1PL0A

Crystal structure of human atic in complex with folate-based inhibitor, bw2315u89uc
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
589
structure length
589
Chain Sequence
GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Human Bifunctional Enzyme Aminoimidazole-4-carboxamide Ribonucleotide Transformylase/IMP Cyclohydrolase in Complex with Potent Sulfonyl-containing Antifolates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 201
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pl0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pl0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A02
2IU3A 1S89A 1KEEA 1M6VA 1VMDA 1EGHA 1C30A 1B93A 1G8MA 1C3OA 1THZA 1BXRA 4EHIA 1IK4A 1PKXA 1P4RA 1CS0A 4A1OA 2B1GA 1CE8A 1OZ0A 1T36A 2X8WA 1PL0A 2IU0A 5H3LA 2B1IA 1A9XA 2YVQA 1S8AA 2XW6A 1JDBB 1ZCZA 3ZZMA 1WO8A 1M9NA
chains in the Genus database with same CATH superfamily
3LQ1A 1QU3A 1W581 3LA6A 1IHOA 5EHNA 4ZZ0A 3RWRD 5GTDA 1DTWB 5GP1A 5BWBA 3A70A 1NOIA 3PKIA 1ZTEA 1CZLA 5HQTA 2I8LA 3WWDA 1J2EA 1QCZA 1JR9A 4OCLB 3K32A 5K03A 1OR8A 2HSJA 1Z08A 3ZU2A 3QYFA 2KW5A 1AKWA 2ATVA 4YROA 1HX7A 4F8YA 4WJLA 4WHMA 5JSZB 3EY9A 2IBMA 3E1UA 5K6TA 1GMGA 1Q7TA 3EMDA 4ZMBA 3VH2A 2IHVA 4KDRA 4UM9D 3SFTA 2WWWA 4LNUB 2UUCB 4A0HA 2OT5A 1Z25A 2C98A 2JFWA 3TJMA 2IPXA 3E3LA 4Q39A 1B0PA 3A1VA 2K7ZA 1KOJA 1MPXA 1T9ZA 5WRFA 3S1AA 4E32A 1ZW1A 1S8FA 4IDQA 1ILEA 5KDDA 2OZLB 4X61A 1WY7A 3H7AA 1GIAA 2YFYA 4OK5A 5D6NA 3AK1A 4ZT4A 4LF7O 1Q1AA 2PYZA 4LDAA 3T9DA 5EIAA 2RCYA 1YS4A 4LNAA 5KVSA 3Q3EA 1WN7A 3GHYA 3TH5A 3H86A 1R4NB 3V8QA 4WKOA 4FCWA 4MTLA 4EJSC 4FPXA 1QPZA 1TU4A 2BBOA 2NQ8A 1M3SA 5B57C 2K7FA 1S5LZ 4KUHA 2EBWA 3GROA 3G7SA 4IJUA 5EXDA 3AI2A 4RCYA 2NGRA 3U1VA 2ZUBA 4JVMA 1QHYA 2GD2A 3NHYA 1E7YA 5BUZA 4MDFA 2Z4TA 5U4QA 3ER9A 4RKYA 2AF4C 2DHRA 4CMIA 3JATB 4YAGA 1AN0A 4MVJA 2WF6A 1OW3B 1VLQA 2ZT7A 4HF7A 4JBNA 3VNSA 3RRJA 1Y0BA 4MW6A 3Q5GA 2YQ5A 4FDTA 1W6UA 2I1LA 5BRNA 2ECFA 4YP1A 5D00A 4BNNA 1Z4LA 2W0SA 1WPXA 4EHBA 1QE0A 1MZVA 1J8DA 1XEAA 2XQKA 4HWKA 4O4LA 3ED5A 2F90A 3DOOA 4RAQA 2CUZA 4OLBA 3OLYA 2HMVA 5E79Z 4FLXA 1P2BA 2EW2A 5BMOA 3J81A 3B9QA 3IODA 1PT7A 1P1JA 2SCUB 1V8ZA 5F78A 4MVJP 1PR9A 3DXRB 2WSSG 2AGAA 3TCXB 1LBSA 2BT4A 4CGYA 2VK2A 4RQAA 1EUYA 4EL0A 3C3YA 4QXAA 2VH5R 3NKVA 3OG9A 5D3KA 3F6PA 1P1FA 1C7QA 1A50B 2BBSA 4EEKA 1S3FA 4BGDA 2NG1A 1ZDMA 2OCGA 3FX7A 1YU6A 4INOA 3EQ7A 1RJWA 4O2AF 2QR4A 1C9EA 3UICA 4BEWA 5EZQA 4P80A 4C14A 2ZSJA 3QNWA 1NN1A 5B5EZ 2Y93A 4DDUA 4MEJA 4EH1A 2AZXA 1ND6A 2ZRPA 4TWKA 1JHOA 2PH7A 3HN7A 3OKAA 1VQ2A 1ORHA 2B9ZA 2GFHA 5IAEA 3VH1A 3DC5A 1NQWA 5LZ5A 1P1IA 2P78A 3ISTA 4RHUA 1CUBA 2Y1LA 2PZ8A 4QUJA 3G8CA 4S24A 3IVCA 4B8ZA 4LDPA 1I2DA 2HCBA 1QORA 4GKKO 1WVGA 3G85A 3F7OA 4YA6A 6REQA 1X38A 3K09C 5JG7A 1Z2EA 1V5IA 4JYYA 4QEDA 2ORIA 1HT2E 1U2ZA 3A6HA 3RRZA 2I99A 2XUKA 3SQOA 2D5CA 2GBLA 4E0BA 4E4YA 4TZKA 3SWWA 3KAKA 1MV8A 2P5TB 3IDAA 5FOSA 4IJ6A 4MB2A 4RVHA 1XNJA 2PG3A 3LOPA 2R2AA 4CIDA 4ZKDA 2EHDA 1XO1A 4QGGA 2JLBA 3H9UA 4ZFNA 4R8RA 3D5EA 5G1OA 1EVJA 3JQAD 4QUHA 4EHNA 4M1EA 1J0CA 1OC2A 1N5DA 4YECA 1V3VA 2YC2C 3OSUA 1QYWA 2BFDB 4NBWA 1B0ZA 1MQ8B 3ZMTA 1C3JA 2NLJC 1K88A 2QUHA 1HMYA 2C4VA 3A4IA 1PHPA 4P4SB 4XIJA 4ZYTA 2BKAA 1KQOA 2Z2XA 5TARA 2Q5CA 1PTKA 2RG7A 3V55A 4WFAV 1GEEA 1A1VA 4DHEA 5J4HA 4EZEA 2EFYA 3W5DA 4BVHA 2JKVA 3FMOB 3TLEA 3EVAA 3OQIB 3FYEB 1GV0A 1HSZA 2H1VA 1WWKA 2IIBA 4RABA 3JU3A 2GCEA 1F2TA 3FBGA 3KR0A 3L4EA 4U6NA 1NGSA 2ZRJA 4HDNA 2QLJA 3GN1A 2BLLA 2E5LO 5E0OA 3V2HA 1DEAA 1ZNQO 2IOFK 2ZT6A 2DFLA 4OO3A 2PUFA 1JT9A 1D2MA 3PXAA 2GO7A 1PJAA 4BMDA 2H17A 1O94A 4AF8A 1CE8B 1X7YA 1QX4A 1AURA 4KFCA 4OHMA 1MA3A 2Q99A 1TADA 1LEHA 1VTKA 1DAOA 1OQAA 3MW8A 5GJWC 2X86A 4CM3A 3A1FA 1I4DD 2DQZA 4LPSA 1DV1A 3B82A 1H2XA 4HVLA 4E5NA 5DF1A 2EDAA 2OHXA 4G9BA 1IDN1 1BD3A 2CHVA 2H5JA 2FEPA 3NM6B 3V9PA 4ZDJA 1QTQA 2EC5A 4GOND 2J9YB 3EVZA 1UFQA 2PRIA 4LMBA 4AZTA 4EMBA 3G7NA 2NN4A 3PQ4A 2K1EA 2QE7D 4OXSA 2RB5A 5T64A 1XUQA 1C9DB 3BEDA 5IHXA 1AMNA 3T3MB 4LC0A 3JYLA 3GLIE 1U1IA 1ADYA 1KDVA 4JI0B 3RTAA 2OOKA 1R1DA 4XD7D 3HZZA 4UTXA 1U0SY 2VJLA 3JQQA 4FBMA 4ZC1A 4OPAA 4CBCA 1FOEB 1I0ZA 1PUJA 2C8VA 3M83A 5IN5A 1G8MA 5I45A 1DKNA 2POCA 3BIOA 1FU7A 3GP3A 1YFJA 1HG0A 2OGUA 5ILGA 2GK6A 1OH6A 2IIVA 2ROQA 3P7MA 2CMGA 1IM8A 2WE7A 1WP8A 5K8TA 3KPYA 2DWQA 2FI1A 3FCOA 4JCCA 5DBEX 5AVKA 1JFVA 2EXXA 2O2IA 2H5IA 1OI0A 3B5JA 3DMHA 2IH1C 1EG2A 2PXHA 2V4UA 1AK9A 2XIQA 4MJ7A 3TD2A 4FHDA 1BH2A 5FUYA 5AHXA 2BE9A 2J6IA 2XUFA 3RVLA 1CSEE 1K9SA 3KLOA 4URYR 5HFAA 4O4JF 2EX3A 5LKRA 1ZK2A 4CC5A 3DLBA 1NY6A 2W11A 3GLQA 1TM5E 3KZXA 3RGWS 2JGIA 3O2NA 3QYAA 4LNHA 1C7IA 2VHTA 3ACDA 4URUR 4X20A 3BHJA 2YHAA 3JY6A 3OOHA 2Q0OC 5DM70 2YZNA 1OLSB 3AR3A 1OCRC 4MO2A 1ZWLA 2NNWB 3HXLA 4F1WA 5CBKA 2ZWMA 3WO0A 1JX9A 1TMKA 1FFAA 1U2GC 3PUHA 2V5VA 3HBLA 4B82A 3JALA 4PA9A 1C1DA 2H48A 3Q7QA 4NDZA 1GUYA 3IPLA 3R3WA 4NFLA 4U1RA 4ZC8A 4DLAA 1CERA 1C2YA 5C9ZA 3Q12A 2YI9A 1M0SA 3UMSA 1E2IA 4KRGA 4ZOLA 4AIIA 6Q21A 5MF6A 1QGUB 4K7JA 4IRMA 1EVEA 1HE5A 4MIOA 2RKOA 4DLVA 3FD8A 3KUDA 2CNNA 1FSPA 4OHXA 2O2JA 3ZCTA 1Y6ZA 2CH7B 2I62A 1R9JA 1DPFA 1L7BA 2O1XA 2PZJA 2WZQA 3WZLA 6CHYA 4AKIA 1GNPA 3I2HA 1TGVA 1FQKA 1YR7A 4MPPA 5FBQB 5CB0A 4K9LA 1JYEA 1WPBA 2REQA 1G20B 2VF5X 3IIJA 1KE2A 4I7ZB 2JIRA 3IOCA 1QUFA 1SOVA 2I3AA 2XMPA 3LSQA 2J7KA 1B8NA 3H2HA 2NADA 2XE6A 2CJWA 4V02A 4HPJB 2G82A 1K9VF 2FYTA 3IAS1 1EVLA 5F5XA 2IOQA 3H1AA 2LWIA 4QLOA 4X88A 1R6VA 1WMDA 4YQYA 4BVEA 3GEDA 1CQWA 4E30A 4R7TA 5L40A 2YV4A 4LYJA 4ZVNA 3TQHA 1CLUA 4J7UA 3PF9A 2CNOA 4KBGA 4PC2A 1ISFA 2OM6A 3FFXA 3ONVA 3WDLA 4EFBA 3E8XA 4WXYB 3GNTA 5ALKA 5TPWB 4RLQA 1XKXA 4BC0A 1Z17A 3NR7A 5KU7A 3PEWA 2JGRA 4BEBA 5L3GA 1JLMA 2AZMA 1SXQA 3UQYS 4ZJPA 3HBJA 3HUFA 3GLHE 1VF6C 2PTMA 1UCFA 1H2WA 3A3PA 5JZSA 1UMCB 4MRPA 3AP1A 2CEKA 3P9KA 4ND8A 3FA2A 3Q5EA 4K6FA 1N4AA 1PS0A 4MA5A 1H9AA 1KFKB 1S2GA 1ONBA 4IHJA 3TQOA 2DZDA 4XVCA 5LWQA 2Z2ZA 1LA2A 2XEDA 2XOXA 3AL2A 5L6LB 1YQQA 2AC2A 4IUDS 2W2PA 3U0ZA 2A33A 4ICIA 1RIFA 4RHYA 1SXHA 2Q6LA 4KFMA 1N6OA 4BN4A 3DW3X 5IZCC 1A76A 1CUZA 2Q45A 2HRBA 4Z0HO 3KO8A 4IRUB 2J3KA 1GRNA 3IFSA 1U28C 2XGSA 4OFZA 5BR1A 2Z2KA 1WKCA 1VLVA 1DF4A 2B4YA 4HH3C 3BCSA 1JS1X 3G8BA 4KXUA 4C1NA 3JTEA 3O4RA 4CM9D 4GMDA 3UWMA 2CTWA 1L8DA 4OK6A 3AWIA 3HP7A 4PO9A 4AUMA 4G37A 1MRSA 3GT0A 1O03A 3ZRVA 3SHOA 3L73H 4R2WA 3V1LA 3VQTA 3W8FA 5GY7A 1A9PA 5IVDA 1Q6IA 1MOQA 2FEKA 4TYPA 5AH0A 2FFQA 3WLIA 4RXUA 2WC1A 1QG2A 5AKEA 3GNQA 4U2FA 4WBNB 2D0OB 1QAMA 3I30X 1SERA 3JQAA 1FRVA 5BW8A 1BMFD 2MSNA 4JVOA 4MP6A 4DL9A 1E0KA 2DJ5A 2PCJA 2R66A 3SS8A 1QFYA 4CCYB 2P7TC 5THQA 5C53B 5TPZD 4B7EA 3ZOZA 1T9AA 5DBOA 1E4EB 4ZMSA 1JEQB 1P62B 3N8KA 3L7MA 4C0JA 3LCVB 3A10A 1THZA 3ORFA 3U5TA 1RZVA 3VO2A 1YZVA 3L9XA 4YUYA 1RU3A 4UVBA 1BHQ1 3D31A 2QZJA 3U44B 1WETA 5LD2B 4NCHA 4RE5A 2BFBB 3VR6H 1UWZA 2W8ZA 4N23A 3TSZA 3F8SA 2Z9DA 3QJYA 5A7GA 3H6GA 3RS5A 1YQWA 4FGSA 3SQDA 3T3EA 2ON6A 2PTHA 5AW1A 1JXQA 1NXSA 2ZSHA 4RUKA 5KHAA 3GX1A 1KB9F 3M5DA 1XTSA 3KE8A 1TZBA 3ZXSA 5HK8A 3IA7A 1PX0A 1NIPA 1I7LA 4WACA 5TQ0A 2XUMA 1UXOA 4OJYA 4CIXA 5BXQC 1YIOA 2DCMA 4BFSA 4P3PA 4W82A 1KAEA 3RK1A 1E62A 3PUZA 3PEYA 3G0CA 4CH5A 4WWHA 2QTSA 1GDDA 3K9NA 3TECE 3OI7A 4FIPC 3ZZNA 4TMYA 3GZJA 3CKLA 3E8HA 1YXBA 2QYHA 6ABPA 4P4GA 3S68A 4DV4B 4O63O 1PL8A 1W9MA 2HVWA 1G2PA 3STXA 4X7MA 4V0RA 2WD9A 2H65A 4QO8A 2EJ7A 4TRNA 2F48A 1FSSA 4G5OA 1TT7A 1ZXLA 5CFPA 4QXPA 5JI2E 4PHZA 2VPWA 4OREX 3GZNA 2PKQO 3G68A 3TIGA 1UXIA 1GNTA 1OH5A 2AW5A 1V26A 2YNMC 2XR1A 4JLOA 4G36A 2ZVDA 3UAGA 3UHOA 4O8YB 3F4BA 4LW8A 1VL0A 4ZOBA 1H8HG 2QSZA 3HY3A 1DS6A 4Y1GA 3FRIA 4X8OA 4ZAFA 1KBZA 4DANA 4DYVA 1G42A 4RH1A 4XX0B 5DB4A 5KVVA 2QROA 4HYQA 1JA8A 3K9AA 5K3BA 1GL6A 4EY6A 3UQ8A 1I80A 1NBEA 2C2HA 2WMDA 1KRWA 1SH7A 3STUA 4OP3A 3VXKA 7ABPA 1B23P 4U7PB 1TVKB 4LYAA 1JLLB 5LL6Y 3K59A 2VJBA 4QDKA 4AYTA 4PZDA 1JEYB 3C8HA 3CUWA 1TKBA 1QB7A 4YRBA 2G07A 4XFJA 1NTMH 1RRGA 4DLZA 1VSBA 1DC3A 2C2KA 3EF3A 3UBMA 1OMOA 3G6BA 2CF6A 2WYOA 3K0AA 4EDHA 4BFCA 1WB4A 5BV2P 5CA0F 4ISCA 5FQOA 1Z2PX 2JCSA 2K87A 3HLYA 3HB1A 1CDZA 2NSJA 3K8ZA 5GTHZ 5FBKA 1KVRA 2WNIA 3U17A 5ALMA 4EPVA 3WGYA 1IOVA 4HDRB 3GT7A 4PDVA 1ZI6A 5TT1A 4EKDA 5JH7F 3DAFA 5C2OA 1YDGA 3W7UA 1X8LA 3VMFA 2LZ0A 3CH7A 1D4AA 2IOFA 2ARHA 1YB2A 4ZJUA 5HM6A 4QT4A 5C81A 1Y6RA 4IUCS 4KDCA 3VTFA 1XZKA 4O0MA 1BEZA 3K35A 3HVJA 2WPNA 5DT9A 8ABPA 1ZJZA 1S96A 1UBKS 5CTAA 5JRJA 3UTCA 4KLAA 5AT1A 1K7CA 1JCHA 3T1HB 1LBIA 3AYXB 4UBJA 1ZI8A 5I8WA 1TLTA 2O8EA 5DI3A 4BO9A 1P9OA 2WP0A 2CFRA 2C0CA 2XHEA 3M33A 4OAPA 1ZOLA 4KQIA 1NR1A 1Y4AE 1HQCA 1BCSA 1R88A 1UC8A 1V1MA 4QHYA 1TZKA 3V7WA 2G84A 4CCWA 3VYTB 1J0EA 1SO8A 3ZCCA 4B4KA 3T15A 3DVLA 3RSLA 3ICOA 4RD0A 3PX2A 5H8WA 1RYMA 5IS2A 2V7PA 1KP3A 2PDAA 2OA0A 3V7NA 4JUCA 4PXSA 4HAYA 1PWXA 4YCSA 1P7YA 4BO4A 3JQ8A 3APOA 2GTAA 1N2SA 1WCWA 3WBFA 3ZU4A 3P2MA 2Q6AA 2P40A 3LYLA 1F2VA 2G4CA 5DRYA 3CUEF 4JQOA 2QKAA 2JFYA 2Y9PB 4AY5A 4EPWA 5KMGB 3L4SO 2ZUWA 2F8MA 4OKSA 3TN7A 3NNNA 3PI6A 2H06A 2XWJI 3T5BA 1OGIA 5LMNO 5C93A 3KYDB 2YZKA 4CV1A 3NORA 1CUHA 1EAYA 1SUEA 3WYEA 3CNOA 1AKNA 5AVVA 3RVPA 4J3FA 1G64A 5ALRA 2IEGA 5EXXA 3OQIA 4C2BA 3ZPGA 4KFUA 3DGEA 4AY4A 1GLNA 5C4MA 1AI5A 4NSNA 1PNMA 1Y9ZA 1YS6A 1E8NA 1O54A 1F2TB 1Q0RA 4N18A 1KH2A 5DM1A 2WTUA 3TX6A 3THSA 1T9HA 3L40A 2UZ0A 3QELB 3V1UA 1ZWKA 2AI1A 4QGBA 3AKYA 1EN6A 2TMYA 2QM3A 4IR7A 1GGNA 5ILQA 5CFLA 4HEA6 5ADVA 4R51A 1JPXA 3G67A 3A3YA 3FR8A 2OSVA 1ORDA 3TLZA 5C3MA 2OTCA 3HZHA 4W7IA 2QE7G 2ZDGA 4HWPA 4PHCA 2J46A 1NJGA 3AKZA 3STLC 1MO2A 2R7AA 1US6A 1X1AA 3H6HA 3PK0A 5T41A 3G6EV 1HT1E 2ID8A 3HB9A 2HXGA 3UFXB 3AZOA 3AVWA 4M6WB 3HFJA 1MGPA 2J6HA 3IUSA 2XCSB 2A0XA 4PQRA 4BNMA 1S5PA 3PQDA 4OTZA 4EVRA 1U1EA 3EOBI 2G76A 4QM7A 4L8FA 1ZAUA 2YIAA 2I4MA 4BU0A 5JDIC 5B2ZA 4QBGB 3RC1A 3O90A 4AMUA 2GZDA 3ZRSA 3TAXA 3EW7A 5GZ3A 5CA3A 3L0ZA 2C82A 4V1CA 3VM6A 1NBHA 4GOLD 1KSJA 6NULA 3UT0A 1WU7A 3NNSA 4XH9B 2QWOB 3D3JA 3OZEA 1IAVA 5LM3A 1BD4A 1LD3A 4B3MB 2B1GA 1U7PA 4IXWA 2APJA 3VNQA 4G1UC 2RIRA 3T1CA 2YWFA 4LGYA 1JDZA 3IAXA 4YXWD 4WZBB 4ARZB 5T4BA 1JHMA 4ALLA 2IH2A 4R68A 5EWJB 4YR7A 2RE8A 1U9YA 3IURA 3T1YO 3UG7A 2QYTA 3WGKA 2QE6A 1MC8A 2V7WA 4KQ2A 4UZFA 5ESRA 3BXOA 3BGVA 1NYTA 4E33A 2YVAA 3IBSA 2VWJA 2ZJ6A 4JI1B 1MW9X 4A82A 1A8SA 1PJRA 3BE6A 3RYHB 1F2DA 4CZ2A 3F5TA 2OXFA 5TS2A 1RPRA 5I48A 2IHZA 4CM4A 1ZGAA 3N39C 1N78A 2FSSA 3UC5A 4XYMA 2O8VA 5K1ZA 2RDMA 3LHIA 3PVZA 4JC0A 4PSAA 1QGYA 3OE7G 3M3PA 1R5JA 2FQ1A 2ZYHA 3C74A 3MJFA 5KYVA 4LZPA 2OFFA 2QEQA 2W00A 4GRDA 3SZMA 4D8XA 4YP7A 5C46F 5K4HA 5C5IA 1RYZA 4IDNA 4B80A 1CQPA 2QUBA 1TAQA 2I6FA 3LHKA 2X41A 3RROA 4NEGA 4BJ5A 4PONA 3RWOA 3PJSK 2MSLA 3EVCA 3I9KA 5TQVA 1QGDA 4QIHA 2XF8A 3M89A 2DOKA 3P3PA 1P0CA 2FRDA 3HJHA 5ICMA 1W5TA 3I5DA 1TD1A 4XWWA 1FDUA 3S29A 1OFGA 1L0BA 1Y8AA 1GVHA 1XL1A 4IOKA 2F43G 2I34A 4JK3A 5EQDA 3WKCA 4GLLA 1Q0SA 4AT1A 4NZYA 2I2XB 1QLHA 5JZMA 3CCCA 1V35A 1PVDA 2OV8A 4RIHA 3OTGA 2DY0A 2OAGA 1AD2A 3RSZA 5DWVA 1DDOA 4XJTA 3EXIA 1KBOA 2QSYA 3JXEA 5IYCO 1KZ1A 5LSAA 3RU2A 4DGQA 3G0GA 4C4YA 2G83A 4EGFA 5L3SB 4JENA 2YICA 4R2KA 5E7JA 4KHPB 1HYGA 2ZUCA 3QX9A 2GRUA 5DM4A 4LHSA 3W8RA 4Z1MG 4FWIB 1O9GA 1GA6A 1G60A 2GBPA 1B14A 2PAAA 3WYFA 2ISCA 1DQNA 2OKCA 1OXMA 3L7KA 4MCIA 2GR9A 2H2AA 5AKXA 3V32A 3AUTA 3PI7A 4QJFB 3CSXA 1U0JA 4LXXA 3U39A 3VOTA 4DJDC 3WQBA 1W5FA 4PN7A 2C2MA 5ENDA 4N0QA 3KEMA 2QLFA 5FOXA 1ST3A 3KOMA 1K0FA 2AOUA 1ZD2P 3KWFA 4ECAA 1OY1A 2OCXA 3EMKA 2EBFX 2ZPAA 1OD6A 4KGZA 4LJ5A 4BYMA 1AZSC 4DM3A 2E76B 4R1MA 2QVZX 1E0AA 4ZCTA 3WXMA 2ORYA 4R9UC 4XD2A 2F62A 2VR1A 3QXHA 4L8JA 1C14A 2IHNA 4IVPA 3K70C 1E3MA 3RUDA 4JDPA 4LXHA 3KU4A 4J0GA 4UJ3A 3C2QA 4GM4A 5AK0A 2BDEA 4BUCA 5KTNA 4K9SA 1SRRA 4MRMB 2OHGA 4NS4A 3RFUA 1COWD 1GYPA 2EZPA 1JHDA 4F6RB 1JR3D 1X8KA 2PZGA 2WSLA 3ES9A 3ZX6A 2R751 2X8AA 4UEJA 2A14A 2ZSAA 5C7IO 5ADHA 4D0RA 5LHGA 3G9XA 2XGOA 4ZODA 1KO4A 3AEQB 4M0CA 5HEKA 2AFVA 3TIVA 1XQYA 4JS0A 2OG4A 3IESA 4TN5A 2AWOA 1F4VA 2XNDA 1H93A 4M9CA 4P7GA 3ZD7A 4LWPA 4N5IX 4MV1A 3N6XA 4C4TA 2FRDC 2HHCA 4RM2A 1I1NA 5J4LA 1FLDA 2IP1A 1Q95A 3Q6IA 3QVVA 4HDMA 4LWQA 2XGGA 4CUKA 3QU7A 4ZT2A 1WZNA 1Q7YW 4G6ZA 5HKLA 3S99A 1CEQA 3T3PB 4H7JA 3RLFA 3URMA 3N8GA 4GE0A 5GVRA 2MINA 1WMFA 1XFDA 3THRA 2CHUA 4AZSA 1CQXA 3SS9X 1QHIA 2O3JA 5HFLA 4FK8A 4YO8A 3GIWA 3MDSA 5EMJA 5I4KA 4OWPA 2I4OA 2JFFA 2IL1A 3E4DA 2IIPA 4OI0A 3ZRWA 1DX4A 2XDQA 5THXA 1WCIB 4MV9A 3QMVA 521PA 1GPDG 1N8TA 1K8AW 1LQUA 2PFSA 1VE7A 2R7LA 4YV0A 3N1UA 1ZEJA 2YX1A 4ZCSA 1JBQA 3JPWA 1BCCH 2R6DA 2AFRA 2O7VA 2O9JA 3AJEA 5AVOA 2HKOA 4XDKA 3OQMA 4B45A 3D2LA 3U44A 3HPLC 4B33A 1R66A 3MA0A 4YJKA 1G7RA 1XK7A 1R3DA 2XCRB 3WX0A 3VNVA 1XNQO 2VYQA 2GAOA 2VBCA 4OL9A 1PJZA 2WIBA 2WWTA 5TGZA 1SCUA 1E18A 2Q1UA 4F38A 5D51S 1WX1A 3R9XA 4Z4QA 3ML1A 3ZY2A 1ISPA 4C6TB 1JKJB 1KEUA 1NP3A 2YWJA 3NOOA 1NRIA 4FP9A 4FYKA 4HB3A 4R9VA 4A1FA 1YS1X 3C8ZA 4FFNA 3WL7A 4I9WA 1SZJG 2EX0A 1ODTC 1X1TA 3GRYA 3HI4A 2B92A 4P38A 1N3IA 5D01A 1U8FO 3VOAA 2HWUA 1GL3A 3HVKA 2PZFA 3E0XA 4TXHA 3ZVRA 4URXR 4R2IA 3NAMA 2DUMA 4DK1A 1IBMO 1H23A 1FJHA 2FUCA 3TK1A 4HS4A 4K9OA 1U7ZA 4QE3A 1M0EA 2IYTA 4G86A 3B48A 4JP5A 5J2TF 4JEMA 1FVFA 1T29A 4KSBA 3K0FB 3PRHA 2H7YA 3L8GA 5LJLA 1TMOA 2WSSA 2JVDA 3RRMA 3WA7A 3NG1A 4OAQA 5F2OA 4G4JA 5M5BA 2REBA 1MB2A 4WY5A 4A6DA 5LJIA 4E5MA 2XOEA 4OB8A 4DV2B 2ALJA 3WKDA 4FFSA 4WFKA 4XTRA 3Q3IA 3GUYA 2ADFA 3IA2A 3T4ZA 2P5OA 3KFXA 4L51A 1QR8A 1ODIA 1XLTC 3ELUA 3ITNA 1QU7A 4NR1A 2VF7A 4G5GA 4Z54A 4P9OA 2P87A 4K6MA 4RZHA 4KQKA 5JE8A 1GNSA 5JAQA 3THWB 5TMBA 4PTLA 3I09A 4NZNA 2RHGB 4P58A 1NXQA 3JD3A 4G8BA 3EQ9A 4ZYZA 5E4YA 1BT8A 1M5IA 3WK4A 4YEDA 3NV9A 1XNGA 1KJ9A 1E92A 3W3AD 5JV5A 3OU7A 4NQRA 4A16A 2C1EA 1W0JG 1DFHA 1M34B 2R8ZA 1KZ6A 2OCDA 2A9QA 1EN4A 1XN1A 2C7OA 3CCSV 1I01A 2C9ZA 4R83A 5J47A 2C9BA 4QPNA 3SOZA 3CURA 4AI8A 1YOVA 1KDPA 2AYXA 3BOSA 3RYTC 1PGJA 3W90A 2QG6A 2CV2A 1FXWF 3L9WA 3CEHA 4QOGA 4INAA 4MGYR 2VF2A 3R3JA 4G5XA 5BNWA 2Q29A 1J5EO 4J80A 1E9AA 4HVTA 4M53A 2QNIA 2JC3A 1PLJA 4EECA 3STWA 1OFTA 1OASA 4QYSA 1U7UA 2ODWA 4QNNA 4RMGA 2EKBA 3KZMA 1NX9A 2XQGA 4RLHA 4DSUA 3SC6A 3L4KA 4NPHA 2JGKA 4OB6A 4CMHA 4ZU1X 1LSOA 3BMQB 3IAUA 4P92A 1ZK3A 2AMVA 1TGOA 3G5TA 1A9XA 5UKDA 1ZL8B 1PQYA 1T6BY 4OIMA 2C8KA 3ZCPA 1F2UB 3RHZA 4J0JA 4IMRA 3SYPA 1L7EA 1FRNA 3UWKA 1FFGA 2W7TA 4F3KA 2JEZA 4KW7A 2P5UA 1QE5A 1U2RA 4KAXA 5C4GB 3RYFA 2LD4A 2XI4A 3WLTA 4WI1A 2FTKE 2ZI7A 5DI3B 2JGFA 3UJHA 4MVWA 4CDNA 2F93B 4MDYA 4E7OA 5C8VA 2QUIA 2AX3A 3ZY5A 4UXIA 5J63A 5L7TA 3TXAA 1W4AA 4BFXA 3JQRA 1TJ4A 3E82A 1Z0UA 5DKFA 4WKPA 1IY1A 3A58B 3IP3A 3G5AA 1IQPA 4UBLA 1P49A 1GGJA 3AP2A 3JQ7A 4G09A 5JLAA 3THOA 1QK3A 1RBMA 3OLCX 2ZCVA 1XRRA 1Y63A 4PX2A 2J0QA 5GAJA 1P74A 5I7HA 4ALJA 2CMHA 3L49A 2AI3A 2WUVA 3GDGA 1IEVA 1W44A 3JSXA 1X7ZA 2HWWA 4BX2A 3ZZ1A 1GZ4A 3P20A 4DEVA 3QGMA 4DUPA 1Z7GA 2V7QA 2J3DA 3KOXA 4R0MA 4RDIA 2V0GA 1WZUA 3ADDA 1WXGA 3D6TB 1FTNA 4P9NA 1LPSA 1NXTA 1FS6A 1FP1D 2X7XA 3NFYA 1EXMA 2WU8A 3ZYZA 2CTRA 4BNZA 2V1UA 1GO2A 2ZJ3A 4X90A 3KZIZ 1GZ6A 2B4KA 1R50A 1KL7A 4RF3A 2HA6A 2PBZA 2YRWA 1P80A 1WN5A 4CCSA 1WLYA 1XLTA 1XTPA 4J41A 2H85A 2Z9BA 2FN8A 4MAAA 5BSEA 3W6NA 1IB0A 2Z8YA 3IE2A 4LXQA 3RSQA 1KQ3A 1X70A 2NXCA 5FHRA 5CBHA 2BCCH 4XDLA 4M49A 4Z3KA 1ZN7A 3F6CA 3MELA 4JX9A 5EINA 4YCMA 3Q9UA 3RS3A 2A5LA 2B5VA 1IDSA 3K20A 1WMEA 3AVOA 3O0DA 4M6WA 2G9QA 1B6SA 2X2PA 5HJ2A 3W4JA 4B79A 2E75B 4ASUG 4WFHA 4ESVA 1N4CA 3JZAA 3AG3B 1VF7A 3ZJ5A 2NZXA 2W93A 3RABA 3P30A 3AFHA 4TL7A 5K3CA 3TOVA 4CTMA 1GH6A 2Q5ZA 2V7TA 1YHNA 2PLWA 3FVWA 4GGMX 1WXEA 4GPEA 1QANA 5K0EA 1AKMA 1U8UA 3SIWA 3EX8A 2I54A 5FA8A 4GC9A 4C7KA 5B3JA 1KYWA 3GRZA 2WWHA 3L1UA 1OUMA 3QBEA 4UTPA 3TF5A 1PR6A 3ZOKA 2GF9A 2GXUA 2A2ZA 3KKOA 2E87A 2GN2A 1JQEA 3AUXA 1QIKA 3E7DA 4PPGA 5KJFA 2HDNB 2FSIA 2CFOA 3DTTA 3N2LA 2ZVJA 4S1OA 3R3XA 1P44A 3ZEDA 3PU6A 2TS1A 4X1KB 3QVJA 2XUIA 5CNIA 1EBUA 3THXB 1RP1A 6LDHA 4NBSA 4P3OA 3K06A 4WE3A 3S1SA 3FNBA 1KS9A 4E09A 4MI3A 2ZTMA 4AZ3A 4D45A 3CUVA 3HWRA 3ELBA 1NR5A 1VIMA 4WCFC 3K9WA 5JRDS 3IEVA 3VDRA 3TWOA 1W4BA 1E20A 1XA3A 4QU0A 4UAVA 4WNCA 4ND3A 4J6FA 4XLZA 1NVXQ 5AI0A 5C0OE 4ABYA 2C3PA 4FUQA 4BNKA 5ES4B 1LPMA 3EEIA 1QCCA 4WZAA 2WLMA 1LVGA 1S3SA 2CDNA 1PS9A 2JJQA 3COZA 3H13A 4HB2A 1Z0SA 2F59A 2ZG6A 4J7JA 3T7EA 1KC3A 3PHIA 5FBVB 5LQSA 4AURA 3CZ9A 3PIIA 4L27A 4RF5A 4O59O 3BHMA 1W25A 1XAGA 2V7BA 5TQ2B 1T3TA 4OVKA 3S3TA 1LF5A 4WD3A 4QVGA 5F1PA 3J81k 1XG5A 3B8HA 3CPSA 3T8YA 4I1UA 4YHHB 3UCFA 7GPBA 5KNDA 3BWYA 5IG2A 4R1UA 2IY8A 3SC3A 4YCAA 5SYMA 2Y69B 4RTNA 3AIMA 3IEUA 5C8ZA 2JVJA 5DNUA 3GFRA 2P2GA 2QPTA 3D6UA 3DCNA 1GUZA 2I6UA 2OFXA 4MDHA 5GW7A 1N5LA 5F7XA 4ASUA 1WBDA 2I5PO 4K81B 3TFWA 3PL5A 1JIQA 2BHSA 2IV3A 1FYXA 4D9EA 4YV2A 5L3SA 3DE4X 2VBIA 1SULA 2CCGA 5A5FA 1P9NA 2P0YA 1GPBA 5CA1B 3IRVA 3NAQA 3QFTA 4JJZA 4PLYA 4PYLA 2YEVA 5EG5A 3ZXYA 2WVGA 1T34A 1JFRA 3FZQA 2B4TO 4HH0A 4RSMA 1CUEA 1X7XB 1NBIA 1XRMA 1S8NA 2N47A 3FLAA 2GYVA 3V8BA 4KU4A 4YT8A 4DYDA 4GXNA 1YDHA 2P75A 2JHGA 1K5PA 4OQ4A 4K3AA 4G4IA 1LDMA 4DG5A 3C5EA 3ENNA 1KSHA 4F3TA 4EY8A 3MAAC 3CRCA 1WUTA 2A9FA 3CEMA 4ZPJA 4LR3A 1SZCA 3IMEA 2E4XA 5FTLA 4ENPA 2Q2VA 4KLCA 1P0QA 1VHTA 4LCUC 4MAFA 2F3UA 1JEOA 2OAP1 4KIJA 1YVEI 4NBRA 4W9NC 1CF9A 4XM0A 3FWZA 3I5UA 4X8LA 1GM8A 3QVGA 1QBGA 3UJPA 1ZCJA 5REQA 2P4QA 2BSKA 5A5GA 1VRWA 3NANA 3TQCA 2XQVA 1XAIA 1Y3FE 2PYJA 2L17A 4EPRA 5KNCH 1N9ZA 1WJGA 1D1QA 3AEKA 3AMVA 4RA6B 3ZW7A 4B47A 1JDSA 3H9VA 1GLGA 4WKGA 2C78A 4DSAA 4Z8YA 4H7HA 4BGIA 1CUDA 1OAOC 4OH7A 5U4XA 3VBCA 5KYUA 2V3WA 5LYJA 2NUPB 1GM5A 2VYCA 2HADA 4EOGA 4YIHA 4PZAA 1WNSA 3FVQA 4L16A 1MXHA 1E3JA 1IPHA 4G2NA 5EA2A 2H1SA 3UJCA 3RVKA 1KU0A 4XJXA 2WAOA 4O4IB 1HE2A 4LBZA 2PGJA 5JD6A 2Z3IA 4HDSA 3AG5A 5BURA 4C4ZA 4IIJA 4O6VA 1HC7A 2PBRA 3O93A 4Q3CA 2CKDA 3GGGA 1VRVA 7REQB 3CHYA 1XEXA 3ESQA 3IXQA 3RW9A 1GG5A 2D2FA 1FFXA 1UJMA 5DXJA 1X1QA 1MABA 2KLHA 1MOSA 3ZRWB 2XDQB 3M1AA 4FW9A 3IBTA 2JJ1D 1Q77A 4IFIA 4TTPA 4OCZA 3QPUA 3ZDZB 4RJIA 4WJZA 3ZGOA 3ZV5A 4ZEXA 4QA9A 5BSMA 3RF7A 4Z4CA 2ZRGA 1P6QA 1DBQA 1M83A 1FQOA 1P18A 2WKWA 2NV6A 3O73A 1SKMA 1J24A 3AG3C 2OQ2A 2A1TR 2GSMB 1U2GA 2FP3A 4GG1A 2HQ1A 3QIVA 2A3RA 4J9UE 4YYZA 2VL7A 2V8OA 1FTGA 1AVTA 4GLFA 3UK1A 3L0OA 3RVQA 1C1XA 3VTKA 4X8HA 1FMCA 4Q6GA 2IY7A 3LZDA 1W5SA 2RH9B 2JCBA 2B8EA 1H3NA 3K92A 4J3JA 4OHZA 2PFKA 4A8JB 2FHPA 4IZOA 4UD2A 1YA8A 2FSVA 1G3QA 1O5TA 3CXUA 3LUBA 2DBQA 4KDEA 4IL5A 5FI1B 4TPKA 4A4DA 3H2ZA 4OMFG 3LKBA 3IV6A 4N5HX 3EDYA 1EK1A 3R5SA 3WV4A 3ACCA 1QIIA 2O3UA 5DDIP 2UAGA 3I04A 3WL8A 4R54A 3ZEFB 1HFEL 2QRQA 5L3QA 3HY4A 3NH6A 4JCOA 3WDKA 3EZ2A 2JHFA 4J6EA 1F6WA 3RB8A 5EMMA 1Q5OA 1SS3A 3CH6A 4GSYA 3WBBA 3GLKA 3F5DA 3NHAA 2R8RA 2CBZA 1W5AA 4BN5A 4FFLA 2OE2A 2JEUA 4MNTA 1T1EA 3K96A 3B40A 5U1PA 1N75A 2HJSA 4TYWA 2CYCA 1UPUA 4YRRA 4I1OA 1BNCA 2ZYTX 3H19A 1J1UA 2XD4A 3PNVA 3GFOA 2ETVA 2XD9A 3SGLA 4AJNA 1PL7A 4Q4CA 2C2BA 5IPFA 3SHWA 1U0BB 3I8OA 1VXRA 1WXHA 4YALA 4DWJA 1DE0A 2II6A 2MMGA 1Z6XA 5LZ9A 1ATZA 4LQDA 4B4UA 2BDTA 1CR2A 4MYRA 4PNZA 4NYJR 2PSHA 4PWZA 3K1YA 5MGBA 1W29A 2B5WA 1JNXX 1N0WA 4PFJA 3QITA 3D43A 4HRAA 2HTFA 3WNQA 4DG9A 4EGJA 1WVMA 2EJTA 5DIFA 2FPRA 2KS6A 3JASB 1A2BA 4FHFA 4JI4O 2FZGA 3JYHA 4YRQA 3SCZA 4Q19A 2RHCA 1SU4A 4FYXA 3SMQA 3VGJA 2VQFO 3EGCA 4IDGA 5JD4A 5K5EA 2W6OA 1DG9A 1XL0A 2H31A 3IJRA 1Y1LA 2NUTA 3WQQA 4TTJA 3VU0A 3JWPA 4MCAA 1VQKV 3GPLA 4EIWA 5IJ9A 1F4PA 4FFKA 5K3AA 2CV1A 1WUIS 1R4NA 4P6VF 3Q5DA 1E2LA 2W6IA 3VR4D 5BQ3A 1OPXA 1DPGA 3QVLA 4Q4AA 3ICQB 3VVLA 3RYCA 1BJTA 4L9WA 2G04A 4EJFA 5JXGA 1RQ7A 1DIHA 4CVNA 2FR5A 2WZBA 3ZZTA 1E7WA 3MLEA 2GEDA 4F6LA 1RRPA 3GFSA 4XGRA 1VIDA 2W2LD 1D07A 1UEJA 3BDVA 1OWPA 3BXHA 1QFSA 3I72A 3Q1KA 4HWOA 3ABSB 1XRPA 4XQGA 5ENVA 2OBLA 1MOZA 2W42A 4CEJB 3P9XA 1DJPA 1YCIA 1F2UA 1UKAA 3RZUA 1QB8A 2DQ4A 1VMGA 3UMFA 4EVIA 4N3AA 5TJ9A 4TX1A 1RPOA 5FLYA 1J56A 3BWBA 1XVVA 2FUEA 4BQEA 3ZJZA 4RPCA 4UC0A 2ES4A 4B0PA 4DR3B 4KP7A 2ZS9A 1V43A 1M1XB 4BW5A 5JASA 3T94A 4XIFA 1EBFA 1BJKA 2WFLA 2C29D 2QD3A 1NVDA 2BD0A 1NYLA 3DB2A 2Q8QA 1IJBA 5JI3E 3QY0A 4OP2A 4GNRA 3KG2A 4YRNA 5EP1A 4NCBA 2O5VA 1PG2A 2C77A 5IWAO 8ADHA 3NIFB 2V7XA 3MSCA 1C9KA 3MS4A 3K15A 3VPSA 2E49A 4JUAA 3D4BA 1RAAA 4JWTA 3KQUA 1FUIA 2IITA 1M34E 1AK2A 4G5FA 1BMFA 1NM5A 5J5CA 1O97C 4R6WA 4RD1A 2HDOA 1HQDA 2NVUA 3F46A 1NV9A 4EW1A 3RC2A 1USGA 2Q0XA 1H0SA 5EQTA 5EGSA 3EIUA 1XCOA 3T41A 2BBWA 1W8DA 3ZDYB 5CCEA 4U2BA 1ONNA 3OQOA 2PRSA 1M93A 2NYUA 1VPLA 3FOZA 1SXJD 4OJMX 4DMGA 5B1NA 4M86A 3JD1A 1U04A 2GN1A 2WJ3A 1DLBA 1DIBA 2W71A 1TVEA 3SX4A 1SHJA 2CJYA 4C0QC 5GAOA 1T4GA 2YUIA 4RIFA 1FKAO 2ZFUA 1L7PA 3LHDA 4IDFA 4UULA 1REQB 1PFUA 3PQ3A 3BZUA 5AVQA 2QF7A 1D1PA 3BSWA 1HYHA 1NHWA 3CZ4A 2OO5A 4BWAA 3DE7X 1NFFA 1T0UA 3L72H 3EPLA 2P0EA 4RSGA 1D3AA 3N53A 5K05A 3TB4A 2RHMA 3DCYA 2BGLA 1H1LB 4K6HA 4XCXA 4OQYA 5FUVA 2O8FA 3IMKA 1LTKA 4W1PA 3JQAB 3DS8A 3FGNA 4IX1A 1A2OA 1B06A 1GTVA 3RTGA 4LPKA 3DAYA 5DXAA 1QCDA 3GPBA 2EDCA 1I1QB 1EGMB 1I6MA 2GEJA 2J5KA 1GU7A 1N6HA 3AEIA 3MOGA 1I4TD 4FFVA 3COJA 4BE7B 1FJ2A 2P2ZA 4FCTA 4R2MA 1EGHA 1VPDA 4CF5A 2G80A 4CZZA 2JAHA 3I2FA 4HLDA 3NVAA 3OIDA 1SHTX 1YSBA 1QOPB 1JU9A 2IX9A 3T99A 2D2IA 3U4MA 4ZV9A 1Q16A 1CEZA 1ESDA 2VPIA 5CFRA 2ODEA 1JA0A 3THXA 3VHLB 2FWNA 4DFDA 3C7TA 3ZIAG 4GLJA 4A2CA 2DP4E 2HA2A 3OZUA 4ZOQI 1TO6A 2XH8A 1ANKA 4MA4A 4PV1B 1A5ZA 2O52A 4LRUA 5DGCA 3S7ZA 4CBVA 4YRMA 1GKYA 2C59A 5EJAA 3WWYA 4ZO9A 1VQMV 4GP6A 4J3NA 4EEQA 1XZBA 2X1HA 1Z8HA 3DQZA 2G5CA 3D0OA 1ARZA 1HY3A 2VXYA 3BD8A 3MTDA 4ZJZA 4X1YB 2H59A 1L1QA 1E60A 4B3RO 4AHCA 4LWOA 3AL0C 4H15A 5IXYA 3H8SA 1Z74A 1QH1B 1KZGB 3MTQA 1VQPV 2F8LA 3T5PA 2W0MA 2BEUA 4HQLA 1X39A 4GWLA 3ABIA 3CMMA 2COKA 1Y8QA 5GMOA 4D8VA 5EOVA 4BGDC 1I5OA 5AVZA 4TWZA 1V5EA 4F4FA 4QTUB 3KRTA 4EFDA 1OLUB 2K4MA 3NB0A 1OXKB 5JNVA 2O2CA 2PZLA 1HDEA 3VX3A 2JDID 4YBZA 2AXPA 4IGEA 2GHIA 5EPEA 1WUJS 4NTZA 4GKJO 3LY7A 1DQRA 2RKBA 1U02A 3K6SB 3ZHQA 1HNWB 1NFRA 3WK9A 4MEBA 2Z3JA 2MW2B 4RFSB 1Q86W 1RLMA 4YY3B 1RLUA 2IPOA 1YIJV 1UWVA 2ZDIA 2BR5A 2IHKA 3CW8X 4LHWA 2PJZA 1NDUA 4LZAA 1VE3A 1TTQB 2I8AA 5L3ZA 3JZDA 5H68A 2N42A 2V65A 2V7UA 3FDZA 3DTUB 1SD5A 2YY5A 4FNOA 4Q02A 1IJKA 4BAZA 1JEYA 3O6VA 1CY1A 2PL3A 1I4EB 1GRJA 3K72B 5I47A 4PY2A 3OZ7A 1O1YA 3L1VA 2PY6A 4R5HA 2QM0A 3OTIA 1DWUA 4WY2A 2HBYA 3HKBA 5AHOA 2AQ8A 3SDBA 3K9FC 2NTNA 2ZIUB 4LC1A 1V6CA 1R8SA 3I8XA 3DAGA 5DCYA 4QDXA 1GM7A 1CUYA 2GXSA 1FNSA 3GRCA 4LX0A 4JX8A 3I6BA 4B2LA 3M4XA 5EBWC 3KZCA 4S05A 2DQ3A 3ED1A 4URVR 8GPBA 2YIBD 5BSFA 1FTSA 1MFPA 1T91A 1ZRMA 3NOQA 4FR5A 3RRBA 1N36O 3P0RA 4BMPB 1CWUA 3QVGB 4CL2A 3H2BA 4YRIA 4WK0B 2GJ4A 3JSAA 4H33A 2XB4A 4WA8A 5KQLA 3W5BA 2Y6UA 4H1WA 2L2QA 2BJWA 2OT3B 2XMGA 3TX2A 1EK5A 4KJXA 1SRQA 2JFGA 4L4ZA 4L28A 1KKDA 2OWDA 1T36A 5HMLA 3ORSA 2AC7A 3FTCA 3QOXA 2ADPA 5TSDA 3BJMA 1WCXA 1QC5B 1NULA 4FHGA 4CETA 3EZGA 3OZVA 3O5AA 3FYUA 4MI1A 1S0UA 3QF7A 1M0TA 1N33B 1U3FA 3H4IA 5KWJA 1PKEA 3DA8A 3R3SA 3VSCA 3D0QA 3BDAA 3WYNA 3KOWA 3LXRA 1JE0A 4RQTA 4ZQIA 4P22A 5HOQA 1B26A 2EG5A 2C88A 2QTMA 4QUIA 3QPVA 4QFDA 1J00A 1G1AA 3FOAA 1QWOA 2XVXA 3M6IA 4ISBA 5E9QA 1YBHA 1PJQA 3KR9A 5T4HA 2PJDA 3RUHA 3KXKA 3QEMA 2H07A 4CLEA 5HRAA 5ALUA 2IK8A 3SGIA 1XF1A 1MPTA 3FG9A 4ESOA 2HCTA 5FADA 4A5OA 3MUNA 4PZCA 4JXEA 4AWBA 1U3CA 2ZJ4A 3OTHA 2ZINA 2WDZA 3VZRA 3ORQA 3WFJA 2CXNA 4CMGA 2OWOA 3U2QA 4R05A 2RD2A 2ZS7A 4ZWNA 2DSNA 4TSFA 4BGVA 4PFSA 5B1DA 1O6FA 3NALA 1OCRB 4J75A 3CCLV 3PV0A 1RXUA 4RJJA 1VSQA 1RACA 1WD5A 4ZYWA 1KP2A 4NZMA 1HRKA 3HJNA 5C5EA 5I9LA 3LDCA 3OY7A 1ACLA 1OZFA 5C1BA 4GX1A 3EUEA 3NRBA 1OIVA 3JATA 3RSSA 3VQWA 3F97A 4UMVA 1WL8A 2B37A 2FPGA 4TYYA 4Q93A 2CGOA 1NJIW 4ZVKA 5E3HA 2R79A 1OBCA 2CFTA 3BMOB 1IOLA 1W87A 4WZBE 5FWDA 3VV2A 3IDQA 4EB8A 3LC0A 3RODA 1F1BA 1VP9A 3NTVA 2G9VA 2VHXA 2AMFA 3DG9A 2XZDA 3SR2C 3JQGA 4ZZ2A 3Q7TA 2IXFA 4NRDA 3A0UA 4IZ6A 4MJLA 2OAQ1 5AK6A 2SCUA 1K4KA 5TJHA 3BPZA 4AJEA 3TM4A 2NUBA 3FCAA 4TYNA 2HVVA 2J9XB 3KCYA 3Q4HB 4DV4O 1NMQA 2H1LA 2Z3WA 3GJTA 3GUHA 3L7CA 4H9GA 3V7FA 3AJAA 1B2RA 4BRUA 4BIZA 4M8NE 4OAOA 4LF6O 4ZEMA 3D36C 2VA8A 4WBNA 4FEEA 4NOLA 4W1RA 4XUDA 1YDWA 2QRNA 5EVJA 1UDXA 1DV2A 1U81A 4HQKA 1R0SA 2G09A 4QG7A 3RVNA 1MR3F 1T8RA 1TLLA 5JARA 3OZRA 1EDOA 2JZCA 4EYGA 4W99A 2C04A 3O8QB 1ZH0A 2VUUA 3NBFA 1ZJJA 3K4PA 3DXYA 3W3AA 4GEGA 5AKLA 3OQNA 4ARZA 1UEXC 2XIJA 4EVQA 2HCJB 4B46A 4BLUA 2ZYDA 3T4UA 5L3EA 2W6NA 4G0UA 2FA9A 4PYMA 4AICA 2PGIA 1U0FA 3BXXA 5CVCA 1ROPA 5KNDH 3AG2B 3HL0A 2ZTLA 5FA5A 2NLOA 4Q7LA 4CXMA 3EPKA 2NNUA 1O7JA 3BILA 1H4QA 4OBBA 4Y6QA 1CRQA 1EM8B 3IVRA 1B0UA 4K8XA 2C5AA 2BHTA 2WJ6A 4NPCA 4Z9XA 5AUPB 2YV1A 2PX8A 3J7AU 4QE9A 4RDXA 1VMAA 3ADCA 2AXTZ 2EFGA 1R9GA 3H11A 1F12A 2O3TA 1Q43A 4QUDA 5G4KB 4JHLA 3OR6C 3BAAA 3M82A 2WTNA 4OXQA 3QO8A 4OJKA 2PF4E 2RH4A 3ASNC 4OA5A 3LY9A 1LB1B 1FDRA 2RHTA 3A06A 1VL8A 3LK7A 4MWSA 3SM9A 1UKVY 3SVZA 1VDMA 3F7NA 4MGEA 2CJFA 2B98A 3QKTA 4CKZA 4A2PA 4CDGA 3EFEA 5IH3A 1L7MA 1OFVA 2ZBVA 2EKLA 3KYCA 3OUTA 3OFVA 3GI1A 4KKVA 4TZ6A 4ZGGA 2ZXWB 1I2MA 4AWAA 2B21A 4YDQA 2G63A 1HPLA 2PRKA 5DRTA 1XXHA 4AMBA 3RKSA 1QPBA 2Q28A 3HMKA 3PYMA 4G1FA 3DMTC 2XAAA 4JGGA 2DAPA 3VR6D 1Y3IA 3DZBA 3E6AA 3K0DA 1U6IA 3DOHA 1XT6A 3ZQ4A 3MWEB 3O9OA 3S2ZA 3UPTA 4CUJA 3F98A 2VI5A 3WYDA 4C5AA 1HQKA 4ND1A 5A1JA 5EJ9A 3EXFA 3CYOA 4N5LA 4ZK6A 1U1DA 4CQNA 1L8XA 2XMBA 3KQMA 3KL2A 4FDMA 3Q2OA 3VR4A 1SVKA 5JXWA 3MJRA 2QN3A 1TYAE 3UH1A 3G8YA 1TM2A 2XKBA 1DDGA 1U90A 2FY8A 1GWNA 1X0XA 2X3UA 2GFQA 2OD7A 3F6RA 3LHSA 2YXHA 2OMEA 3LRXA 2OCPA 1EFRD 4Q4LA 1SBZA 4RZSA 1G4AE 3H1GA 4JZYA 3AEUB 4DW8A 4DXDA 3I9OA 4CMEA 3OZDA 3E89A 3UF0A 3DF7A 3VPHA 2IPNA 1VL5A 3WNCA 2PI5A 3L8YA 2L69A 4B3TO 2LKDA 5IVHA 1XL4A 1IM2A 1KE1A 3ETHA 4WECA 5AUOB 3ROGA 2NP7A 3UC9A 3KXDA 4C2UA 2EL7A 1QU2A 2N0SA 2RI6A 4XQ9A 1GZDA 3GNSA 2GK4A 2ZBPA 3EXEB 1WDLA 4BCCA 4DB2A 1RAFA 3PF8A 4WSOA 5IAOA 5KQPA 1YO6A 5FPTA 4CLDA 3UAVA 4UHFA 1K8QA 3DMGA 3OCJA 4PLVA 1NQTA 1W94A 2ZKLA 1CVIA 3MT8A 2PPLA 3EWSA 1BMFG 4K05A 1YZHA 4RXMA 2P62A 1NW6A 2JB9A 4O4IF 3OIVA 4WXHA 4ARCA 2ORVA 4V0KA 1JG3A 3TL3A 3ZE7A 1W96A 1Q3EA 3W2TA 2N1BA 1YHQV 5JDCA 3FPBA 3FM9A 5G0WA 1S7GA 1BC5A 1NKSA 2UUPA 1AZLA 3BXFA 4RL4A 3LUPA 4DR2B 3N0XA 2R8XA 4XQ0A 2BFNA 3MPOA 1ZMBA 3UK7A 4ZI7F 3IILA 2ZEJA 1TM7E 2MJLA 2VYND 3PNYA 3MAJA 4FXPA 1I13A 4MPRA 4MYDA 4DCGA 5DTJA 3EEOA 4C5BA 1LW6E 5HVNA 10MHA 3VPCA 2YRXA 3CXRA 4Q1DA 2I91A 1PVOA 4NJEB 3HSKA 3F71A 4MUMA 5EJIA 3UO8B 5KHHA 2WNSA 3QVWA 1QVFU 3E5RA 4Y9RA 3KNZA 2Q4TA 3NR2A 3VAZA 4D5GA 5JVDF 3UPUA 4Z53A 4BMNA 1U3GA 1TE2A 4L73A 1O9BA 1QTRA 1SPXA 5HA5A 4NAVA 5ALNA 1Z3AA 5AG2A 3WDSA 2ATXA 1AZWA 3O03A 4NKGB 1D6NA 2QW1A 4D6TH 3ZWBA 4L74A 3RRNA 4E5VA 1CVRA 2BM8A 3B3FA 5HK9A 5JSHA 1AQLA 4RTMA 1AKYA 2YZGA 3JV7A 5DTQA 1BW9A 3OM8A 2GHRA 2ZXUA 1T4CB 3HR8A 4UTNA 1SIBE 2H7CA 4R3WA 4WK6A 4TKLA 1PP4A 1QGUA 2XTJA 4TQGA 4UUBA 4FMDB 1G5QA 2DWUA 3ZWAA 2YW9A 5LQAA 3OZSA 3ULKA 2XWPA 5DOZA 3U11A 1MP0A 1XYYA 2DJIA 4PYIA 3WRXC 1K92A 5C5CA 5BUQA 1IBMB 3LT4A 3AQIA 3F67A 3KM0A 2NPFA 3USZA 4FFOA 4HNTA 4KR3A 4K40A 4N47A 3PKZA 2IC5A 4GOJA 1WMSA 3REQB 4M8IA 4K3UA 3VKHA 4RA9A 4MQFA 3U31A 2F67A 2PMBA 3ZXUB 4D4MA 4F3CA 2EX1A 5CX1B 4CMEC 1H2BA 3QUBA 1R5NA 1CETA 3UFXA 4KBFA 3ROPA 4KXLA 3UJ6A 3ROTA 2AK3A 3UPDA 4EZIA 2WTXA 3A9WA 4AJ2A 4C6TA 3DO6A 3DEZA 4B3GA 1RTTA 4LS3A 3QKRB 3AR2A 2H4HA 2D8MA 2Z1NA 1Q14A 2I2DA 2PXCA 4Q7EA 5CNJA 1SVSA 3WGZA 1PNLA 2J8ZA 5LMUB 3UMYA 2H3OA 4I9UA 1P9RA 2VHJA 5K0NA 1N2IA 1K86A 1NG1A 3DBOB 4HJXA 3FPCA 4LF4B 3OEHG 4NTYA 2AR0A 2Q67A 4Q47A 4JELA 4UDOA 1BS2A 1RMTA 4Q3DA 5AJHA 4TL9A 5B3KA 2J3JA 2RJ3A 2VDJA 2PUSA 2QX6A 1LRLA 4MV4A 3V34A 1QHFA 4DY6A 4QSHA 1GRCA 4XAQA 1R6UA 1XDZA 2YYYA 5AXCA 1PUIA 2M9MA 4BDTA 4WFEA 1KJQA 2F3SA 3HYSA 5F2NA 4EEZA 3UO3A 1HLDA 1I3CA 2OC9A 5IMSA 2Q5HA 2PT7A 4KUMA 3KPWA 1X4TA 3BE4A 3R5HA 1O5OA 1CEYA 4ZCMA 3NDIA 1JQ3A 4Y6SA 2PGAA 2I4NA 1LU9A 4JLSA 2AI2A 5AXAA 3ZLVA 1O8BA 2AXQA 2FB5A 1P7WA 1O3YA 2F3QA 2RC6A 1VMDA 4K9MA 3SR4A 4OCLA 3LX5A 4HADA 5JXIA 3LV8A 4HRQA 1G8JA 1QUEA 4EHKA 3G6WA 4JD5A 2P9JA 3UENA 4B83A 5HIMA 1ZWIC 3PZRA 3ZWVA 5A5EA 2CJXA 5A4JA 4QIWF 3BTOA 1BN6A 4I1VA 4JEUA 4B48A 4ZHQF 2ETNA 2QM4A 1RTKA 3DWGA 4W5HA 3AJRA 3MHSC 1R0XA 2AJDA 3R7LA 5K1XA 3FVVA 3JARB 2F9MA 1C0KA 4DPLA 1LLCA 1J20A 4EEXA 3MSXA 4N48A 4M83A 4D3ZA 1MC4A 2E3CA 1GGFA 1IVYA 2GN4A 2EVWX 4XSGA 3GDOA 3D5QA 1E1QD 1Z8DA 2YZ2A 3H1KH 3MOSA 5JWRA 1DJNA 3SVLA 5KA5A 4RDCA 3HO1A 5HIAA 5B64A 1O6GA 3DZHA 4KIGA 4G07A 4KH1A 2G9UA 2BZ0A 1IXBA 4B2YA 3CE9A 2GNPA 1BQ0A 1RFGE 4WKNA 3GVHA 1SK9A 3G0HA 3E7WA 1ECBA 2JD0A 5FAKA 3PUYA 2LR0A 5AM5A 3HBAA 4EPTA 2H4JA 2PI4A 1MUUA 2G1UA 1M6HA 4KWTA 4W7HA 4E7PA 1OB5A 3BFXA 2F64A 5A5VA 3EDRA 3ANTA 3OJCA 3G1WA 4KUEA 5LZ7A 3GVMA 2RH8A 4GPZA 2BOCC 4O4JA 1TZ2A 3VR6A 3ESAA 1P72A 1G20E 2I80A 3WMXA 1M90W 3GFQA 3MCVA 4YUXA 1UJWB 3CKMA 1BE3H 3V4FA 1KHTA 1UH5A 3G0BA 4BFWA 1W2WB 2J3HA 2H1WA 1OBFO 2GFIA 3D64A 4PE5B 4OBEA 1L3BA 4I6EA 2RHOA 1IBKB 3DQPA 1UP7A 5KHGA 1ZY2A 1OBOA 4DQUA 4GWKA 5KHLB 2KCQA 4BO1A 4YXFA 1FDOA 3HU5A 3OIUA 1VRCA 2EJUA 1Z5UA 4M88A 4RK0A 3VPAA 5BUSA 3B1FA 3HN2A 1SQ5A 4AIRA 2IUYA 4P9CA 1P61B 4EB6A 1FFTB 1DOHA 2FMKA 2DHEA 3IUPA 3OF5A 3OM9A 1GQSA 4QTTB 4Z0TA 1AI6A 3OQ6A 3S70A 4TRRA 1V4BA 1M1KW 2Y0EA 1E6MA 2ZPTX 4FYYA 2R72A 1IN4A 4UDYX 1GTMA 1TCAA 5K8UA 2H1CA 1KOGA 3E1GA 4BO0A 1X3SA 2HMTA 4NMXB 3QO5A 3SHTA 5KTKA 1AA6A 2HBRA 1N8SA 1AKTA 3TTVA 1JU4A 2QXYA 5EUBA 1NJFA 1CPYA 1SKYE 5IKOA 2P2NA 1WA8B 4RO2A 1U8ZA 3ANMA 3AHEA 3I9JA 1BXZA 3IQIX 3LJKA 4FZ3A 5DGIA 4ZTBA 2FJUA 2UZIR 4QRHA 3TLKA 1Y7TA 5G02A 4UOEA 4Z4GA 4Y2QA 4J0EA 4M9UA 5JFOA 1N1EA 1SUAA 2V54A 1GV1A 2IS6A 5ESDA 1RJEA 1NNSA 3K1AA 4GYCB 2A7QA 2NTVA 2DR3A 3KB1A 3A4NA 1ZC4A 4NYMR 3LDGA 5JHHB 2AJCA 3W3AH 3DMYA 2BFFA 2IZ6A 1PFKA 2DMRA 4QPKA 3FW1A 3AU8A 3G8AA 3GXOA 3P0JA 4WJKB 5A4MS 1SG6A 1XALA 2MYUA 2V0NA 4ILEA 4NFYA 2OBMA 4KK3A 5D2CA 3OJ6A 4JYAO 4MINA 3UZUA 2WIGA 3DXFA 3LKDA 4ERNA 4YR9A 4E0QA 1OI2A 4ABTA 4EMSA 1KOFA 1SC9A 4YJGA 2DYKA 3EZFA 3VOBA 1OAKA 4U7FA 5B53A 2ZATA 3U0BA 4ZO8A 5LCXA 1J2TA 3ASVA 3DL4A 1K5QA 2RGYA 3IERA 4EUFA 2R9VA 4EW2A 3FZNA 1FYEA 1O94D 4D25A 5BQXA 4GI3A 3I56V 3L82B 4EPYA 4K1LA 3PJRA 1IXRC 4W4KA 1EUQA 1H38A 1YRWA 2QJFA 2XWQA 1EBBA 3A14A 4RVGA 2PD6A 4P5EA 4Z4FA 5FFFA 4HDOB 1AN9A 4IIBA 3NHFA 5IJXA 1VQOV 1XA0A 1DLIA 3A32A 1DOAA 2B3DA 2Y1FA 2Q5IA 1H2RS 4OX9B 2Z09A 3O83A 5IBRA 2C83A 2F1KA 3B8MA 5JIBA 2XNHA 1JHQA 3NAZA 3OKPA 5BQPA 2VF4X 2XBLA 2XADA 3SG0A 2OENG 2PGGA 2IV7A 5JNRA 1KA9H 4TSFD 3X1WA 3O0TA 5ED0A 2VSXA 4R31A 1L1FA 3A1EA 4DA6A 4EELA 5TIIA 2F43A 1VHQA 1V3UA 3MS7A 1ISJA 1VSTA 4TWRA 1HNNA 3GCZA 2O54A 3TI7A 3IUNA 1EFRA 1E1NA 1XROA 5A4KA 2OCCC 3LP8A 4WZAB 5ISMA 5G4KA 4QXMA 3NJ8A 1WXWA 2SKDA 4QXRA 4HR7A 5COQA 5JS2A 3OU6A 1PDVA 1JIUA 1BO6A 3F7TA 1DHRA 3H9BA 3LC2O 1RZ3A 2VK8A 3TFQA 5LMZA 2C58A 3PHLA 1KVUA 2DFDA 4K1RA 4IT5A 1JG1A 4BNDA 1G63A 3GP8A 2I2WA 3SP1A 1WG8A 1JB9A 1AOXA 1K89A 1M2JA 3AG6A 4HQ0A 5AJUA 3TZKA 1DGQA 4XWAA 4QOHA 4I08A 1B3RA 1AUOA 1CIJA 2ZAIA 3FKSD 1FMJA 4R9SA 2BF4A 2CXUA 2JGDB 1V7ZA 3C90A 3BN3A 3FHLA 3IOYA 3LW8A 3NO4A 3AJ8A 4H08A 1TAEA 5D6OA 5HE8A 1KY5A 1W75A 2E89A 5CR9A 1IU9A 3QXXA 5ALWA 5SICE 4PQTA 1MEOA 1LWOA 2OQIA 2YVUA 3AHCA 4JBHA 4JSYA 1I7DA 4YT4A 2OCIA 2X58A 1T3ZA 5DSZA 3DR5A 1JKIA 2XXBA 1DKPA 3IAFA 2IGBA 3PUWA 1AF7A 3NHPA 1GD1O 4FOTA 4P36A 3ENKA 4YS6A 3O8CA 3M9XA 1I4OA 5KPJA 2R44A 3JQ9C 1BHO1 1OTHA 4QJBA 3BL6A 4RORA 3BH0A 4FCVA 5J23A 3LDEA 3QVNA 1DB3A 3GFVA 2ZJ7A 5E7MA 5A03A 1Y4MA 1DFIA 3TLJA 4JVLA 3ZN2A 1KI6B 3D6MA 5ALVA 4WIGA 4FSXA 2JFVA 2ZTUA 2ZUEA 4KREA 1TU3A 4S35A 2LGWA 1X7WB 5CHEA 5B1BC 5FP0A 2OXTA 1OHHG 3GCWA 2NSHA 2IF2A 5FLKA 721PA 4DSOA 2YXPX 4DIKA 5IYZF 3P0IA 3DUFB 4QELA 1S2IA 1ZN8A 5K3OA 2VUSA 3JQBC 4ZOLB 3VX4A 1OI3A 1PZGA 3P9ZA 1LFAA 1YDMA 2GZHA 1GR0A 1U2TA 1HR0B 3AU9A 3DFIA 4OYYA 4ZVLA 3M3DA 4B32A 1A8PA 1E2EA 4TWAA 3PLRA 3UJDA 5F2VO 4NICA 3AV3A 4G81A 2AZDA 2H4ZA 5REQB 5H83A 5DM60 5EKSA 5TS3A 4BS9A 3QTLA 4EB3A 1N9GA 2YQ4A 3R20A 4QNRA 1PV0A 5DCWA 3BMQA 2FK7A 1YI8A 3A1SA 4J4TA 1VEWA 5EWJA 3EJWA 3F47A 3II6X 5DLYA 3UAXA 4H37A 1JDBC 3DHEA 2BR3A 2RBKA 2JH3A 1FMTA 3NJ4A 2BEVA 2OCHA 4DIBA 1E7MA 2G0AA 5L4LA 2X7RB 3HCWA 5I51A 5KYTA 2KI5A 3NEJA 4U00A 1S6YA 3N0WA 3IDOA 5BWCA 1BMQA 5I8PA 5EP3A 1NSFA 2A5DA 2W4IA 4E5UA 4BAYA 2UYGA 1SUIA 3V4PB 3ZN1A 3GN2A 1ESNA 4EFNA 3GDHA 3GFPA 3CVVA 2HW8A 2BW0A 4C05A 4JFAA 1JDTA 3EW9A 5JSUA 2MSKA 4UQOA 4W8HA 2FXVA 3PDCA 4MVXA 1WUYA 4X65O 4BVGA 1QO7A 1A8IA 3F7MA 1NNLA 4BX9A 2UU9O 3NW9A 5FDFA 2UYQA 4OLJA 4JMLA 4BLVA 1E1LA 3M6AA 4MKIA 4KFRA 3OMAB 4PG6A 5FUXA 4I5GA 1UM9B 1QIHA 1IRIA 4N7MA 2NACA 3NV7A 4HMQA 3AK3A 2KLBA 4MQMA 3WJ7A 1ZD5A 3V4SA 5EKUA 5FOVA 4GKAA 4GP9A 3K9SA 1IG3A 1UIMA 3E3AA 3U3MA 3VI3B 5IP5A 3WLLA 2O8DA 2FSHA 4IHJB 1KYQA 5E7QA 1ZSNA 3I01A 3TG2A 1M57B 4C4OA 1IWOA 1Y48E 3UJ8A 1V39A 3VR2A 3E8SA 1NMSA 3ML0A 5K1PA 4KRXA 4BEJA 4MVSA 4D3YA 2W5UA 1IY0A 3OJ0A 3L46A 4XGKA 3A28A 4JT8A 3V4OA 4ILGC 1KEPA 5JZVA 4TV9B 1UOOA 2Y05A 1PEDA 4DRYA 3HEAA 3GUUA 5FL7A 3N76A 4IGGA 4MIYA 2EQAA 2VYVD 3MTBA 1V3QE 1IN5A 3H4VA 3O2JA 2UKDA 2C7BA 1K75A 5KLVH 4P35A 4D7TA 3AILA 4K87A 5HNKA 3ZGZA 2PQMA 1F7YA 5FBHA 2ODMA 1YE8A 3G8QA 3WB0A 2QP9X 1L1EA 2ZE7A 1Z2DA 3CF4G 4D9JA 2OY0A 2MMCA 4FIDA 3SBOA 1RM1B 3T7TA 1PQWA 4I5DA 5IAAA 2RN9A 1AKRA 2XMCA 3U0VA 2CK3G 1U3UA 2Q3EA 3ZH9B 1JDUA 2XSZD 3M99B 3VYRB 2RH5A 5EUQB 5L3QB 4B3MO 2FCRA 4JJEA 3F1KA 2EF0A 1AR5A 5BMVB 1IHXA 4TTVA 1VCHA 5BSKA 1I24A 3IVGA 3A3NA 2H5EA 1V8DA 3QPWA 4LN1A 5HG0A 4DV5O 1E4EA 1QH9A 2XMDA 4XI9A 4C0KA 3HACA 3RHFA 2HF2A 4WMLA 4QM6A 3PE3A 3P71T 2O5EA 4AF7A 1T1IA 4Y1EA 3MUEA 2QL7A 4FD3A 4GMHA 3ETDA 1C30A 2R85A 2XHZA 1FMLA 1KUQA 5JBNA 1ZW6A 3ZDAA 3PITA 1BGYH 1KEZA 4IIXA 3HKEA 1FNNA 1GKUB 1ST2A 3AF1A 4LCBA 5TT0A 3U7QB 3A0RB 1IMJA 1XVAA 3HYNA 1EQUA 1YVUA 2PZAA 3GGOA 2M98A 4FKBA 1H42A 4MKXA 2HREA 5I4IA 3SJQC 2HR3A 3GFFA 1QOZA 4PGHA 2IYRA 2O0JA 3C39A 4RPKA 1RNLA 4QJ5A 3V6MA 2CHGA 2FE1A 3DONA 3RV3A 2QUJA 3GLFA 3DZCA 4PI0A 5K6RA 2FSFA 1JXAA 1ORRA 4RQEA 3C3PA 1YJBA 1LC0A 1XPUA 3O4FA 4FNMA 1G7CA 1IY2A 3HU3A 3NM4A 1HUQA 3F78A 4IYRA 1SIOA 3MFQA 1OCCC 4HDAA 4P32A 5BQOA 4AJKA 5LQJA 1XZNA 5F52A 5LVAA 5B7GA 1ZZGA 1H65A 4D4KA 3GUZA 1EXWA 1H6CA 1OHHA 2YWBA 3JYPA 3QWFA 3KZNA 2GAJA 4YO7A 1RQ2A 1QR6A 3BRQA 1R0BA 1DEHA 4K6GA 3SNKA 1FDIA 3T3DA 5BN3B 5KC8A 1Q20A 3T7JA 5CGZA 1E2HA 3R7NA 4FVMA 2ACEA 3D3NA 3UCSC 5F76A 1QAOA 1ECCA 3A26A 1E0JA 1WTCA 2BL4A 5B2FA 4YRJA 4DR5B 2NV2B 5CLIA 4B87A 2GCOA 1HYQA 5A4AA 2VDWA 2Z98A 1JSLA 4D4JA 3WMEA 4CKCB 5I5EA 3OPXA 4JSRA 3WISA 2M1XA 4Z3OA 2O05A 3H6KA 5JNTA 4RULA 1GA1A 3DEAA 3O3OB 1JNYA 2EW8A 3BDIA 4F06A 5KAFZ 1S02A 5IKMA 4FM2A 1ZD8A 1HTTA 2X23A 4KHPO 4P31A 1MLDA 3UGKA 5TE9A 3VKGA 3OTOO 2EYUA 3UUWA 1OFUA 1P33A 4K35A 2X6BA 1A82A 1QX3A 3KKLA 1J21A 4EJ2A 5GINE 4EO4A 4GW3A 1G3RA 2XTMA 1TIKA 3FFWA 2IYWA 2Q7XA 5I7FA 1DARA 2YHIB 2DY1A 1UDWA 2PZMA 3PN1A 2YEVB 3K2BA 5C34B 4C06A 3P19A 3CNNA 1LDEA 2ZR9A 5CYOA 2Q6KA 5E8RA 3G6KA 5IVIA 3RLIA 2CZQA 2GEBA 1WMBA 3T9FA 3IJ5A 5K0GA 3WSVA 2PSEA 2VZEA 2VO1A 4UCOA 4CC6A 1J0BA 1N1MA 2VNSA 4HK4A 4UM9B 2E6KA 5FUWA 3D4NA 1GZ7A 2FFRA 3DP9A 4AJJA 1QYIA 2W6QA 1XN4A 1QHGA 1SQQH 4P7FA 4AWXA 4ZMRA 3M49A 4DQLA 4LTDA 1PJBA 4UCXA 1OILA 2AJBA 2HK7A 4G4SP 1E2DA 4LMRA 3ONNA 4OF4A 1B93A 2BAGA 5DNDA 4BV9A 4EJSA 5EKTA 2HTEA 3GWZA 1YUMA 3A1CA 4A26A 4RC9A 1U98A 3DZGA 3AB3A 2ZIXA 1M67A 1LRKA 3D2AA 4MQ4A 2OV1A 3G2IA 3JCUZ 5A4IS 2P8RA 1R64A 2KBFA 3LYUA 4ZREA 3ETCA 4PA3A 1EK2A 3KETA 1BMTA 2ZJ0A 1GTSA 4A5SA 2WB2A 4WESB 4BZZA 2B83A 2BCEA 2CAZC 2VP4A 3G9ZA 4KTTE 4DMLA 1M1UA 1Z2AA 4FK5C 4KIFA 4GHWA 4ZRDA 2QMUA 5CCXA 3B6IA 2IDJA 3G5LA 4JVNA 5LYJB 3I83A 1GUFA 1LGYA 2R7MA 3RFFA 1WABA 4OPHA 2P1RA 5KZMB 3H01A 2R68A 4DLSA 2OO7A 4P5PA 3R5JA 2PR2A 4OV6B 4JV5O 5DX8A 4MVOA 1L9KA 2VZ9A 4DDTA 1U80A 4CG3A 1SCDA 2IUTA 2GXAA 1Q22A 1E9DA 3C3DA 5H70A 2V8BA 1QV6A 4KYIB 2HK8A 2BTOA 2GTPA 2NZ8A 4R6ZA 2ZT8A 1LV8A 4BE4A 1NDHA 1WQ3A 4BNXA 1TF7A 1OZ0A 4KV9A 7REQA 2N04A 1QHHA 4YJHA 5JNLA 1WLSA 3E9NA 5L53A 3LDHA 2QAGA 3PJGA 2D5NA 1XTVA 2RHDA 1MABB 3C97A 1LZLA 1BHJA 3PVSA 4ZJYA 2HX1A 1EGQA 4LBVA 1XVIA 3JVIA 4BYGA 1W0KD 2IEDA 3VA7A 3QPBA 1ZL8A 1TIPA 5KTRA 1XMJA 4QICA 3VZBA 4J0DA 2HSDA 1X3LA 5IEBA 3W4IA 4EHIA 3UJ3X 2FMTA 1EP1B 3BGDA 3UHAA 2ISQA 2ZIAA 2ZPUA 3HCEA 2IW5A 3MGBA 3O84A 4N9WA 3G88A 4I2VA 1UWKA 1G2OA 1OIXA 3A6DA 4JI4B 3WNZA 4CIYA 4PLPA 1GZVA 4ZO6A 1TC2A 2RGGA 1DQPA 1UK8A 4Y18A 3UUGA 4BJ3A 1YGPA 1C1XB 2A79B 2VCHA 4D2IA 1O0CA 2VJQA 3HDTA 4G1CA 4RJLA 1XOUA 5JSKA 4JI1O 1PR3A 2PD4A 4DUGD 1T6NA 3V7YA 3PQEA 1GQ2A 4I9HA 3EYWA 1H0RA 2IQIA 2MU1A 3WGOA 3IV7A 2LKCA 4PPQA 4YXWG 2EKQA 1QBKC 3GMIA 3OCWA 2JFBA 3U4CA 1LLQA 4Z7NB 2FPSA 4Q7KA 1ZI9A 2GPJA 3LI2A 2VSQA 2PUEA 3M6FA 8MHTA 2P06A 2R9RB 3J7AC 1XR3A 2V1XA 3BIXA 1TT5A 4MUXA 2DTDA 2AD1A 4P98A 5EAIA 3V3KA 1FPQA 3P9NA 5KKAA 2M6SA 4AP5A 4I0XA 1F4MA 2NR5A 4IIFA 3QOFA 2QMYA 2IHYA 4K0KO 3C1TA 3T7DA 4B9AA 3DOFA 2O2DA 4EQ6B 3BRWD 4RV4A 2G1JA 5HR5A 2BGTA 3I76A 1ADCA 2I22A 4BP8A 1SXGA 3K4HA 4IGKA 1DO0A 2CJPA 3SEFA 3SSAA 4B76A 4CHGA 2OYCA 2OIGA 1FX0B 3PR2B 4L85A 4EUHA 5JFGA 5CXQA 4BLRA 2HU7A 3GJ7A 3JAMN 4HYTA 1RYEA 1ZIOA 2EGHA 2HCRA 2PMCA 3HLTA 3LSTA 4TWJA 5EERA 4ESHA 4ZEVA 4PHHA 5JXHA 4C22A 1EJBA 1HDRA 4K88A 2X6CA 3K5HA 2YSUB 2Y68A 4QFBA 3Q8MA 3R8CA 1N7HA 3K5OA 1RS0A 2FZEA 3OZAA 2NZWA 3I9V6 1C81A 1VSUA 2ZJ8A 5JAZA 5KSWB 1SUFA 2Q46A 2GQ0A 3P45A 3CH5A 1UBTS 3DBHA 3GLRA 4WFIA 3PYXA 4NBTA 3JASA 3L4BA 5FLEX 1EJ0A 1GCAA 3T0GA 4L7QA 3C6XA 3TR6A 7YASA 1AU9A 4DBVO 1OV6A 2OL4A 2YV3A 3V2UA 3ZDXB 1D2GA 1K9MW 1N33O 3DCIA 3CMAV 1DTEA 1TAUA 1A5SB 2VDOB 4I4TF 1QOQB 4YPVA 5FL7D 1IQUA 1K7DA 3IR6A 1VYHA 1F5NA 2EBUA 2ZD9A 2R65A 5FTJA 4DDKA 5B30A 3F7VC 1TA4A 4LF8O 2H4FA 4YONB 4NZPA 2O2XA 1HNXB 1YRBA 3D6VA 5K8JB 3RT3C 2HNBA 2ZRCA 1RWQA 1Y3HA 2NVOA 1YNOA 1RXSA 4IYJA 4EL5A 3KVNA 3R3UA 2FZWA 3B20A 3LTNC 3NETA 1IXKA 1DBPA 1VL1A 1XI2A 3TEFA 1M56C 2FQQA 2PWBA 5CA0B 3UJBA 1SOUA 1ZO8A 3WB9A 2PNFA 2E5WA 4TS4A 4M21A 1G5PA 5AOBA 5NULA 4UPEA 3KEGA 3RVYA 1VKNA 3ANLA 2BMJA 2DECA 3ER6A 5DCAJ 4Q6WA 2F1MA 1FRQA 1UJNA 4GUDA 2AHRA 1EYZA 4IG9A 4A92A 4FJ0A 4BRSA 1EXDA 5B66Z 2ICAA 5JCOC 2GXQA 3EDQA 3W6PA 5E6SA 5LP6B 3WLKX 4UB6Z 3K4QA 2NZ2A 4GDMA 3SLKA 2GUZA 4LC5A 2EIXA 1QTIA 3BE8A 5LZ4A 4LC9A 3FBTA 3SXPA 2CK3D 4YMLA 1XD2A 1SKVA 1R18A 4J1NA 2R8OA 4A7PA 4I36A 4KN8A 1DJQA 5BT8A 2IP2A 5K01A 2OZVA 5IDQA 3P0FA 1A88A 1EDDA 1YH3A 2JAPA 2Z3ZA 5AKJA 1BVRA 2P9TA 4IDEA 4JLWA 2D1YA 2HF9A 4QUBA 1HNZO 4N3NA 1XZJA 1T26A 4L0DA 5EJ5A 3O8LA 2F23A 3Q6NA 5B3LA 2FUKA 4YCNA 5DHPA 2JL1A 1J1ZA 3VR1A 1ACJA 4IEFB 3CBQA 2B2CA 1EX7A 3DOJA 3QFSA 4AUEA 1V8PA 1XJCA 2AXEA 2E37A 3GEGA 4JL5A 1B3BA 1GKLA 4GM0A 2IBZH 4M87A 3R6LA 3OPYB 3ZGVA 4E1BA 1G291 1K4MA 1FNBA 2CMFA 3QPCA 4TMKA 1Y6QA 5IARA 4C2AA 3HCNA 1I7PA 3NIBA 4DGSA 2X6RA 1ELOA 1I0HA 3D8NA 1IN6A 1QFMA 4Q9AA 2H0QA 4G3XA 4JH0A 5CIQA 3UFBA 4BNJA 5KTPA 4LCNA 1MX3A 3QPDA 5AM4A 4ENSA 4PO3X 1SG9A 4OJNA 3ANSA 4I5IA 4CL8A 2GHTA 2IH3C 3GB7C 4DMHA 4E11A 2ORED 3PWKA 5B55A 5DV9A 4UUQA 3DDHA 3K30A 5LOVB 3DPIA 4MR7B 5DLEA 2IUUA 1TNDA 1Q3HA 4F6EA 2JIBA 3C4VA 4X9QA 1J7JA 3TGWA 1H3EA 4YP9A 3P9IA 5AOVA 3EFFK 2E3JA 1U6JA 5KCMA 1Y82A 3HUDA 4PINA 2IYEA 4IYHA 3OQ1A 4R69A 1SETA 3A31A 1NQUA 1WCIA 3D3WB 3EH1A 4BB0A 2W4LA 3N28A 3OTOB 3AZQA 1XQ1A 3P9RA 4LY6A 4PZ0A 2QR3A 5FOUA 1E1RG 4GKJB 1UM8A 2IZZA 1WXIA 3HU2A 2O8DB 4MYTA 3UCXA 3QMPA 1GG2A 3ICEA 4I4TA 2HQSA 3R75A 3RSHA 1DXHA 2AG0A 4NJOA 5J5VA 3TLAA 3A0RA 4AQYB 4I99A 2E4AA 2GEVA 2DVMA 3A4TA 4IDOA 2VDKB 4LOLA 3HGTA 2AHZA 4B6EA 4MKFA 4TT8A 4JIGA 4BRZA 3QUAA 4Q4JB 5F21A 5KYKA 3QVXA 2JAUA 4TT3A 2JANA 3BXGA 4GE3A 2M7WA 5CD9A 4ZTZB 5INTA 3H11B 3DVQX 3ZZMA 1MOFA 4NDAA 1O6BA 4AMYA 4KWEA 3O4IA 5JO0A 3I64A 2AEFA 4MCJA 3KVYA 3ZU6A 2PUHA 3IXLA 1BCRA 3O21A 5AQ1A 3R6DA 2GK7A 1SG0A 2ZIZA 1GEGA 3MTJA 3AF0A 4RAIA 1QRTA 4G3MA 5BV0A 5J2TB 2ATKC 3HB5X 5LUBA 4F5DA 2HF7A 4MJ3A 4ZT6A 3WAKA 5KYXB 1QYRA 2AYZA 1AQIA 1EWVA 4I9GA 5L3VA 2ODNA 2K2WA 3H84A 4MGIR 5TPWA 4HNUA 5KJCA 2X13A 3GNLA 1HL3A 1YQUA 4GRAA 2YVLA 2EZOA 4CE6A 2UZ4A 2ZJAA 3U81A 1ENZA 2WT8A 3E48A 3B6ZA 3LOQA 2XTAA 5EBMC 1QH1A 1E8MA 4LYGA 4GXQA 1FFXB 4P4UA 5DM0A 5GADl 2CKMA 2ZWVA 2GN9A 5DNWA 1NE2A 3BY6A 1EN5A 4FINA 1OC4A 4WZZA 3V1YA 1XVTA 3E22B 1SHZA 2ECKA 1M1NB 3EG9A 4OG2A 5KOHA 1R6XA 1GUAA 5LU8A 2QM7A 1OKKD 1CR4A 1GG8A 1TQ6A 1UQUA 1VBNA 3O2QB 1R8QA 3WI7A 4DMCA 2VKTA 3RS0A 4UXJA 3F0TA 1JMYA 1JZQA 1W88A 2XUZA 2XY4A 1DIAA 1W6RA 2YASA 2OHIA 3OAAD 4RETA 3SICE 2VXCA 4BO6A 4ERXA 2VTBA 5JQGB 4HS9A 4KOAA 4HX5A 4FT2A 4BXOB 4NR0A 1SN7A 3IMFA 4V2IA 5DK6A 1I3KA 1WW2A 4CS4A 3LPAA 2OBNA 2VOJA 4IDPA 3K16A 4YV1A 1VIBA 4QG3A 4DIOA 3O7MA 2ACWA 4MUEA 2IUFA 1YZUA 1HGXA 3K1TA 3TIFA 3Q11A 2C7VA 2X8WA 3UWOA 1FSFA 5DHAA 1P1CA 2V59A 5HF8A 3PE4A 4PRKA 3IPYA 5IMBA 5JJJB 1EVYA 2HWYA 4B4OA 3D6HA 1YOVB 4NECA 2QTOA 1GL7A 1GPAA 3FROA 1H94A 4HL6A 1P2GA 3UKJA 1ZD4A 5BSTA 5AM3A 2MYNA 2WLTA 4MVJI 3UV3A 3W9BA 1HFKA 1EI9A 4LRQA 3QF4A 2NUAB 4C08A 4UCFA 1G6HA 5B3SB 1GZHB 1W35A 1CS0B 1U9CA 3KPVA 1N0UA 4JC5A 3UMCA 2RCNA 1N0VC 4F9FA 2C2ZA 2F1RA 1CJMA 1UAQA 3QLUC 1W46A 2XECA 4DV6B 1NE7A 4PVCA 5EHIA