCXA 2YQ5A 4IOLA 1BU5A 1ZX3A 4QQ8A 4ZKIA 3OEED 3D5EA 1NAIA 4YRTA 2ASEA 4A6DA 3AJEA 4PZ9A 1NTKH 4Q3LA 1SG0A 2R44A 4QAJA 3MOIA 2OZPA 4G2TA 1PTJC 3ADOA 4D6TH 4B3DA 4MVSA 3O73A 5DXFA 3QF4A 2FSPA 3IDQA 4W5NA 4ZA2A 5C3MA 1QVRA 2WJ3A 4K1XA 3ZNQA 3APQA 1BCSB 3DQPA 2E5FA 3LL7A 4KO1S 3SIWA 3LHIA 2FFQA 1W0JD 4PXAA 1RI3A 5CB6A 3R5FA 2CJPA 3THWB 3TUJC 2CHVA 3BBPA 3EC2A 1ACMA 3FD8A 1CIVA 3FI9A 5DW0A 1EVKA 3Q0IA 4TXLA 3UAVA 4EGAA 4F6LA 1YC5A 1JEAA 2I3GA 3ZBUA 4ZGWA 3LOPA 2NSJA 1KO4A 3ZW7A 1MENA 4RK4A 2F7SA 4M22A 3FROA 1DG9A 3R5TA 3AF2A 2AQKA 2JG3A 2Q4RA 1VIVA 1G42A 1AQYA 1KECA 1G9XA 1S2LA 4I43B 2VG8A 1CZUA 4JR1A 2H8KA 3C2QA 1PJZA 5FPHA 4H3SA 1XWWA 1U0FA 3C6MA 3MTDA 3K1AA 1S3GA 3BCSA 2ZANA 1ORWA 5J4LA 3IMFA 3CCBA 4JLBA 4FFPA 1O9HA 1BROA 2DLCX 1CZKA 2OXRA 3OM1A 1AE1A 1O6FA 2XT6A 3KKLA 3G2IA 1Z4JA 3ZH2A 5FULA 1VKJA 3LPLA 2WUGA 4KFRA 3RNOA 1M6VA 5ELXA 1QK3A 2M6RA 3IAFA 1QYWA 2R4QA 5ERXA 4TN5A 4PHTA 3U9SA 3K9HA 4NKRA 1GG2A 2XNHA 1M7HA 1EA5A 2Z09A 1G0NA 4CEIA 2PWAA 4TUYF 1LKZA 2D74A 3RYIB 2HVJC 1DRJA 4XB6B 4R7GA 2J32A 1YR6A 1XQVA 2J9YB 1VQLV 2FWMX 1V41E 2D7JA 3KAJA 3F5QA 3Q4GA 2DTDA 1VGVA 2JPDA 3IDAA 3OEHG 1VBMA 1WKBA 1N1MA 2PX0A 3QE3A 3CH4B 4OUDB 2BTQB 1MQ8B 5HMMA 2XCTB 2J4CA 3KKPA 1WU7A 1ADYA 1PJLA 3MOSA 4IXNA 3CE2A 5JNTA 3KC2A 3E48A 2K5UA 2GZAA 5T67A 2J3EA 4MIOA 1BU8A 3HR8A 2ZVDA 1BEUB 3OTFA 4WFQA 5J5AA 2CNBA 2RBEA 3EZYA 1FSSA 2Z6QA 1GVHA 2BGRA 2J67A 5KU1A 1GSHA 2X9GA 1IQRA 1VCOA 4C7BA 5CA0A 3CZRA 2QSUA 1I1QB 1G2OA 1RCUA 3CF4A 2GF2A 1B6QA 3P9PA 3RVRA 4ZDWA 4BMDA 2C2ZA 1ISMA 2X1MA 3W5BA 5CXXA 2HJGA 1QSGA 1D07A 3N0WA 1YK0A 3CMCO 1AMUA 2JA2A 4OCMA 1SWWA 3GLHB 1RM4A 1XA4A 1KNQA 3IXMA 1HO3A 4TMXA 1SB9A 3EC7A 1LQTA 3N7UA 1TOAA 1T6NA 4OI4A 4HTFA 2E18A 4M8LA 4NAHA 4WNAA 4XSGA 3AETB 3VVMA 3O75A 1ORHA 3BGVA 3DEHA 5SZHB 5K0GA 1KEWA 4OH1A 3HJFA 4JI1O 3HV2A 3MHHC 1KSJA 4XPZA 1XL4A 2HSDA 2AZ0A 2BGNA 1NW5A 3ABMC 5AJHA 1WQ3A 3I0NA 1TFRA 3T06B 1P0MA 3AF4A 2AFIB 4C2TA 1LD3A 1U1EA 4GT1A 4X64B 1H8HD 1SVNA 4P9NA 1K8XB 1G18A 5LZ4A 3Q72A 2H2DA 3JQ7A 4WCDA 1C1XB 2WWIA 2FMXA 4YRPA 2A9HA 1BHAA 1JXOA 3KYBA 2R5NA 3AUSA 1PTJA 1CP9A 4FFDA 4EL5A 2NR5A 1JHRA 4OHKA 4OFWA 2XMPA 2Y67A 2W48A 2PRZA 3GVCA 4JJAA 2WV7A 3SDLA 3IUMA 4IGEA 2CL7X 3HVUA 1QIJA 2PVSA 1VQ7V 1QH8A 2RB4A 1TD9A 4X65O 5K6TA 4K9DA 2HQSA 2N0SA 2BH2A 2XCOA 3ETNA 1R6XA 9ATCA 3N5CA 3OPMA 3FF1A 3JRNA 4TS4A 2OHVA 4B4OA 4FMTA 1CK4A 3IT1A 2P9FA 2GJKA 2JLWA 2HW8A 3GJSA 1IULA 3K9GA 3R66A 1EDOA 1JJBA 3NHPA 4RVDA 3SQDA 1CP3A 4CLXA 1IY8A 1PV1A 3HSYA 1XBLA 2HA5A 5EJ6A 2FXVA 2IBTA 1K66A 1AVTA 3HTXA 2BONA 5JH7B 3NPMA 3ACDA 4B4DA 4JI8B 4G0PA 3DT9A 1IWOA 4J10A 4IJQA 2YDXA 2WU8A 3GFPA 4JI3B 2D2FA 3R7LA 2FG7C 4HNTA 1VKZA 3ZHYA 2ILVA 4CG0A 2ACVA 2QA4V 4N01A 1X92A 2WFZA 4UVCA 4WESA 5SICE 5DSXA 4TXNA 3D8RA 4C4RA 3CRCA 2RK6A 4K9PA 3CX7A 4DSUA 3F4BA 5E7MA 5FOVA 4CR6A 3G7UA 2ENWA 1KC1A 4MW6A 4Q4AB 4IKOA 2C82A 3DBIA 3K5PA 2MYTA 4TZ0A 3GCGA 2AN1A 4ZJPA 5SY4A 1IAQA 2QNIA 4ZT4A 2X7RB 3L73H 5LU8A 3KUKA 1ES9A 3JW8A 1WIWA 2QTRA 2VHWA 4ZOLF 2EGUA 3KKNA 3YASA 4IDBA 1YDWA 3BFRA 2P2CA 4P53A 1JLSA 1CLUA 3GMDA 4OL0A 5BT9A 1D6NA 5TQVA 1MQ9A 4C5BA 3VNRA 4B3MB 4DSNA 1S2IA 1QP4A 1PS8A 5DISB 1IHPA 4W5QA 3AINA 1H2XA 1JTVA 1IBLB 2QWQB 3BL8A 1U2TA 1AZWA 2PXCA 2XT0A 5JI2E 2ITDC 4I9FA 4P0QB 4FYJA 1Z4IA 4QPCA 1KA9H 3WKBA 1DX9A 1RRCA 1YS7A 1M2GA 1J5XA 5LGTA 5BQXA 3ZIDA 1QIKA 3M6WA 1LX6A 4QASA 4ALKA 5LOVF 1Z2CA 5JSKA 3KXPA 2VF4X 1JDPA 1WCXA 1QDEA 2VQFO 2FL4A 3TR6A 2C9BA 4RHTA 3MSXA 1U0GA 3M2TA 4FEEA 2A1UA 2QJ1A 2GYVA 3CUTA 4LJSA 1L5SA 1DC4A 3EIOA 4QQRA 4G25A 3FZEA 3WGTA 2QUKA 3NIFB 4JELA 3FAVA 2CSUA 4Y2TA 3VR6A 3WWEA 1A98A 3Q8XB 2GQ0A 2X4IA 5HPYB 1IX9A 2Z3ZA 3BSWA 4HN9A 3I6ZA 3GLFA 4LTMA 1QNMA 4DMRA 2VYND 2FB5A 2XB4A 1RXYA 3GJ8A 3SZLA 3NHYA 4PSAA 2QLLA 3R76A 3PHHA 4R1NA 5IXYA 1FNNA 1R3KC 4LHXA 2EINB 1G3RA 2R87A 4MVYA 4K46A 5A0FA 1T2FA 1S77D 1SC3A 5CYPA 3BH0A 1LTKA 1T2CA 4KR0A 3LUPA 1D7AA 2QRLA 1XRMA 1Q12A 1RD4A 2JH8A 4M8SA 3JD0A 4CODB 4N47A 1GXSB 4N0EA 5IM4A 3I9KA 3V1LA 3CISA 1KMIY 1XZGA 4U3JB 4PA3A 4WFBV 3QELB 3QW4B 3DLPX 4NJMA 5TVGA 2UUPA 1JJOA 4YRNA 3E8MA 3CF6R 4IUDS 3O8QA 4WY2A 5G1OA 1NVKA 3PJDA 3E3AA 2PGGA 3BRWD 3VSDA 3SOZA 2HRBA 1Z0FA 1QV7A 3EMDA 3R7AA 4OLJA 2JARA 1W5AA 5DN9A 2NNLD 2AUMA 1OT5A 5CK4A 3D4NA 1GCIA 1S4QA 3QOXA 5C8YA 4BVGA 3Q98A 1B93A 2IOFK 4CH4A 2DG2A 5C4IA 4KDEA 2RGNC 4TT3G 3A04A 5FOUA 3K2BA 2YHAA 3SI7A 2ID8A 3M6LA 4PAOA 3IAS1 1VL2A 1V96A 3F6SA 1ZL2A 2DWPA 4YR9A 4AG3A 3ZXXA 3N75A 5FV7A 1WKVA 4DJ5X 4XWOA 4YT8A 3ASZA 3FKQA 3KJHA 1P2TA 3B3JA 3E9QA 4RWEA 1C8LA 3AKZA 3E4DA 1W87A 2VQEO 3FYCA 2HMTA 3WSWA 1E9CA 3H2BA 1T0IA 2XNDG 2WM8A 4FQ7A 1QQTA 2GOYA 1QHGA 5DHUA 1L5YA 2JIPA 2EZOA 4CI9A 4FLMA 3OM9A 2C7OA 2D5NA 4PYQA 2JCSA 5K9ZA 3GP8A 2R6DA 1CW2B 1XHZA 5AD1A 2V4MA 3TLBA 4JASB 1QGUA 1HK7A 4PPGA 1W5EA 4KAJA 1ODFA 4Y2YA 4FYPA 4WASA 1RXCA 1F2DA 2OT3B 2HREA 3IDZA 2A7XA 3AB7A 1G20A 2GESA 3C3TA 2RH5A 9MHTA 4DXDA 3CVVA 2W00A 2OSVA 3U16A 4KXFB 3VA7A 2QV0A 4BVLA 2K2QB 4M55A 1QIMA 3H3XA 2D8AA 4RZ3A 1Y1QA 1ZA2A 4F4DA 3WMWA 2OCAA 5FNVB 5K8VA 3I9LA 1CQJA 1YI8A 5IUNC 1EG2A 1GNQA 2OZLB 5JC1A 5FYQA 2JJ2A 3V1YA 4RTQA 3DF9A 2IEAA 2W0SA 4NPAA 4AKIA 1J20A 3VAYA 3HLKA 2PBRA 4MWSA 2AXEA 5BWCA 4Q1DA 4YEDA 2CB0A 4BB0A 3RC3A 4XQCA 2SECE 4D4JA 3DZIA 3U3XA 1H85A 4ZDKA 2Z2JA 4GP6A 4N76A 1CU1A 1IZ0A 5JWPA 3IR7A 1NMEA 5E6RB 2UAGA 2FHPA 1LPOA 1R50A 2W6ID 3FFXA 4LWSB 2GVNA 3TKAA 3D5QA 3DL7A 4RZUA 5F51A 4H7HA 1YB4A 3HJNA 2V4UA 5K6RA 1Z25A 5LXTF 1P8JA 1VKRA 3QVGA 4F0JA 5IJ9B 3W3ZB 2BFNA 1UFIA 2ZREA 4MTXA 3UB3A 4O8YB 3J7TA 3ZXIA 1R6NA 1X3SA 1VPWA 3WYEA 3B1FA 2B98A 4G84A 3E0XA 2J45A 4NCHA 3IUSA 2BHNA 3DPIA 2ZYUX 3TJTA 4BMXA 3VC1A 4MUFA 2WM2A 3K0BA 4I9QA 3S5UA 3V8NA 3AHHA 3LD9A 4N65A 4WEOA 2PU7A 1AXGA 2YSUB 1XD9A 5T4BA 5KOJB 1KEZA 3PR2B 1UMDA 1YTUA 3HKBA 1DOZA 3AVTA 1J24A 4P0TA 3RV3A 2JI4A 2CV2A 1IQ0A 4QTTB 2O0KA 4GS5A 3H1LH 3N27A 2Q3HA 3ETHA 5K6AA 2A0YA 1SUFA 1DE0A 4CBCA 3KP1A 1ZA1A 4BQFA 2ASVA 1QLNA 4BLSA 5KNBD 4LOHA 1ZKDA 1TZMA 1FFDA 2V74B 3EQ9A 3MQ2A 1KP3A 4ZQGA 1ZVQA 5LCXA 5EKXA 2OG1A 4OXIA 1U3WA 3VR0A 1YRBA 1FYJA 5KTPA 1JECA 2Y4TA 5CCBA 3FDXA 4EQ6A 5A71A 1PGOA 1BXGA 5L40A 2J07A 3RJMA 1JDBB 3IHWA 4QHTA 1ULSA 4PM4A 1AHIA 3ZBHA 2N46A 3ED5A 4HGPA 5IBCA 1MO5A 4TRRA 1H2MA 3OGCC 2RGNA 5B5SA 1VQ5V 4ZHQF 4KK4A 2B8TA 3ZPXA 3B5EA 2JIZD 4C2UA 2VDWB 3Q3CA 1EQUA 2J5KA 1XZLA 2AFHA 3F3SA 2EF1A 5L3QA 3L5KA 1U3CA 1QCDA 2ZYSA 2YV5A 1A69A 2AD5A 1PKXA 4U2CA 2RB5A 1HFWA 3L7DA 4JN6B 2WJZB 3GT7A 3HGTA 2MCFA 2HLDG 4IDDA 2VHQA 1QVZA 4LMRA 4OXKA 5A4DA 1ZU4A 2GMWA 3W6PA 4RL6A 3LRTA 4KBGA 3E2PA 1K7CA 4PYNA 2XQJA 1AD2A 1DTWA 3K1AB 3GPBA 2V6BA 2R00C 2GHTA 4ZOQI 3PX2A 2B36A 4GO1A 2LTAA 4BL5A 1KP9A 4B1FA 3ZHOA 1DQNA 4FDVA 3RF6A 3A37A 1JAZA 3G8BA 4NARA 3DC6A 2GEVA 5JJEB 2VPZA 3UPTA 3ZHSA 2QZZA 1OCEA 3K5WA 2QMQA 1Q7YW 1MNAA 4RZHA 3H9QA 6ADHA 1OBVA 5EJAA 1OIWA 3FSGA 2HK9A 3HZZA 3PEYA 3G79A 1MZEA 1L3IA 4EKDA 3OCQA 1C9DB 4DV2O 2EW1A 4DA0A 3KG2A 3LCMA 4CEIB 4KJXA 4A27A 2OWOA 1NUTA 2D2XA 1NI4A 4B2PA 3IO5A 3M49A 2ZS7A 721PA 5IKXA 1XK6A 3SQXA 3WRYC 1UBNA 3P52A 4L16A 2WZQA 5DFAA 2OQRA 4X64O 1Z06A 2WLTA 2WT9A 2BHLA 4DQKA 3WWCA 1JSZA 4ZVQA 4DNXA 4ZYXA 4KWHA 1X42A 1UPTA 1A27A 3BD6A 4LISA 3AG4B 5HE9A 4CN9A 4LVCA 1FL9A 3U7FB 4HNVA 4HVAA 2QY6A 3C7KA 2GWRA 3NRJA 4ER0A 1E8NA 3S1SA 5CA0B 3N8HA 1GRNA 4MULA 2ORIA 3F8WA 5F77A 4G8CA 2Q9UA 1S0VA 5T5QA 3K1JA 3QTCA 5JVDB 4ROTA 2EULA 5IDJA 4OCMB 3M4ZA 3BTUA 1SCKA 2QN8A 1QCEA 1V1JA 5J43A 1KR5A 3IXLA 4AZSA 4GOKA 5KQLA 1EM6A 4WNAB 1QZTA 2G84A 2QRKA 4QULA 5KX5B 4F3KA 1GN6A 1BD4A 4MYDA 3G8YA 1OXTA 1IY9A 2VTEA 5ITWA 3PP8A 4FR2A 3UJ9A 4JI8O 2WIFA 5KTSA 3WICA 2H11A 2P6OA 3MJ4A 4PAQA 2FYUH 1ZQ1A 2WB4A 3MN1A 1KFBB 3WVNA 5AESA 4H13B 4XFKA 1HE1C 3ZS8C 1U90A 3LYHA 2YHIA 1IVSA 3P0FA 4UZSA 4DGSA 5A7GA 4P80A 4URUR 4BLWA 1SHKA 5FLXA 2ZRIA 4OJKA 1OKKA 5E4TA 4DNPA 1N0HA 2IZ5A 4LIPD 4RF4A 5EINA 4TRNA 1XU4A 2GM5A 1ZUWA 1A5BB 3W5VA 2WY2D 5CXQA 4MDEA 2G9NA 3JWJA 2YVLA 3I39X 4J43A 2GD2A 1A88A 2E85A 4EYSA 3IVCA 1W48A 2GK6A 4ETMA 1TX4B 1BCSA 1EP2B 3OJOA 3E35A 4CV1A 4FN4A 1J00A 1GCAA 2PJRA 4FHCA 2O2XA 1TW2A 5ALMA 4BRUA 1NSFA 4LI0A 1DUVG 3ASVA 5J63A 4PF1A 4MUIA 1ZJZA 2B5WA 1L3BA 3QXSA 3QUBA 4WOJA 1RJFA 2BEJA 4BGEA 2AGVA 4L0MA 4TQUS 4FWTA 2X8LA 3DAHA 3CHXA 3F1KA 5EBLC 3R0IA 2IE0A 3ZWXA 2BGLA 2C7QA 3U62A 2YW9A 4YMUA 4KXQA 1IBLO 5CIYA 1FLDA 3MGBA 4EABA 3OR6C 3HCFA 2MSLA 2B1IA 3DGEC 1O4VA 1AKWA 3CUSA 3P2OA 4B81A 2I67A 4YALA 1QO0A 3LT5A 4U7TB 3VDXA 4BTVA 4JJFA 4C21A 5J2TA 3GHHA 3KTDA 1JHYA 3BFJA 1NBME 5ARCA 3IAM6 4DG5A 5FH9A 1EU1A 1TZBA 3QY0A 4WESB 1VJ1A 2Y68A 3KJFA 1KO1A 1SOVA 1X87A 4HWOA 4G1MB 2IPLA 1RPNA 4K9OA 1SCAA 1JQ3A 2Q1UA 3OMIB 4RDXA 5FLKA 4L74A 2KSQA 121PA 4RSRA 1DAFA 5FP0A 2X2FA 2GJ4A 2ECOA 1VJDA 3ZMTA 2GBGA 1RE0A 3ZY2A 5ALTA 2B0JA 5A0TA 2XHEA 3TE6A 2YNMD 1R9GA 3OIGA 2NN3C 2HA7A 2HHHO 2X0KA 5A4JA 1IXMA 3P94A 4Q4CA 3OQMA 1K5HA 3KWMA 3M1YA 2X2EA 1H6AA 2BEVB 1Q6IA 2QTZA 2PR2A 3G3EA 5I01A 3LUFA 4UCQA 4TV9F 3Q7PA 4EHLA 1EGAA 5DGXA 2XOKG 2QWXA 4UW9A 3SE0A 1WUJS 1L7MA 2IM9A 4OIFA 1R6BX 3P20A 3A4LA 3QH4A 2QJOA 4MT8A 2DHQA 1YZLA 4JVLA 3IVAA 1E32A 3HXMA 2PUBA 4NMMA 10MHA 3W5UA 1U8XX 2OAP1 2JS3A 4OCZA 3ZHQA 1PIWA 2CHFA 4J3NA 2A3NA 1HDRA 4XVQA 2PYZA 4J11A 2H07A 4EELA 2R60A 3LCCA 3VH1A 4UXHA 4A7PA 4P9CA 5K3CA 1L4EA 3QEMB 4L5IA 4G97A 2P27A 4P81A 4W7SA 1B4DA 3ZWCA 1YHQV 1X7WA 5EZQA 9LDTA 3ABMB 1AI5A 1W8DA 3R4CA 1Z5OA 1LC0A 1FYVA 4JP2A 3O4RA 4MYTA 3GUZA 1Z7WA 2PKQP 4BNUA 2ZBPA 2JI9A 3DM5A 3ZS8A 3V7UA 3MTEA 3EPJA 1T3TA 2Y4UA 1MUUA 2EINC 3T1OA 3L75H 4L02A 4B33A 1KS9A 3TJMA 4MRMA 4N23A 3BPSA 2G5PA 2O4CA 3KZKA 4ZOCA 1WXIA 3LCRA 4GLFA 5JYEA 3EE6A 2CGNA 4M9SA 1R3LC 3V2IA 2MSNA 5IAJA 1NN3A 5DN6G 3RLIA 4IHJF 4LQLA 1G8AA 3VO9A 4RFVA 4RVHA 1CQXA 1Y3IA 1EWQA 4N6OA 1SUDA 2PUVA 1JQAA 3NJ4A 1A71A 2DEUA 2O3SA 1H22A 4IIFA 3VPCA 2P5YA 3KL4A 2QAGC 1E5VA 1WY5A 2FN7A 3K70C 1UBKS 4MV3A 2CDYA 3R20A 5C8YB 4X8LA 1X38A 2Z57A 1MH9A 1SWVA 5EUQB 4Q9LA 3PC7A 5JJIA 4WVLA 2RN9A 1YFZA 2ZVPX 4N5DA 3NHMA 2WWGA 3I6MA 2WB2A 5G0SA 2OHIA 1OH6A 3DGEA 2PO5A 4Z4GA 4WCFC 3K9CA 4M2LA 4NE2A 5T57A 1Y5NA 5K4HA 3RIXA 4NESA 4NMLA 3C8UA 1RWKA 4H1TA 2ADMA 3K9BA 4ARZA 1CEEA 3EC1A 4FDMA 3V8RA 5KWSA 3K73O 5BZBA 3AM4A 3JZFA 3O9OA 3H1FA 3T7JA 5K3EA 1GARA 5KTKA 4MW1A 5AKJA 1SQ6A 3I4FA 3C43A 5DBOA 1UXKA 4RETA 1DWPA 3FHOA 3CRMA 1XZ8A 3DXYA 2I8LA 5B3SC 3E1GA 2PKQO 1AKQA 3MMSA 3DP9A 2QL6A 1QGUB 4Z1MD 4A23A 1I30A 3PNSA 1VG8A 1A5ZA 3B38A 1G8HA 2JW5A 3ZQUA 1HMPA 5ICEA 2D1YA 3BE6A 5K0SA 2GKSA 3H13A 1DKUA 2AC2A 1WMAA 4TWJA 1G20B 2NUTB 3PPWA 3GL9A 3IAXA 1ZZGA 2XCIA 1N57A 2PGJA 4EDHA 2A2ZA 4LF5B 2NM0A 2BFMA 3WYAA 3VU3A 5CLHA 2HBYA 4LD4A 1CG6A 4Y8VA 2GNAA 1SCUB 5THXA 4YT2A 1N36O 3NNDA 4LECA 1ZNYA 4NG4A 5ES3A 3KCXA 2JLVA 4BBJA 4ZTBA 2GBFA 4CQMA 2FR8C 2F1IA 3V4ZA 1WP9A 1G5TA 4N3NA 2O20A 3DZHA 2YS7A 3EOZA 1E6CA 4IIEA 2PW9A 4ODIA 1XDSA 2CD7A 3UMFA 1YMVA 1ICEA 4GDFA 1WXXA 1L0BA 3ZBTA 3H1AA 4QATA 2X7XA 4ENUA 3A0RB 3KAQA 4TMYA 4K9QA 3C15C 3E9MA 1THZA 5FBRB 3QKSA 4J4BA 1PZXA 3PUYA 4M9ZA 1HY3A 1XAJA 1J90A 1A9PA 1E64A 4F60A 1TF5A 1D2RA 4LHZA 2D2EA 4U8GA 1IEWA 1OFUX 4L4UA 4JI7B 4ATNA 4QREA 4ZI5A 4DSAA 1Z8NA 1GNRA 5HJ7A 2IK8A 1Q8IA 1EN5A 1RI1A 1OU0A 5LMNO 1TEXA 5LMUB 3L0IB 2I7VA 2HJRA 2VNJA 4MVCA 4PZAA 3ZCQA 2H51A 1RC8A 2GUGA 2Q6LA 5JCJA 2XF8A 2Z95A 1WX1A 3WK8A 3ISVA 3I83A 3WLNA 4UE6A 3TNJA 4EG6A 5L51A 3GQVA 3VUEA 2R79A 1P0PA 4BP3A 3GGGA 4BNTA 1EINA 1RJWA 3PXAA 5GIPE 5DRTA 1ORQC 3V7NA 2W2OA 3F97A 2OORC 3AYZB 4LRUA 2BMDA 4D98A 3HKBB 3U1TA 3OI7A 2PA0A 5SY9A 2LW1A 4ZAVA 3ILVA 2ZVQX 3NAGA 3RG8A 5I9MA 4CQLB 2BI7A 4F3RA 5JNRA 3P0RA 3CXCU 1F5NA 1GZVA 4EUHA 1RQNA 3F8SA 3GYGA 3AMVA 3ZWQA 1GXSA 3QELA 3W3AH 2EBUA 2NNUA 1OLOA 2D3OW 4GGOA 1GRRA 1Q17A 2L19A 1BGWA 4DV4O 1H0SA 1LI5A 1A9ZA 1P77A 4RC9A 2QAGA 4EQ6B 1W59A 2QMZA 2N42A 1BXGB 3L6UA 3RRJA 3BWBA 1EM8B 3VYTB 1YF3A 1TPZA 1N5RA 3UTCA 1JDBC 4BNWA 2VQFB 4LJRA 2ZTMA 4U7FA 4XQ9A 1ZOSA 4OXQA 1SHZA 4KUGA 3ONNA 4WCFA 4OGLA 5L3QB 2EW8A 3GA7A 3ZE6A 3I01M 3TGPA 1M72A 3GB9A 5CIQA 1SPBS 2NXEA 1FAFA 3OEHA 4OBXA 3WL3A 3OZBA 1IB6A 1VXRA 1U0OC 3LX6A 1NMQA 3U0ZA 3KWFA 2OCDA 5CBGA 1TUIA 3FYDA 1RLUA 1OFIA 1X1BA 2HLNA 3QOYA 1AKMA 2B3JA 3RWBA 1WWRA 5EKDA 1XI1A 4B8YA 1RP1A 3GJTA 2IYSA 4E3ZA 2J6IA 1UP4A 4M89A 3BK1A 2ZEJA 3BRSA 1GQFA 3SFTA 1L8QA 1DIOB 3NX4A 4FKBA 1CTQA 1WBJB 1Y6XA 3HYNA 3I53A 3BAFA 4YMGA 2X5XA 2W93A 4V2UA 3BXPA 2A4MA 1PT8A 1AN9A 1QIHA 2YYZA 1VQOV 4D9MA 3W79A 1XR3A 1ZCJA 4GX0A 3I0ZA 4YAKA 3H6HA 2FR8A 5C81A 2JI8A 5FA8A 2VDNB 2EKQA 1Y74A 3JCUZ 4IQFA 1NI4B 2JVIA 2EIXA 4GXTA 7ADHA 3ZWAA 3FB1A 2H5JA 3NVKI 3V48A 4WKPA 1Q57A 4QWMA 3GDOA 5D1NA 4IXMA 4KL8S 1IOZA 4ZKEA 4PWYA 1XTKA 2C5GA 2DCMA 4MRRA 1GWNA 4DG8A 4YN3A 4YYZA 1IRIA 1SK8A 1WUIS 1OAOA 4G07A 3K9AA 4U0JA 1C7ZA 2KBFA 1GTG1 5JC8A 2W4MA 3QUCA 1S9HA 5EKUA 1E1NA 4D4LA 3FNGA 3N8DA 1ZMXA 2R5FA 1FVFA 1O87A 1DU4A 4FVMA 2CLKB 3W2FA 2VQEB 3T41A 4ZVNA 4BNHA 4LWSA 3MWJA 5IJAA 4J29A 1RP7A 3MWFA 3J7AU 2J87A 4NE7A 2F95B 3ETJA 1M67A 3CLSD 3UQYS 3VVLA 2B6HA 3D2BA 2C0CA 2H00A 3TZHA 2V9PA 2ZUBA 4O8YA 1L5RA 3WA7A 3S55A 3Q2IA 3GH3A 1NMZA 1QTNA 4X66O 3ROTA 4BW5A 3G02A 1Z75A 4TRJA 1JHDA 2ZIGA 3M9LA 3I2KA 3K8QA 4MV4A 3K3PA 3KQOA 4HN2A 3DCJA 4I4CA 2WICA 3BXOA 5FLEX 3U13A 2VEOA 4EKEA 2GLXA 4AZVA 1XLWA 2BFAA 2KWIA 2QIPA 4E4YA 5KOJA 5HA5A 1P2FA 3AERB 1U4NA 5JQWA 3BUSA 2GSMB 3QBTA 4DLYA 2UYCA 2DQSA 2IHTA 4TRMA 2P06A 5B1DA 1RYFA 5BQFA 3LLVA 1OYOA 3DDZX 1GU1A 1P9WA 3G23A 4NAVA 3R3ZA 1WETA 5IT9A 1E2BA 1BRTA 2VN8A 3LJKA 3ZHUA 2ZZKA 3KLNA 3DMOA 1P39A 3RWOA 2XVXA 4F3YA 1OXMA 1M73E 3LT1A 1ZS9A 2Z9BA 4OHXA 3D1LA 1XQ8A 4N3BA 5IM5A 3T99A 3CLUD 2Z2KA 3EZLA 4Y1RA 4O25A 2IBSA 5JPDA 1P4GA 3VR5H 1TKRA 1JMYA 4Y2RA 5A04A 1C29B 1TZJA 2J3KA 3GCXA 1NMYA 5CPBA 3RSSA 2QRVB 1RTTA 2WJHA 2VDWA 4GL2A 1MGOA 2Q5ZA 4X54A 5CYGA 2ZJ5A 4HDAA 5JTTA 1H3NA 2B7LA 2W0FC 2AHYA 4R3NA 1AR5A 4MHOA 1MC1A 4TWRA 2L69A 5ILOA 2ZBFA 3M4YA 2OAEA 2QE7G 5EYPB 4N82A 2WWTA 4AURA 4LCBA 2W71A 3MGKA 4NABA 3ZGOA 4Q02A 1QANA 1AI6A 3EH2A 4PZ0A 3EGXB 3T4PA 5J2TB 1DCTA 1EX9A 4XUCA 2PSDA 4JL5A 1LQ2A 4P83A 4IQ8A 1Z3AA 5BMVF 3E9CA 1TQ6A 3UMVA 4YI5A 3NAZA 2XW6A 4RMNA 1W0KA 2VS0A 1THMA 1WB6A 3DTVD 2CNKA 3CCRV 2QENA 1BDHA 3AGQA 1YAJA 3IODA 3RVJA 2NP6A 1O5TA 2GZRA 2GPNA 3ST7A 2IOYA 3D6VA 4MUNA 1DARA 3CW8X 2GVZC 3T5GA 3OM8A 1HSOA 1U7XA 4YMIA 3ZZUA 3ES9A 3IV7A 1KOLA 5AUOB 1GR0A 3G13A 3SGLA 3WAKA 3JYLA 4P4SB 3PPIA 1CHDA 4D9HA 1RLOA 3GJRA 4M1OA 1GITA 1OF1A 3QVWA 2WVGA 2DH5A 3JD1A 1JW9B 3TXXA 3TLEA 4E6EA 4PNEA 4JUCA 4PYKA 4H2DA 1ITZA 3I04A 5C46F 1SXPA 5M04A 4XD7A 4UU0A 4E2ZA 1EGVB 1M8KA 4MHSA 3L1UA 3OG9A 3LP6A 1BA3A 3CIFA 4Y0AA 1T29A 4PQGA 2OL4A 3V6LA 2ZTHA 1PJ3A 2Q41A 2X8AA 5JVDA 1BDIA 5EESA 5DNCA 1LI7A 3QOWA 2YVAA 5KUTA 2WKWA 4TZ6A 3ZR4B 2H1SA 4TYQA 2WJWA 1SCIA 4FKMA 1PM9A 1GUYA 5ECYA 4F1JA 4GX1A 1P1KA 5KX5A 2P6UA 3TW4A 3LQ2A 2WJYA 1SERA 2PRIA 3SPGA 2EDAA 4CS2A 4KFCA 4B3HA 4ZCQA 3CGWA 4I19A 4DV2B 1URPA 4TT3A 1X7WB 5K0TA 5T4EA 4KHPO 4Y6RA 4AD8A 4RACA 5JWRA 4DAOA 4GZLA 2BN4A 1FFCA 4UNNA 3M33A 3LC0A 1N1GA 3SPCA 1UOOA 3ABQB 2A0WA 2O19A 1GA6A 4NY1A 1R9NA 1OX4B 3H5WA 1SS3A 4N5IX 4GPBA 4GF5A 3DS8A 2IWRA 2FFHA 1QF9A 4D99A 1ND5A 3WP0A 4OHUA 2ONYA 3ENQA 4MRMB 4QELA 2XNDA 1E6UA 3MWKA 3ROMA 4HATA 4R8RA 3U1BA 3TQSA 4QJBA 4JU9A 4I8DA 3BL6A 4LF5O 1JR2A 2V8OA 4MPDA 1I0IA 3IXQA 3OMXA 4MVUA 3PJEA 3IPYA 5FBKA 4WXEA 1VECA 1SC9A 1QYDA 1RHQA 4D9IA 3F6RA 2QIOA 4O2AF 4LBVA 4HRWA 2W6QA 4IHKA 4F4FA 4LNUB 2RGXA 5KNCD 4NFYA 4QQKA 4KAFA 1ZK0A 3AIKA 4ZIRA 2VHVA 2PG3A 1XAIA 3OCUA 3MTQA 2NXWA 3K6SA 3A6PC 1Z56C 3MUOA 1PX0A 3KE9A 2PH3A 1JT9A 1KO8A 3TZKA 1I3KA 2PKEA 3KU4A 2GPBA 1RMYA 3G9TA 2I6XA 4DXWA 1ULAA 3FB5C 1UC5B 4RLSA 4MH0R 1K88A 3TOCA 4ARZB 1XNQB 3L1IA 4LJYA 4CUKA 4A2CA 2ST1A 3TJRA 2C4VA 2RAUA 3K4QA 5JECA 3CF0A 4RJ2A 4REMA 1PGNA 4IWYA 5I7AA 4C01A 4EMSA 5DCLA 2ONCA 4U39A 4DR7B 1V26A 4EFKA 3B2EE 1K5DA 5HIIA 3BWEA 4MTCA 4IF6A 4G01B 4JI7O 1QRTA 2E6UX 3X2SA 4YAWA 4ZAXA 2XI4A 2MMCA 4RNDB 2M7WA 3VDNB 2L0XA 2JDID 3BZUA 1NG9A 1K27A 5KYUB 2BBOA 2QJTA 1L8OA 5F33A 5LA6B 1UPXA 5LMUO 5EZ5A 4DB4A 4F7OA 1A9XA 2E55A 4CQNA 2XTMA 4YECA 1HNXB 2QQFA 1BS9A 1APBA 3SD7A 1V5GA 4KGVA 5EJ5A 5JXWA 6CHYA 5AVYA 1ECJA 2DTEA 1U6IA 3OLWA 1S2DA 4P7GA 4CQMB 1X7XB 1HYBA 2GETA 5KVCA 1XO1A 4Y2QA 2FMKA 4LX8A 4OKSA 2X5NA 2G9UA 4CT5A 2I78A 1HT0A 1R8XA 3ME5A 3N87A 3FGNA 1YZBA 2XCSB 4JZYA 2DXIA 5SZIA 1N2IA 2REXB 3L7IA 3QKTA 3OMLA 2BEVA 5EIOA 3QPCA 2X3FA 5TMBA 1XE3A 4LYYA 3AZQA 1CJSA 1YONA 3WG9A 1NG1A 2JCXA 1D0VA 3KUDA 3WGIA 2W70A 1B74A 1NWHA 3NEPX 3QKSB 4LZOA 2Z3YA 2ODAA 2W6JA 4Z0PA 2GUWA 2A59A 2QTMA 1NUPA 2HR3A 2JBAB 5CJ2A 4WZAE 1JR9A 4QUKA 3UUEA 1OASA 1P7WA 3DBLB 2O7VA 1W0KG 1LPPA 1RQRA 3KCYA 3EB9A 3LKZA 1N3BA 3VKHA 3D6FA 3MJRA 2FFBA 4MGYR 2RHGB 2JRLA 2IU3A 1R5XA 2Y93A 1MO2A 2ZSFA 1C3EA 2H57A 1D4AA 3EX7C 5J40A 5I9NA 2F1KA 3QEMA 4PVCA 1P0IA 4MS2A 1E1MA 1BL8A 1D4ZA 2H17A 2I29A 3TNFA 3P26A 1E62A 2C5HA 3PCRB 3TQOA 3TL3A 3T3GA 5ANRB 1Y1PA 3F1LA 1MX9A 1M8JA 4UBNA 5CM9C 3LGAA 1WABA 2WP0A 2C2YA 4NBLA 3ASYA 4FK5C 4RS4A 4J07A 2HHHB 1IXKA 3BDAA 3TE7A 4MQFA 2XYQA 1FMCA 3LHFA 3EUEA 2HLDA 2CCJA 2PHZA 2WA3A 4GM0A 3AUFA 1CT9A 2W4QA 1Q7BA 3I1JA 5DM60 1QYXA 2YN2A 3GZTB 4BQOA 1SESA 3FXAA 2EX1A 1KF0A 2R6ZA 1DZIA 4IMJB 3U3DA 4MA5A 1SZPA 1XD2B 2VA9A 1I14A 4MS1A 1EVIA 3GVMA 4N41A 4GM4A 4IIVA 2XWPA 2ZJ8A 1JV2B 3SOPA 2YUIA 1STOA 3W2EA 3ITEA 2HN9A 1I5EA 1PNMA 2UXXA 1UBRS 3L07A 2VS1A 1XQWA 3OTIA 2CFOA 2QAGB 4J6EA 4PTLA 1E3DA 1U0NA 4BKPA 3K70B 2WHYA 3GFRA 5JCXA 5GJBA 1KK1A 3CCSV 3SJZA 2IKSA 3B4SA 5KNDD 4WCFB 5FO0A 1XTTA 1NDHA 1T1SA 2GZSA 5BWNA 2H5EA 5BN5B 2PZAA 4RCZA 1V2GA 4GE3A 3R7NA 4EKWA 3ULKA 3LS2A 4GKJO 4G36A 3HCNA 4J0HA 4E6PA 1EXNA 3P2IA 4PG8A 5BWLA 3HNOA 3IBTA 5B3SB 3MRSA 4I5DA 1ZRSA 1EK1A 2QZ9A 1NW7A 1AQ6A 4IV0A 1N8TA 3FSRA 4E70A 4P9OA 3Q10A 3UGKA 1ID1A 4PC3A 3FVRA 2WVAA 2H4XA 2DOSA 4B0OA 2JFOA 4ZI3A 5CLGA 1ADCA 1JTFA 8OHMA 2NUTA 2WHQA 4ZT3A 4FYKA 4LD2A 3ZU6A 3O1HB 3PIIA 3MWDA 1TRKA 4JXJA 4KRXA 3CB4A 3LQ4A 4HYTA 1PQPA 3L8MA 5B58T 1RM5A 2ZT6A 4E31A 1I4DD 3PENA 1Z0UA 4E07A 1WDKA 1SCUA 1M54A 5AHKA 4KR9A 4BO7A 4X3CA 5DGHA 3ZJZA 5IU6A 3A6HA 1Y74B 2B4TO 3BK2A 3DB2A 3OF3A 2W8ZA 2RGWA 2Q9AA 3UJDA 1ZVKA 1O8BA 1FTQA 4D8WA 3S2IA 3OPNA 5G3YA 2AE1A 4H7FA 1QAQA 1Y4MA 5JG7A 3OF2A 4TGLA 2B4KA 3QWBA 3P9YA 1RZRA 2RKWA 3G5AA 1M1ZA 2VSNA 2BM8A 1P3Y1 3A0RA 1SAYA 1GUAA 2FR5A 4B83A 5KYYB 1DUIA 4JTDB 3GJ3A 1J56A 3GJ4A 4H18A 1NY5A 2IX3A 1X8LA 1CNFA 2DX7A 3CURA 4X7RA 3QI2A 1E8MA 4EB8A 5IYDO 1P6UA 2XVMA 1I2BA 3DEZA 2AN3A 4P1ZA 4TSFG 2NQ2C 3UMCA 2ZUVA 3PQ4A 5F1YA 2QX6A 4NBVA 2WJPA 5DXJA 4HOYA 1K7FB 1PUXA 3K59A 3S2YA 4MVJH 1T1RA 1K7EB 5K3FA 3OJXA 4AMYA 2IP4A 3O8BA 1ENYA 5JJBA 5FOWA 1KC8W 3JQ6A 3FYEB 3V2GA 4KN5A 3T3MB 2GN4A 1XEWY 3ZE2B 2POCA 1L7PA 3LA6A 3OLQA 1ZCFA 2Z5VA 3EF3A 3H7IA 1ZH0A 1YACA 3JWGA 1ZH6A 1WF6A 4QOSA 2Q2QA 4L8LA 1L4NA 4C4SA 1N36B 3I1FA 4MITA 4F96A 5BO5A 1OJLA 3K0CC 4B7EA 1LUAA 3SVZA 3BA6A 3KSZO 1HXHA 4TUYA 1PYGA 3HABA 4JZGA 1UJNA 3BZBA 4D8TA 2FFRA 4CQLA 5KIAA 3B6JA 3FVVA 3D8SA 2W6JG 4PYRA 4F6RA 3R9WA 3LC2O 3ORFA 1NP7A 2W98A 2PFSA 2IYWA 5IFLA 3DAOA 1ZONA 1H1LB 1UT8A 4URHA 5LDDC 5J23A 3W05A 1ZD2P 1A9QA 4BPBA 3D02A 3URMA 5A5DA 5A0VA 5HCUA 1TU4A 4AY4A 1CUYA 2DSNA 2E75B 1FY2A 4EG2A 3IJFX 4Y1RB 1EM8A 1RSOA 4GLBA 5M5BA 2MT9A 2DUWA 3WGOA 2I1LA 3TMAA 1N4AA 2V65A 2VJDA 2Q7EA 2BFOA 4QVKA 2GD0A 1ZOLA 3EXG2 3TAHA 3K0AB 2H4YA 3GN1A 1REQA 3H2ZA 1HF3A 4EMTA 5LMNB 4HVTA 2Z8YA 2DGDA 1UP6A 1WLYA 3OKFA 2W42A 1L4KA 4NU5A 3T1HB 2C3MA 2FPSA 2GJAA 1JJIA 3D7LA 2NOAA 3X1MA 2H52A 1AKVA 3L84A 5GAJA 3V55A 3RWMB 4RJKA 1W76A 1X70A 4CL3A 5DLDA 1CULC 4ENRA 4PWZA 5IC6A 2JS7A 2IUEA 4Z6KA 3UN1A 4BEWA 4RWUA 3T4XA 1WB8A 3FUTA 2C7VA 3BXZA 2ZIWB 4A10A 3NBKA 1SC1A 1LLFA 2GAIA 1Q6HA 2AMVA 1TA9A 3CMAV 3DMFA 3H1GA 2JEXA 2XOKA 1F14A 4DR4B 4F7DA 1RQPA 1B3BA 3ZCPA 1MQSA 1PVDA 1KSFX 5CNMA 4LYJA 3K5IA 4B6OA 2ID9A 5DNAA 4X0EA 4EF6A 4KV9A 1TYDE 1QHIA 1C8BA 2VTDA 4FLEA 4ZTUB 5CFRA 3C7CB 5EE0A 4CT4B 4DV4B 1G6OA 2AQHA 1D9XA 2BY4A 4GC5A 1KYZA 4B09A 1Z36A 5FWAA 5D7NA 1FD9A 3AI2A 1XTPA 1U8FO 3U80A 5EG5A 1TQ2A 4I2NA 1JJ2U 1M2WA 4DCOA 2FQYA 1MT3A 4YONB 2YW2A 4V02A 4YGXB 3V1UA 3NBYC 1RKVA 3WGVA 4MTOA 1AS3A 5JW6A 1L5LA 2D1FA 3ORQA 3QU7A 3D59A 1VJ0A 1N7HA 2OAGA 4Z9AA 1ROPA 1OLSA 5ALOA 3WKDA 1I7FA 4R9NA 4OUKX 4QARA 4IIUA 5DCWA 4RE6A 1A8QA 3KB2A 2VF7A 4LGMA 2W2LD 4OP2A 5JU6A 3FHJA 1WU8A 2P9EA 4WY5A 4U7JA 2QYOA 4YJ3F 1E96A 4WNYA 2ZIUB 1K4DC 1UXIA 2DP4E 2IW1A 3UWMA 1DJLA 2C88A 3BTVA 3WLQA 5JRJA 4NEHB 4OKIA 3K8OE 1SCBA 3D6NB 3ZUGA 3A1SA 3BWDD 5DN6A 3Q3VA 1ESZA 4E88A 2P40A 5FCDA 3U4HA 4F38A 5CEFA 1U8UA 4B85A 2XQFA 4A6PA 3TTSA 2JHGA 2C2MA 1OIXA 2ZWOA 1P6XA 4CM5A 3NNSA 4AJOA 5EPEA 4AO7A 1IZ9A 1C9YA 4M53A 1T25A 1XNQO 2WAAA 1BX0A 5H68A 2O14A 2BZGA 1RWXA 3ZRXA 1NP6A 2GARA 3AERA 4PBRA 2EEPA 4DR7O 1BMQA 5A3VA 1R3DA 1G291 2F9MA 4K8RB 4DV6B 4JTCB 4D9FA 5JAQA 2IJKA 2EC5A 4Z7OB 3SS7X 2AB0A 2GV9A 3VU8A 5HF9A 1QBGA 3WE7A 3GO4A 1ZUIA 3EH1A 5L53A 4RVFA 2JFWA 4JC5A 1T0UA 3RC9A 3QHQA 1UBSB 1FDWA 4AY6A 3AEYA 3PFCA 1BVYF 1UPFA 4WJZA 4OA5A 3CYFA 1RLMA 2Q3DA 2PZ8A 5CDTA 3CA8A 1T3GA 3ZBPA 4ITUA 1C3OA 4EG4A 1ZSVA 4HY3A 4J75A 1W2GA 1HNXO 4BIIA 4HNQA 1EQAA 1QZ3A 1NF2A 3CC8A 5C35A 2K4MA 3ZWYA 3TD6A 1NVVR 3CZCA 2YYAA 3DYIA 3EXFA 1DSSG 2RIPA 4ZIRB 3TLCA 2QRVA 3AO0B 4DCNA 3T7TA 4TXMA 4R0VA 5LOVA 3OTWA 5ILQA 4TWAA 3ICEA 1AGXA 5BMOA 1T3SA 4TLMB 1NX9A 4X66B 3RM3A 3K6SB 4D26A 2HWXA 2QYSA 4RH0A 5AKZA 1WLSA 2DT5A 2ZJFA 3TVDA 1N5DA 4WKOA 3LC1O 3KOOA 3MUEA 4IYRA 4A92A 1YB5A 3STUA 5EYPA 1W46A 1GK9A 1AKNA 3RU9A 1ZO8A 1U96A 2FW8A 2H1OA 1UBOS 1X1AA 3E8GA 4UM9D 1QE3A 1XCGB 1M56B 1PO7A 1JYEA 1E4VA 3RSZA 2O3QA 2R00A 4OXYA 4KQ9A 1W2BU 2Z43A 3L7BA 3THRA 3EGXA 3LWNA 4N8EA 3BCCH 1OWMA 1XZAA 4R83A 2X1VA 2KB1A 3JWPA 1MC8A 1R4NA 5COAA 4EW6A 4OJQA 3PXBA 4EPXA 3TF5A 2O95A 3SNHA 5DTQA 4RENA 4PPFA 3G0BA 2VNAA 3DAFA 1R5JA 1CP2A 5ALUA 2F1JA 4XR4A 2HU2A 4O6VA 1SGWA 1CNEA 4MKZA 2KJQA 1T8UA 2R7NA 5EQFA 1P7PA 4HG2A 4FGJA 1U2EA 5TMEA 4FW8A 4ARAA 1A9XB 5JZMA 3NP7A 4RHUA 3EIHA 4BYGA 3AR2A 3WRYA 3HUUA 4PRLA 4HZIA 1V8PA 2OD7A 5EGNA 4KW7A 1NVTA 2WHEA 1HOXA 2Q68A 2H0RA 3PFGA 5LNK1 4YCNA 1I33A 4F4UA 1G6KA 4MS4B 3ZVMA 1JR3D 2FK7A 4P4SA 1OY1A 2ZNJA 1P9NA 2QK4A 2ZKOA 4EHNA 2ZQZA 1X8KA 3UAZA 2BDUA 1IK4A 2G7ZA 3LPCA 3DFMA 3HEBA 3O21A 4DWOA 4AMZA 1FSFA 2QOEA 3KAPA 4B6PA 3G80A 1ZM4A 2EIMC 3DOOA 3B85A 2C00A 2FN3A 1HFKA 4YA6A 1CUDA 2B2NA 4DDWA 3G17A 2RE8A 1PEAA 4XX1A 2ODWA 2AXTZ 3O7WA 1R3JC 3ECCA 3FPFA 3FUWA 2HBQA 1GG8A 1U94A 5DK6A 1U80A 2ZTLA 4ZRDA 1HT2E 1N0UA 3VPGA 3DLBA 3GJ7A 1I6WA 3GLIB 4I4NA 1GUZA 3MBIA 4YAIA 3I6IA 5BSHA 2OKGA 5K45A 2IIBA 2G0TA 1PNOA 2YIDA 4BLUA 2E0IA 1Y4ZA 2NTEA 1V5FA 4RJIA 2AK2A 4NFSA 1YHZA 2HQ1A 2RCVA 4XGRA 4BP8A 5HOQA 1V8FA 2QI9F 1AI7A 5ICSA 1XZIA 2YI9A 4GPD1 5DCAJ 5HS6A 1QAMA 1P7BA 3TETA 1GTL1 3WQSB 5TSDA 2HU7A 3GAFA 3Q7TA 2NYRA 3NLLA 3HO1A 3TMKA 2YJ3A 2WKQA 4AJ9A 5FFFA 5HX7A 1EGHA 1OT3A 1XZMA 3KYDB 4EYEA 2A78A 3KYJB 1KJWA 2FSUA 1YE5A 1RIFA 2BMAA 4GD3Q 4I0XA 4PHFA 4HL6A 1EVEA 4WFJA 1OX4A 1R5OA 3FTCA 3Q5EA 4JT4A 4CUZA 4MQFB 4PX2A 3CUEF 3OUZA 5DHFA 3PF9A 4ZDIA 1S02A 1MHPA 3C8HA 2RK3A 5FI0B 5U4XA 2KHZA 4PXYA 2ZTUA 1NVVQ 5IHXA 2CNNA 2XMRA 2ZBRA 3DFFA 2JGKA 3OZDA 3L7YA 3EPKA 1DWOA 1QLWA 4MS1B 4YMVA 3W2HA 3GAMA 3C16C 1A7UA 1P7YA 3N28A 5K5EA 2O5EA 1CXZB 2DUNA 4Z9YA 1L3CA 4PZPA 4F7WA 5IKEA 2Y0DA 4LNUA 1C8KA 3IQEA 4D74A 4DYHA 3VR3A 5EXPA 2HTEA 1J09A 2QY9A 5LGNA 3T5CA 3JQRA 2Y48A 1XTZA 4PAGA 5KI6A 3SBDA 1LCIA 4U8HA 3TJZA 1FU4A 1N8RW 1EVLA 2HCFA 4DDUA 5LXTA 2PSFA 4COKA 1FRVA 2YIBD 4HFMA 3W7VA 1ODCA 4HBZA 4ZWNA 2Y92A 4LI3X 5AJZA 1GCOA 4EUKA 4FKZA 3DKKA 2GAFA 1MHTA 2EFGA 1UPUA 3P32A 1KDPA 1D0IA 5CXUA 2IXTA 3I45A 3GWZA 2G28A 4KHPB 2VC2B 1FRZA 1YJXA 2VJBA 1QV6A 1XWFA 3HCEA 4MW3A 4I9GA 4BNJA 3PFFA 1UWCA 3DXFA 4QLAA 3H1KH 1YJ9V 3MTJA 1Z22A 1C4OA 4CN8A 2VP0A 1NQOA 4FEYA 5JIBA 1DGQA 2NT3A 4D9JA 4HK4A 1PT7A 1KPGA 3Q7QA 1CY4A 3TEFA 5U4QA 2V7QG 5KYUA 2XR1A 5EC8A 2H5IA 4Q82A 3JZIA 4Z3OA 1UJMA 2YIMA 5LA6A 2XMSA 3T7SA 2QN7A 3TO5A 3IH5A 2FN9A 3NM5A 4ZYLA 2QX4A 4HNGA 3R3VA 3MWDB 1Q21A 1XCLA 5MFPA 5K2MA 2YXLA 2NVOA 1N9KA 4Q6GA 2QUZA 3FCUB 1L8LA 3FFAA 2QVZX 3T7DA 3WGJA 3T5PA 1FTSA 4EUNA 4KXLA 3OTHA 1FFHA 4A5SA 3PYLA 5LQRA 3SPIA 2P78A 2GZ1A 1KAOA 1SBQA 3CCUV 5E8RA 1X7XA 1Y1LA 3RUIA 4OVKA 1I2AA 3VYUB 1ODSA 3G5TA 1DDOA 2VTKA 3IRUA 3RUDA 1VK9A 3P71T 3QA9A 5LZ5A 1U8YA 3SR0A 3ORHA 1USKA 4B6SA 3SC6A 4P2ZA 4TQDA 1G9SA 1T36A 5BYJA 4ZHQA 3G67A 1TYAE 1TVEA 1U7ZA 5CVDA 2HWYA 3I5YA 3EEBA 4EYQA 5HJEA 2PZEA 1US8B 3H1HH 4EGCB 4EEQA 2SHKA 3ZMUA 3FOAA 1AB3A 2XAGA 4UUOA 4DKXA 2JJ1D 1K5QA 3CTPA 4IGGA 3UZUA 4IJWA 5JD4A 1BFUA 2JBAA 5LU9A 3OD1A 2NZUG 3RS8A 3K2IA 3DBLA 3L7KA 3KJGA 1AB6A 2LVBA 2CFSA 3FY4A 2ZP1A 2B5UA 5LYJF 3W5HA 3ESZA 3SFZA 3ESYA 2YBEA 5E2AA 4KC0A 1OTYA 1PCXA 5K3FB 1INLA 2QG4A 4XWWA 2RGAA 3H4TA 4S12A 4BC0A 2ROQA 3OWHA 3HP4A 1X4TA 4PQYA 1OFVA 4UREA 3UAGA 3TXQA 3ANSA 2Y1EA 4QT0A 1YJNV 1EEHA 2PZMA 3T1HO 2ATCA 3DOIA 3OQBA 5ALVA 4E03A 1YS1X 5IFKA 1UMKA 3AR6A 2ZZMA 4IVRA 2QZSA 2BGUA 2EFEB 3PRKE 1FXWF 3EXIA 2C9DA 4TLAA 2X0JA 3PYMA 4OLBA 2OMEA 3OFJA 2PX5A 3RHFA 4OAOA 2WTNA 2O8CB 5FTNA 3LX5A 2QE7A 2IEBA 1VMKA 4IX1A 3HSKA 3A6LA 4TUYB 3DVSX 3TDMA 2Q9BA 3U19A 3GLVA 4IS3A 4L0DA 2CGOA 1U3UA 3E8XA 3OQVA 4DR4O 2JD0A 1TVCA 2NYVA 4F6RB 2PY6A 4Z1VA 1XD2A 3I3SR 4GPZA 4OK6A 2AS0A 3WI7A 1G0OA 2VUSA 4HDSB 5LMCA 1R27A 1K9MW 3BKWA 2N1BA 4HAWA 3RR2A 3WSVA 1DBRA 3UANA 2CDBA 5FTMA 1QU3A 4QRIA 3MS4A 3PEVA 3DMGA 2CBGA 4DVGA 4NCKA 1H9AA 1N0VC 4HDRA 3DW3X 3T2MA 1RSOB 4E5NA 4CMGA 4U2KA 1T5DX 2OV6A 4E30A 1SU8A 1I0HA 4P3NA 4RKFA 1ZI8A 2EFHB 4I46A 3GU3A 3RQIA 2NYAA 3ABZA 3CVYA 1JA8A 4UEQA 2Z5LA 3ZIAA 2IYTA 2WSYB 1REQB 3RTBA 2CDRA 3RRXA 1JDTA 5BN5A 2H7CA 4KIJA 4C1NA 1QAOA 1DB3A 4XW2A 3C4QA 1K9SA 2VOJA 2PWYA 5DBIA 1QX4A 4PDVA 4JBIA 3FLBA 4HFNA 2FPRA 5ER6A 5GINE 4TZTA 2HHJA 3RVPA 5TC4A 4HYEA 4ZREA 3DBHB 1MV5A 2ZI4A 4BX8A 3Q0EA 3DBVO 5JXGA 1I5YA 2A1TS 2QLJA 4G85A 4QSMA 2CY0A 5C32A 4P93A 2GASA 2DECA 4FM9A 3AY3A 3IQDB 1RJEA 2ON6A 1OCOC 3OMWA 4IJVA 4MVJF 1K8ZB 2KM1A 4G5RA 4NBUA 1JJVA 4QDXA 2F00A 1PG0A 1GEEA 2O0MA 4ALMA 4JENA 2OESA 3LUTB 2ZJBA 1G1AA 5C7LO 3U09A 1ESDA 1GTSA 4IF4A 3AY6A 4JJEA 2V6JA 3CRNA 2YZGA 2IIQA 2CUNA 1WD7A 1VPLA 3LDAA 3HYSA 2BLNA 2FH5B 1IK6A 2VH5R 4JBGA 2IH4A 3T34A 5TGDA 3W9UA 4DV6O 3K31A 5A5GA 1PP9H 4IDOA 1KBZA 1DHTA 3O8LA 3D81A 3Q6IA 3OFND