1PL0A

Crystal structure of human atic in complex with folate-based inhibitor, bw2315u89uc
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
589
structure length
589
Chain Sequence
b'GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Crystal Structures of Human Bifunctional Enzyme Aminoimidazole-4-carboxamide Ribonucleotide Transformylase/IMP Cyclohydrolase in Complex with Potent Sulfonyl-containing Antifolates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
total genus 201
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pl0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pl0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A02
5H3LA 1S89A 1S8AA 1B93A 1OZ0A 1G8MA 2YVQA 1P4RA 1PL0A 2IU0A 2IU3A 1M6VA 1ZCZA 2B1GA 1BXRA 1CS0A 1M9NA 4EHIA 4A1OA 2X8WA 1C30A 1EGHA 2XW6A 1T36A 1A9XA 3ZZMA 1KEEA 1IK4A 1VMDA 2B1IA 1PKXA 1C3OA 1CE8A 1THZA 1WO8A 1JDBB
chains in the Genus database with same CATH superfamily
2RK6A 5JJJB 4EUKA 3T3NA 1JEYB 3NDIA 5DNAA 3DBHB 4OMDA 1EUDA 2ECPA 1KZGB 4K1XA 3ZCSA 2DPXA 3CZ4A 4YAIA 5LXTA 3FPBA 3L7AA 1YZTA 2JCGA 4OSEA 3CY6A 5G0TA 1VP3A 3C6BA 5IC6A 1AB3A 4J7JA 1NYTA 3Q8XB 1MENA 3HFGA 1W75A 4LGYA 4CTJA 3CW8X 3K2EA 4LC5A 1EYZA 5C32A 3DXZA 3K1AB 5EE1A 1SCAA 1JFRA 4ZT4A 1BE1A 5E3JA 1MFPA 1YRAA 4ALLA 3CCLV 1R74A 1G8MA 1YU6A 1DJOA 3WLIA 2VDLB 3KRTA 1XLTC 2Q5CA 3KD2A 1VLHA 5LR6A 1M8PA 4RIIA 2GAAA 1ZUHA 1OWMA 3BCUA 4MDHA 1E77A 4UM9B 2BEVA 1XUOA 4DR1O 5D5PA 5F51A 3ESAA 2HXYA 4K81B 4Q4JB 1JTEA 4AO6A 1XCMA 1JFVA 1JSLA 1FX1A 4EAAA 3H6KA 4CM7A 3TNDA 5GM2A 1FDOA 2HVWA 1P19A 1EAMA 3B5EA 3PHGA 3S7ZA 4CMJA 1M75A 4AJIA 4Z1OA 2VPXA 2XDQA 1XI2A 3VJKA 1O6CA 4RPIA 2WYIA 3ZOKA 1PFUA 1DHRA 2ONKA 2C00A 3V7FA 1UEIA 2NO5A 2XMGA 4KN9S 2YBEA 2J9RA 3G5LA 1M76A 2EFCB 1JJBA 3SEFA 1PL0A 2O2EA 4IKOA 3AG3B 4MV0A 3PEWA 1KKCA 2JGKA 2Y67A 4LRXA 4JWTA 1B4DA 3NJRA 3NVDA 1RHRA 1UQTA 4XFKA 1U4OA 2NU9A 3TZ6A 2GVZC 1UKAA 1GL7A 3NUQA 7ADHA 4FZ5A 4ZHQA 4W1QA 3TQSA 2YIJA 2WD9A 5AHWA 3DEZA 2WLNA 3MUEA 3LUKA 4N8SA 4HGPA 4J6FA 4ASUG 1C50A 2J09A 4WL0A 2IGBA 3JYQA 1KJIA 4V0MA 1ORWA 2GAFA 3H4VA 2BWJA 2R7MA 1VMAA 4V3CA 2HQOA 3CUUA 3F4BA 6REQB 3WMWA 2ZR8A 3FDJA 4OQPA 2RH8A 1CB7A 2R84A 5DI3A 1EVIA 2PKYX 4YIHA 4ANFA 2IXAA 2QRQA 2GLTA 1XKLA 2EZ9A 4OYHA 3SHVA 3GEDA 3RPEA 2V7VA 5A5FA 4WN3A 3ZNQA 1CR1A 3BGVA 4KE9A 3LGSA 4DV6O 2RJZA 5CA1B 3VO1A 2PX6A 5GZ3A 3V4OA 2O2ZA 3WA7A 4RVSA 4Y67A 1RSZA 3ICOA 3D3KA 4LXHA 1AXRA 2DC1A 2RBGA 1U9JA 3PPIA 3M83A 1KJWA 4FQ8A 4F46A 5JDIC 4DUZB 1NTOA 4CEHA 3AFIA 2FEKA 2XLCA 4F4CA 3WMFA 1V25A 4RPHA 3BXXA 1P44A 4MH0R 2GLUA 4CM8A 2VUHB 4LKRA 2QSUA 1XYVA 2JIRA 3DQPA 2R8XA 4DR4O 4Q0MA 4X1OA 4M1SA 2C2ZA 1RS0A 4R84A 1XI1A 1XZGA 1FS0G 2VDMB 4G4IA 5KTOA 4KGDA 2AF3C 3DD1A 5EYPA 2XE6A 1XRRA 2FJUA 4IFBA 2W2XA 4WKBA 2FPGB 5IXSA 3T0FA 4DB4A 3GT3A 4R1PA 5HIMA 2Q9BA 1M6VB 1DXQA 1NXWA 5ALFA 4B3DA 2X6TA 2AHRA 1E1RG 1M10A 1BSVA 4CL0A 3C14C 1X7YB 2AOXA 4JU9A 1WZUA 1U6IA 2E0IA 1ND5A 3HKDA 3N8HA 3TPCA 1L5KA 3FKQA 1X7XB 4NZ9A 3SBXA 2QX6A 2A5GA 1JALA 2BAGA 5A4KA 3JZAA 4ZK6A 1Y3DE 3DZFA 4N0MA 4YRQA 3LH5A 1GTJ1 4UVBA 4Q1AA 1EWKA 1P2DA 1QV6A 4Z0PA 2GFQA 2XWJI 1TYZA 1WXHA 1IG0A 3FW1A 2BDTA 2D1QA 3HEMA 1M72A 2B1RA 4PZZA 3MXTA 4Y9DA 2ARKA 5KVAA 5L3SA 4CR8A 1J2TA 3FHCB 4QECA 3FHOA 4BZXA 3IULA 1MTZA 4D8UA 3W5SA 1H2HA 4FOOA 2QVGA 3H9JA 1JYEA 3F7YC 1WQ1R 2CDRA 1H4VB 4OV6B 1CY2A 1NU1H 2EIJC 2VZ9A 3W7BA 3DL0A 1YFZA 3LOPA 4PINA 4Z1MG 1NJSA 1T9KA 3G0BA 3OCJA 1HXHA 3AM3A 5K51A 1FOEB 4J3JA 4KXXA 1LLUA 3LPLA 5E9AA 1EGAA 5KU7A 4HGQA 4UREA 3AK3A 1Z74A 4OBEA 1FTYA 4NLLA 4RMJA 2CXXA 4MRMB 3SIWA 1GCIA 3VR5D 4EUFA 1HNWO 1GNVA 3DVLA 4PLVA 1IRXA 4PO8A 3H75A 5ALLA 4U3JA 4BNTA 2HPZA 3U7FB 1L5LA 4MCHA 4C4ZA 4Z4FA 2BTQB 4AJPA 1UZAA 3HKEA 2BI7A 1SMKA 1QR8A 4RCYA 2HQ1A 5FBHA 2N47A 3PA8A 5AJUA 4C0QC 2ZSEA 4JT8A 4Y0NA 3ZLVA 3EFBA 3KPVA 2QHXA 4LYGA 3KEMA 2H8GA 3N7TA 4PQFA 4UPDA 3HVIA 2ITDC 4UCWA 3AVPA 4IJWA 3E7PA 1L7XA 1YDEA 3DS8A 4PYKA 1XTKA 4G56A 4GIBA 4J0QA 4GX2A 3FUWA 3NBKA 1FZQA 1NJ6A 2RB4A 1RXSA 3L2OB 1CUFA 1UMDB 1JG3A 2PR2A 4ODIA 3H84A 3OE4A 1EA7A 2JJ2G 2QLCA 2PKCA 5F76A 2RHBA 3RD5A 3M99B 2EFGA 3D6UA 3F49S 4DLUA 1W2GA 2OXCA 4XAQA 5BO5A 4HEHA 3UA3A 3U3OA 9LDTA 1GTG1 3DONA 3CRRA 4GOXA 1FRNA 5CTAA 3IR7A 3AT1A 4HUQA 2QY6A 2QSYA 1NTMH 1XL6A 4XIGS 3W1EA 4NZOA 5JD6A 1L8XA 5ELXA 3O0DA 3TZKA 4L5JA 2Q0QA 3C5VA 4RZXA 1QR6A 3NV9A 2Y93A 1OI7A 1BRTA 4UCVA 1QK3A 3DOOA 3BE8A 1M34B 1BC5A 3UUGA 5F7XA 5THKA 4WMLA 4LI0A 1F8XA 3QOXA 5CFZA 2P35A 3WK6A 4FHDA 2A59A 1DTWB 2I80A 1QDUA 4LDAA 2IZ0A 2XOKG 3S99A 1QV9A 3A6GA 2QR3A 3OIWA 1TECE 5DNYB 4CMIA 1G5HA 1BX1A 1OCCC 2OHOA 1PS0A 2UXDO 2X5NA 2AG1A 1QONA 1XDGA 2ONZA 2JI8A 3KVYA 2GCEA 1C9DB 1Z15A 4YV2A 1NVAA 1YEWA 3IS3A 1UBJS 1O5OA 3VVLA 1IY2A 3WGZA 2YBDA 3MM4A 1TD9A 3W79A 3DNMA 1QQCA 3QVLA 2I55A 1E1KA 5I4IA 3KKNA 2XGSA 3OGCC 2GKOA 1E8NA 4BN4A 3GQBB 1ZRSA 4QXOA 4M8KA 3WL8A 1DP4A 3REOA 1BS3A 1IOVA 5ALSA 4BWGA 3UJ8A 5EZQA 3E0XA 2DFDA 3QI2A 2XT9A 3UAZA 2O2SA 3T1VA 2PBLA 3OW2U 2I2DA 1GNPA 4TRRA 2DZDA 1DKNA 2A35A 2SKCA 5CPBA 4C2UA 4NMXB 1ZA1A 4JLKA 3AVYA 4EG5A 2AJCA 2GN8A 1YRHA 4BNDA 2ZCJA 1Y82A 2FX5A 2NUBA 5MN6A 3FYTA 5SICE 1KNXA 3VC3A 5CDUA 3N7UA 3JRWA 4I08A 2VATA 2I4OA 1KJQA 2FOLA 4PR0A 4U6SA 1KWGA 3E9CA 4KOEC 5E4TA 1UAGA 1E7QA 2X41A 2SKEA 1WEHA 4COOA 1XRSB 5BNIA 1HFKA 3NR2A 3AF6A 2ONCA 1OVMA 1KSFX 1MA3A 3FZGA 4KVGA 4WW0A 1MOFA 3B48A 4YQYA 4ZICA 3UUFA 3RSHA 4FGWA 4B85A 4N82A 4N3AA 3CJQA 4N3NA 3DOEA 1P2VA 1RPNA 4AVYA 1T1GA 1RP3B 1SQFA 1DQZA 3DMRA 2P78A 4BCCA 1Z0KA 3BD9A 5KJFA 5A5GA 5KTPA 4F3RA 1WMSA 3SGIA 2WHQA 1V45E 4RA9A 5DM70 3AINA 3LQQA 4FX5A 4NNJA 3VU9B 1FYEA 3BWMA 1QIJA 1P60A 4LZNA 2DTDA 4OFXA 2NW6A 3AFMA 1R4MB 2X23A 3SJAC 5JI2E 1P49A 1J8YF 3OTHA 5LCXA 5J2UF 2Q6KA 4GXTA 3RARA 4HR7A 3HNRA 3CNQS 1QQ6A 4YV0A 3WQQA 2WT4A 3KOOA 3ZWYA 2CJPA 1Q7CA 5CB6A 1HL3A 1WZEA 3O91A 2FPKA 4JEMA 2PGGA 3ZE2B 1XR3A 1L8OA 2L2QA 2XUDA 4RDCA 3O4FA 2CNNA 2CDCA 2HK8A 2G9QA 4J0CA 2XWPA 3F3SA 4XDYA 1F48A 1DBVO 4CFSA 2H92A 2A14A 1PUJA 4FGUA 4BP3A 4X9QA 2NP6A 2HZ7A 1UT5A 1TT7A 1OBOA 3RKRA 4G0MA 3UHOA 3W6OA 3GJYA 4PHFA 4AF6A 4B0PA 3D2CA 4U7PB 3A2FA 3JQ7A 4A36A 4N5DA 4CBVA 5HMLA 3LDCA 1AP6A 1L9XA 3VNQA 1QBZA 2QRHA 1TT5A 3IVCA 2BM0A 2JASA 1RWPA 3NDPA 1XL1A 4Y2QA 1Z7WA 4D9FA 2AN4A 3CMMA 1FP4B 1J9GA 4GLJA 2GN6A 5IHXA 3FSGD 3K0AA 2XUGA 5C9ZA 2FPMA 2FV8A 1X59A 1FP1D 1OFUA 3TGLA 3AFHA 5EE9A 4EY5A 3PKJA 3DDHA 4ZCMA 2EW8A 3LX8A 4E5MA 4QTXA 5B3AA 4D6TH 3DF9A 4OMCA 1TYCA 2A3RA 1T3TA 4MUJA 3NTQA 1V7CA 5EIBC 1BTOA 3NIWA 3U81A 1OV4A 3UGKA 3F5MA 1NMSA 4BLVA 4ETIA 1Y8CA 1JEQB 3EIXA 1JE0A 3RGGA 2V45A 4UNSA 1VLLA 2QM8A 1KTIA 3DVSX 3MRVA 1L4YA 1ISPA 3QJ5A 4MCAA 3ZGOA 4RDHA 5IKXA 2Y92A 2PRZA 4JSTA 3ONNA 4TLBA 1NZJA 2EZPA 5GONB 1ZM4A 2Q7HA 1M1NB 4GR4A 2HDNB 3OLXA 4CMHA 4WOCA 4FCWA 4F6EA 2DBZA 1X92A 2LGWA 4PO1A 1Y5MA 4FMDF 2NNLD 3ITDA 1GQRA 1Y8AA 2HREA 2QDXA 1HQYE 3SR4A 2LXNA 2CLEB 3I2KA 4RJLA 4WVFA 4TQAA 3K9CA 2QT9A 1CZOA 5IPFA 4P81A 2X5XA 3T6KA 5JJCA 2GQ0A 5FPSA 3PENA 3ZEDA 3TD9A 5FL7D 1OLXB 2VLIA 2O5RA 2Q4OA 3HCDA 1RYNA 1VYVA 5CR9A 2I6UA 3TO5A 3RFUA 4R9RA 3UHJA 3MHTA 1AHPA 1ODCA 3VDXA 1BS2A 4MA0A 5IXJA 3AY6A 4CQMD 3DZKA 1ZOLA 1A95A 5L45A 3A4IA 4I81A 3T4EA 4I9QA 3M6VA 4NQZA 2PY5A 2MIIA 2ZTUA 5DIFA 1GA6A 3P9IA 1K3UB 5K8UA 2PUCA 2H07A 3I58A 4RTQA 2VJMA 3FKSA 3PXAA 3BZWA 3C3EA 4MSQA 1K0UA 1RFYA 1JA0A 4C14A 4YT5A 5I6DA 4EF4A 3F6EX 3SJ7A 3UB2A 2NAFA 3T7KA 1Y63A 3AK1A 3HV2A 5EEHA 2W4QA 1QF7A 4MQ6A 1F6BA 5DSZA 1NRXA 3SKYA 2V8OA 2JIDA 4BFSA 1KQOA 1TIYA 2XHBA 1OZGA 2DYSC 5B2FA 2VPIA 3DG9A 2FN7A 1PZGA 3UJ3X 3N2KB 3EBLA 4QICA 3E2PA 1NF9A 2BBWA 3ZGZA 1GG5A 3GI1A 4EHKA 1A4RA 3T1YO 4ABYA 1H2WA 4TT3G 5FFNA 3SZUA 2Y05A 2R9RB 1EK1A 3LC2O 4G63A 3CNNA 2W8BB 3PTLA 1CFJA 2XCQA 3OX4A 3RAPR 3QFHA 4XA8A 1MDFA 1K4CC 4X8AA 4ZVMA 1OE0A 4ZAYA 1YVWA 1N6KA 1CUAA 3HKBB 2G8LA 1KUQA 4JODA 3K04A 2GM4A 5BV2P 1RHQA 3DT9A 2X5JO 4Y1RB 3E86A 2ODEA 4RWEA 2C5AA 5AK6A 4JI1O 2HSGA 4MI3A 2G0NA 1FS5A 3PXGA 3T1TA 1WXGA 1ZQ1A 4W9NA 1NNI1 4PC1A 1Y8QB 1JSRA 4YCLA 2AOUB 4N48A 1QCZA 3AM5A 4CMEC 4E30A 1GQ2A 2ZM6O 1DAFA 1N5IA 2ET6A 3AIKA 1AI5A 3PSAA 4G5HA 2PH3A 1MVLA 5IYBO 4CV2A 4IIJF 4GI7A 2VAPA 5EP2A 1DEHA 4FFRA 2EINB 1SVWA 4U2EA 5THQA 3D1JA 5AMXA 4RY0A 2VHEA 4QOIA 2EX4A 2WWVD 2HD4A 3TWOA 5KSPA 4B3FX 4Q5IA 1KYZA 4OG2A 5LB4A 4JU8A 2XAFA 4XSHA 2JATA 5JXHA 4HWSA 3NYWA 4PZYA 3WOHA 5LMZA 3U4QA 4DM7A 2ZAIA 1YITV 1V71A 3GUCA 3EZ7A 3CVWA 4I9UA 2FR1A 1G4YB 2QP9X 3I9V1 3HXTA 5FBLB 4NULA 4O25A 1HSOA 3H87A 5CW2A 2W5UA 2N04A 2WB4A 4ALNA 4P3OA 1VBKA 2DFVA 3FTCA 4XWAA 1HC7A 1JIKA 3WL5A 4DIMA 2XTZA 1IHYA 3QEMA 1PR1A 1DEXA 2X2OA 2Z3IA 4D10F 4DMCA 1UQUA 4UU7A 1KQFA 4F2WA 4MEJA 1EFKA 2XAGA 4KFSA 1QRTA 1LPSA 3J81A 2WKWA 5KHOC 4JBGA 1J4AA 1V11A 4I2NA 5AK5A 3AM1A 4MB6A 4R1SA 3IOBA 4GMKA 1P2FA 4D0GA 3D0RA 3KJQA 3I5XA 1Q5OA 2B7LA 1UXKA 4U5QA 2X8BA 3ZRXA 2XVAA 4CF4A 1W1WA 1VZ2A 1IDN1 3EXHA 1EFRG 4FLTA 4CLXA 4H1TA 4J49A 3JARB 4X20B 2D3TA 4UCOA 1BN6A 1NY6A 4EF6A 4CU2A 3RVOA 5T4EA 1AUPA 1GXSB 2DQ4A 2DWEC 4H31A 9LDBA 3H5VA 1CE8B 2JHFA 3EF3A 1NKSA 2HEGA 1LCIA 1L4KA 3E53A 3U39A 3E8MA 4Y2TA 3ORRA 3GEEA 2ANBA 2AZ4A 3B89A 4I3HA 1UXOA 3DCIA 3K5IA 1RXYA 3H5AA 4KU4A 1RRFA 2OG4A 5ALHA 3D59A 2I62A 1UP7A 2G08A 4XW2A 2NWQA 1M7HA 2HRCA 3X1KA 2I03A 4HVLA 1IBMB 1NW5A 3K35A 2PGAA 3COWA 3GHYA 5HEKA 2HHLA 5KO2A 4KRFA 3JQFC 4N41A 2R6ZA 4GI5A 3AUFA 1YFJA 1S5PA 3TFWA 4N76A 3RI3A 2FZLA 1HZZA 3PUHA 2CWWA 4OCMB 1C8LA 2YKGA 4Q16A 3S7TA 1MUUA 3OUZA 4V39A 2QF7A 3KYBA 3QXHA 2RAVA 5TR9A 5ITWA 2AEEA 2Y0DA 3TAUA 2D8MA 4U2GA 1E1YA 3EGOA 4XLTA 1H22A 5BNTA 3WG7B 4RIFA 3T1CA 4N4AA 1D4OA 3BHIA 1BWRA 4UC0A 4TVBA 3CHYA 1JTVA 1QR9A 4E5NA 1SCUA 5I9MA 2CBGA 4IIEA 4C01A 4G1CA 2YN2A 3CZQA 2YMQA 4NMLA 1KSHA 4G41A 2WZCA 4UTZA 3WZMA 4CG0A 4PGHA 2DPYA 4H4EA 7REQB 1NLZA 1EP3B 3WGGA 5TMDA 5LZ5A 4FGKA 3KKLA 3SC2B 2QM0A 4PBSA 3C3YA 3AHEA 2DPGA 1Y3IA 2QX4A 4P22A 1K33A 1IU9A 4XSVA 3LM8A 3INRA 2RK4A 2Y0IA 3CPHA 1A98A 4MA4A 2RDCA 4QODA 4R71A 2DH6A 2WILA 2AJ8A 3BMXA 4GLFA 3L7IA 3GY0A 3UZUA 1EGVB 1LDEA 2FPUA 3GT4A 3BQMB 4UD2A 1NQAO 4ENWA 4ZPJA 2B5UA 3GNLA 2G06A 3ZHTA 1DKLA 1URPA 4CIAA 2Q5OA 5KHGA 3EG5A 3W5UA 1A5TA 1H5QA 4BQSA 4ZZIA 1YNOA 2WD7A 2ECKA 4RY9A 4HDMB 4X66B 1KJZA 4M88A 2FTKA 3WMRA 2FRVA 4M7RA 1I33A 3ZCXA 1EBBA 1EG7A 1PHRA 4M0MA 3B8MA 2AZDA 1LBEA 3VVBA 2F00A 3PVCA 5BV1A 2ZRJA 1GR0A 1UCFA 3NM6B 2G77B 4WBNA 3LC1O 4AMYA 2GM9A 1KZ7B 2GYWA 5JROA 2PMFA 5GY7A 4ZMRA 1E5TA 5KQPA 4U9UA 3UJ9A 1ZNXA 4DWJA 4URYR 1XZIA 3C1AA 4NG4A 4OX9B 4YCNA 1KK2A 1I5YA 1L7DA 2Y69C 1G64A 3K6SB 4JLBA 4A10A 3H11B 2NTJA 4UQOA 1ST2A 4YPVA 2ZJ1A 5PGMA 5LZ2A 1GSAA 4LF8O 5ITZB 1QC5A 2J9FA 3HZOA 3MUFA 1JAHA 4QXMA 2XNKA 1SKYE 2EW1A 5M5BA 1QRUA 2F95B 3EW9A 2AHYA 1DOHA 2HLDG 1Z6QA 1O96A 2IDKA 2OFFA 1VG1A 2WAMA 2ZRPA 3BXOA 3DC2A 3EG9A 3NH6A 2R96A 1G3MA 1X1DA 4B32A 4MR7B 2JGDA 3EWSA 5L7WA 4TSKA 4BEBA 1JPUA 4AIIA 2HA2A 2C84A 2FPPB 4JV5O 3NHLA 1CB0A 2ZRAA 1FU4A 1R27A 3C98A 1RP7A 1K7XB 3PQCA 3H1EA 1NXVA 1R1BA 2I7TA 4EZEA 3P2OA 2A9FA 2OFXA 3F1KA 1SCKA 3T1NA 4CCSA 3LFTA 3HUUA 1U2GA 4ERNA 4HPJB 3GELA 2GJKA 4CTMA 1LPPA 5SYNA 4DKJA 3G80A 2P8RA 3Q7QA 2PWYA 5TQ2A 1P1BA 4X65B 3PNVA 5BR8O 1U6KA 3NFYA 1VCMA 5KYKA 5AKGA 4NI5A 3R7FA 3CSUA 4H0NA 5H9CA 1X1EA 3Q0IA 1XLUA 4X6LA 3GYGA 1NS1A 3BF8A 1NURA 1NQXA 4PHTA 1CUBA 4ILKA 2WNHA 3R7SA 2R6JA 1M66A 4FMCF 2WFAA 3SFTA 4EFNA 1SVSA 2G71A 2UYQA 1ZITA 2HQBA 1P7VA 4TN1A 4D9GA 4NEHB 3FCEA 4KQXA 2NZ8A 3A26A 5JE8A 1JZQA 3IILA 5D3MA 2Q2QA 1D5CA 2CFOA 4MICA 5CK5A 3GZNB 3W7XA 4JBNA 1VQOV 2EEZA 4GGOA 1RC1A 4B7CA 1MIHA 3ETCA 1AQIA 3W05A 1SKAA 1SG9A 1X7WB 2ID8A 4NXNB 1DKRA 2V6BA 1DPFA 3RK4A 4YONB 5JNWA 3KZVA 3IHKA 3ZBQA 2D2XA 2XUJA 1MG1A 3DPIA 4TGLA 1RSOB 3L9XA 4DS3A 3SEQA 3EMVA 1G7CA 4ZOLA 5L3VA 2P3SA 2CLLB 4QQNA 3BJZA 4IX1A 1K3TA 4ZBMA 4O5AA 4PSDA 3ICEA 4ILGC 2D54A 2GZRA 2BF4A 4HL6A 4P4SB 4IHJF 4Q9JA 5CBKA 2B9ZA 4NICA 5EE3A 4B7AA 1VJGA 1HT2E 3E8SA 1VFNA 4AZVA 4ZT6A 4DEVA 1XMQB 3NIBA 4XH9B 4E0QA 5EBWC 3U9LA 4JXEA 2HSWA 3SN6A 1W47A 1C9YA 3HLTA 3OOJA 5BUZA 2RI6A 2VP4A 3X43A 4BB0A 2ATEA 1PUIA 3OA0A 3ZWDA 5F2NA 1GPWB 3RSZA 3LWZA 2A0FA 1Z73A 1Z5NA 1UPAA 1RJ9A 4E4TA 2C5FA 1FTNA 1U8TA 6Q21A 3C6ZA 2Y0BA 3O9ZA 4DIKA 2WIFA 5AHOA 3AZQA 5JS2A 1V16A 4FYPA 1SQ5A 2FSIA 2VF5X 3EZ6A 3I28A 2I6GA 2VQ3A 3RV3A 1YZNA 3RYIB 1J1UA 4B6FA 1H2NA 2ENWA 2RDMA 4Z0NA 5K45A 1WUHS 1QIFA 4HN9A 2ADPA 3PXDA 3MD0A 3SXUA 3VR2D 1E1CB 1ZMXA 3L0IB 3WHPA 1CP3A 3BRQA 1RPAA 5DCYA 3CPSA 3K5HA 3LP6A 4NC9A 3LYLA 1A71A 4FR2A 2HMUA 2YXEA 1NBIA 2Q8QA 4MRNA 4CIXA 5CUQA 1YOVB 5KNBA 2B9VA 3L06A 3UAVA 4D82A 1DFGA 3AUYA 2E7ZA 2ZAGA 5KAIZ 2P5SA 4XE5A 3Q9UA 4LE0A 1MIOA 1Q0LA 1SRYA 1K98A 3CRCA 1TKRA 1SVMA 4REMA 4H1VA 4ILEA 3IBFA 4BVGA 2W48A 1SVKA 2VJDA 5ALJA 5EGSA 3CLKA 5JC1A 5FKJA 5KINB 1YIJV 2AVNA 1U96A 3WLKX 1QDLB 1S8FA 1BEEA 2H54A 5F9HA 3GDFA 2H1OA 3ZHZA 4YUAA 4BTLA 5TDHA 4HWRA 2XQGA 5LP1A 3C97A 4Q1DA 3LP8A 1F17A 2Q9LA 3I64A 3IT2A 2O9JA 4LC0A 1J0BA 3PC8C 3T1HB 1SXQA 1EM8A 1Q0HA 4CC5A 3QJGA 2IFTA 3SAJA 3F7TA 4QD3A 5EMLA 1JR6A 4B4OA 4JN6B 3V7WA 1O95A 3BWBA 3E1UA 3H2HA 2IUFA 1S3FA 1M2OA 4N7JA 3LPNA 2OTCA 3EF0A 1X9GA 3QBEA 1NSTA 4IMPA 2CF5A 5DJ5A 3GDHA 4XIFA 2WK1A 4R2IA 3MJCA 2ZXWC 1P1HA 2D5BA 1OHHA 4EA7A 3JWEA 1Y9ZA 2IYOA 4CF3A 3WLLA 5HYVA 4O3MA 2C2MA 3DFMA 1XN1A 3GCDA 1U5CA 1SD2A 3D0KA 3DCNA 4KWTA 5EWLA 1AZSC 1WR8A 1WNTA 2GZHA 2IDZA 4O8YB 3T12A 4BBPA 1Y1PA 4IQ0A 5FNVB 3QGMA 4MW8A 1JR3D 2HTEA 1MKYA 1DAMA 5B4TA 3BDAA 2ODNA 3FB5C 1LVUA 1ZRNA 3WNVA 2PL3A 2VP2A 4IJQA 3C3PA 5B66Z 3CKMA 3VHQA 4OIFA 3STWA 2X0LA 4O2AB 4E1BA 2O2XA 1S8AA 3PEEA 1C81A 1GFIA 5IM4F 5I45A 2PTGA 4QUHA 4EYKA 1GQYA 1WXIA 4MS4A 3E5RA 3KTDA 2EJWA 4PGFA 2GWHA 4AG3A 3OMLA 4Y0AA 3MMXA 3FFQA 2VDQB 1QYWA 1DTEA 2MYPA 5JCOA 1M2WA 1DS6A 1F2DA 4NL4H 3ZDDA 2P2ZA 2DBVO 2O0LA 2YW2A 4P9NA 2X0FA 3UMYA 4HLUA 2JS5A 3NGLA 4R3NA 4IHAA 3WFJA 2BHSA 1GT91 3UICA 3EGIA 3TW0A 3HVJA 4IDDA 4JI3B 1XDZA 1JDBC 3CF6R 1SVIA 3P2EA 2NVWA 2V7XA 4FR0A 4L51A 3IJEB 1AP5A 1ZI6A 5A5VA 1VA5A 1XF9A 1G1AA 2BFNA 1VMIA 5DTEA 4K9QA 5AVTA 2AUMA 1B3RA 4QBIA 5DK4A 3QKRB 5CDSA 4H16A 3ZUPA 2FWPA 5IARA 5C31A 4CCYA 1U6JA 2NSHA 1CJCA 4GT1A 1V95A 3DTVB 5F35A 4LF7B 4QEDA 1RAHA 2BDUA 4ZMBA 5C5IA 1I9CA 1YACA 3D6JA 3WGTA 3ASNC 3IPYA 3QKTA 1VI6A 4I0XB 1VIAA 5AXDA 5AJHA 3O8BA 3ZGLA 3KJGA 3AJ9A 1I30A 2AR0A 4DLZA 4MHTA 3DXRA 5BRNA 1KE1A 5JG7A 3DMOA 3F47A 3OX3A 5BURA 3TEJA 3SHWA 3M6MD 4KNWA 2W37A 3TZQA 3THWA 3BRCA 1GRQA 2OZPA 2Y6UA 3ENQA 1DC8A 1ZZEA 5FD8A 2BGMA 3CP1A 1Q3TA 2G28A 4FZ1A 3OEHD 5G4LA 5SZJA 2GI4A 3BJRA 4MSUA 3VAZA 5DCUA 2GZDA 3CCVV 1MQ8B 3KLOA 1Q6YA 3OC6A 3W06A 3K6RA 4QTTB 3UJDA 1E2LA 1WJZA 1J97A 2OO5C 4KXFB 3E9EA 1V3UA 3X1YA 4WESB 1QP4A 1XDDA 4PLHA 1HE1C 2I5PO 1I2DA 1I0HA 2WM9B 4BRZA 2XODA 2JIZA 4U8GA 5H8WA 1JVSA 1LC3A 3VR0A 1C41A 1RYFA 3ZXYA 2PJDA 1WPGA 1N0VC 4OHFA 3RGWS 4YYEA 3MWEA 4BEWA 3V4FA 4NB5A 4G0YA 3ZWNA 1W4AA 1SUEA 1MQAA 2AG6A 1TUEA 4Q9NA 4O4IA 2JFOA 1R0WA 1QANA 3L04A 5KOJA 3HC7A 2AFIB 4K6FA 3H1LH 2PZKA 1OCRC 4NU0A 2PXHA 4Z7OB 3DO5A 3KR2A 2PXAA 2CNWD 2XIJA 2BOCC 3CINA 3KDAA 2YZ2A 1LPOA 3OX1A 4D44A 1HDGO 4HYQA 2GUGA 1ENYA 2KBFA 3GGDA 4ZCSA 2P90A 4RSMA 5H59A 2YDXA 4RABA 1B8VA 1PWHA 4DJAA 4JZGA 3NDRA 2RFLA 4M1WA 3ZCUA 2AX4A 3BMOB 2MWMA 4JT2A 3NNSA 2QTGA 4WACA 3C3BA 3GF4A 2JI4A 2NO4A 1R7RA 4C05A 2H3HA 4NFYA 1C1DB 1HYHA 5K8CA 3IVMA 1AHIA 3OU2A 4UVHA 2IELA 3LBYA 4UMFA 4BE9A 2Q3CA 1XB2A 2Y0CA 3K9FC 1YL7A 4KBYA 1T2VA 5DDIP 5IDWA 2Y1GA 1CULC 3BPZA 1DDGA 2NXEA 4HRYA 1OX4A 3FUUA 1WB5A 2HK9A 1CRQA 3SS7X 4DV1B 5A1TA 2JC3A 5I4CA 1ZD5A 4BV9A 4KE8A 5L9AA 1EVEA 3DLHA 1DOZA 4RIHA 4PZ9A 2C4TA 3EEYA 3ICXA 3MIZA 4PA7A 1JQDA 5FV4A 2HXVA 3GRRA 2QVZX 1NKVA 3OFND 3N2YA 4B3JA 2QDOA 5DN9A 2ZSBA 4UBMA 5JY1A 1QG4A 2VT3A 3ZRWB 3F8SA 3WGLA 2DH5A 2GNAA 1LUWA 2C07A 3NNDA 4P3XA 3V1TC 5B1BC 2XTMA 3AV3A 2QM3A 1KSGA 1E4VA 4UVEA 1TM1E 1EK5A 1XD8A 3U44A 3VR6D 5HZKA 3SDSA 2SECE 5F3WB 3VDRA 1WDMA 4F11A 4R1QA 1OBFO 5T4BA 4II7A 3AUJB 3Q72A 2DKNA 2GD6A 3JVIA 3GJ3A 1YBVA 2ATIA 1KAOA 3C7KA 4J41A 4LVCA 4U4AA 5EIWA 1OGJA 1QQ5A 1YA8A 1TYAE 1YTFD 2JJ1A 3N8NA 3VNRA 5EJEA 3K58A 2OWOA 2ZJYA 4YJ3A 4R50A 2GLXA 3PRHA 5K6TA 4TQDA 3ZK9A 4KVZA 2PUDA 1H5UA 2A1IA 1QYIA 2RHLA 4XIIA 5HKKD 4MTFA 5GGXA 4B1FA 3TR0A 3PI6A 3FXAA 3ELBA 3SR3A 2FWNA 2P67A 2CNBA 3G2OA 5AHXA 4MPDA 3GT0A 3F4KA 2UZ3A 4BASA 1Z62A 3W4JA 1LH0A 2IEIA 2YXBA 2YNMA 4RBNA 1COWD 3ODPA 3S2IA 4R0VA 1NOIA 2O2YA 2J45A 3UB3A 3A11A 3QVXA 1XWWA 4PQTA 4GI3A 3KR1A 2XTJA 4E5KA 4QJIA 2ZKLA 2AEFA 3HCCA 4MP8A 1UC8A 4BJ6A 7GPBA 4X8MA 3ORQA 3CR7A 4EG1A 1C3EA 3OZBA 2C1XA 3WOVA 3ILSA 2L19A 1XJCA 3T5GA 3ROPA 1WD5A 2FFJA 2CY0A 2NPFA 1XQVA 4MR8A 1XLVA 1XQYA 5A03A 3T8YA 2QWOB 4QKQA 1P1CA 2VJYA 4BQRA 1W5BA 2HRDA 3JCZA 4TV8F 4MQLA 3PU6A 1JFFA 4BMPB 1ISSA 1CUGA 4IR7A 4WXYB 1Q1NA 1OZFA 3SX4A 4FIPC 4JB3A 1NL3A 2I9KA 5IYDO 1XMIA 2X13A 1KAGA 5JVDF 4PM4A 4DIDA 2R97A 2OCGA 1V7PC 1DK1A 3B9PA 5YASA 3E8HA 4OXRA 4MK4A 2Z2ZA 3WSWA 5DYYA 3OFVA 2IYXA 3UCSC 2ZU0C 3RTEA 1R5XA 4NARA 4MV5A 2Q7XA 1SKQA 2FF5A 4M0FA 1TI7A 4GEGA 1DSSG 3LL7A 2J5QA 2Y68A 3AERB 4PG8A 1J22A 2G17A 2IW3A 1UEJA 2XZOA 4WN9B 3NYQA 4JYPA 1J5XA 3WRYC 4EHAA 1A2OA 1SVNA 2O57A 1SIBE 3UAOA 5IBRA 3HYRA 5KNBH 2NU7A 3KFXA 5IJ0A 2H0RA 2VR1A 3L8HA 3OLYA 3BAFA 2QWXA 4PYMA 5K8LA 3OUTA 1PYOA 2QJFA 3I2GA 1C9JA 1ZCFA 1WN5A 3H9GA 2QTBA 4KRGA 5F4ZA 2JLXA 2GZSA 2DLCX 2O3KA 3B2EE 3I5UA 1RU3A 4BPRA 4YRIA 1KFJB 1YAJA 4R51A 1N1EA 2V6IA 5GP1A 3TQOA 2P5OA 1D3AA 3R3YA 3V7NA 3UO2A 2OBFA 3AOEA 4JT9A 4I8DA 1EUYA 4Z4EA 2DB3A 4F1JA 2UV8A 5HGJA 2VWQA 2W58A 5FQNA 1P2GA 3S3TA 3OZ7A 2XNSA 3HZZA 4P7BA 4NJEA 1W4BA 4FC6A 4TV9A 3B1KA 1A7UA 1TTPB 2VH5R 3OIGA 5E6UB 3TBFA 3JD4A 4AKHA 1PR9A 4G4SP 3KJHA 1WXEA 2IHZA 3AG3C 1LK0A 2HJHA 3E7WA 3EWNA 3TTYA 2OORC 4PVCA 5KNDH 3EMDA 1EEXB 3RKSA 3VV3A 1HFJA 4R69A 1NW7A 3NJ8A 4DR5O 1T9DA 4NOJA 2SBTA 1A8SA 4CKEB 1I5EA 3NRBA 2A1TR 4F4UA 1NR7A 4TL6A 4PNHA 4J75A 5U1PA 1R4NA 4R81A 2NSDA 3U37A 1MNGA 3KKPA 5E0OA 2N75A 1VQ9V 4K9SA 4KMOA 1QIGA 1H8EG 1MAAA 4PZUA 4N40A 3FKJA 2YFYA 1CRZA 4FNMA 3H97A 2ZI3A 2H2IA 2OECA 2OIEA 3WK4A 1ULZA 4EEZA 4HWGA 3RAJA 3NBQA 1T26A 4HH3C 4AQYO 3ZI0A 1P4AA 5IEJA 5KWSA 1QGOA 1Y42X 4G6ZA 1JF8A 3UCXA 3WZLA 1Q5PA 4EG8A 3TECE 4OYLA 1UPCA 3QTCA 2YUIA 1GKKA 2PI4A 1ODTC 2Q2WA 4Z2YA 2Z0MA 4G5RA 5HFNA 3ZMUA 4ZRMA 2DSTA 5BQXA 4TXNA 3PT9A 2M32A 3VKVA 2YRFA 4ZU3A 4YY3O 2Q4BA 4D42A 4AWAA 2BBSA 3LBFA 1TVCA 2OUKA 1SQXH 2OT3B 4IX9A 3GRYA 3SQDA 4K05A 1TCBA 2IXBA 4BNGA 4RL6A 1SHUX 3PNSA 3DBIA 4ZT3A 1RWXA 2R6CA 5BN5B 1U99A 4WBSA 1XTIA 2A9VA 4DMHA 2W2OA 3FF1A 1UUFA 3TCNA 5F2KA 3HQ4O 3AVTA 1IX9A 3RSSA 3W9SA 5LOVF 1RM4A 3KU4A 4LZWA 4BCBA 4TLMB 3K79A 1I7DA 2BR3A 1XT6A 3SDLA 1FNDA 4QGAA 5T67A 2Y1DA 1MG0A 4G5XA 1E6CA 3QBTA 4C4OA 2XB9A 3MSCA 3PGA1 2J0EA 3RAFC 3TNJA 1XMOO 1CS4C 4GP9A 1NVPB 4DZRA 4F1WA 2G9RA 4PAQA 1R0BA 3RRZA 5DRTA 4OREX 2R9IA 3J81k 5ES3A 2VPQA 1OGIA 1N2SA 3E8FA 1X8JA 2VTEA 4HDQB 5DM60 3C0KA 5JSKA 1U9IC 4LF6O 2WHRA 4GLLA 2GMWA 4ID3A 2V98A 1RQGA 4LG1A 4BDTA 1KJNA 2RKWA 4Q1FA 1VL2A 3BVPA 1IMOA 3G79A 1NT2B 1UT8A 3SBDA 1KBHA 2IXTA 3KKEA 1DJQA 5IN4A 5FA5A 1FFXB 1G2OA 4EA6A 4O8CA 4EGCB 4HB0A 3QF4B 4DMGA 4NMWA 1Z17A 1RM1B 1Y6GA 4MPTA 2IKSA 3UOAB 2NVBA 2RGUA 1H2MA 4EABA 3B20A 4UQLA 3LX5A 5HFAA 3TPZA 1GCOA 3S2SA 1SHJA 4MW1A 1CZNA 4C06A 1TK3A 2H9AA 4BVBA 1WZIA 4UEWA 1NMQA 1UDCA 3VNUA 1AO3A 2FZWA 5HCIA 1SIOA 2M1ZA 1H1DA 4Q01A 2IYYA 2R7AA 2UXNA 4NMMA 2HX1A 3L7DA 1JA8A 1N2CB 2ZBFA 1MOSA 4E13A 3JWJA 5A05A 4R3UC 5AP9A 3SC3A 1KEPA 3VU8A 1EXWA 5K0LA 2BEJA 5JTTA 4CMAA 1PVOA 1F1JA 1VLZA 4CQLA 3PPWA 4LJKA 4HNGA 1ZCJA 5COQA 1TA4A 1RZ3A 1C29B 2ZE7A 3NP7A 3IGFA 1THGA 1LBQA 5DCWA 4BMYA 5C35A 4YCSA 1OT5A 2E4WA 4RTSA 4R8VA 1KU9A 1XXLA 3ZJ4A 1L3BA 3DE2X 3B2EA 1QZTA 1XEFA 3ZXIA 4QIWF 1EDZA 2XOXA 2A5JA 2RGDA 3GUYA 2EJBA 1MEEA 4MUBA 1YD7A 2C95A 4MVRA 4V3BA 3KBOA 2SHKA 2ZNRA 4HH0A 3FNHA 1LDGA 1Z9BA 1Z6ZA 2VCEA 3UWMA 3WHLA 3FMGA 4P4GA 5DOZA 3NHPA 2GNPA 4R7CA 3DEFA 2YY6A 3OZSA 4CN9A 4IGFA 3HA2A 2DN9A 3F97A 5LP6B 4ZD4A 2HB6A 2JGNA 1NUUA 3F90A 1N2BA 2H0QA 2NTVA 4JC8A 1GPYA 3LX4A 1KY2A 3U0VA 3L92A 1NMYA 4X00A 1QGUB 4NVRA 4RCVA 1IBRA 1ZUNB 1N25A 1F7YA 4GYWA 3VXKA 4F56A 2ZUFA 4A5SA 1R9MA 1RBZA 1VQ1A 3QFFA 1TGOA 1S4QA 3VO8A 1P8AA 1ZGZA 4YMGA 4BNMA 4I36A 4Q93A 3HGQA 1X4TA 2OAEA 2KM1A 5DX1A 4FFSA 4WCEV 3BHMA 2D1RA 2Q68A 1F2TB 4EJFA 4BO9A 5JCJD 3HJNA 4DZTA 2AJDA 3PLRA 1XXHE 1X14A 2A58A 1X1SA 4PNZA 1ZVJA 1YIDA 1L4MA 3PICA 3DWIA 3AVXA 3LQ1A 3TE6A 4CR7A 2VDWA 1CUJA 3PUXA 4DC9A 4L6IA 4CBCA 4FK8A 8ATCA 4K26A 4PWYA 1KERA 1OI0A 3RVJA 2XSZD 1KPIA 3DHEA 1VCIA 4ZYYA 4BR6A 2V3WA 5I7VA 1VF5B 4Z7QB 2HNBA 4LD2A 3H83A 3E9MA 2PBFA 1NQ5A 5JQGB 4ZT5A 5LUAA 1L4LA 2EDCA 4A26A 4D81A 3M2TA 4RLFA 5JARA 2CTRA 4J7XA 4CL2A 2WHXA 1GO2A 3R5JA 2Q4PA 5EZSA 5TPZA 4ZO6A 1XMVA 3GXOA 4DRXA 1I4TD 3O47A 1IOZA 3MWKA 3U3JA 1PW7A 3MINB 3JWHA 4TLAA 3KXKA 3E27A 4R68A 4OOFA 3ROXA 1L2TA 4OHVA 3TRFA 1K3FA 4TT8A 3VKFA 4CWAA 1EUCB 2VL7A 3TG2A 3ZCQA 4D9IA 1FBTA 2OC4A 3K73O 4JLUA 1NIPA 4FFPA 1RRGA 3ADKA 3T0GA 4HX5A 2WSLA 3H3XA 4PZLA 3BZUA 2D5IA 1RYEA 3F2IA 4LMAA 3MB5A 2IIQA 1SBTA 2CFSA 2ZFUA 1XTZA 2WMNB 2QORA 5CM9C 3QG5A 2VDOB 3S8YA 1NVBA 2BBOA 1B6SA 1HYEA 1ZN8A 3TLGA 4BCDA 1CUHA 3DMTC 1W9MA 2G1PA 1QLHA 3LSQA 4J0HA 1PSZA 4X54A 1SQVH 4IOJA 3RU3A 2REXB 4BHTA 3KZ1E 3LZCA 2YXPX 3HYTA 4ZFRA 4FYWA 3VJMA 1TTTA 3CRZA 3IRVA 2GARA 1SXIA 1PKXA 1GWNA 3KYDB 4WOBA 5C46F 1BQEA 4O6VA 4KE7A 4X64B 4UATA 2XAUA 4ZI7B 2WUEA 1AE1A 4YECA 4AO8A 2SNIE 1NRWA 3RTAA 2H3EA 2WWHA 3HDGA 4LSGA 1ZGBA 5DLYA 1X9HA 1T4BA 4J7CA 2WAOA 3VNBA 4EO7A 2YZKA 3IT0A 4JP5A 4U7HA 2YWFA 3T4UA 4X62B 3ZU5A 4H6XA 1FYDA 3VYRB 5DCLA 4B2PA 4PDVA 3WQRA 3I92A 2ESRA 2XMSA 4WSOA 1EDEA 2X5KO 3K3WA 2XUHA 3GJRA 4AECA 1GYQA 5EUBA 4CUJA 1WCV1 3ESXA 2VFAA 1G21E 1PJ4A 1SVLA 4HDSA 3ONDA 3GU3A 1W19A 4Z4IA 1L0LH 1I7LA 3EPLA 4M7PA 2QJTA 1ZS9A 2HF9A 3LY5A 3KJFA 1ZHFA 4C30A 2XMBA 2R44A 4M60A 3CXRA 1Z4LA 4ARIA 1B26A 1RHUA 3TW8B 3IODA 2QYHA 5JH7F 3WKAA 3WWZA 1IFXA 5EKUA 5EMJA 2C99A 1J8FA 1O54A 3OQNA 1O0BA 1Y74B 1BVYF 4GSKA 1K27A 1NRJB 1TGYA 4Z3OA 1N78A 1Y7HA 4BMSA 1JA1A 2J9XB 1PWZA 4GMGA 2B6HA 3II6X 1QB7A 1ZLYA 1DIBA 3QENA 2WSSG 2IOQA 2O3RA 3ETJA 4TL7A 5CMUA 5JNUA 1B6GA 5JALA 4JSYA 1RM3A 3V4ZA 2XUZA 1VK9A 4UNRA 3NC1C 3PNPA 4JJFA 3CN7A 3BRWA 3EVFA 1YHQV 1U0EA 4DEXA 1BD4A 1ESEA 1RPOA 1T8SA 3OP1A 1PLLA 5G0WA 3KAJA 2IX3A 2PS0A 5DXAA 3ABQB 4H4DA 3KQLA 4KXQA 3RVKA 5TJ9A 2OP1A 4B3IA 1TLFA 3MIIA 4KGZA 4FW8A 5TJHA 4MV3A 3PLAE 1YTUA 3V2GA 3PQ8A 5KSOA 1QFYA 1FJGO 2IE0A 1WVMA 1Q14A 4L4RA 3BA9A 3OPXA 4C0WA 3L1VA 5H4GA 3EEQA 5IKEA 1FTGA 4YT4A 5A4DA 3JAWA 3EWAA 2HSEA 2RPZA 4GXRA 4XM0A 3K9LA 3I62A 1BW9B 1VBMA 3AF2A 1GYPA 2PTHA 3FWHA 1XXHA 2GZ3A 4L87A 5IT5A 3B7GA 4ZQFA 3BTSA 1RLJA 3NKVA 4TTJA 4H1WA 1CZRA 2UZAA 1HORA 5L3QB 3A6KA 3ZY6A 1IIBA 4WEOA 2QR5A 1QYVA 3GLIE 4OB8A 1J07A 1QVWA 4DMUB 3QIVA 1DJMA 1Z3IX 3BWVA 4U9IS 2P69A 1ZL0A 3QA3E 3EZXA 2QI9F 4X84A 3W9UA 1T8RA 1U1EA 3GDOA 2PAAA 3GAAA 5FTNA 4I43B 3M8AA 3T5AA 3UQZA 2Z2XA 4XQCA 2A9OA 5LQCA 3CSXA 5FJJA 2WI8A 1ODIA 3CU5A 3EGDB 1H3EA 3HHEA 1HO3A 2QTTA 1PQYA 3G9ZA 3EXEB 1KOGA 4TSFA 3RVBA 4HK4A 3R5TA 5KQGA 3ZCTA 1NDHA 4ZGWA 3BULA 3ABLB 1VYTA 5FAKA 4P3YA 2XQIA 2LNDA 1WDWB 1FC0A 1TO2E 3IMKA 1ZEMA 1KFBB 4GL4A 3HBMA 4BO2A 4B6OA 2DHEA 2WFLB 1FFTB 4TS1A 3NXSA 1WOYA 1PFYA 4UHKA 4PQYA 2IPXA 4QPKA 1OLOA 2I3ZA 3D4NA 4BP9A 2OD2A 2YR0A 1HKUA 1E1LA 5KQLA 4JOQA 4LMPA 3R23A 3BH1A 4K8XA 3S6JA 2QP4A 1TJNA 3OQOA 3UFXB 1J8MF 3X1DA 4JI7O 4BIUA 3PBKA 2GBLA 2MT9A 2ZIEA 4U7TB 1C3OA 1AX9A 3I1FA 2HA6A 4IUYA 5TX7A 3KPWA 3ES9A 3SPIA 4PIVA 5AKIA 1CTQA 1G9XA 4I99A 5JW6A 2HDOA 4LVNA 3ZN1A 2V7QD 1OYOA 3L0PA 4JNCA 4M8IA 2EINC 1NR5A 3GJZA 2IOFA 3RM3A 1JJ7A 3CTPA 1TKCA 2Z6UA 2C1EA 4ZKEA 4E21A 3GVCA 1XWIA 1U28C 2R8PA 3Q7PA 1SA0A 2C9ZA 1MAHA 1Y7TA 4D74A 1EZZA 1E2NA 1VIVA 3A58B 1FLAA 3FNQA 3N2GA 2WLIA 2ZG6A 4LWPA 2QUKA 5DTQA 5EKTA 1Q17A 1G21A 4UBIA 5KTNA 4DDVA 2C9YA 1Z25A 4PNEA 4MT8A 1JUDA 1YKFA 1XN4A 1QHSA 4N47A 3PTZA 4EYOA 3HXLA 1V47A 2UZIR 3EXIB 2Q0SA 4L8JA 3O4VA 1F0YA 3RC2A 1F7UA 1T9AA 1A8QA 1M7BA 1Y3CE 4J0FA 4KX3A 1N9GB 3AEIA 5FFMA 5AVYA 1N33B 5EPUA 1MU0A 3HH8A 4QNRA 1US8A 1GTL1 5C8YA 4GWGA 4DARA 5JDCC 1OTHA 1G3QA 4F38A 3C39A 3DLCA 2X14A 3H4IA 4IOKA 1M4UA 4KPUA 4L8FA 4POAA 4QJFB 2PSJA 4ROTA 3JQGB 4GOOD 2Y0EA 4WASA 2GJ4A 1Y6RA 5GZ1A 1M2JA 4NDNE 4G37A 3OZCA 2V7EA 2PJUA 3OCQA 1Y1SA 2AEMA 2HUNA 4TXLA 1UMBA 2ZUWA 2AFHB 2MK3A 3JASA 1F51E 3A31A 2IPOA 3LAWA 2DT5A 5BV7A 3R7DA 2PX2A 1WCIB 5JBNA 2R0QC 2GV9A 1M1YE 4L85A 3ZCPA 4YX9A 2RGBA 4W9MC 5EZYA 2VDUE 4EVIA 4R1NA 4JVNA 3KXIA 4IYIA 3LUGA 5HBRA 1CUEA 2OHJA 2QUZA 2UUOA 1YCFA 1QP0A 1M6NA 3DKKA 2ZSUA 3SYTA 4ZV7A 4PFJA 3B12A 3I2FA 1MBZA 1RQ2A 2FSPA 3FUCA 1M6HA 2ZDQA 2IXEA 1SKVA 1J0DA 1W48A 4JKOA 3HB7A 1NHGA 3ZBTA 1C0KA 3DE0X 3SSNA 3O1JC 4JI0B 3ND6A 2NADA 2EBHX 3O2QB 4RENA 1DBSA 2F55A 4FI3F 3RYCB 2DSNA 4E5YA 4MUKA 2X4GA 3W7SA 1ICEA 4GR5A 3MOIA 4IZIA 1A88A 4XYLA 3O93A 3WKEA 4N54A 3JSXA 1U0RA 4ZXFA 3OEWA 2JIBA 4LHXA 5J9FA 3LY8A 4G9BA 2F8MA 2XBMA 4YRRA 4L2IA 3A05A 1LV7A 1OOEA 2Y1OA 1CY0A 2AR7A 2D59A 3WG7C 4EDHA 4G26A 4Q4DA 4KKXB 3VI4B 4KRYA 2ZIMA 3P9KA 2XYRA 3HCWA 5E9JA 3DMDA 2YS8A 3M1IA 2D4HA 2ALJA 3TPFA 4CC6A 1K1EA 3V3TA 5AICA 4IH4A 4ZYUA 4PZPA 3OUUA 1PDVA 3HDVA 3B77A 3B8FA 4B8YA 2MINB 1KL7A 3CLSC 4L9AA 4ZO7A 1IXMA 4PX2A 3CCMV 4PFQA 3T95A 2NO6A 5ESDA 2AE2A 4CLHA 3MHPA 4LOHA 2A5LA 3WBBA 4A92A 4GL2A 3PPVA 2OXTA 3K1YA 3MYRA 1EE1A 3EODA 4JA2A 2NUAA 4HGNA 4LJAA 4TTPA 3VZPA 3DBRA 1P9LA 3K5PA 2FHPA 3RWBA 3KTAB 2KKWA 1F0NA 4JI5O 4QUJA 3LUJA 4YMIA 4WAUA 5EEGA 3HBJA 3SQXA 4B8WA 2W2NA 2QE7D 3V1LA 4B83A 1NV9A 1GAXA 1IAQA 3BFJA 4R8KA 4R7GA 3TNFA 1H2SB 1LX6A 1F2UB 2E1RA 4RVDA 3BX1A 4C29A 3RTGA 3QM1A 3KXDA 2FMLA 1Z45A 1SNYA 1TF5A 6PFKA 5BXQC 5I7RA 4KLRA 1E0DA 4U2CA 1ZOSA 5A9TA 3H6HA 2XAJA 4CUZA 2HSJA 4AX4A 2RG1A 3JVUA 4B44A 5TEWA 1YA6A 1E1NA 4CEIB 4TQ9A 5K1XA 4YEDA 1ISGA 4OK6A 5SV2A 4MW7A 1ISFA 3ZWPA 3LUDA 1QZ3A 3W5VA 5D7BA 2CNLA 4MMXB 2F67A 3NUGA 3CS5A 1U94A 2GCIA 2J59A 3WDMA 4KXVA 3F9RA 2Q46A 5EXDA 5TE9A 2YHUA 4YALA 1QO0D 2GSWA 5EJFA 1E79G 5G0VA 3A1FA 3RAEC 1OFGA 3DGFC 1NDQA 4EMTA 3GDGA 4RKEA 4N7RA 5T64A 1XHFA 3LV8A 3GJSA 2CXHA 3ELYA 3S1AA 1PJ2A 2HG5C 4MROA 4HQ6A 4JGIA 4KW7A 4RETA 3FTEA 2O0HA 4P3KA 4ZQHA 3C8MA 3UAYA 3K0FB 4A6PA 4CLEA 2EKBA 2O6HA 3GGPA 4EEQA 4BZQA 4ZEXA 2DFKB 4OO3A 1K7DA 1TB4A 3BBPA 3IEXA 4WZ6A 3Q12A 4GWLA 3GN2A 1T13A 3PWKA 1GVHA 3ISVA 4K2AA 4FD2A 2AC7A 4AJOA 2PUAA 1II0A 3KEGA 1R6AA 5C5CA 5JCPA 1J0XO 2YQ4A 4ZK2A 2BH9A 2EX0A 1R73A 3FPSA 1NH2B 3G82C 2IOFK 2I66A 1AXEA 4XJTA 3V4PB 3TUIC 2WJIA 3O74A 4WJZA 4ZU6X 2O8CB 2H5EA 2G76A 1YS2X 3IJPA 4FW9A 3E05A 1L5NA 1ZLXA 4IDAA 1R6UA 5DN6G 2PUGA 1YS7A 1Z0SA 2Z43A 2ZUSA 3IAEA 4EFBA 4AMUA 3E3OA 2WF7A 4MGIR 1P4JA 3DE6X 3DPSA 4QYTA 4FDUA 4Y0VA 4BU0A 2BTEA 5JV5A 2IDMA 1WMAA 4ZVOA 4RKWA 1XDCA 3T0IA 1OLUA 3K59A 1EJ6A 4UJ5A 1F51A 1IRIA 2BUCA 4UAVA 2FDRA 3SLKA 3ZDXB 1IK6A 3WRWA 4L6CA 4F8YA 3V6MA 1DCTA 2ZS7A 4GVLA 1SRQA 1KY3A 2I4MA 2II6A 1M1YA 5LLDA 3NLLA 1P9WA 2ACWA 3L49A 3TNYA 5IJXA 1M5RA 3R3XA 3JAMN 4QU5A 5BQOA 1T5OA 4DHEA 1E9SA 1CEYA 4NCJA 3BFVA 5E7QA 2Q3BA 1LEHA 1E1RD 2YWHA 5C2OA 4WH0A 4LFBO 5JCZA 2LJ2A 1JLLB 1OXKB 3UG6A 5CB8A 1UPBA 1W9HA 4TMVA 4GQIA 4G09A 4ES6A 4KDRA 1MV5A 3R0ZA 4FYXA 2F1RA 1C4XA 5LMNO 4BFUA 3UT5B 2EZ8A 3U3DA 1FFGA 4C08A 4X3CA 2F3PA 3L93A 2GJSA 5CHEA 5K3OA 2R8ZA 3JQBC 4B09A 4F3YA 3SJZA 1GZHB 5LIRA 2DU8A 3KR0A 2FP4A 1TC2A 1RAIA 4N6NA 2WSBA 3ICPA 1T25A 2GUWA 1DB3A 1M2VB 3A6EA 1ICIA 1K6IA 3VISA 5C4GB 2LGQA 2XUAA 5LGTA 1C4OA 2X4DA 4JB2A 1ZBQA 1C30B 4QJ3A 1KMHA 1OQAA 1J5EO 5FOXA 4AO7A 3GCZA 1VQPV 1F06A 1QKKA 3LPMA 3QBVA 4Z1MD 3GL9A 1N36O 1WMEA 4J2TA 4UB8Z 2W2KA 2IZ1A 1E6UA 2O7QA 2XT6A 2FLVA 1VLVA 3SJBA 2VA9A 1U4SA 3ABMB 5C2JB 1Y1RA 1IXYA 1V7ZA 4B7KA 2O59A 4LCBA 1L4FA 1NG1A 2JGUA 5IKMA 4XUGB 3AEZA 3A0UA 3HJCA 3PQ3A 2VO1A 2G6BA 2X8JB 2ZSJA 4EYQA 3OBBA 4BECA 1VSUA 3UHFA 2P1ZA 4J0GA 4QX6A 2EBFX 4EH1A 1IJEA 5FLXA 3AYZB 4UV8A 4XTCS 4DABA 2WG2A 2ZW9A 3KUCA 4IIDA 1E1MA 2G09A 2DW4A 3SI7A 2B8WA 2PX4A 3C4JA 4GBJA 4U2FA 4PCAA 4LBEC 4FFBA 5KPDA 4YJGB 4F85A 3RANA 2H29A 4BUZA 1JT2A 3QY0A 3NIFB 3SPJA 4RPGA 5JSZB 3L0ZA 5TRTA 1HDEA 2JLZA 5SY6A 2VJOA 1W2BU 3GMSA 4KHZA 3HUDA 4GXNA 4RFLA 2IPNA 4UEQA 3R3VA 3COYA 4L4UA 5MHTA 1V3QE 2SCUA 2R9AA 4JBXA 4MGYR 4TMFA 3K0HA 4JCOA 4XIJA 4U0KA 3RYTC 5A5DA 2WF8A 4BL5A 1S0VA 1UBCA 1IEXA 3PGLA 2XIQA 3WIEA 4PGGA 3HCPA 4NYIQ 5BVHB 3A6PC 1QCYA 1D2AA 1I3CA 5DZSA 2FQWA 4PSCA 3E9YA 4XYBA 2R47A 2QSZA 2QA5A 1S2LA 5ERGB 1ZD9A 5IS2A 3B3JA 1AMUA 1HDXA 2BP7A 5FBQB 2Z6VA 3SS9X 2O3JA 4BC1A 3TLKA 2XOKD 1IJFA 4QLBA 1WP9A 3OUSA 4I9WA 3MMPA 1KDVA 3FZNA 3GARA 4P9CA 4WCFA 3IKLA 2XCRB 3X44A 5AI4A 2GO1A 3WR5A 5H1YA 3N0RA 5M7EA 2FSSA 2XD4A 3EZLA 3K16A 4LFAB 1EVYA 5LZ8A 2GBIA 4YIKA 5KYYB 1SXGA 2QTCA 4ENTA 1QE3A 2DUWA 4KL8S 3TR6A 1K8XB 3FZEA 1BA3A 5ECDA 2PK3A 5JYBA 2GCGA 1FSSA 3GEIA 1XROA 3QWHA 3SPXA 4I3FA 3OIVA 3QMMA 3CNEA 1FKAO 3SFVA 3PB3A 1GQFA 4OIMA 3W2FA 1E2HA 2E18A 1BMFG 4HVTA 1LUVA 5U4XA 4DVGA 1J8VA 2WAAA 3L07A 2FUCA 1JL3A 2F43G 5KWVA 3TW4A 1KYVA 3JALA 3O75A 4DNFA 4C4TA 2O2JA 1XRPA 4IDBA 4DUYB 1N6IA 2W6JA 1BXRB 5LLSA 3WA6A 3IT3A 3KR9A 2Z5LA 1RLUA 1Z2OX 2XR1A 4GKJB 3BIOA 3HYSA 5A3JA 2QJOA 4WFFA 1WXDA 3UMSA 1VJ5A 1GDTA 2QNRA 1ZUIA 5JANA 3ETHA 1YBHA 2G1KA 1AQ6A 4H77A 4JASB 1PJBA 3RRNA 3VVMA 2XXBA 3DLBA 1CIVA 1U80A 2AXPA 1GG8A 4OHZA 4R2MA 4BC0A 2JKVA 4HDKA 1EG2A 3LOUA 2SKDA 2X4LA 4M8LA 3EZGA 3KLMX 1XNQB 1TAHA 1DVRA 5HJ2A 4WHMA 1Z6XA 4MQFB 1MABB 1QIKA 2B30A 3A7DA 4L8GA 3BJMA 1N9KA 3ZU4A 5KDLA 5ECWA 2LFRA 4O1HA 5BSKA 3HP1A 3K5OA 3U11A 4MWZA 1X87A 2GEDA 6NULA 4KAJA 2HCJB 3FCCA 1Z8HA 5B57C 3PL1A 4EHLA 2CXRA 1KQPA 1S3SA 4EKDA 2YC2C 4X6UA 2YS7A 4I9HA 2VPYA 3UA4A 5J4VA 5KUKA 1PG5A 3FE2A 3GFGA 1QR2A 3KG2A 3EVCA 2C5BA 4ZYTA 1XOIA 2BV3A 3L9WA 4FOSA 4OL0A 3A0HZ 4B3SO 5LHIA 1YCIA 4LH6A 1JDUA 4QOGA 4I7EA 5B3JC 2X9VA 3WIDA 2R1TA 1MAVA 2F59A 2FJ0A 2Z0AA 4D7AA 3WISA 1RABA 1VZ3A 1Q7TA 4QOEA 4ZVVA 3VX3A 3PFGA 1MQSA 2HBQA 2B20A 4JFAA 2RG7A 3L9DA 4J9YB 1J9EA 2GWRA 2ZETA 4CQMA 4K8RB 1K8ZB 1R5OA 1CDZA 1OCOB 4IEFB 2WRZA 3LQRA 4OFZA 5EA2A 4A8JB 3E22B 1MHTA 3A1NA 4NH0A 3BIWA 221PA 2OXEA 2R7LA 1TRHA 5L4NA 3SLGA 3GNSA 1WN7A 4LW8A 4US1R 1COZA 1ABBA 5FHQA 2DFPA 1Z38A 5FWYA 4LF4B 4OL9A 3DHYA 2C1ZA 3MWDB 5EC1C 2HU7A 2AXTZ 4TTSA 4F2DA 1EN5A 1CCWA 5AQEA 5KNCD 4YRCA 1U7HA 3QVGB 1T8TA 1Y76B 3GJ5A 1RHJA 1SXJD 1OSNA 2TSYB 2LCIA 1U65A 3QE9Y 1H1TA 3UATA 4OQLA 5JRZA 2YUAA 2COKA 5CM8B 2LUOA 2I3BA 4EGSA 1X13A 1EFHA 2XECA 4HNRA 1LWNA 3ZQ4A 3HU1A 1BO6A 1NY5A 1E3SA 3HDHA 1HMYA 4XX0B 2X6BA 4UDYX 2IHBA 1FP7A 4Y1EA 3KSZO 2R00A 3DL2A 2V6FA 4R1OA 4WFKA 4ZVQA 1YC2A 1GPJA 3IE0A 5HTKA 5JD5A 1PN3A 3Q3EA 3T3OA 4C4AA 2BFBA 3T4XA 4F2GA 4JBYA 1T1SA 3VKGA 4W5TA 2A5DA 2UVPB 4A0QA 4PRZA 2WFMA 2N05A 3ROKA 3FM9A 4DY4A 3R0XA 3EXAA 4RE6A 3IIIA 2R1UA 1DXYA 1ZINA 1ZD4A 4QNHB 4AM8A 3KXPA 2XOEA 1PQUA 1L5VA 2QZSA 1XX6A 3V97A 1EFTA 4P93A 1U1FA 4XOIA 2Y2UA 3R65A 3OF2A 3KSBC 4JP3A 5A4AA 3TRDA 5IYZA 1QHIA 3R7WA 5J2UA 1KECA 2Q27A 5JSFA 1T8UA 3IVRA 2Y4NA 3N2ZB 2C5HA 2Z2KA 3IDAA 4RKRA 3D64A 4DSTA 4W7SA 3E9RA 1O6FA 1A1VA 3SYLA 1BDIA 3DV0A 5LHHA 2ZBQA 3H2KA 3LGXA 1XZAA 2VP9A 4IQ4A 3TQHA 4H60A 3DW1X 5DTRA 4YP9A 5EPOA 3P5SA 3P0RA 5CB4A 3HPRA 1SG6A 5LA6F 2I7VA 3HKCA 1Z2CA 3DM5A 1Z83A 3P30A 4C3UA 4OF4A 4TT3D 5DT9A 4UCRA 4FLVA 1JKJB 2K5UA 3ZWBA 4DLYA 3WTCA 3K70D 2ORIA 5HM6A 1RPTA 5T8KA 4M49A 3EY9A 2RHMA 4HQOA 5GTHZ 2R8RA 5A4FS 5E8JA 4WNAB 3U9TA 5FULA 1UKVY 3PD0A 1GG9A 1T6XA 4INJA 3TR5A 3MTBA 5DSTA 1QHHB 4M7WA 5ILOA 3H1TA 2PH7A 3OU6A 2BEWB 3L6EA 3ELUA 1ULAA 3KS9A 5FUVA 2I1LA 3IAUA 4PDRA 4MULA 4B43A 1K7EB 1E0KA 4AWBA 3KKMA 2MYUA 1LPBB 5FBKA 4E4RA 2HV8A 3V8EA 1PNVA 1MDBA 4H35A 5L6MB 1KDTA 5LQNA 3D3EA 2EP5A 3D43A 5J5AA 5LQSA 1QCDA 4IXNA 1S2IA 4PAGA 5T5QA 4L8VA 4Q9LA 1KQ3A 4GEKA 1P9RA 3KYIB 2Q5JA 3MFQA 3B1FA 3K71B 4DLPA 4OKNA 4FNAA 4OPMA 2J3KA 1FPMA 2R4UA 2P5TB 3QLVC 1GG2A 1GZVA 1Q81W 4JFRA 2BGJA 1ZOPA 1E6KA 5K3DA 1EUDB 2JDIA 3FOFC 3OWHA 2UUAO 1YGPA 2X0EA 4CM4A 3BABA 3EQ2A 5LXTB 4CPDA 1NSFA 4ZEOA 3AETA 1DQSA 1F12A 4QARA 2AC2A 4BGIA 3T61A 4LMRA 4I1YA 3QPCA 1QMPA 3HRHA 3LX6A 1TEXA 4QUEA 5F9FA 3D8NA 3EMBA 3SG0A 2VHUA 4D8VA 4MYTA 3GFPA 4YTEA 2BEUA 3S5JA 1Q1BA 2CK3D 1U3GA 3HWX1 4QJ5A 4KIFA 3WYFA 2YV5A 2WKRA 3R41A 3SPGA 3QFRA 3KVVA 1RYMA 3C70A 3BCHA 3F4LA 2QP3A 2HP8A 2HWKA 1CY6A 2NXNA 4YAWA 4RSGA 4RF5A 3ETDA 1QBGA 3LHSA 2EQBA 3PP8A 3TB4A 2BEVB 3FOZA 3C7CB 4O29A 3PLNA 1ZSPA 1H2YA 1QKJA 2EV9A 1D1TA 4R8LA 2UUCB 2FSHA 2JLVA 3FNIA 3PHIA 4P32A 4UVGA 3L8FA 1U7DA 1UBHS 4X85A 5JTUA 4Q7KA 3IDZA 4UE3S 2CD9A 1OUMA 2XDQB 4UXNA 5K20A 3Q7SA 2QPOA 4L5CA 4S1OA 2CSUA 16PKA 2FVXA 2QTLA 3BH6A 1SHTX 3SR2C 4ZTZB 3B1JA 1O2DA 3CR8A 2N46A 3LTNC 2I67A 2Q7GA 4C88A 2OM2A 5J2TF 4O33A 3ASOB 1ZC3A 5AW7A 4QAQA 3K4PA 1SU8A 4KBFA 3AG4B 2R11A 1XP5A 1KO1A 4URZR 5FUMA 4LVUA 2GT1A 1MRZA 3OPQA 3DTYA 1BQZA 1YJWV 4YACA 5JRJA 2NU9B 1P33A 1ECBA 5CEEA 2C9CA 1O97C 3IQIX 1ZK2A 2RI0A 5BYBA 4IBOA 4LY0A 4ZHQB 2YHAA 3RJTA 3RF7A 4GPIB 3DKRA 1EHYA 4MSJA 1FS4A 4EB0A 3L6DA 3DOCA 5L3CA 4X61A 2IZ6A 3VA7A 1W0KG 5BSTA 2AS0A 2BEKA 5A9SA 3K8ZA 4HTAA 1QBKC 3G6BA 3FFTA 3FB4A 2P3LA 4RJKA 3ZNNA 4HDNA 1QIEA 4Z9AA 5JEEA 1GNRA 4NYKA 5DI3B 1JAXA 4IIJA 1T8PA 5DP1A 3GVMA 1TQ4A 1ZNYA 2NNUA 2Q7DA 2RHRA 5AXBA 3DE3X 2QRVA 3SQNA 4EG0A 5A71A 5HRUA 2GN2A 4G1MB 2JHCA 1JHXA 2YDEA 3NWJA 5DVZA 1IM5A 4F3NA 3T7TA 3EY4A 2ZRCA 4MEBA 5E4YA 2H7VA 4AS2A 1B74A 2JLWA 4YWHA 4XCQA 3AI2A 4US2R 2YRXA 4KGXA 4PQEA 4CEHB 2FEWB 1CR0A 2OAGA 3VDQA 1YR2A 3TGPA 2FFQA 4Y3UA 4OUKX 3UK7A 5AI0A 1BAPA 2YOGA 1E5DA 3EA5A 3AC0A 4FFKA 4CM8B 4KP4A 5FPYA 1U97A 3ORYA 4YA6A 2F9FA 2YYAA 3VMMA 2Z5GA 4C7VA 4ESVA 1P17A 2RCVA 1SOVA 2H3OA 3JS5A 4IG9A 4YXWG 1ULBA 2YMPA 4PBRA 3ZTTA 2G9UA 1BKYA 3LC7O 2WTNA 5F64A 1AI6A 5EYPB 4DA7A 5IT4A 4LHWA 5NULA 5T4FA 2B4TO 1B8OA 3MS2A 1YJ9V 3SYNA 3N39C 4B48A 2GK3A 2HR3A 4DREA 2HHHO 4MW3A 3QF7A 4I50F 1XE3A 5K03A 3JU3A 4IIVA 4MIYA 1YASA 2VJKA 1TZJA 1RAEA 3SWWA 3L18A 2R86A 4CH5A 2A78A 2Q6VA 1CIPA 3H1IH 1X74A 1ZOOA 3HKDB 3KO8A 2PZEA 1GFZA 1EX9A 1YJAA 3MT7A 2XKKA 4FPXA 3CUWA 3FPAA 3VDMA 4YJFA 4YO8A 1TA8A 2AXEA 1JR3E 3UANA 4XR4A 4EY7A 1C9KA 3TL3A 3OPNA 1NI4A 2EARA 1LK5A 1G7TA 3FRIA 2ZBDA 2CEKA 2Z3JA 2HJFC 1PE0A 1LB1B 2C2OA 4RC9A 2JCXA 4UKDA 3KZIZ 1KXJA 3I8XA 4LKOA 5B1AB 1GARA 1F4MA 4J11A 5L3SB 5DEDA 1RD4A 4JJKA 3O8CA 4J1TA 2J0SA 1EM1A 2ZCVA 4RTKA 2ZKIA 4IDOA 1MSWD 1V2GA 4L0MA 4E3ZA 1NBMD 4NS1A 4BZPA 2OV2A 3ZS8C 3A1EA 3IQWA 1U02A 2Q4DA 1ZSVA 2JJYA 3H01A 4FDVA 2J8ZA 1CQPA 5GTIZ 5KWIA 2W6IA 1VQNV 1K5PA 2F3UA 3A6HA 4D8TA 4KH0A 1RPJA 1Z4KA 2NLOA 4OLAA 5LBIA 3ANYB 2CB9A 1RM1C 3DZJA 1IY8A 4CW7A 2L69A 4P38A 1Q0PA 1XTJA 2PLNA 4DV7B 2D2EA 3LHDA 3A1SA 1SZXA 3IV9A 4U3JB 1B43A 1GSIA 1YI0A 2H9IA 3H3JA 3UJBA 1KZ6A 3ZWMA 4L4SA 3GBVA 3BFXA 4A8HA 3SNHA 3UTDA 1QFMA 3DFFA 4OTZA 3HKEB 2JFUA 4BFTA 4EF5A 3GWGA 4KQJA 2WPDD 2GN9A 5KX5F 1H2LA 4Z3DA 2ILTA 1Y1KE 4JUBA 3OQVA 2XWBF 4OH1A 1ZDMA 3VO9A 4OUDA 1NPYA 4DQLA 5T7BA 4K46A 4P3PA 3DC6A 2CE2X 2XCOA 5KLVH 4ESOA 3TJZA 3BL6A 1GM7A 3P5BA 4X90A 5C18A 4JVSB 3W5CA 1IN4A 5ALTA 4KIWA 4N1AA 2Y77A 2A1UA 4EOGA 4ZDWA 5IVPA 1MO5A 1UK9A 1KFKB 4FZJA 2XY4A 3Q9SA 1ZAUA 1QOQB 5FBWB 4FM1A 2Q5ZA 3CH6A 1M1ZA 3CH5A 2QKSA 5CURA 1X1AA 4UCSA 3G9UA 2ASVA 3FROA 1UBFA 1I4WA 1G5TA 1YOBA 4B4DA 4QOFA 4KP7A 4A16A 1LQUA 3MAJA 1YXMA 3RTDA 4FWBA 1XGKA 5DLEA 5K4GA 1Q95A 2WJJA 4HUQB 5J47A 3ZUGA 4EJ6A 3WFIA 1ZM9A 1R3IC 1U98A 3NETA 3Q98A 5DYWA 1I01A 3QVUA 2B35A 4OHOA 3QEAZ 4HJRA 5LQMA 4BTEA 1GKLA 2QN2A 3T1OA 4RZ2A 4ZP1A 5JAPA 5FI0B 4M0DA 4K6MA 3E9QA 3BZBA 1Z4JA 5LP6C 2EZUA 3FVQA 1NNLA 3FRHA 2AKYA 1IONA 4CMIB 3Q88A 1VMKA 1SAYA 1MTOA 4AKSA 4HATA 3K5MA 2H7YA 1WAZA 1MPXA 4MRAA 2ZJBA 3Q3CA 4PSVA 1IQ0A 3PIIA 3EQ7A 4KAFA 1XTVA 3PKZA 4DCMA 1QHFA 3RYHA 1Z4MA 2C4MA 5EC8A 3OJ6A 4PG5A 3G9TA 5C7IO 4INOA 2PNFA 3PYXA 1YZGA 1E7YA 3T4DA 1IZ8A 1XCBA 3L1UA 1VHLA 3EIOA 3NGXA 1U0FA 3B3AA 3GOQA 4D7SA 4KNYA 3S3XA 1NW4A 1UP4A 3EK2A 3B3FA 3AP2A 1RBYA 3DXFA 1H4QA 2EHJA 4AG6A 2OHFA 4C0AC 3TZLA 4MPRA 4I5IA 3R3ZA 1QGZA 3LT4A 2AMYA 1UJ6A 5IBPA 2NN3C 1M2NA 4NCXA 3PQFA 2FEMA 2D5NA 4MUNA 3IKMB 4BNDB 1LX7A 1U7UA 3NV7A 3ZHUA 1LBHA 3O5AA 4JI6O 3PC7A 2ISSD 4LZOA 4IO1A 3GPLA 1T4DA 1FLVA 2QU7A 3GR6A 3PE3A 3IAS1 2CLSA 1IN5A 2E85A 3SVTA 1R3KC 1LPNA 1XTUA 2GAOA 3L7KA 3LA8A 3TRJA 3E8GA 1R9JA 4WADA 1QG2A 2N1BA 3VPHA 1PQWA 3TXYA 3P9YA 5F5XA 1WUYA 4QVGA 2CGOA 3O8OA 4ZQIA 1I4LD 4FE3A 1ORDA 4DR6O 5JZVA 3CG4A 1ODFA 1IHOA 2JZCA 3IAXA 2JFHA 3E3MA 2H51A 2C82A 3UENA 1OZ0A 2QTOA 4W8OA 3QEJA 2XNHA 3AKCA 1JR3A 4RA9B 1YMQA 1U8EA 3EPRA 5CIQA 3VPAA 4G0VA 1X7ZA 1TUBA 3UFBA 3ZU3A 5DXFA 4NONA 3EDQA 2IBMA 2X1MA 4EHDA 2FQ1A 3R76A 3WLHA 5AM3A 1XUQA 3W3AD 4R98A 4D46A 3E2IA 3I9JA 4MWOA 2IWHA 2YWBA 4LYFA 2WTUA 1OKKA 3P94A 4B73A 2XNDG 1Y6XA 3CXUA 1JIJA 3O21A 4TWKA 1D2RA 3N0TA 1ZJWA 5AIAA 3RIEA 1JQEA 3HB9A 1VJDA 3ESBA 4W8GA 3IUBA 4MHOA 4JQYA 4F3CA 5K3FA 3QBJA 3PEFA 2V97A 3WMGA 2LGJA 1SC5B 2F1JA 2HF2A 1EX6A 1RJGA 3OAAG 4XWGA 4YMVA 4G0PA 4WCDA 5EXSA 5FAXA 4HH1A 2V4ZA 3A3KA 2EJTA 1P5JA 1USWA 2FZEA 1CUYA 1UAAA 3JQ7B 3RRBA 3VH2A 1V55B 1TT5B 1P3Y1 1VB5A 4RFSA 4FLYA 1G4AE 1DINA 1SCBA 3PHBE 3MLBA 1HX7A 1FXSA 3TAHA 4UD6A 2TECE 4HWTA 3K0AB 1YULA 3GZ4A 4QYIA 2NLJC 3UHAA 4YROA 5FUWA 2OTJV 1CQXA 2IYPA 4Q4AA 5DHAA 2DECA 2PZAA 4IHJA 1PJAA 2I8CA 4Q39A 2A67A 4G4SO 4ZC8A 4OHBA 4FK5C 4L15A 2ETNA 2RJOA 2ZNJA 2B3ZA 5IAJA 4L78A 1IM8A 1KQGA 1Z3CA 4X71A 3ZV7A 3MG9A 1JVBA 3MN1A 4OU4A 1UL1X 4DA6A 4W5RA 5I48A 1M6EX 3IBSA 3F5SA 1H4SA 1YO6A 3CRMA 5I9BA 3OEHA 1ZBDA 2JAPA 2FE1A 2F4NA 1O4VA 1JTFA 4R6XA 4MNTA 3DO8A 5BQ5A 1D9XA 1YIOA 3HO8A 4RXTA 5DT2A 2ZQ5A 1MZPA 4MIEA 2P6UA 1TVMA 1UFOA 3P97A 3X2EA 3KALA 1NATA 4DR7O 4DUGD 3KFVA 3VZSA 1EVQA 1SGWA 3M3HA 4LJSA 2QVCA 2ZIZA 3NKLA 2LCFA 2XCSB 5BYJA 1M73E 3KE8A 3UTCA 5DWVA 4KPFC 2CUTA 3KQKA 4AMZA 5KYUA 2IEDA 5J58A 3FUXA 4IIGA 3K5NA 1OF1A 3NAQA 2FZKA 2WFZA 4HPXB 5LWQA 5L3ZA 1VE6A 4IDEA 2VJMB 2QG4A 4GXQA 1XRQA 2HSDA 1VA4A 1A9TA 3CWCA 1RJDA 3HCNA 2J08A 4K7JA 4PLTA 3DCJA 3K1TA 2AW3A 1I5XA 1ZH6A 2DLNA 1EVJA 4Y2YA 4MWEA 4OJMX 4GHWA 2EKLA 5E38A 5CD1A 4IZ6A 1PL4A 2AOVA 3IXMA 2PSHA 4KNVA 2LCQA 4FYKA 1F4LA 3WJ7A 1FTWA 1PCXA 1ZD1A 3FYUA 3MTAA 4EPWA 3GN1A 3OZRA 4RWUA 5AHKA 3TZHA 1H3FA 1QAMA 3HXKA 2YJ6A 1E3WA 4NENA 2ZPTX 2NQ2C 2IOYA 2PPLA 3N5CA 5CJPA 5B1SA 2VAWA 3VQXA 3CBGA 2E5LO 5KI6A 1Y8RB 3TLXA 3ZK8A 1A9QA 3RS7A 2QL6A 2EJVA 1N34O 4YLGA 1H0KA 2GHIA 1I5RA 3DMHA 4EQ6A 4M9RA 3L73H 3QX8A 4PI2A 1Q91A 2MW2B 1C8KA 3KQHA 5KJEA 4O2BF 1AR1B 2PE5A 3EFFK 4B31A 2GK6A 2ZBEA 4ZCIA 4UM5A 2PMEA 3T5DA 2HXGA 3FMVA 2CB0A 3B36A 3SE0A 4AP5A 3GLIA 1J23A 1Z5UA 2IYTA 4BNWA 3SHQA 2QK4A 2AKAB 2W8ZA 4HPWA 3B6IA 2CVPA 3K09C 3K9QO 3UGJA 1EJBA 2Y48A 2ZUUA 5JNRA 3VHRA 3ABLC 4H1HA 5A7HA 4RHUA 4AS3A 2Q1YA 2FUG1 1EP2B 1PO7A 1N8SA 2PKWA 1V1JA 4GD3Q 1PQPA 1UBUS 1TYDE 3NEAA 4I4NA 3KV3O 3T38A 4L72A 2RN9A 3WWYA 4JQZA 4GZMA 1C9NA 5GADl 5GAOA 4WK0B 1A4XA 1WHSA 4R2JA 9ATCA 4H3VA 1Y6ZA 4AJ1A 1AZTA 3D02A 4TWRA 1ZN7A 5IM4A 3BQ9A 2YOHA 3QVWA 4R83A 6ADHA 5A5EA 2FVYA 1OJ7A 4HMOA 4E2YA 4S0XA 3T5BA 2DJVA 4IO0A 2G80A 3W5JA 4QHTA 3GFRA 4HRXA 1YB7A 8AT1A 2G8NA 3U4QB 3HHPA 3QVVA 1AB6A 1R8SA 4HQRA 4ZTUB 2PY6A 4P4NA 1HOTA 4O8XA 2QLLA 1UT6A 4H27A 2ZAMA 5LMUB 4ITUA 1YZKA 3I1YA 2I4TA 1Z0FA 2WIJA 4CT4B 1T6BY 3EUFA 4DR2B 4I1PA 2ZIXA 4IFTA 3F7OA 2FR8C 1EXNA 4UCTA 3QEMB 4O4JF 2ZRIA 1M2KA 4JVMA 1I14A 4EI7A 2D3OW 2OUIA 2ZNVA 5M52C 1COWA 5DHQA 1LW7A 3FPFA 4BV2A 3IIKA 1BWQA 3IBGA 4E2ZA 3VC7A 1ETUA 2F4VO 4QU9A 1V11B 5CBFA 1YGYA 2ZWVA 2F1OA 4GKBA 3MJVA 3MWGA 1OZHA 2NVOA 3TQRA 1KK0A 4Y98A 1E0SA 2H48A 1S9DA 3QHQA 4JB0A 2YZ7A 1MC8A 5B7NA 3UW1A 1H6DA 3IFXA 1CP2A 4KCGA 1JWLA 1N2GA 4UE2A 2EWVA 3PR1A 5CA0F 4YBZA 1FXHA 4OCNB 3EXHB 2J31A 5JAQA 3GAZA 1M74A 1R4ZA 4KVFA 4PRLA 4ASUD 2ISQA 3MGGA 2B25A 3IPCA 3RN4A 1H69A 3M7IA 3ZZNA 2Q5FA 4HV4A 1ZZGA 4S1TA 4WZBE 3ZDYB 2X7JA 1ZVMA 1IL0A 4QL3A 1EX7A 4MMYB 4G0QA 2UXCB 4M3NA 1P1RA 1FYXA 4BFYA 2VRCD 2EXXA 2LV8A 4G2KA 1BOFA 3WMXA 1X77A 2PLFA 2XYQA 3I72A 5EMKA 3LUBA 1ORHA 4YVFA 2H1IA 2BL4A 2LZ0A 2QPLA 1Y7PA 3NT5A 1JHUA 2CLFB 1YDFA 1O03A 5U9CA 2VWPA 1B23P 1NW3A 1JIIA 2O2IA 1ADCA 3WC4A 5KVSA 4PPYA 4CMCA 3F7MA 1K88A 2EVWX 1ZO8A 1G17A 3FGPA 4FNOA 2BFPA 3FGNA 1EK0A 2Z95A 3GNTA 3DZDA 1V96A 3U19A 3OP4A 2G9NA 1Y6QA 1AJNA 4ER0A 1EFDN 1XQWA 3EX8A 1RXUA 1K4YA 4TWBA 3QYPA 5DGIA 2IF2A 2Z5UA 3RHFA 4ISBA 2WG0A 2JFVA 4HZIA 2QYTA 4RJ2A 3M70A 1SCUB 4HGZA 1GH6A 2A0WA 2O0KA 3VR5A 1LQTA 2DFNA 2FPLA 3VKUA 4UMEA 1TUIA 4E7OA 3JD3A 4TPKA 5AR1A 1KEEA 1I6MA 4TS3A 3A36A 4OQFA 3OPYI 1J6UA 2VDVE 1WMBA 421PA 1YH3A 1FFBA 2FB9A 1SUWA 3DWEX 1R6NA 4ISCA 3OGIB 4ERXA 1P8JA 2CVZA 2G3YA 1T4MA 3CF4G 4QFCA 2X3FA 2NUTA 1TJ3A 2F64A 5J1TB 1BVHA 1PR4A 4ENRA 5CT5A 3CKYA 4M86A 1NG9A 3LNMB 2FW7A 4NXMB 2LW7A 1Z2DA 1AS2A 1TU4A 3C6XA 1I2BA 1CF4A 1OYVA 3I9FA 4JUCA 3EVZA 2ZYUX 5G41A 4KGVA 3VZQA 3SQLA 1QGAA 3F6SA 1NOJA 3PZBA 1YJBA 4TL8A 2OOSA 3I9LA 2C04A 4PC2A 3TSAA 4L0DA 2FFRA 5J43A 1Q6IA 3STTA 2DP4E 1P1JA 2ZIGA 2BM1A 5LJIA 1YUMA 2WTXA 1AQLA 4EGQA 2QL7A 1PX0A