1PL0A

Crystal structure of human atic in complex with folate-based inhibitor, bw2315u89uc
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
589
structure length
589
Chain Sequence
GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Human Bifunctional Enzyme Aminoimidazole-4-carboxamide Ribonucleotide Transformylase/IMP Cyclohydrolase in Complex with Potent Sulfonyl-containing Antifolates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 201
structure length 589
sequence length 589
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1pl0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1pl0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1pl0A02
3ZZMA 4A1OA 1OZ0A 1EGHA 2B1GA 1PL0A 1S89A 1VMDA 2X8WA 1C30A 1ZCZA 1THZA 5H3LA 2IU0A 2IU3A 1IK4A 1M6VA 1KEEA 1WO8A 2YVQA 1S8AA 1T36A 2B1IA 1CE8A 1PKXA 1JDBB 1M9NA 4EHIA 1C3OA 1CS0A 1G8MA 1BXRA 2XW6A 1B93A 1P4RA 1A9XA
chains in the Genus database with same CATH superfamily
1UZMA 2WTBA 4BNIA 3BHNA 2IS6A 2XXBA 3KWLA 3WB0A 4Z9YA 1IUOA 2WFAA 3D6VA 3GA7A 5FNZA 3K73O 1P45A 4ETMA 5LQCA 2IU4A 2ABWA 2FTKE 3IKTA 4U39A 3MINA 4KBYA 1WA5A 4KO3S 5FHQA 3OMLA 4I99A 5JZBA 2ZWPA 5DP2A 4ZYWA 1P2SA 1AB5A 2R48A 4AG5A 4W5QA 4ZVLA 1RXVA 3AJ9A 3PCXA 3VNAA 3Q88A 3FHLA 4LOLA 4OP1A 1SOAA 3ZCTA 3Q8LA 4N41A 1XJ5A 3M4YA 2F8SA 1JIUA 3U4AA 3RGWS 1Z0JA 4IDGA 5EE1A 5FPSA 1TIYA 1V8DA 2UAGA 1SKYB 2M1XA 2PUVA 5I7OA 4BE9A 2RI6A 1DSSG 2P7TC 2H0QA 3NUZA 2YWCA 9LDBA 4QX6A 3ZZMA 4D4LA 4PICA 1PU2A 2LW7A 1R1DA 1DHTA 1WLSA 1VMEA 2E4WA 2IS4A 1AP6A 3ZU6A 3IV9A 1RPZA 2CL6X 2YQ4A 1WU8A 1BQZA 2A79B 3ELBA 4ND8B 2JLSA 4R2XA 5DTEA 5GP1A 2VDVE 5K2MA 4QD3A 4MEJA 1QTNA 4U7HA 4GQBA 1T6XA 2VRNA 3IVXA 5JCXA 3RHTA 2DOKA 1PV2A 5CLLA 1PWXA 1NQTA 1V39A 2I2AA 2QYTA 2JIZA 3C16C 3K3PA 3RFFA 3DBIA 3TPCA 3QU7A 4DIKA 3ZMUA 2QD4A 1PNMA 2AEFA 2KLHA 5ALPA 4ZOQI 5K8UA 1LY1A 2ZSIA 2F1KA 1VJCA 2UUBB 1E2MA 1YVDA 2JRIA 1WCIB 1K9VF 4J91A 5CW1A 2QLMA 2PUGA 3A2LA 1I36A 2ARHA 4TLLB 3KLOA 1O5IA 4PZAA 4ZRNA 4D9CA 1UMBB 4RACA 1YL5A 1LS6A 3PUZA 2K7FA 3GDWA 4EEXA 5EEHA 5KWSA 3PI6A 1KD1W 3UM9A 1QYIA 1SWWA 2A3RA 2VDOB 3U9SA 2W42A 2X0JA 3BS4A 1DBQA 2X2OA 4CUJA 1PZNA 5D8DA 2ZAOA 4U2BA 5JECA 5K3FB 4B3RB 1WG8A 2BCJQ 4MV1A 2QXUA 5BSMA 2X4IA 3RH0A 1J33A 2ODAA 1R4ZA 1TPZA 1M75A 4NX2A 5HJ7A 2V9ZA 4QNNA 1EQUA 4DR2B 2VJCA 2ECKA 3QXGA 4G5HA 4INPA 3GARA 1KDZA 4PAQA 3WSWA 5KOYA 1RQLA 3C74A 3UAXA 5DRYA 2FR1A 2UZ4A 5DBHX 4FK8A 2BGIA 4E5YA 2HCTA 4JTCB 3K1JA 4KTVE 1FNSA 2EHJA 3GVIA 2EBUA 1TYZA 2C5FA 3QF7A 1T6BY 2A9RA 3NC4A 2OQIA 4DG8A 1G1XB 1UPTA 4F6LA 3BULA 1H2BA 3TTXA 2PUEA 2FAXA 2ZIFA 4ZICA 1CZHA 2X76A 7REQB 3AT1A 4ES6A 5CIYA 3HJNA 3AL3A 1ZOPA 4EABA 4PS0A 2CB9A 3EPLA 2VWGA 1Y6XA 1S8OA 3U60B 2FFBA 4YHHO 1N2CA 3EVGA 2IEYA 2PV0A 3IVAA 1DDIA 4MW4A 4WNYA 4HRWA 2QR4A 1AUVA 3VR4D 1J22A 2OMEA 5DTMA 3TOVA 3W90A 1U2RA 1O9GA 1XBLA 3R65A 2QM0A 2G88A 2Y1LA 3OCUA 4D99A 1OJHA 3QO5A 4D0NA 2P8SA 1SVKA 2HSZA 3F1KA 4GX0A 1Y80A 4FONA 1THMA 2OWDA 3ORSA 2G8NA 4LVUA 4KXYA 3EOAI 4OOFA 4Q34A 3ETDA 4DV0O 1M34A 4OP2A 2O5RA 1WB7A 4UEJA 4OGGA 4P82A 2XYQA 1UPGA 5DGHA 4TROA 3RPEA 3CWZA 4FPXA 1SQPH 2JGMA 2LPMA 3PQ3A 3WGOA 4WNAB 5GVRA 1P1FA 4RZHA 3VGJA 2CE7A 3QWHA 2J33A 1MW9X 2FJPA 3MNFA 4KYUA 3VGPA 3VSAA 3JAKA 3E58A 3IAS6 4W1QA 2CV2A 1AM4D 2UVPB 3C3YA 3A4NA 4M86A 5HFAA 4DR5O 4N4AA 1T8YA 3UFBA 2F66C 3ESAA 2D2IA 3RYFA 3E4CA 2E87A 4QGSA 3LC7O 4W1RA 3PDIA 3EXFA 1BKSB 3GWZA 4CBVA 3SIWA 2WMNB 1V96A 3DXFA 2H57A 3CNHA 4ENSA 2A2ZA 3LPDA 4UQOA 4B6JA 1SZXA 4P5DA 4JLNA 1ZC4A 3IJ4A 3LUBA 1RBYA 3OETA 1DJMA 3FTQA 1NJFA 1F3OA 2X3FA 3I9NA 4DLUA 4J4BA 3HKEA 2ZS9A 5F3DA 1S7GA 1XEWX 5CH5A 1ZSNA 5GOTA 1C7QA 1ND6A 3GB7C 4N7JA 2WLLB 3TLEA 4XRGA 5C52B 5H9CA 2R3SA 1FFWA 4REQA 3CW9A 3WIOA 2Q5LA 2QM4A 2D5CA 1C4KA 1E3TA 1DPGA 1PQWA 4R6WA 2OQVA 2GM4A 2I33A 2WAOA 3WGQA 3L6EA 1XHZA 4J90A 4R41A 3R7AA 1F8UA 3C3JA 1ABEA 3TNLA 4IDBA 3R74A 4DADA 3ROQA 3RFCA 4Q5IA 5GIPE 2FSIA 2Q99A 5ANRB 1KTIA 1GUDA 4D4MA 1Y5RA 4LWQA 1N4AA 4UBLA 2WUFA 3B7PA 3MINB 5EC1C 1YZQA 2CLMB 3NPAA 2WSYB 2OV4A 3ZGVA 5ED4A 1G3UA 4QAJA 4UCUA 2GJSA 3FZYA 5FRDA 5KSZA 1E5LA 2RGDA 1OZGA 3FI0A 3IPLA 2RJNA 1N5MA 1XXHB 1T36A 5E3IA 4CF3A 4UFPA 1JQ5A 3N2ZB 2Z2KA 4YI5A 5HMLA 4ZAGA 2C7VA 2BEWB 5IASA 1PR6A 3OQPA 4LA4A 3BE4A 2UVDA 4BC0A 4YUXA 5IH3A 1WPXA 2WG2A 3IHLA 3R76A 4FMCB 5CT4A 3OLZA 3VI4B 1JEJA 1L5ZA 4NU0A 5LD2B 4X95A 2Q67A 5AVYA 1UBTS 2RKBA 2CUGA 2CLKB 3HLYA 5JAIA 1J1ZA 2I1VB 4K9PA 2A30A 3I62A 3ELDA 2ZWAA 4BNFA 1M7GA 4TXLA 4F2PA 2M6RA 4FOOA 4TWAA 4X88A 1KQPA 1MZVA 4O2BA 3UWOA 4TUYA 1J8VA 2NVWA 1PL6A 3X1MA 3L73H 4UNNA 3QMWA 4ZCRA 2PANA 2CCKA 4RPCA 2QN7A 4FFBA 1RXIA 4F92B 2ZRMA 2C00A 1J39A 3FFXA 1QHFA 4PYNA 2PUHA 1FYJA 2EEPA 2EATA 4PLGA 3L5OA 4DSZA 1OTYA 4ON9A 4C4SA 3G1WA 5K0EA 1H8EG 3RW0A 2D6FA 1OU4A 1WCIA 2RAFA 3JWEA 3QJYA 4BP8A 1TADA 1R9NA 1JVMA 2C78A 3BMNB 3GT3A 1GQQA 2ASVA 4D0RA 3GBSA 3A9VA 1TYCA 1UMBA 2EG9A 2QRZA 4WASA 5K4AA 1ANKA 1NTOA 2B4RO 1Z82A 2VH5R 4G37A 5EUMA 1E6KA 3OW2U 1IE3A 3MCTA 4UHCA 3W4KA 4BVJA 5EJ5A 5JMPA 2QTOA 3T5GA 5TMPA 5CG2A 2PMCA 2ZLBA 2HGZA 3HDVA 4LPKA 1RABA 1XXHE 4M7OA 3IOMA 1BS1A 2UYHA 4ZAWA 1E2GA 2XCLA 4G56A 4G85A 1S76D 4TS1A 5IAAA 3NR2A 2ICAA 4N1AA 4QUIA 1KDVA 3RAPR 4BCDA 3IAS1 1E6MA 1AZTA 4N0MA 1VF6A 2V7QD 1YB4A 4B4DA 2ATIA 5HQ3A 1OFVA 2HF9A 4RUFA 1H4TA 1HO3A 4FLZA 4O0LA 2CL5A 4YJ2F 4RQUA 4UKDA 3ZY3A 1YJCA 2HADA 1F4NA 1MZFA 1Z13A 3R5FA 2H1SA 2C58A 2FXIA 3H1AA 5HCUA 4QU0A 5TRTA 2H4WA 3KJHA 4DYDA 2IUSA 3KJZA 5KJ6A 5CA1F 2WP8J 4LDRA 3DDNA 3HLTA 1VL2A 3UXMA 4MUHA 3VPFA 4QYXA 3CRAA 5EAIA 3T9AA 1Q2UA 4OHBA 5EJ4A 3BD8A 3FUVA 4MYRA 3DKRA 4EFEA 2D00A 2DP4E 3A70A 4KB5A 4LRYA 2P3QA 1JMYA 3T61A 2PIDA 4P83A 2XVMA 3AEQB 5DCYA 4UEOA 3X1YA 2CV0A 4XI9A 4C6TB 4HBGA 3THRA 2OO3A 4LNUB 1T4CA 1CP3A 1RM5A 3HB4X 4Y18A 1CU1A 4ZD4A 4NNPA 4AMGA 4ENPA 2ZE7A 5J2TB 3NIGB 5KTOA 2R6DA 2OB2A 4MV3A 4H1UA 5K20A 3DDUA 3JVDA 4TSRA 2Y92A 3EVEA 1L7EA 2BL4A 4ZT2A 2VBGA 2PLAA 1UT8A 3N2LA 5CH8A 1L6RA 4BE7B 4GOXA 2TS1A 4OO3A 2G25A 5DFAA 1M34B 4A3SA 1HX7A 1NU6A 3SYNA 3UV3A 4CXMA 3N8GA 2GRJA 5ILQA 3D4IA 1XQ9A 3M99B 4FEAA 1RRKA 4HXEB 1XVVA 2I2BA 4KLAA 4R84A 5K51A 3TSAA 2DECA 4F3RA 2IPLA 3JQEA 1I6MA 3HP1A 4QO7A 3HA7A 4M8SA 1DAGA 3E7DA 3T9FA 1ZISA 2N05A 1E0KA 5B53A 2VBCA 4EUNA 1P9LA 2R6JA 4YYEA 4I5DA 1O57A 2AKYA 1VIMA 3PDIB 4JJ6A 4TQ9A 5EZYF 2O1XA 3MTQA 3R09A 2X0FA 2H3HA 1PDWA 3NIFB 1KMQA 1OWNA 1JDVA 3ICPA 2X9NA 3GZJA 2WV9A 3UZUA 3CW2A 1V95A 3AY3A 3B38A 3E2MA 4JJGA 3V8EA 1R3IC 1ODKA 2RB4A 1PUXA 2G6TA 3PCTA 2B8NA 2BOVA 4JUDX 4U6QA 5LP6F 3HKEB 1TFUA 3D8HA 4GQAA 3RM3A 3TR0A 3X2EA 5I9LA 2QVLA 3KJQA 4PZ0A 1NVFA 2YC0A 1R6DA 4QJFB 4YRBA 3AOEA 1XRPA 5KHIA 1S8AA 1GN4A 1XDUA 3I9FA 3ND9A 4R1SA 2ZDIC 2O7SA 4PFKA 3HUUA 4X3CA 5G3ZA 4ZVVA 4TV8F 4PYOA 3TSOA 1Y3HA 5LU8A 1MB9A 2IYNA 3ZD6A 5FYDA 4CF4A 5I9TA 5HWSA 3FHOA 4PLHA 1P0MA 3BMXA 3KTDA 2IIPA 4QVIA 3NNSA 1XQ8A 3TLMA 4J0CA 4B2YA 2QBYA 2OG4A 2YOGA 1G20B 4INJA 4MP3A 3T4EA 1RI2A 4RO2A 2HJRA 1JEDA 3K96A 1MVNA 2NQ8A 1G8JA 4RSMA 2BTOA 4ZZ1A 621PA 5KBYA 2B1GA 2FWRA 4Y9TA 2XLBA 4B5KA 2FW9A 4DMRA 1G21B 2FKAA 1D04A 4H1VA 3PUVA 4NC9A 5DCUA 3AEXA 3E1GA 2EC5A 4GX1A 4P32A 4XJSA 5CIWA 1XTBA 3CHYA 4TYQA 3PUKA 3R2NA 4RAOA 4WCFB 4S2UA 4WT7A 1R3UA 1XXHA 3ZS9A 2VNKA 3OQ6A 5H4HA 4P0QB 3M6AA 2Y66A 2HWWA 2W83A 1RKQA 3HR7A 3P2IA 1IXRC 2VDWA 3HBAA 1C3VA 2BEWA 3PD1A 3WMRA 4EI7A 3NKLA 3IC5A 4F6CA 3OJCA 1AI5A 5GTIZ 5EE3A 2Z4TA 3NONA 5IS2A 2F62A 3KKLA 2DOSA 3ESXA 1B73A 2BRUC 3L1UA 5IKXA 3JALB 1WBJB 3LBYA 1GTOA 3PUIA 5EJ7A 1NU1H 1C1XA 2HHJA 4P2ZA 5AHOA 3P2EA 1WA8B 2Q4BA 2WUEA 3SQNA 2BBOA 1OZAA 5MF6A 4JYBA 1HLPA 2FZLA 2Q7EA 2QZJA 3LSTA 2G06A 3FBGA 3FPCA 2V0NA 3QK7A 4X6YA 3ADOA 1I3NA 3I5XA 4HGZA 2H1RA 4UBMA 2J0VA 4XFKA 3K4HA 4HB0A 4I5EA 4RHTA 5FUYA 4OI1A 3TX2A 4H60A 3VC1A 4JB2A 4II3A 4LYGA 1I94B 1I9CA 3LYHA 2BI7A 4TUYB 1UEJA 3JQ7A 1SUWA 4GEKA 2VTEA 5CR9A 3SDZA 3TRKA 5JTUA 2A33A 2GKOA 3BIFA 1LR1A 4IHAA 4KPEC 2XWSA 4FZ0A 4Y2HA 5B7NA 1M2HA 2ZIXA 4XDKA 2ZBQA 4I66A 3MILA 1QCZA 3GMDA 4YP1A 1OFUX 5E3JA 3VVCA 3RN4A 4DG5A 2W6JD 3DQQA 2QTCA 1VXOA 1DVRA 4F5WA 4H7EA 3QWFA 1AU9A 4G4SO 4BKQA 1QP0A 2W8BA 1U5CA 1GPNA 2C20A 4FFRA 5CFQA 3DLBA 4TWZA 1C1DB 1QHIA 5IDVA 1LDBA 4K1RA 2NO9A 2Q5JA 2Z8YM 4BN4A 3DT9A 3L7OA 3VSCA 2WNIA 5AM5A 3C6BA 4DDKA 3ENKA 4NBLA 4QGPA 2IW1A 3VO1A 1TRHA 3K8YA 2IV2X 1SHJA 4UV8A 5LHGA 1PJAA 4OU4A 1DF5A 3M5DA 3Q5DA 4DXWA 3C1OA 4F1WA 1Z5VA 4RVCA 3DMPA 4CZZA 5T4HA 4CLRA 5SZKB 4C2AA 5HFJA 4MZXA 4QJ4A 1CZUA 3V8NA 5LQKA 5HQ3B 1YOBA 1Y4ZA 3H9CA 5HFMA 4DQ0A 5CEJA 4N39A 1GGVA 1XAIA 1NUAA 2JAUA 5BYKA 2IC5A 2CTPA 2W0XA 2SBTA 3NATA 4HH4A 3QPCA 1Q0HA 1XL6A 3HXOA 1YCFA 4ZT7A 2JVDA 3T1YB 1A2BA 5J4KA 3IAEA 5LMCA 1GPDG 5DZSA 2KQUA 4CS2A 4U3FH 3J81N 1FXUA 3DPIA 4IJ6A 4V1CA 2YVLA 4G1VA 5LFAA 2VSYA 3L49A 1DAPA 3IODA 2RH9B 2XY4A 4XOIA 3WLFA 2KX7A 1XVAA 2QVGA 3E84A 3KDSE 1CJKC 4XWGA 1D4ZA 3AEQA 1R10A 1ZIPA 4CKZA 5LOVA 1H2NA 1QB8A 1E8DA 1MJ5A 1R6XA 2HBZA 1PKXA 4IL6Z 4LNUA 4QE7A 1T4CB 2QLJA 3E48A 5H8WA 2Z6UA 5FPKA 3D7KA 1EM6A 3TGLA 5J2TA 1IVYA 4WWHA 4X84A 4ZMRA 1ZMRA 4RQBA 3LE8A 4B17A 4EKGA 2V4MA 3AY6A 4EL0A 1H2WA 3P5BA 4MRSA 1JR2A 4E7PA 5CPBA 5E79Z 4YLEA 1VQOV 1RQRA 2HSJA 3IELA 3WOHA 5T7BA 2A9QA 4FSDA 2GM3A 4CCSA 1OB2A 3PENA 4HBNA 1ZABA 3FKSA 3EMKA 4L6IA 3X44A 2EQ5A 1A0OA 4L5JA 1ZM7A 3JQ6A 2EL7A 2X23A 4JC4A 1JECA 2GV9A 2GCOA 4EYGA 5AVXA 5ICGA 3L0IB 2I4MA 1WV1A 4HVLA 5M2QA 3H2BA 5D7BA 4XWTA 1J1IA 2F67A 4WK6A 1JEQB 4MR9A 4L75A 3I5DA 1J99A 1KO4A 2G0AA 3BHIA 1VDMA 2GBIA 3V2IA 3PXAA 1GEGA 2AMYA 2G4VA 3TLAA 2A0LA 3L6RA 2IV7A 3ZNOA 3A0BZ 1PKEA 1X7HA 4CUZA 4QJIA 3R3YA 1PJBA 1KNQA 1U11A 2G1JA 1V9CA 1GZHB 1NS1A 1WB4A 3WNBA 3OLVA 1P33A 3SYPA 1V47A 4HDRB 3TH5A 4QIWF 3ZVRA 3U81A 1NDHA 2AHOA 3K7EA 4BGUA 4Q3DA 4Z9BA 5H59A 4ZQBA 3X43A 2X7HA 4BAUA 3AJAA 1U2QA 3IKLA 3DDWA 4IJWA 1K7EB 2WJZB 1H8HA 1U3TA 3AZOA 1NDQA 3LK7A 3PI7A 3PLRA 4IUBS 3TLBA 1KP3A 2OE2A 4NOMA 5ESWA 521PA 3K0SA 2J4FA 5IJAA 3W7TA 3AR8A 3N2NA 1F14A 1GTJ1 1WSDA 2XTMA 3KB2A 4TQFA 3NHMA 4FDLA 4IZHA 1Q43A 4BW9A 3JQ8B 1T9AA 4M6WB 3DJYA 3HA5A 5BUQA 3S7ZA 4CU2A 5JBIA 1AX9A 2XAAA 3TXAA 1KWGA 3I6IA 3J80A 3GWOA 1N8TA 3K5IA 2IIBA 4PEVA 1EX9A 1ZH8A 3OT4A 3R5HA 1A50B 2EF1A 3M6XA 2QM7A 1T6YA 4B7AA 1G21A 2H0AA 4GI3A 4X7RA 5TMDA 4A8JB 3LW8A 3TX6A 4CTNA 3O3MB 4KIFA 4OXNA 4R51A 4X71A 1H2SB 2ZTMA 1EIZA 1HT1E 1JSCA 1W8IA 3S6JA 4O33A 4CR7A 4HH3C 1V3TA 4LNHA 1EN4A 4R7CA 1J95A 3D7LA 4WCFA 4B48A 2FWIA 3A10A 5GINE 3EDCA 2VDWB 1UWKA 3PGXA 4PPNA 1EESA 1I2ZA 1M1NB 4I5IA 5F23A 5JD6A 3H1KH 3AG1B 3KEFA 3OPYI 1ZCFA 2Q1WA 3SU8A 1EMDA 4JC5A 2QV0A 4KXWA 5FNVF 3JALA 3JAWB 5A4DA 3THSA 2EIMB 1OBVA 3EW7A 4YBRA 3T8YA 2WHQA 4LDPA 1Q3HA 5AK4A 4HQOA 1N5OX 1VIDA 4R8VA 3HSSA 1O97D 3LSUA 3RYCA 5IJ9B 4AO8A 4BZQA 4EMTA 1NVTA 2OZVA 5JO0A 2Z3VA 5HS4A 3KAJA 5JXGA 2PMDA 4X7BA 4JLUA 3WO0A 1XOUA 1N9KA 2I3DA 4PC3A 1KJ8A 2QK4A 3U44B 4R3NA 4CF5A 4ZP1A 3U5ZB 2PD4A 5FPTA 3V8RA 4DBLE 4L57A 3C7AA 1OYYA 4XGQA 1KIAA 1TVKA 4N3NA 2G9UA 1FD9A 1VI2A 2R4UA 4IQFA 1GZVA 4MSQA 1JKIA 3G79A 5K6RA 3CLTD 2V0GA 5KS2A 1CJUC 1ZHOA 3QRWA 3T95A 2AYXA 3MBOA 5GMOA 1VG0B 5ER6A 2PMKA 1SJ9A 2GN9A 3IQDB 3AV0B 3SOZA 2YJ3A 4RZSA 3P0EA 3QZUA 3VSBA 4JCOA 2UZAA 3S28A 3G6KA 2YRWA 4GMKA 1Q8IA 1K68A 1Y1SA 4CFSA 3CZMA 3ZD7A 1X8LA 1U8UA 2HVVA 3PSHA 2WYVA 3T7JA 1WN7A 4F2GA 2XXAA 3FJYA 2VHJA 4NJOA 3A06A 1NWCA 3NBFA 1UIRA 1QGED 2FE1A 1RMTA 1N2GA 1CRLA 4CQMD 4L5BA 3BJIC 3WLTA 3A27A 3INYA 2FFRA 421PA 1DIAA 2HO5A 4O8YB 4CLRB 3KFXA 4NI5A 2P69A 1UJCA 2WT4A 3OOYA 3PQ2A 4RQTA 1E94E 2VL7A 5LZ2A 1KYIA 3BPSA 1IEVA 1ZI6A 4K1LA 3OZBA 4OFBA 3RYIA 1TJPB 4UM7A 4EFMA 1Y3AA 1Y9DA 3P2OA 3P8ZA 3WNDA 1RHRA 1W2WB 2P3LA 3OIDA 4RM2A 3B2EE 2VP3A 3JQAD 2RHHA 3TRIA 1T8RA 2LP4Y 4DLKA 1RHMA 1NKTA 1A8QA 2X86A 1C30A 1US8B 3U26A 2QL9A 4V1CB 2P9CA 1N6PA 2A1UB 5E8JA 4BC1A 1KMMA 2VXYA 3DFIA 4GPEA 1DJOA 2B5VA 5JVDB 4KPYA 2E75B 4AI8A 1IBKB 1H05A 3I2GA 3KZKA 2O2DA 4XGKA 4IGGA 1YZNA 2OFFA 1DQYA 3GJQA 4IQ0A 5LOVB 1MRZA 3HFJA 3L1IA 4PTZA 4A91A 1JH9A 1V45E 3QLUA 1VE7A 2DRIA 3V1UA 4TOIA 1XLUA 3WVNA 1XK7A 1IZ0A 3O90A 4BS9A 4DYLA 2FEAA 4MQFB 1EP9A 2J3IA 3Q0EA 2P8JA 3U1BA 2V55B 2ECOA 4I1RA 5ENDA 3RJMA 1QGZA 3CKKA 3NOQA 2K6GA 3D36A 4MSWC 2F1MA 3SQLA 1F51A 1N5IA 2JH9A 1QPGA 1S5LZ 3UENA 2AJBA 2GI4A 1UUFA 1JG2A 2Z3HA 5DE3A 4ACBA 1SRRA 2GAJA 4RMNA 4Y6LA 1J4AA 5SZHB 1MTZA 4RBNA 5CN0A 1X1DA 3QTBA 1ZOOA 1MC5A 4C7VA 3EVZA 1M1ZA 3ZX4A 2X5NA 1F9AA 1CUXA 2G07A 2GCOB 2RHOA 2TMKA 2ZFUA 3N2KA 4X1OA 2OM2A 2JGNA 3IL2A 2N74A 4JSRA 3CVVA 4DZZA 1MDBA 1OT5A 1RE0A 1JDBB 1LWNA 1Z0UA 1S77D 3HVHA 4U2GA 1OYOA 1UBKS 5EINA 4P0PB 1JEQA 3CA8A 4MR9B 6REQA 3QUTA 2OLKA 1DC5A 5KQGA 1VP7A 4MVUA 1E6EA 4KQIA 2AUTA 2GUWA 4I5FA 3N0XA 5EN4A 3RI3A 3TKLA 2IELA 3R9WA 3EB9A 1HH4A 1AHIA 3IDOA 5DXAA 3T4XA 2O20A 3QBDA 3UG6A 4HDRA 2V58A 4KXFB 3D2LA 4L9WA 3TK1A 2ZZKA 4BEVA 2P27A 2WAAA 4OIMA 4RTQA 3E22A 3OPQA 2FZWA 2HMAA 2BLLA 4IIHA 3V7WA 3ZHBA 4A2CA 2ORIA 4H44B 4UTPA 3GD7A 3RQSA 2WHXA 2H5IA 3M9LA 5JY1A 5DI3A 2Q8VA 4D44A 1VKHA 4Y3UA 2ORYA 3EFEA 4C4ZA 4OAQA 3QPAA 5C1OA 5LPNA 2DQ3A 1I5RA 4HJXA 1L7AA 1OI4A 3THOA 4YO7A 1AB3A 2XUQA 2ZIEA 2QTFA 3HYRA 4AB1A 5GONA 2YZNA 3EC2A 3EIQA 2CNBA 3FNGA 1EHCA 3TM4A 3VDRA 3UJBA 4XGIA 2GBOA 3OY7A 1J1UA 1DRUA 1FS5A 2HPVA 2Q1YA 3JQ8A 4M6WA 3V7UA 3B1ZA 4RA6A 4NBSA 4XIFA 3IJFX 4WZ6A 2HA5A 3G9XA 1KORA 1VMKA 4OHVA 1GKLA 2HREA 3DBHB 3FOZA 1B00A 1MA3A 4H16A 1EXDA 3KQKA 3M8AA 1JHUA 2AVNA 5D7NA 5JC1A 5KHGA 3Q15C 4RPIA 1XC7A 1PN3A 5F2VO 1R0YA 2B9EA 3AMVA 3CZRA 5A71A 3JQPA 4ALNA 5M04A 1TCCA 2WF5A 4RC9A 4WINA 2PEZA 3ITKA 1GR1A 4Q7EA 1FUUA 1M1NA 2IIQA 2JI7A 5JSKA 2EFHB 2P0AA 4R1UA 3RK4A 4C43A 3RVZA 2Z04A 1XDBA 4HWKA 3JAWA 3P32A 2PKYX 1AG9A 1VYHA 1YB5A 3FIUA 4IDHA 4MQ5A 2Q3EA 1T9HA 3ZBQA 3E70C 1GZDA 2Y4NA 1E2HA 4XUDA 1R8JA 2A9HA 5G0VA 1HOXA 4GZ6A 4AJKA 1CQWA 3QW4B 3IOCA 1L8OA 2RGEA 3MA0A 1V8BA 4I08A 4H18A 3VM6A 3SXPA 1HYQA 1HK7A 3IAM6 5DYYA 1L0NH 1O6ZA 2IA5A 2ZKIA 3L0CA 4Q9LA 1KI1A 2C5HA 5AXBA 4DEXA 1GDHA 1W4AA 2PKQO 3DOHA 3HXMA 3L7CA 2BHSA 1S5HC 4YXWA 2QG9A 2Q2WA 3CV3A 1NW8A 4IRXA 4JQYA 1TVKB 2E6KA 3RUEA 1Z26A 1HL7A 4HNQA 5IAOA 3B8FA 2C0QA 2PY6A 4DBZA 3Q72A 1IIRA 4WZZA 3VHXA 1ZDMA 3TQRA 4ETIA 3WWCA 2ODPA 3OT7A 4OBWA 3UUGA 2POQX 3EFHA 1OH6A 2NLOA 3RSGA 2F3SA 1CYEA 5GGYA 2XW6A 3RHZA 5LYJB 3GLUA 4L5YA 2XRFA 1WF3A 2W6IG 2E5LO 5AW7A 3A6FA 2GK7A 3WSTA 4BRZA 3G8AA 2FY8A 3L4BC 4ZV7A 3MHSC 1D6NA 1RVV1 1SHLA 1VIAA 5F7OA 1C0EA 2B36A 3LIIA 1R16A 1J0AA 3OEHA 4DMKA 1NJSA 3KZMA 1E62A 3G23A 3W9UA 1GSAA 1N78A 2YXNA 4UJ5A 4NCJA 3R7NA 1GP2A 2GCGA 3K72B 4C0JA 1G4UR 5KJCA 4ZJUA 1BGXT 5FFFA 5BURA 1KETA 1XP5A 2GKGA 3DMRA 4UHBA 4O8YA 3I2HA 2P79A 2IYQA 4M9CA 3ZJUA 4C88A 3QUBA 1KY3A 3UBMA 1VJ0A 4LFBB 1HTTA 4NQRA 1PP4A 3NKVA 4AS1A 2PMFA 4L8FA 1FCJA 2C9ZA 4H3VA 3CWCA 1VZ3A 1YVWA 1PZMA 3HB5X 3BY6A 2C95A 3LK6A 4UJ3A 5CK4A 3B7GA 4NP6A 5E9JA 4YMTA 5BN5B 4ASUD 3GJRA 2PYIA 1JTVA 2R2AA 3VQWA 1C30B 1US8A 4YIOA 4WOPA 2ZULA 5CDTA 2BKXA 2HK6A 1GGKA 2PUWA 1VEWA 2J85A 5DI9A 1K75A 3VPDA 3W3AD 2CGEA 2IHKA 1BW9A 4CV1A 1BVHA 5JVDF 2J3DA 2HQSA 5EUBA 2GLXA 3A6PC 5T8KC 1G19A 4JLBA 3AF2A 3JASB 2AEJA 5C35A 2GRAA 1ZL8B 3RRBA 2E85A 2HJFC 5LZ5A 5JARA 4GI2A 3CIOA 1W6RA 4JN6B 8LDHA 4Q9DA 1BX1A 4MQFA 1JL3A 4KCGA 3TLGA 3VKFA 3K6SA 3CZ5A 1P9OA 4FCCA 4NK4A 2J0QA 1YCDA 1N8RW 2AB0A 5BSHA 4EG0A 1KVUA 4C7XA 5FL7D 4AULA 5C1PA 4MRNA 4CNBA 4FLTA 2C84A 2X42A 5AW9A 1AUXA 2A59A 2WPNA 5L6LB 1Y9ZA 3JYNA 1ZK2A 2XVXA 2QTSA 4Q01A 2PX5A 3LJKA 3GLTA 5D3QA 1BSVA 1M2KA 1QR9A 3ANLA 4EBFA 3B9BA 3WK5A 4MIYA 1SXJD 3HCOA 1YZTA 2OVFA 5JWPA 1UWVA 3DZ8A 4IF4A 3NHRA 3K9FC 3EPKA 4OI0A 3FOBA 1DKNA 2I6GA 2DC1A 3GFSA 5IANA 2ZWIA 2XE7A 4JGGA 4H17A 5J58A 2P4QA 4ZGWA 2GBFA 3KQLA 1QIGA 2C2OA 4ARCA 4ZTZB 2CY0A 1IWOA 2AL7A 1YASA 1NP7A 4OQ4A 1OT3A 1W0KD 4MW9A 3HXPA 2PH7A 3GD5A 3S2GA 4PDRA 1IM8A 3CURA 4FE7A 3K9LA 2BJWA 2MYNA 3GDHA 3V2UA 2FYTA 2P06A 4II7A 5F9HA 3B70A 1FSZA 3DMTA 4NMHA 1MNQA 1G0OA 5DNEA 3GJ4A 1EK0A 4HG2A 4GOJA 5JT1A 4ZARA 4IVNA 5EKXA 1SAYA 1O97C 3ROMA 3MT0A 1KEEB 1QIMA 3OGIB 1WM1A 3U9LA 4BVEA 2MSEB 3SQDA 5IUJC 1GUFA 4X8HA 3EA0A 2FSHA 4NE9A 4J16C 5CNMA 1NLZA 2MHCA 2W9XA 3KV3O 4P31A 3W6ZA 4KGVA 3H97A 4R16A 2EJCA 2D2CB 4J43A 1ST2A 2W00A 3FDIA 3PRKE 4JUIA 4BLQA 2K87A 3RVKA 2YZKA 3H1IH 4NV0A 3CCQV 4WZAB 3K4PA 5CDGA 1LA2A 1K33A 4QDTA 1R0LA 2GTSA 4YMIA 2QAGA 4B3RO 3ZX6A 3FWPA 4R2WA 3LUDA 1ZK0A 2W6CX 3EBOA 3FH0A 4ZO9A 3S2EA 5AXDA 5C5IA 1WXDA 3ELYA 3OEEG 2HV8A 1KK3A 1TEHA 4IDEA 5DM2A 4XQ0A 1E9CA 3DBHA 5ERGB 1AV7A 4ZQFA 4EYEA 3E8HA 1DP4A 3EXHC 4QQNA 2YV3A 1FUKA 2XDQB 3ZIAA 5DYGA 4PDLA 2WJVA 3AERB 1V4NA 3VO2A 5JCPA 1KAMA 4FW9A 3SLKA 4F3CA 3UMRA 1GARA 1M2GA 4P93A 2BELA 4TTAA 1S1CA 3H2SA 2H8PC 2B34A 3H13A 4OHCA 1TC1A 3C3BA 1OWPA 4FK5C 1ZZGA 1P77A 3CR8A 3G7NA 1P2UA 4X66O 1SHKA 1RYHA 3TBKA 3NXSA 1AKEA 1T1JA 4R8SA 1IHYA 5TEVA 4IGIA 4QNRA 1KRWA 3ON5A 2PGGA 3P9IA 1M5RA 3VBEA 1USIA 1M33A 1KVTA 5JCZA 1O8CA 4CMEA 4R9NA 2ZTSA 3KSBC 4IO1A 4GWKA 1N7IA 4PGAA 1P0PA 4QA9A 5E7QA 3UHJA 3IUEA 2Q41A 1Z2AA 5BXQC 1FYVA 2PH3A 3QX8A 4JKIA 4HT3B 1M7BA 1BHO1 1V41E 1W4RA 4M36A 3L9DA 4YXWG 3DGEC 2UUBO 1T8UA 3MHHC 1IHPA 2VDKB 2ZE6A 3BMOB 3KSZO 4JBNA 4RMHA 4MRMA 4KKXB 3WGMA 3QM1A 4G23A 1C8KA 2O9JA 2JJ2D 1O6FA 4FXPA 4V24A 2CHGA 4UHHA 3CN9A 1BE8A 4LRXA 3ZMVA 3AVYA 3AKYA 3TLYA 5JEEA 1EBBA 3H8WA 2V1XA 1Q6UA 4TXJA 4P35A 3BXHA 5J2UF 3KL4A 2IJKA 1PR0A 3AETA 3ID6C 1ZNZA 2C7BA 4QIHA 2Q6IA 2VF4X 2X3UA 2TRSB 4GR4A 4OGWA 1FU8A 3VZDA 3K70C 4P4TA 1EYZA 1GCAA 4J0IA 2Q4PA 4Y2GA 2O2HA 5DTIA 3D4LA 1R4MB 3E8GA 3ZRXA 1Y7LA 3RTGA 5JNLA 4QBIA 4KFCA 1DAOA 4UUMA 1TUBA 2PGDA 4D9GA 2P4HX 1LCIA 3O8CA 3EQZA 4N3AA 1SG9A 1TIBA 2JA1A 3PNPA 1E2FA 1XMOO 3AXTA 3FUCA 1XQ6A 4HZGA 2C77A 5FTWA 1W4ZA 2GJ8A 2A1IA 2QW0X 1MH9A 5CK5A 5J5CA 4HYTA 1JEAA 2G1KA 4XKJA 1VPEA 2ZSJA 3N8HA 3QQPA 3DOEA 1XEXA 4EYKA 2GILA 5BN5A 5C8VA 1UKAA 1V8FA 1HKUA 1V5FA 1ATZA 1BDJA 3OWHA 4A73A 5KCMA 2Y27A 4GOLD 1RJ9B 4DS3A 3D6MA 3FOWA 3KCYA 2GOYA 1ECFA 3I4CA 2EF0A 2E74B 3W6PA 1NUUA 1DTOA 2XI4A 2R8RA 3IEKA 4ZCQA 3BD9A 3JASA 3T06B 2AA3A 1WTAA 3E9DA 1YITV 1ZL8A 2BWJA 3GL9A 1NBMA 2V4UA 3QITA 3QUAA 4I4TF 1CUDA 1GRVA 2PUFA 1I10A 1PJ4A 2H2IA 1AGYA 4LFAO 3FDJA 3ELWA 3L77A 1YMVA 5F76A 3FTFA 1KYOF 2ETNA 4N23A 1YBAA 2VJAA 3K6SB 3N0TA 1DUVG 1MCZA 4FBLA 1U9YA 4RTPA 2OBNA 5LKRA 3H01A 4HS9A 4MLZA 4FHZA 4IXDA 4YJ2A 5EWMB 2XBMA 4CG3A 3FFWA 3LKVA 3SE7A 2DJVA 2OFXA 2KG7A 4ZVKA 2IV3A 4Z6KA 1DO0A 4F60A 2PBLA 2ZT9B 5LJIA 3ZDDA 1AQYA 3DDCA 1Z2EA 4Q7LA 1GY8A 3DZFA 4LECA 3RU2A 2J08A 4A0GA 1R8QA 1PD1A 4RIHA 3FKSD 1ZKDA 4TXHA 3HB7A 2DR2A 2QX9A 3J80N 4MV7A 2H4YA 2PT5A 3ED1A 4JLDA 5IYZA 4WAUA 2FW7A 1GPMA 2WPDG 3O1LA 4KLNA 2F9MA 3H2JA 3VYTB 2IH4A 1DCMA 2JZNA 1EEXB 2JS7A 1FYFA 2HG5C 3JS5A 4KN5A 2YYAA 3KDAA 2CDBA 1F9EA 2BZ0A 3K32A 4TWRA 1JFFA 4BFLA 4DLWA 4WZBA 4EX7A 5FTLA 5HUHA 3G5TA 4UXIA 1R6NA 5C51B 2V1UA 1S8NA 4NMMA 4URVR 4LF4B 4QREA 2QTNA 2O8EA 3LOUA 3DULA 1PV1A 1WLEA 3UK0A 2ZIVB 4HWOA 3QVJA 3LCJA 4ZYVA 3D3QA 1QHHA 4Q9JA 4JLWA 1KEEA 3AOEC 2YTZA 4DLPA 2M6KA 1QLNA 1DUIA 1XT6A 1P5HA 1Y5MA 4MQMA 4CFZA 4YJGA 5KYUA 4A0RA 4CMIA 5A3VA 3WGHA 3QG1A 2VJBA 2JGDA 2A9FA 2DQYA 4C0BA 2B6HA 3WG7C 2I3AA 3K15A 4HBZA 4O02B 1UJ5A 2ZCUA 1ZU5A 2YOHA 1VE9A 1UMDA 1WMDA 1K63A 4G07A 4WZAA 4XGNA 1XDWA 2WY2D 3CGGA 3L7NA 1NG9A 3DPUA 2KE5A 2A0UA 2QAGB 4EHKA 4G5YA 1G5IA 1QYCA 3OO1A 3TSCA 5AHWA 3FRHA 2CKDA 4O5OA 4QTTB 1ND5A 4S24A 4XEUA 3WXBA 4W8HA 3I58A 3BHMA 5I7EA 4GZMA 3OJ6A 1YR3A 2FR8A 2PR2A 4KQGA 4BMOB 5CMLA 5DLEA 1B06A 5KYVA 5EIXA 1YSDA 2XDQA 1FYWA 2FRXA 3BWCA 3FETA 4NAHA 5DJ5A 3UICA 3V3KA 2Z0MA 4A8PA 1HZZA 1SBIA 1YV9A 3KLPX 1SKUA 4CKEA 4ETWA 3MQ4A 4QHSA 3ZW7A 1MC4A 4NOKA 1XZGA 5BR7A 2IBZH 2ZIMA 1FZQA 1POWA 2I03A 2FPMA 2IUYA 5LZ8A 1OWOA 1HNNA 4E0QA 4HAXA 2F95B 2VIIA 3RVBA 3QPWA 2DFLA 1IC6A 1PZGA 1T43A 1YBFA 1DBSA 2C2XA 4HAMA 3A1EA 3JWHA 3P9ZA 1NR1A 3M4XA 4OQXA 4R0VA 1DG3A 4ISCA 4DM4A 3I01M 4JBXA 4LXUA 5JXWA 1DS6A 1FFYA 2XUZA 1QNLA 3QTLA 3GCGA 4MMZB 2HVWA 1PGJA 1SKQA 3T1NA 4F4FA 2JCBA 1DLJA 1QAQA 1XLVA 2F1RA 4P7GA 3MTAA 1MG1A 1GKYA 3IAM1 5CXXA 1V3QE 3KB6A 1O03A 2RQ6A 2WUGA 3EZXA 3EGOA 3EIEA 2N75A 3N07A 2C29D 3UAOA 1MD9A 4TRRA 5B2EA 3H1GA 3RVRA 5BPHA 6REQB 3BMOA 2FR8C 2GCIA 3B8EA 5MGBA 4DK0A 4DIMA 3Q9UA 4G0NA 1AT1A 2FDRA 4URZR 5ERYA 4MYTA 2WU1A 1G5PA 2GESA 4FKBA 4MYHA 5G0WA 5C1IA 4BNWA 1ZGBA 1W0KA 4DLLA 1GA4A 3CX4A 3DAFA 1PGQA 4H1WA 3T1CA 3B6IA 3PK0A 4Z0TA 1G2OA 2WM8A 2JJQA 3KQPA 4LYFA 5CB8A 4EY6A 2UXCO 1RC1A 5K01A 3NAMA 5ADVA 4R5HA 3N6VA 3KKQA 3DXYA 5JJEB 4MKZA 2ACEA 1M2EA 2XVZA 5JAHA 3B09A 3FB6C 3JSLA 1C2TA 1MEOA 1Z15A 2M9MA 2RKWA 2Y1CA 3OOWA 4MQEB 4Q9KA 3RARA 1NQVA 5CBPA 1M2VB 2Y76A 3WKCA 4DPMA 3FYIB 2GQ0A 4QPDA 3UO8B 1S5PA 1Z4JA 2PGOA 4KAFA 2B3DA 3OE1A 4KQ1A 4NQZA 5HZKA 3IEIA 5L7TA 4DCGA 3D1VA 4LSWA 4EHIA 3EIUA 2VHUA 4NCKA 4W1PA 3AKZA 4JI1O 4CG1A 1TU0A 4LOAA 2XRYA 3PCRB 3EVBA 1FW8A 1EQ2A 2C8KA 3WP0A 2G4LA 3OPVA 3CGWA 4YDRA 1MX1A 3QF4A 2YH2A 3ZLUA 4BJHB 2JD0A 4YJKA 4D26A 3A0RA 2R5FA 3C1AA 2WSSG 3O83A 4MVJE 1XEXB 3VMFA 1EKXA 3AEYA 3PXEA 1G38A 1G3QA 1YS2X 2QTHA 1P0QA 3CEJA 1XI1A 3WICA 4AQ7A 5A0TA 1UOQA 2YIBA 2ZPAA 2VCYA 1D6SA 2WJAA 1QHSA 3OWXA 3I52A 5G40A 1C0PA 4PA3A 1A69A 3I72A 4NZYA 2XPCA 1NBHA 3MUEA 3OU6A 4NMXB 3SOPA 1K7XB 2QZSA 3N8NA 2W2PA 3KPJA 3WG9A 1LPPA 2QRMA 2VSQA 3FCUB 5BV7A 5IM4F 1XWFA 4GZ3A 2LTAA 4KXLA 1S5JA 2VSXA 3MVEA 3PXBA 5J4HA 1S6YA 1CFZA 2WIAA 3UUWA 1XL1A 3T2MA 2PSJA 4TKLA 4Q3EA 3ANMA 2O59A 4BB5A 4J9VA 5GQSA 2IEGA 1A5SB 5E2AA 4HMOA 4NYJQ 4DREA 1XSEA 3D5EA 3F7MA 4JXJA 4XH9B 3S0JA 4Y6GB 1I3OA 3JZAA 3QX9A 2KG7B 4BGVA 4CNQA 2C7QA 1CTQA 2NTEA 3QUQA 2FW6A 3IMCA 3ZMTA 2ZSHA 2VDMB 4G9EA 3ZHTA 3KU4A 3OEWA 4LQLA 3ZK8A 3KOUA 3SYCA 1XNJA 4FCWA 1Q17A 3KQVA 1WCYA 1PNQA 3CB2A 1NRJB 3MOIA 4IP0A 5FJIA 2C98A 3U80A 1YWGO 2VZ8A 5EXDA 4ZVTA 2Q7HA 1J7KA 2GF0A 1UDAA 3AF6A 1ZRNA 2OCXA 2FH5B 2QTRA 2RKOA 3DV0A 4MS1A 4XVHA 1CUHA 1HQDA 1R9JA 2AI1A 3SIRA 3DUWA 5CYPA 1U3FA 4F0JA 2R0QC 2FLWA 5CMUA 4JBHA 3E1UA 2OAEA 4C87A 2BPOA 2VTBB 4US0R 5AMXA 4RVOA 2D0IA 3ONDA 3A0HZ 5BV8A 2E4UA 4HRXA 4M1EA 3KCNA 3B1WA 1NKVA 3JQFA 3VHQA 5C3MA 2XYHA 4ZD6A 3S70A 2A0XA 3WR5A 3HKBB 3AG4B 4MKHA 1AJQA 1NTKH 1JXOA 3P9NA 1Q50A 1HFEL 4AT1A 2F1HA 1NXQA 2FP4A 3CM0A 3RT1A 1A76A 4X64B 1YHYA 1TL7C 2OESA 3LQRA 3DE4X 4IUYA 4M99A 4AS3A 2GXQA 3HFRA 4WMLA 2IGBA 3E2PA 3EFBA 5ECGC 4MR7A 3VAYA 4YJGB 5KYUB 5DCAJ 4HX9A 2FPGA 4WERA 2EULA 3RHFA 4M89A 2JGDB 3P7MA 4RK5A 3KR2A 1RHJA 5LQJA 4OQYA 5KX5A 4ZVNA 1N8SA 3T15A 5MN6A 1G9SA 4K6GA 2JI8A 3FMFA 1Q7YW 1E9SA 1YMQA 4FMCF 4BNYA 1JFSA 2BFPA 2IWRA 5D6OA 2XKJE 4QFCA 4I1UA 1Z08A 3N3AC 1WIWA 1M76A 1ORVA 4E32A 2ZUEA 4EEZA 1JKFA 4DSNA 2QVYX 3N7UA 4BFVA 1E3MA 2QXTA 3CH4B 4JYYA 4XIYA 2XHZA 1O5TA 4WCFC 2EG5A 3HY4A 1LU9A 1DQRA 1ZD2P 2HBRA 3KB8A 3NIBA 3DTNA 3WJAA 3AHGA 4WPGA 4ATNA 1FRQA 2D0OB 4CKEB 3GLFB 2R1ZA 1P39A 1U2SA 2H1CA 2HHHB 1RD4A 2NT3A 2NVOA 2YXDA 2C8LA 3OTOO 1FQKA 1NF8A 3OICA 4EI8A 3IBTA 3KVOA 1RYMA 4YMVA 2NV6A 3H0CA 2IYXA 3LBFA 3V8PA 4EJ0A 1X6VA 1F0KA 3T3EA 1GZ4A 4KQCA 1E79D 5ALOA 3OLCX 2NO0A 1T3HA 3GLGB 3JQBC 2OV2A 2BIFA 3KWMA 2X7RB 2Z4SA 3SGIA 5ALEA 4MKRA 5KTMA 4ITVA 4FZ1A 2OD2A 4Q0MA 4XD7A 4D7SA 5EFZA 2DHEA 4JWTA 1VE1A 4E1VA 1N77A 2HUNA 4KE7A 1ENPA 2HIAA 2G38A 2XWBF 2IDMA 1KI4A 2PL3A 2ZDGA 3USCS 5KOIA 4ENTA 2ECFA 1MAWA 1SXJC 2FPKA 2JLAA 4ZYLA 1JJBA 4C4RA 1W4LA 2B21A 4BU0A 4JR1A 4ZPXA 3NHZA 3FR8A 4X1IB 3GVXA 3NM4A 4OATA 4RFVA 2ZBUA 2PFKA 4B45A 1Z3IX 5D3MA 1JZTA 3R7FA 1W48A 3GJ3A 5LP6C 4IJVA 3E05A 4JKYA 2XNDD 2CK3G 1KUQA 3H04A 4DMLA 1UMCA 1A9QA 5J3JA 4X65O 3GUVA 1GVHA 5IT4A 1S3SA 5GY7A 3E9ZA 2XOKD 2FPSA 2ZDIA 1WB8A 3DA8A 3EG9B 2Z3JA 1WUJS 3ETEA 1OFTA 1SG6A 1ZK1A 1CZKA 5B1NA 4QPNA 1AKQA 4XX0B 3U3JA 3QQ5A 1XTRA 4AJNA 4EZBA 4OLAA 1BKYA 3WV5A 1N6IA 2NAFA 2GWRA 1SCDA 2HJGA 3I34X 1BRMA 3IRUA 2W2OA 2VZEA 4JT8A 1M90W 1COWA 5AKKA 5F1YA 3HCDA 4CM9D 3KKKA 3ABSB 1ECBA 4DEVA 1V5EA 1UR5A 4BFYA 2XIQA 4I9FA 3T5AA 2EEZA 3PFBA 2JEYA 4JC0A 4ER6A 2GZ1A 2WKSA 3NYWA 2I6SA 2YW9A 3NBMA 4GLBA 5BN4A 5IABA 1R6KA 3B3JA 4WN3A 3C8DA 4Z2WA 2OCPA 2CMKA 2RCNA 5KTSA 3OZFA 4I50A 2PRZA 3TZCA 4MHSA 3UFXA 1A8UA 2P1ZA 2V65A 3KYBA 1L5HB 4AZWA 1W85A 1Q1BA 2VDRB 4ZTUB 4LBZA 4BOYA 4NR1A 1H66A 3C4JA 3KEOA 3MHPA 3NTXA 6PFKA 1CB7A 3JQAA 4YGYA 1ISMA 1TLFA 3AF4A 3Q3VA 4GT1A 1SHZA 1V37A 1AR5A 1X9IA 2L6LA 1KI2A 2R8ZA 4Q6WA 4ZV9A 3C14C 3BB4A 1HZJA 3RIMA 4B46A 4Z2AA 3LDHA 3P97A 1GM8A 1PR5A 1VE6A 3IUNA 5LMNO 3CCCA 2W6IA 3DLPX 4FOSA 1X92A 3O38A 3ODGA 1QCCA 4TKUB 1NULA 1RC0A 4TS9A 1ZR4A 2DPHA 2C97A 1R64A 1AV6A 2ZWOA 4QUDA 4RH3A 2QS9A 4FGJA 2DYSC 2OWOA 5FADA 2A3QA 4HXGA 4DA0A 4CQMA 1DRVA 3W6UA 3SHTA 3V7FA 3LTNC 2VTVA 4HGNA 1Q5OA 4DTIA 2CXTA 3RIHA 3CP1A 5HS6A 1E3SA 1TJ4A 4I4IA 3O8NA 1QCEA 1LBSA 2ZR8A 3GJ8A 3IIMA 3R3VA 1QZ3A 2ASEA 4BQEA 4PSCA 2DN9A 3DAPA 5AICA 4DIBA 2Z09A 1KL7A 2HLDA 4JL8A 2C3PA 3FYCA 3ZCCA 3B53X 5J23A 4GPTA 1YL7A 4P2GA 2NZUG 3TGUH 2AFIB 3HS3A 3GLGE 4R71A 3DR5A 2KB1A 1DXYA 2B1QA 3CXUA 4NRDA 4R7GA 3L8GA 4M98A 2B37A 1ZL2A 2V8BA 2E4XA 1BIFA 3DAOA 2CLIB 1OX6A 4R5MA 4IL5A 4R05A 4X9XA 1RVDA 3ROTA 4DV3B 5AKZA 3RHSA 3LUGA 1PLJA 3T7TA 1XMSA 2A9PA 2ZXFA 4QULA 5T6BA 2ZK7A 4BIIA 1E0AA 1Z5UA 4HMPA 3ZHOA 4WKCA 3DE5X 2X13A 1YVUA 4JP1A 1J8QA 4JBIA 1BE1A 3LD9A 1KHHA 1W1UA 4LEIA 2SNIE 4MR7B 4NG4A 3ZY2A 4D0GA 2BSKB 3JQGA 3NLLA 5DTQA 3L3BA 1SC3A 1UDCA 5C80A 3A1SA 5KX5B 3QENA 3O5AA 2HF2A 1ZU4A 3AUXA 5ITZB 1BOOA 4B6OA 5A9RA 1FXSA 1XU4A 5B6IA 1Y48E 2AXPA 4LQCA 1Y34E 1C41A 5FBHA 1LI7A 2EJBA 2JGKA 4K28A 4ZAXA 2O0JA 5LMUO 4OCNB 3LO5A 4CBCA 4EJSA 4OKIA 2YWEA 1JHZA 4TKMA 1AA6A 2XUJA 3PSAA 5BVHB 4UNRA 2ISSD 1H8EA 4BO2A 1KBZA 3FPHA 3K1YA 3ONNA 3ZDBA 1NXSA 4BZWA 1N3YA 3QP9A 2HMVA 3F46A 4AVYA 4B3TO 4WLFA 3DMGA 2DJIA 4UEQA 3X3HA 4EUEA 1RQ2A 3JCUZ 1W8DA 3ILYA 5SYMA 3JTEA 1ISPA 4AMUA 5L3VA 1E4YA 4E08A 1LDGA 4PDMA 3RBZA 2DFPA 3C98A 3CONA 3VZCA 5HK9A 2JLUA 4TSFG 3ABUA 2WIFA 4HZUA 3Q8KA 1YRYE 5LQRA 2HV9A 5CITA 1M74A 2EIKC 3K1AA 3RIEA 2QLFA 5E0KB 5KTKA 4GXTA 5KYTA 3K71B 3GFBA 2JLQA 1ULHA 2SKEA 2WWTA 1ONSA 3HYLA 1P4RA 3OX1A 5C93A 3MXOA 4RFSA 5JALA 3W7SA 1XI2A 1XYGA 3QBJA 1GKIA 1P8AA 2JIZD 2LCIA 2P9BA 2V7WA 3A6DA 3P19A 3V1TC 2PS3A 1E9BA 3S81A 1Q14A 2Q5EA 5ES4B 4X62O 1KYQA 3BGSA 2YC2C 2DUJA 4B9AA 4HH0A 1RM1C 1MAAA 5CYGA 1X3LA 3HFGA 4ME6A 2YMLA 3E53A 3LGAA 4OV6B 5JJCA 1XMQB 2F43A 3MTJA 5JCOC 5IYCO 2W4QA 4GC5A 4P3KA 4WFEA 1X9HA 5CIQA 3S1AB 3SM9A 3TIGA 2X77A 2HB6A 4I3HA 1JHOA 3AF0A 1ZN2A 1MIOB 3M2PA 5A4MS 4EG5A 1JJ7A 3LXXA 3LVRE 1YRQA 4WXHA 3DL7A 5KYKA 3SJBC 1J8FA 3HACA 4D8WA 4PCVA 4G2KA 1UANA 2X3YA 3DTUB 2UXBO 2B5UA 2CXNA 3SDLA 1M3SA 2B4TO 1Q86W 1ZTEA 1T3TA 4KL1A 3JPYA 2XUPA 4UNIA 2R8XA 1VSTA 3TMYA 4IG9A 3C3AA 5FHRA 3UMJA 1ONNA 3WYDA 2Q29A 4E6PA 3NVAA 3PUXA 1B42A 3R77A 4GU5A 4QOJA 5FQOA 3LFHA 4B31A 3Q6MA 5ALUA 1CYDA 5KQMA 4OCNA 3GPCA 1XG5A 3A2FA 2P65A 2HWYA 1P1JA 2CE2X 3LX6A 4KOAA 4D45A 2B5WA 4N6NA 3OQVA 2D7DA 3K58A 3EG9A 5K3SA 2ODBA 4RD0A 2I2FA 2YQ5A 4CLDA 5BXYA 1QQ7A 3QXXA 1SOVA 2Q5QA 2ATXA 1NHWA 4IS2A 4J0QA 4A82A 2HTEA 1EJ0A 1VLZA 1NJ2A 3LDUA 3FRJA 1AQ6A 4GMGA 2X2FA 5F2KA 3OC6A 4QEDA 3IOEA 1B8NA 1Y74B 3UHFA 1ZNWA 1JSXA 3DTTA 1P17A 4J2TA 5EE9A 1FMFA 3SJ7A 3L92A 1Z6ZA 4Z9XA 2PUJA 3HUTA 1F1BA 1UAYA 1UC9A 3RVLA 1TZJA 2JJMA 2O8NA 4MICA 4RL4A 1BYUA 1Z5PA 1GYQA 1G17A 2Z3IA 3H1EA 1K89A 3CF4A 3SYRA 3ZVLA 4O08A 1QG0A 4HAUA 3L0ZA 3QLTA 2JARA 1SRQA 5JFOA 3DCJA 3CNEA 2QD3A 1KB9F 4I50B 4L4RA 2OG2A 2ZRJA 3UFXB 1QQBA 1E89A 1Y81A 4MYUA 1W85B 1Z2NX 3GRZA 4BXOB 2ISQA 1V4BA 1KAEA 1H9CA 3DFMA 4ABTA 1F4MA 4Q6BA 1JHMA 2A0KA 1OCZC 4PSUA 4YAIA 5J4VA 2B4AA 4MVYA 3IKJA 1KOLA 2XWJI 3TEJA 3BJMA 3CNBA 5IYDO 4NVRA 3ZHQA 2Y1XA 3KEGA 2O4UX 1SC1A 2AOWA 2P6OA 3NJ8A 2ETXA 1IURA 3IQWA 2HLDD 4L6AA 3FZEA 1QAMA 1ZRHA 3NHPA 4OXIA 5JE8A 3T9DA 5DB4A 4JQCA 1W5FA 3OTGA 1HF3A 1Q1AA 1NJ5A 3BXXA 2N47A 2IW5A 1YFKA 4QO8A 3QA9A 4TTJA 4XUEA 5EXPA 1JVSA 3TINA 4CQMB 1FLVA 4YP9A 1EFPB 2ORED 3TG8A 4BQNA 3LT2A 2NQ2C 1NJ6A 1RXCA 3C8UA 4YCDA 1B16A 1QIFA 2WD9A 2VPPA 4CRWB 5KYWA 3TXQA 3P20A 4Z1OA 1N8NA 1Q0TA 3SKVA 3K8ZA 1IMJA 1CBUA 1CQPA 3UHOA 2DSNA 1WX1A 5CM2Z 2IZ1A 1DKOA 4EQZA 3D6HA 5E95A 4ER7A 3BSWA 5JD4A 2HEPA 1I1QB 4WGGA 3E1KA 1BYIA 3U5TA 2UXNA 4JB0A 2ZSFA 1A1VA 1F2TA 2AFIA 2QF7A 2Z6VA 4KQXA 4L51A 4JMPA 1YI8A 1HC7A 2BBTA 2PAAA 5ILGA 2G5TA 5JNWA 4E1BA 2R87A 5I4IA 2ZNJA 2QMQA 4BGDC 3PUHA 1NNUA 4U6SA 5KSOA 4II2A 3PP8A 4HJRA 1RCTE 1PV0A 1S0UA 5FI3A 5D00A 4C0XA 1DEXA 1EU1A 1QV7A 4LZPA 1IAQA 1V2HE 3BSSA 3TCXB 5I8PA 4LQ4A 3V7YA 1XZ8A 2CHUA 2VNJA 2YHUA 1TO6A 1E61A 1C4XA 1KRHA 3P9QA 3OCJA 3MCVA 4MEBA 5LUBA 4HS4A 4DAEA 2AMJA 2WJ6A 1K4CC 1NF2A 4HDNB 3JQGB 5D84A 3WMXA 5IHPA 3PIIA 2P2ZA 2OY0A 3QMVA 1C4WA 1RTKA 3ZJTA 2M6YA 4RTMA 1SK9A 1VJGA 1E18A 2MYPA 2OYRA 1Q77A 1U7WA 5EP1A 4OK3A 4BB0A 4F97A 1VIYA 1YUNA 2INGX 2VH2A 2WICA 3BG5A 5JAQA 3SY8A 1VGRA 5EQTA 1B93A 2WOOA 3AF1A 2G1AA 3NTOA 5FWNA 2WJWA 3SLGA 3DFZA 5KVQA 4AC9A 4EJSB 2DERA 3W7WA 1TLTA 4HDOB 2ADOA 2X7XA 1OR8A 4N6GA 2I78A 1SR8A 2X1VA 4MLDA 3OEHG 3A14A 3AHCA 1OA0A 5IKPA 2I54A 3K79A 3PITA 4KWEA 1RYNA 2B0JA 3N8KA 5JY6A 5IYBO 3ZR4B 3L2OB 1E64A 4PV1B 3ONVA 3KO8A 4FHDA 4MI3A 3WRYA 4PZYA 5AKYA 5IZ4A 2J3LA 1T2EA 3PUYA 1LV8A 1OZFA 2J9RA 4GP9A 1SIBE 2F8LA 4JD5A 3RWMB 2H4JA 3MTDA 3CF2A 1XCPA 3QNEA 3GRUA 4P7JA 5LBUA 4BNZA 4L08A 4C1BA 3TUIC 5FV4A 4NTYA 2Y4UA 3VTZA 2A57A 2CZCA 3KYDB 3A2NA 4RUKA 4OGKA 1GH6A 3T1VA 4RFSB 5HKKA 3KQWA 2AG5A 2LD4A 1UPXA 1AS0A 1CY2A 1N25A 2FFJA 2L17A 4M1WA 3ZNPA 1Z6TA 1FMJA 2HX1A 4IV0A 5BYJA 4I43B 1X15A 3CVJA 3EBLA 3EEYA 2IOFA 5AJVB 2Z3ZA 4P92A 2CV1A 4HHEA 2R96A 3G49A 3GP8A 4ZT5A 3C1TA 2P7HA 3VR2A 2I6XA 1RBQA 4MX8A 3EIXA 2F43B 4TSFD 5I9SA 1K8XB 1RWXA 3SEQA 2AG0A 3DWIA 3S1AA 2DPLA 3EIOA 1B76A 3FGPA 3K04A 2Z5GA 5I7WA 3JQ9A 1XXLA 4NB5A 1OLXA 4KSCA 1JLRA 1KH3A 2IYEA 1OHHD 1YQGA 2JHGA 3HG7A 5FBRB 4Y7DA 4OF4A 1O87A 4NZMA 1WAZA 2YJ6A 4PG5A 1ZIOA 3L0BA 3S2UA 3KAPA 1MO4A 5JANA 2XB2A 2QVBA 3V42A 1N0JA 3ITEA 3UB4A 3OPXA 4TRMA 4FYWA 4P54A 3PEVA 3RC9A 5YASA 5IHXA 1C3EA 1JILA 3AG6A 5J2UA 1ZSYA 4GD3Q 2XF8A 5IFKA 5B30A 3GLIB 2Y0DA 4A03A 4OPMA 4HR7A 3ZE6A 4KBGA 2UUAO 1VLHA 1EX7A 1GN3A 2QLTA 4NV3A 3ZH9B 3ABMC 3K92A 4UCRA 4JKOA 5EZYB 1VMIA 2HDHA 4AS2A 1BXZA 5JBNA 4JI5O 4JPRA 2BOBC 2LKDA 4JJ8A 4OSOA 3RV4A 5LMNB 2NTYC 4F4HA 5J63A 5B3JC 1UX1A 2ZJ6A 2QMYA 3WK6A 4BFTA 1Y74A 1ZG3A 3ORFA 3W77A 1DEKA 4DLVA 1ZMXA 4AROA 3EHBB 1D3AA 4MMYB 4LF7O 1SFRA 3VU0A 4FZVA 2OHXA 5LCXA 2XYRA 1YE3A 1YCIA 4QGAA 1WUTA 2CBGA 3JR3A 3SJAA 1U8TA 4UARA 3W5UA 4KIUA 5IAEA 1KZHA 4TRNA 2I8CA 2CLFB 3ABQB 3TKYA 4JJ7A 1KOJA 1W1IA 2KPOA 4BPRA 3PHCA 3VPAA 1ARZA 2BI8A 2Y1FA 4FFSA 3D3WB 2NYUA 1R0ZA 5KMGA 5KUTA 3DXRA 1N6KA 3V00A 1L7VC 4R4JA 4BIOA 3ADCA 1HOTA 5BWOA 2HA4A 2VQFB 2OCBA 4JUBA 4L0MA 4W7HA 3TOCA 1F4VA 1NJGA 3Q11A 1M8KA 4QXRA 5I3ZA 4XPIA 4CGYA 1Z4PX 4B7EA 2EZ8A 3K5MA 2AX3A 1SUSA 4QHYA 1WZCA 4Z86A 4Z7OB 1TMOA 2P6MA 1TX4B 5E6SB 5D01A 4KFTA 5J2TF 1F7VA 3CISA 3T1QA 3KHTA 2O1EA 5EKDA 2RHTA 5IT9N 5LB2A 2YR0A 4MWDA 2DM6A 2AC7A 2V4ZA 2OILA 3AVOA 2J5BA 3I28A 3Q9NA 4BRUA 1GFWA 1VI5A 3M70A 5I9IA 1E20A 1OSNA 4OQQA 2JIDA 3JQBA 5B3SC 1HPLA 4KHZA 3K5LA 2N1BA 1XDZA 3GLHA 3MGAA 2EGGA 4TZ6A 3FNFA 1VGVA 1O3YA 2TMGA 2WJHA 3LDCA 3ZV7A 5KYWB 1R2QA 1UAQA 4ONEA 5HEKA 1IH8A 2OWEA 2VF7A 4G1EB 1DMRA 5DPMA 1XZHA 3T4UA 4WJLA 2NU6B 3OU7A 2HZBA 4NENA 2O5VA 5G0UA 3TJMA 5F77A 2YHIA 2JH8A 3PDUA 1YA6A 1RADA 4E5PA 4MK4A 5PGMA 1Q6IA 1KZ1A 3DZHA 5BN3A 1H42A 4AY5A 4XD2A 3ZXYA 1YIAA 2R7KA 1OHHA 1VYVA 3RU9A 5JD5A 5DYNA 4V39A 3C7KA 4HP8A 1WAMA 3DD1A 5LIPA 1PJ2A 1XNGA 2G67A 3HH8A 3U7GA 2Y0BA 3WP1B 2OCHA 1I3KA 3DGFC 5IVIA 4FX5A 4KLRA 1MJGA 3PC7A 4TSFA 4BX8A 1DKPA 4NXMB 1DJLA 1U2GC 3PXUA 4EL5A 1MB0A 1Q3KA 1MV5A 5DW0A 3NM6B 1AB6A 4PLWA 3SFVA 5M34A 4TMFA 4I0XA 1F17A 2CXRA 5BOVA 5L4SA 3SC2A 3TDNA 4AZ3B 3NYIA 4QYIB 1Z8NA 4BASA 2JVJA 5IMSA 2DU8A 5EMKA 5HQJA 1IQPA 3AINA 3RS0A 4AP6A 5IJXA 3DC5A 1U0NA 4OHUA 1JU9A 5TQJA 1I2DA 4JB3A 1KE1A 2C9YA 3QY0A 4IVQA 1RI4A 2RGNA 4QU9A 3VZRA 5KVSA 1D9ZA 2KMLA 2HFKA 4YUAA 1AKWA 1S01A 1TTQB 3PYMA 4CM5A 1AQUA 1I0IA 2EJWA 3K31A 2BH2A 4B0PA 1G3RA 1MJHA 2NTJA 3FSEA 4Y2UA 3UO3A 1KSJA 3I1IA 5CTAA 4CN8A 1PLLA 1YJQA 3IR5A 2HCBA 4DR1B 5ITSA 1C8LA 1C7IA 4LXXA 1AGNA 1JAYA 1K66A 2XT6A 3BEOA 4W4TA 1OI2A 2OGWA 1EFCA 2BEVB 2GPWA 4IFTA 1U2GA 2Y6UA 4Z4FA 1UC5B 4HXFB 2I3GA 2HLPA 2P5TB 2E37A 2WSIA 1EM1A 4TM7A 1ZCAA 1E2PA 2I67A 2REQA 1M6HA 2FI1A 3PQDA 4GNKA 4M1QA 1YGYA 2ZRBA 1ATIA 3C7CB 4BRSA 3CJQA 1GV1A 4BVLA 1S96A 1JFVA 2GO1A 3KYDA 4TKZA 3PNQA 5AKGA 3RD5A 1K5HA 3CWBH 3MWEB 3BDAA 4DV1B 2QI9C 4B47A 3ZI7A 4EARA 4KXNA 4IXNA 3E23A 1T9GR 3AEUB 3KQOA 3UK7A 4JDUA 4QKQA 4UEKA 5IT0A 2PKEA 1E79G 4LC9A 5L3GA 2GEKA 3G7SA 1BCRB 1HL3A 1XVIA 3W5CA 4GW3A 4B3HA 4M0UA 2X0KA 4MJ7A 5AI5A 3RFTA 4BL5A 3WO1A 1LDNA 2AI2A 3PJEA 2QE7G 5JSYA 3BSFA 2DBYA 1BMTA 2PZAA 3K0AA 5A5EA 2IKSA 3R4CA 1UC4B 4URFA 1PO7A 2XF2A 3OQJA 3OCXA 4H37A 2B99A 3Q7SA 2VCEA 4DIUA 3NHSA 3W3AH 1O96A 4X62B 1KMHB 1NYQA 1TAQA 2CLSA 1Z2DA 2G9ZA 4FFPA 2P6RA 4KVFA 2OTLV 1D2CA 1YE8A 4R2LA 1E5VA 5B57C 5L9AA 1Y1RA 4BQOA 1EDBA 4Q7QA 4BNLA 3ZV4A 1NG1A 3ZN2A 4CM6A 1ESNA 2BP7B 4R9VA 3FTDA 3GEIA 4RL6A 3JQDA 5F7XA 1BMQA 3VQVA 1C8BA 1EVYA 1M73E 2QRJA 5IDWA 4HQ0A 3GLIA 2VWQA 2JEZA 2WVAA 4D97A 3I5UA 1N92A 3H5LA 3ZWBA 4CTMA 2BE3A 3G9QA 2PT6A 1L3CA 2P9JA 1GUZA 2X0EA 4CDMA 4CHGA 2ZJYA 1M1YA 1CZLA 4IVRA 1QNFA 3L7KA 3UUFA 1B8VA 2H3OA 3TW8B 4HUTA 1CUSA 4B3SB 1O89A 3GZNB 1E1QD 2C42A 5IFLA 1S4QA 3CE6A 1HDCA 2VATA 2FE4A 1X1TA 1OBOA 3ZOKA 2VUUA 2PU5A 4RMGA 4MI1A 5EJEA 4IVPA 4I5GA 4YHHB 4FB5A 4C1NA 1FDRA 1BHQ1 5C1DA 3X1ZA 2DKNA 2FSFA 4FYJA 4YXWD 1U7TA 4KEAA 3UA4A 3JRWA 4C0QC 3EZ9A 1QH1A 3WL7A 1AVTA 5GJBA 4G0VA 1REQB 1IZ8A 1OYWA 5KMGB 4OHMA 3D7RA 3DXRB 3OD5A 3Q98A 4WLEA 4TTQA 2VHXA 1A72A 4KACA 2OO5C 5DYWA 3KHSA 4B3DA 1IPHA 1E3WB 4EBBA 3TPFA 3GU3A 4NHOA 3OZCA 5CT5A 2I91A 5HQTA 1YL6A 2I2XB 5EYPB 4LPSA 3BN3A 4A8TA 1L4FA 3Q2IA 4U7OA 3NCHA 1S72V 1VC2A 2C4HA 2XECA 2IHYA 1O94C 1P1HA 1HDIA 4C2BA 5BUSA 2ZM6B 1A5AB 4DR2O 1WOYA 3NWBA 4ZU3A 1KFKB 3B20A 4RZ3A 2YIDA 1QFMA 4RVSA 1RFYA 3ROFA 3OUFA 3H5VA 2B98A 3U7QA 3NDBB 3SWWA 2ZQ5A 3NHFA 4DJFC 2E1PA 2O4CA 4JI7O 1SD1A 1ZGGA 2I22A 3LLVA 3HCBA 1DKRA 5B55A 3MT7A 2I4OA 2NZWA 1CDOA 4X3PA 1MOSA 5CVUA 5GAOA 5G3YA 4BBPA 1U7ZA 3N05A 3DE7X 2RPZA 1TAEA 4Q20A 3J7AU 2JBAA 1ESDA 2D8AA 2J45A 4U7PB 3O4GA 3C6XA 2VN8A 4CH5A 1CUYA 2ENUA 5AYVA 4AW9A 4HV4A 4F3KA 4NENB 1XZBA 4A1FA 2W4IA 4DCOA 5BZBA 1HNZO 2FSUA 4L72A 1O0CA 4ZWNA 4KXQA 1V8ZA 1KPGA 4GBMA 2RHJA 3MLEA 2O7NA 3O03A 1GAJA 4ZHSA 1PR1A 3FSGD 2PK3A 1OXVA 4NCBA 1NMYA 4CEJB 3AHFA 3R8XA 4Z9FA 4JOCA 1DBWA 4HYYA 4GKKO 4LWZA 1Z88A 5IARA 1XVTA 2W2QA 3B9QA 3LY7A 2A0WA 2F3QA 2EX0A 4WFFA 5LDDC 5FX2A 4LXYA 1COZA 1FXKC 4R7ZA 1JYSA 1VP9A 4DA7A 5BSKA 3TW6A 3EIFA 1FNDA 1G98A 2VQDA 3PEFA 4TMWA 5B58T 1XLTA 4MAAA 3SC2B 3TR5A 3ZWQA 4AMZA 1AN9A 3QEJA 5BWBA 5IDXA 1A9TA 4AZ3A 3L40A 1N7HA 2W71A 3AUUA 4JXKA 3TQTA 1JKJA 2P62A 2OFWA 4N21A 1GJRA 2MINB 3IPRA 3QGMA 2DQZA 2ZTUA 4M83A 3F90A 4RHYA 3SN6A 3UAVA 4BKMA 3HJFA 2Y2VA 4NTZA 5ER9A 4MAFA 3AB7A 4TLCA 4U0KA 2DULA 3AK2A 4CKWB 1DWPA 4DLBA 4L3WA 3EIHA 3AVWA 4ZVPA 5H16A 1A8IA 4LCNA 3TFOA 3PXXA 1IXKA 1TB4A 1LUAA 1QBKC 2AE2A 2HRBA 5AUQA 2G5GX 2CL0X 4HRYA 2ZVQX 3I1JA 4LJ9A 2ZT7A 1FLAA 2XAGA 3E82A 3MS4A 4G65A 3AFHA 4JBWA 4H0LB 4B3BA 1H8ED 2DW4A 3NBYC 1QU3A 3FRIA 2GNAA 2BEVA 3GJTA 3DSQA 3AX6A 3JTMA 2XBLA 3CYFA 3RJZA 2Y0EA 5CA1A 3EZ2A 2PVPA 2B8TA 4IICA 3SVTA 5D5QA 1OXXK 4MMXB 2JI9A 1WQ3A 2B94A 3QO8A 3THYA 4NTXA 1G7TA 4PQRA 3STLC 4Y2RA 1E2UA 1LDMA 2Q3HA 2Q8PA 3E1SA 4I8DA 2D06A 1Q44A 2VVTA 1RP3B 4KYIB 3AJDA 5DGXA 5H80A 1UOOA 2PS9A 4RTNA 1G8KA 3M5CA 2J09A 3E9QA 2EFEB 1OASA 3EMVA 3U4HA 1XZPA 2GHRA 1NW5A 3Q7RA 2HU7A 1DKMA 1BCRA 2FWPA 4NU5A 3IURA 1T0PA 2GCEA 4M8IA 1T0UA 5TGDA 1WUHS 4G5QA 3VQTA 4BVGA 5HJEA 4WXRA 4B33A 1I8TA 3JAMA 1MQAA 1Z7WA 3GRVA 3NAQA 1P31A 1FE8A 2R79A 1S0VA 2VYNA 2Z2ZA 1TAGA 3K0AB 3WL8A 2ODWA 2WTAA 4ARAA 1DXOA 1JR3A 2VZ9A 4FFMA 2FKXA 3C15C 1UKYA 5E2IA 3VPCA 2DBZA 3LVBA 3UJ9A 2RIPA 2ZM5A 4U1RA 1WXQA 3WL4A 5JROA 2JBWA 1KH1A 3RYTC 1CJSA 4ARVA 3TEFA 1EM8B 2ZI6A 4NJEB 3TE7A 1RAGA 2DB3A 4A0QA 2HRRA 2YCLA 1GL3A 4GKJO 2BF7A 1BQ4A 5JDIC 2PAFA 2W11A 2BP7A 2Q3FA 5HSGA 1KNXA 2PFGA 8AT1A 3M83A 2FEKA 3D2BA 3ECAA 4QATA 4K8OA 1O95C 2FSSA 2HMWA 5HDBB 3GRAA 1X70A 4FQ7A 4XYEA 3A8TA 5FOUA 1W96A 3A25A 1RIIA 2X41A 3OHSX 5HKKD 1MUUA 1Q7BA 4P53A 1TUGA 1IXMA 3S3TA 1X3SA 1MT0A 2CMHA 4TMYA 3ZJZA 4F2HA 3K2IA 5AK0A 1PLKA 1GNQA 5CFZA 5DN6D 4I14A 1B23P 3D1JA 3UXEA 4EDFA 1RSOA 4EG2A 1JG1A 4G8BA 2ZD9A 1EB9A 1XZNA 2EZOA 1J0CA 1QB7A 4PBSA 1K6XA 1TKAA 1BXKA 1XRLA 3FCEA 3EIWA 2YJ5A 5DWQA 2F55A 2W6ID 3HZRA 1FDSA 2YV4A 2RMKA 1ODTC 1KF0A 1M8PA 1WN6A 3WRWA 2ZI3A 1ESEA 3AW9A 3TNJA 1ZRMA 4L7QA 4YHBA 2AEEA 3K5WA 5JSZB 3ZDRA 2CNLA 3OZIA 3L8ZA 1KP9A 4WK4B 4ESHA 2LR0A 4LF8B 3CPJB 3K30A 3OMAB 4QDXA 2JFOA 5DSXA 4XWOA 4YX9A 2DBVO 1QH1B 1B74A 3CVWA 4DDWA 1FFTB 3ZE9A 2O06A 4J3FA 1CERA 4JOSA 1E77A 2EKLA 5K8LA 3N2GB 2F17A 2IM9A 4KPFC 3DV9A 2LUOA 3IDFA 1IEQA 1QU7A 1WPQA 2BFFB 4WOCA 1M6EX 2H85A 1YJWV 3N9IA 1DB3A 1WVMA 4I7ZB 3ADBA 1HNXO 1KP2A 1IHUA 2O0LA 1QPBA 1XHEA 1DZ3A 2Q4DA 4NICA 4FDAA 1YIOA 3RQIA 2EYUA 1NVPB 3G9UA 1E7RA 1ONPA 3GLFA 3VU1A 1Z7BA 4GUNA 4EI9A 1TXGA 4F4DA 1S3JA 3ABZA 1P0CA 5JO9A 3I0ZA 3FB5C 2XB6A 2DTXA 2HY7A 3OM8A 1WTCA 1XWWA 2WDZA 4QRIA 2ZYIA 5EFOA 4KR3A 1NQWA 1GMGA 1WV0A 2G77B 2JFFA 1AZWA 1KK1A 2I8LA 3PQ6A 2GASA 4QWWA 5DK4A 2LCQA 2GXSA 4BV2A 3KVRA 1NV8A 4GXRA 4C6SA 4TV8B 3FPAA 5B1AC 1AKTA 3D3NA 4ERXA 1TAHA 1JW9B 1RCUA 1ZJYA 1NVPD 4GI1A 4G67A 4Y1GA 3FCCA 3INNA 5FL7A 1MABG 1XJCA 4KK3A 1A9YA 2NADA 3FZNA 4LOKA 5IBPA 4XDGA 1GFSA 4NNOA 3HE3A 4KO8A 1BEZA 2GN1A 4XSHA 2AFRA 3TM5A 3ZCVA 4CEJA 4G2NA 2IYVA 2FLKA 3MJHA 1KO8A 3UW3A 3UJHA 1ACJA 4UTZA 4HF7A 2F7SA 2RFLA 2ESRA 4KX3A 4J42A 1AXGA 3OH8A 1XTUA 2HNAA 1FUYB 2FZCA 2QWQB 2Q6KA 1R3KC 1WZNA 3IUQA 4OCZA 2OCDA 4HEHA 1JR6A 2WILA 1DE0A 2XMGA 4MW0A 3H11B 3ZBPA 1SIWA 3BEHA 2VHVA 4XRRA 4ASUA 2FMHA 1JQ3A 1K2WA 4EJ6A 1P80A 3SEZA 3VDMA 1E79A 1W35A 3BL8A 4H7HA 4Q48A 2WWRA 4EKEA 2B82A 3L0PA 1WW8A 5DN9A 3I5YA 1J21A 3COSA 4K0RA 3CEMA 1RQNA 2CDNA 4UULA 4CMHA 1WU7A 4CKWA 1OLSB 4YAEA 3N6XA 4GM0A 3UC5A 1P4GA 4A27A 4Z4IA 1GVNB 4P9DA 5CVTA 1QX4A 2JDID 1U1IA 2NO7A 3K5OA 1J9EA 2F1OA 3KZXA 2VSOA 4U5QA 3TYXA 3P3PA 5CA0A 3NHJA 5BMOA 4HRQA 1PBTA 3IA2A 3KAQA 5JSHA 2OENG 3IP9A 3ZVNA 1YTFB 3HCNA 1T0BA 4EW3A 2PV7A 2H31A 3HCPA 1XLTC 5REQB 3UJPA 2VXCA 3GRRA 3UTDA 4CM4A 5BQFA 4LISA 1T5HX 2QU7A 3JYLA 4EECA 1QG4A 2HJ9A 1OY1A 1IRXA 1ZONA 3L5KA 2EAUA 2AV6A 5FBQB 1ISGA 1KFBB 1DINA 4N0QA 3W9SA 1YJ5A 1ZGZA 1AHNA 1ZJ6A 5IJWA 1EBFA 3PR2B 2WWIA 3NUQA 4FKMA 1BU8A 2QX8A 4L8VA 3EE6A 5FWDA 1NHGA 5FR2A 1INLA 4G4GA 1VL5A 2ILTA 5LD2C 3NEPX 1H38A 5IM4A 1SQVH 2BFBA 2ZZMA 4IPTA 1L0BA 5B2ZA 3DC7A 4GWLA 4WV3A 4ZC8A 1TC2A 1NJ1A 2FZ4A 4BE4A 2AJTA 3IULA 2RI1A 3NHKA 2CGOA 4KQFA 1P2FA 3VZPA 1YRHA 1I1HA 1NASA 2XE4A 3K35A 4BNXA 2D2EA 3H9QA 4MS3B 3UK1A 1CY4A 1PWYE 3NRBA 2QTGA 4KU4A 4Q7KA 4WLVA 2Y77A 2Q0AA 3EPHA 4DCVA 4R1PA 3NUGA 4XDLA 1X7YA 4PFSA 4YAUA 4N5HX 1GFIA 2GHYA 1RNLA 2ZRDA 1WHSB 3EVNA 1ZXBA 3CE2A 4TL7A 1N6HA 2JFZA 5AJZA 4YRFA 3L93A 3OFNA 2I71A 1APBA 1RSZA 3TECE 4CKXA 1EM8A 5IC4A 1SRYA 1A4UA 2XMPA 3N28A 2OIEA 5J9PC 2XSZD 3AONB 3A31A 1X7XB 1GV0A 3H6GA 1OI3A 3FPKA 3HV2A 3LECA 1EEHA 3LDGA 1ZO8A 2FJUA 4MCHA 4YRLA 1JDPA 2PZFA 4LYAA 4C0WA 1NATA 3B78A 4JFAA 4R9UC 1RC8A 3RT7A 2EGUA 1SOWA 2YXLA 4Q4JB 5ESDA 2FPRA 4O2AF 4BKUA 1AA9A 4RLFA 4EYQA 2XNJA 5F1KA 4PHTA 2IU6A 2CTWA 4UPDA 4CKBA 1MOZA 1EGAA 1C9KA 4DO2A 1AKUA 4IMPA 1VPLA 1UOEA 1GILA 4QVGA 3QOXA 2RGRA 1ORIA 1I0HA 4COOA 1RSOB 3MGGA 4K6KA 4PDVA 2G76A 3SZMA 3T12A 1U8XX 3G17A 1V54C 1XJWA 3NDJA 3R6TA 4D74A 5JS1A 1JHYA 2AVDA 2LBPA 4Q66C 4X24A 1QYRA 4PWYA 2C4UA 1SXGA 5DNDA 5K0NA 2FWJA 1FTNA 1JGTA 1QC5A 4OYYA 3CJHA 4LH6A 1P7ZA 3F9CA 3TIVA 1N5KA 2QQEA 3CE9A 1EP2B 1S2MA 1WSAA 4LRUA 1QCDA 3S68A 1P3Y1 2CVQA 4RKEA 5ALTA 2XCOA 1FNNA 2BEJA 2JKVA 3V33A 1M8GA 3IQHX 1TLLA 1QIDA 3FCOA 2FUG1 1U5BA 3OCCA 3IOBA 3ORHA 3H4VA 2HVKC 3L1KA 2Z08A 1N2XA 1Y1QA 3VH3A 4MVCA 4DJTA 3UA3A 2ZJ7A 2NUBA 3M9XA 5LWQA 3K0GA 2EZPA 1GGMA 4F3WA 3D6JA 3N2GA 3I39X 3KUCA 5BQOA 1BZKA 1NY5A 2H1WA 4R50A 1LGYA 3B5IA 3EGDA 3U7IA 1JIKA 3EH1A 5J4YA 4DA4A 3WMWA 1IOLA 3CW8X 3M6MD 1Z0KA 3V97A 4J16A 5FO1A 4KXRA 3A6ZA 3FAVB 1RXUA 1P4HA 3L9XA 4JT2A 4H1HA 1G5QA 1TT5B 4NSNA 1UKCA 1JPJA 3ZRSA 5CW6A 2GBCA 1CUJA 4ZN6A 2AW9A 2MR6A 1Z22A 2R1UA 2YDXA 1PL0A 1JAIA 1BWQA 4FFWA 4FYMA 1R74A 4KAAA 4LC0A 1E0SA 5FUBA 3RJ5A 5KSYA 3SQWA 3LV8A 1DC7A 4P4UA 4B3MB 1ZWKA 3C3XA 5EMLA 3VKUA 4BO4A 5JWOA 2OZPA 1PR4A 3TW0A 3K70D 3U4QB 2KI5A 4RIGA 3BRQA 1MB4A 4GC9A 3B6MA 1O7JA 3OM3B 4LX0A 4NFYA 4YJ3F 1IHDA 3TOZA 5EIEA 5ENZA 4TV8A 2EJVA 5GW7A 2XJ9A 4PPFA 3WNVA 2AKEA 1U9JA 4XJVA 5DHRA 2GHQA 3K9BA 5SY4A 2VDPB 4FKZA 5KOJA 4M8LA 3LXMA 2YSUB 1G1MA 5EE0A 4LTNA 3STHA 1N4DA 1QFXA 1WOMA 2DQSA 1QWSA 2KJQA 2O0KA 4PXYA 3SBEA 4C3OB 5KVCA 4LMBA 4U0JA 1HTWA 2DCUA 1CDDA 2D3WA 3F4LA 4KOEC 2BDTA 3UYKA 1W36D 1OXSC 2I7TA 1FS0G 2WJPA 3PGMA 3JYHA 3QLJA 4KPGA 1VPWA 2D2VA 3DKKA 2QWRB 2VP0A 4HVTA 5P21A 2W0FC 5GTDA 3EASA 2QTTA 3E9CA 4IGFA