1PL6A

Human sdh/nadh/inhibitor complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
356
structure length
356
Chain Sequence
AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sorbitol dehydrogenase
total genus 114
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl6A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl6A01
3PYXA 4CMEC 4JNKA 4Z3DA 3O8QA 3HFGA 3O9ZA 1DPGA 4BOYA 3H9UA 3AWDA 3C1OA 2AEFA 4INAA 4FB5A 1DRUA 4IQ0A 2FPGA 2RBEA 3WGZA 5K6AC 1SO8A 3G49A 3DBVO 3IP1A 2Y93A 1GDHA 3KEOA 3K31A 4R1SA 1WWKA 5BNTA 2RH8A 1CIVA 1VM6A 3TN7A 4A5OA 3BMCB 2CF5A 3RBZA 3RC1A 4DC1A 4MVJD 1W8DA 2A35A 2W2KA 2W98A 3MWDB 4WPGA 1YBVA 4FN4A 3ICPA 5ER9A 4ZRNA 5G4LA 4WASA 5TF4A 4JBIA 1XELA 4JBGA 1RJWA 2O23A 8LDHA 1YJ8A 4YJHB 1GY8A 3VZSA 4DBZA 5L4NA 3OBBA 3NGLA 2WYVA 1F8GA 3Q0EA 4IS2A 4YT4A 4J0EA 2CZCA 4PG7A 1DIAA 2OP1A 4DRYA 1R66A 1PR9A 1PQWA 3JQAB 1JAXA 5C7IO 1DBVO 2LDXA 3VTZA 5FF9A 5A9RA 4WEQA 5TT1A 3GUYA 2ZTMA 1KOLA 4PLTA 5T6BA 1M6HA 1YDEA 2YQ4A 3G3EA 1TA4A 5TT0A 4CR6A 1OC4A 2AEMA 1LDMA 1HLDA 3QWIA 2EKLA 4TVOA 4CM1A 3M2TA 2I65A 2R00A 3MJSA 4LVUA 3ZU4A 1ENPA 3JD1A 5F3RA 4MIYA 4K6FA 3F5QA 2OL4A 2Q4BA 3I5MA 2CFCA 5ICSA 3HJAA 4RQTA 4S1VA 2RHRA 4IIVA 4B4VA 4B3IA 4IQ8A 1FDSA 1F12A 1B14A 3W6ZA 4ZN6A 3LC7O 4I9UA 1GV0A 1PIWA 5L3ZA 2CD9A 3ZNNA 4L4RA 5JYDA 2X22A 2CVZA 3JV7A 3IS3A 4IDEA 1NAHA 2VOEA 5JCJD 3QVWA 3VH2A 4CQLB 4H16A 2B37A 1GPJA 2EF1A 4TKMA 4G5HA 3WMXA 1GU7A 3LYLA 2EKPA 2C59A 3JSAA 3TDKA 1QYWA 1K6IA 3H9EO 1GUFA 3K73O 1JAYA 4E2YA 1NVGA 3JQ9C 1LSUA 1R15A 5DT9A 3DHYA 3F1KA 3WBFA 5IN4A 1Y8RA 3U4IA 3JQFA 3F9IA 4BVAA 1IZ9A 1GFSA 2NVUA 4L4XA 4CUZA 2VT3A 1HE2A 3PTZA 3BTOA 4BO8A 1LSSA 3IDSA 4Q9NA 3DZHA 1E92A 3ZWYA 4CM4B 1F14A 4J43A 2Y1GA 3FPLA 3ITKA 3Q2KA 1P1IA 4IJVA 3NRCA 5IZCA 3E8XA 4W82A 1YO6A 3LT0A 3WLFA 3VOSA 4QFDA 1OAAA 1CRWG 2A4KA 4CV2A 1XQ6A 3NJ8A 4RVGA 3WXBA 5JY1A 5DBIA 4BO2A 3AW9A 1A4IA 5TLSA 4CV1A 3WSVA 4B7UA 1UDCA 2PD4A 3DZKA 1DJNA 3F46A 2AHRA 3E9MA 1HKUA 4O5OA 4X54A 5F1KA 4A0SA 3UGKA 5IDYA 1KVTA 3GNSA 3S2GA 1U3VA 4MO2A 2D8AA 3OECA 1KVUA 1Q7CA 5T8KC 5IFLA 3OICA 5BSFA 2NVWA 3HDJA 1QKIA 1JU9A 2BGMA 2RCYA 2V7PA 3Q6IA 4URFA 2DFVA 4Y67A 1O95A 3LC1O 3AUAA 1ADFA 4GH5A 4L74A 5I7SA 5B37A 4AFNA 3SVTA 4DPKA 2VHWA 2FSVA 3KETA 1V9LA 5A03A 3RQSA 2LDBA 4IJKA 1R4NA 2UVDA 4R1TA 3MWEB 3QY9A 3BMNA 4UEJA 1NXQA 4FGWA 3AI1A 1ISIA 3VH3A 2E6UX 4MP6A 3PZBA 4ZQGA 3CXRA 3BHIA 3EY4A 3A4VA 3WGIA 3IIEA 5COQA 1ZXBA 3RROA 3OQ1A 2GN4A 3AUTA 4MJLA 4B8ZA 3S55A 3O8QB 2EW2A 3WJAA 1Q7BA 6LDHA 4TROA 3ZU5A 3VPGA 2X0IA 1R4MA 1YKFA 3GAFA 4CQMD 3IOYA 4D44A 4E13A 4HXYA 4E5KA 4N5MA 4UULA 2QYTA 1Q0QA 3C85A 3VPHA 4RJTA 2NTJA 2VRCD 5JE8A 1K5HA 1QLJA 3JQEA 3ZWXA 4RQUA 3LU1A 3EVNA 3QW2A 2WYUA 4YPOA 3BMCA 3T4EA 4IGEA 1E5LA 3K6JA 3KLPX 2W2KB 3OJ0A 1JVBA 5L4LA 3CUKA 2WM3A 1DJQA 1NVMB 5HBRA 4DIBA 1JQBA 4QUKA 4FOOA 4M89A 2R2GA 3EHEA 3P2YA 4YJHA 2A9FA 2YFHA 4E12A 2D3TA 5JDIA 1HYEA 3CINA 3FBTA 5IZCC 4JX8A 3JQAA 1NPTO 4M1QA 2GGSA 5COAA 4Y8VA 5CG1A 2Q45A 2JHFA 4GGOA 3NTRA 3RSHA 3U4DA 4BNNA 5HS6A 3D3WA 2O3SA 1BMDA 3WGGA 4UREA 2O7SA 3JQ8B 3NV9A 2PGLA 4XDYA 4FJ1A 1KVRA 5LDGA 3V1UA 3RUEA 4RPKA 4RVDA 1SNYA 2OZPA 3NX4A 4MP8A 3DWFA 1O9BA 2CDBA 1FJHA 1YQXA 5ES3A 4BGVA 3DOJA 4NFHA 1B15A 1LUAA 3L6EA 4ZGWA 2ZYAA 2Q2VA 1GQ2A 2W8ZA 1Y6JA 3DO5A 1PL7A 1MLDA 2O3UA 3PJEA 3PWSA 5MGBA 1D1TA 3UN1A 1E1LA 4P4LA 1LXCA 4PIVA 2Z95A 1ENOA 3TZHA 3PHHA 1GQYA 3F4BA 4CPDA 1EFLA 2YHUA 3PGJA 3A9WA 3WFJA 4EUFA 4D41A 1B3BA 1DIRA 4JP3A 4U0JA 9LDBA 3DAFA 4R54A 3OEWA 4W99A 3TPCA 3WTCA 1B2LA 2QRKA 3E6AA 3CMCO 1Y5RA 1RYEA 2BD0A 4NBRA 4IJUA 3P7MA 3PEFA 4FOSA 3OEYA 4R41A 2NVUB 1Z45A 1J0XO 1E3EA 3B6ZA 1A9ZA 4JN6B 1HWYA 4OSOA 1JKIA 1Q7GA 3H4VA 4EJMA 5BSEA 1T1RA 3H9GA 4CM4A 4WOJA 1YBMA 4B4WA 4BNGA 4B3HA 3I6QA 3L9WA 1V6AA 4LGVA 4PVCA 5A5EA 2HMTA 4BGIA 4M54A 4N7RA 4FQ8A 1HDOA 2PGJA 3I83A 1XYGA 2IODA 3PXXA 2ZQYA 2IZ0A 3KZVA 1YGYA 2EP7A 2C7VA 4IS3A 4J6FA 3ZDFA 1XLTA 3QP9A 2X7HA 3TZKA 2ZB7A 2IYOA 4Q3CA 1KEPA 2HJSA 1HE3A 1N7GA 1WXDA 1GEEA 1NVTA 3FSRA 3RUIA 4BO6A 4I5FA 2D2IA 3PLNA 4FJ2A 4PFJA 1WZEA 1IULA 5F1PA 4ALNA 4GLOA 2PWZA 5L7TA 4U0KA 1E7WA 4WLNA 3QIVA 3VH4A 4YDRA 5K6AA 1UUFA 1ISFA 2V6MA 3TF5A 2AMFA 2GN8A 3L0DA 2DPHA 1H2BA 4KWHA 4ND5A 5IF3A 3EMKA 4LRTB 1UJMA 1XDWA 1X14A 1N2SA 3TL2A 4CMGA 3NYWA 4RF3A 3KYBA 1JW9B 3JTMA 3UOGA 1N1EA 2G1UA 4D79A 1EVIA 4TZTA 1A72A 4Y9DA 4YJFA 2BF7A 1R4NB 2V6BA 3BXXA 5GY7A 3SXPA 3DBHB 1B3RA 5CDUA 2B69A 1NFRA 1GZ6A 4HWKA 4XQ9A 2A94A 4FDAA 3OA0A 4LCJA 4U5QA 2NU7A 4OOFA 4YJGA 1ZK1A 3CZRA 4HNGA 1I8TA 1JVSA 1R4MB 1LRKA 2HRZA 2VWPA 2VRCA 2O4CA 4I5EA 4FGSA 3EVTA 4B7XA 5L9AA 2HK7A 1YRLA 4Y6PA 2VHVA 4J49A 1EBUA 1V3VA 4TRRA 3ZWBA 4F45A 4PRLA 1LC0A 1SCUA 3WWZA 4E32A 5BR7A 3HNPA 3R6DA 4MVJE 4YT8A 4RVHA 5EERA 4DBVO 1UXGA 1O0SA 1U7TA 2FRDA 4XRGA 3ZGYA 4IDCA 1LDBA 3FCOA 4DXHA 4JXKA 4TQGA 3U09A 1QV6A 1DSSG 3AOEC 4DUPA 4J2OA 3E48A 4OAQA 3H2SA 2HK9A 3RI3A 4IZHA 1Q0LA 1EUZA 1VJ1A 3B1FA 3HB4X 4L4SA 2C5AA 2NQTA 1ZEJA 5T5QA 3DTTA 1GQQA 3D3WB 3RBVA 2JJYA 3DZJA 1YB1A 4GGPA 4TRNA 3ITDA 3QV1A 4OJNA 4BNHA 4F46A 4E33A 5HTOA 3DAPA 1P77A 3JQ8A 4O6VA 5HA5A 1E6WA 2B4RO 1U8FO 2Q3EA 3ON5A 3PHLA 3UCXA 2FPPA 5DZSA 1ISJA 3ETGA 3F6YA 4A26A 4IJWA 4EI2A 4NZ9A 4NJMB 3ZI0A 4OKNA 4L0QA 5BT9A 4RF5A 1A7KA 3GOHA 1ARZA 2X9GA 1EFKA 2XXJA 4FFLA 4ILKA 4LN1A 1L1FA 3E9NA 4CODB 1Q0HA 2CY0A 3RAJA 3RWBA 1M2WA 5G0WA 1SBYA 2WJPA 3GVPA 3GHYA 1UXIA 1QMGA 3G0OA 3KXDA 3JD2A 3RFVA 1Z75A 1LLQA 2AA3A 3UCEA 3WSWA 3D0OA 3QVTA 4EUEA 1E7SA 5L53A 1AN9A 2VYVA 3ICCA 1AXGA 3BTUA 2PZLA 3L4BC 2EHDA 2J3KA 3FF4A 3OQBA 1BTOA 1FDUA 3GEDA 4J7CA 5FI5A 2H9IA 1HZJA 2C54A 1O5IA 4DVJA 2HLPA 2X0NA 3I9KA 1D3AA 4XJTA 3VZPA 5ITWA 1DIHA 2GF2A 3WDSA 3OJEA 3ASUA 2EKQA 3DBLB 2J6IA 3F3SA 1U8XX 1S6YA 1NR7A 4XZ3A 4OM8A 4P4GA 5L4SA 1C1XA 2B0JA 4RDIA 4OH1A 1JWBB 1GYRA 3ZU3A 2QHXA 3ENKA 4E6PA 4FIZA 1HF3A 2YY7A 5F21A 4CM6A 1ZUD1 2OMEA 1DFGA 2B5VA 7ADHA 2FSSA 4OGWA 2JCYA 1VI2A 5ENDA 3TWOA 3GC6A 2EJVA 2QX7A 4AJPA 4DQUA 5KVVA 4TKLA 2HJRA 1YDWA 4EW6A 4NPCA 3SJ7A 1UDAA 2PK3A 3NDJA 1GUZA 1E7RA 4J0FA 3RBXA 1W4ZA 3GGOA 5T64A 3VC7A 5JY6A 1BSVA 3SC4A 2HDHA 1H9AA 2G17A 3VVBA 2P5YA 3WTBA 5F5NA 4OXKA 1HE5A 4RV9A 1FK8A 2Y1DA 3MEQA 2EGGA 3FNEA 4DA9A 1T2FA 3VZRA 4PLCA 2VWHA 2DVMA 5CDTA 4TZKA 2YHIA 4RLSA 4C4OA 5AYVA 3SEFA 1QSGA 3KSZO 5A4DA 1WMAA 3DQPA 3M6IA 1XEAA 2RHCA 4OXYA 1ZK4A 3IQDB 2YUTA 3DXFA 2YJZA 3ZV3A 3PGXA 4YJFB 1RM4A 5JBIA 3OH8A 1RWBA 3DBHA 4QT0A 1GZ4A 4XIJA 5KWEA 1P1JA 2VHZA 4BKQA 4ZQBA 5JLAA 3ZWOA 1WDKA 2FN7A 2P9CA 3E18A 1E7QA 3G1TA 4QFCA 2NU9A 1X13A 4YJGB 3KB6A 4BGEA 2QIOA 4F6LA 1YB5A 1VL0A 1KIFA 1YL7A 4KQWA 4BNLA 4WLUA 3Q11A 1B7GO 5U9CA 2DTXA 2G82A 3KSUA 2Y66A 1TEHA 3M2PA 4F3YA 2P4QA 1IHYA 1V8BA 3FTPA 4Z9YA 4Z6KA 4E2WA 4IPTA 4ITUA 4FCCA 1WP4A 1BW9A 1E3WA 3VDRA 1LEHA 3E5MA 2EJWA 1XQ1A 4P8RA 1OFGA 1F06A 3RUHA 3ZWWA 4OHUA 2NVBA 3A14A 3LT2A 3CMMA 3B1JA 3JQ9A 2O3TA 5ILOA 3ROQA 2E48A 1NFQA 4ONEA 3QWBA 2D1YA 3JQCA 4NMHA 4RF2A 2AQIA 1T2CA 2POQX 1VLLA 1PGQA 4AJKA 3INTA 3H6KA 1PJQA 3PJFA 4TSKA 1VL8A 5GMOA 1HYHA 2W2LA 2I76A 3FPCA 4HUJA 4CV3A 2Y0EA 4ID9A 1PQUA 1RM5A 1ZSYA 3OJFA 3DMYA 3NJ4A 4CM7A 2C0CA 2E82A 3D64A 2XF8A 3BZUA 3ZV6A 2Q1WA 4NJMA 5T57A 3U4HA 2PA3A 4R01A 5I9MA 4MVJF 4GX0A 3B70A 3CIFA 5HWSA 1GR0A 5JO0A 4UVIA 4O0LA 2I3GA 3UCFA 4KTTE 4R3WA 2GLXA 1E77A 2DLDA 1WLYA 4GL4A 1B8PA 3X2FA 1C14A 3UW3A 3GAZA 4UEKA 2DU8A 1VC2A 2P9EA 1W73A 2G76A 4GX5A 4NFYA 3AY3A 3ADOA 2Q46A 4J1TA 1CF2O 2C2XA 3ZH2A 3RUFA 3WGYA 5DDIP 5U4QA 2JL1A 1SEVA 3JD4A 1V0JA 4MKXA 1P1FA 3NDIA 2Y1OA 1RKXA 2DC1A 3D1LA 1OOEA 1Q1NA 3W8FA 4KMSA 1OC2A 3QWAA 4KUEA 4DLLA 1YQDA 2QZZA 4K28A 3DBLA 2ET6A 3A06A 3C24A 2YZ7A 4J7UA 4PLGA 4MVJH 1C1XB 4Q3AA 1LQUA 2DTDA 4FR5A 3GN1A 1IHXA 4YBZA 2WDZA 3C7AA 1WW8A 4A27A 2X58A 4KZPA 3UVEA 1QYDA 1IPFA 1EZ4A 4PLFA 4UUOA 4JROA 4LW8A 1M76A 3ZV5A 4BNFA 4CUKA 4XEHA 5TJHA 4BNYA 3QVSA 5T8KA 3E1KA 4Q39A 1P33A 2P9GA 4QXMA 1NHWA 1RPNA 1Y5MA 3RCBA 3DMTA 2PY6A 3SLKA 2VZ8A 4CLOA 2FWMX 2GDZA 4BKPA 4TRMA 1LQTA 4OKIA 1DHTA 5H82A 4ESOA 3VPXA 1I3MA 2BMAA 4LSMA 1BVUA 1B8UA 4XCVA 2BFPA 4KWIA 4DC0A 2VWQA 1KETA 1NBOA 2ZTLA 4RGBA 4HFJA 1C0LA 3AI2A 2HMVA 5K9ZA 3M1AA 3HFSA 2YHIB 3PYMA 2Y67A 1L7EA 1HT0A 5FFFA 2JKVA 1DRVA 4UVEA 3DR3A 1MGOA 4W4TA 5EQDA 4BB6A 5JSFA 1XU7A 4BS9A 3OIGA 3EDMA 4CUJA 3TJRA 4HFMA 4WCFC 4G81A 4D45A 4CLRB 2GYYA 4PRKA 2FZEA 2NQ8A 2PZJA 2GPTA 4ZHSA 5JAMA 2VYVD 1H6AA 3H9QA 2BH9A 5IAAA 3EGOA 1R16A 3M1LA 2D0IA 2X86A 5U1PA 4NFSA 3UF0A 2ZIZA 1H94A 3HG7A 1T1SA 4PG8A 1GADO 3C7DB 2PV7A 2GERA 4ND2A 3DL2A 4RCVA 4CLDA 1TXGA 3K5PA 4QQRA 4JJFA 1H2HA 4II2A 1U3TA 2VYND 3IJRA 3FNFA 5AXBA 5KCZA 4QO8A 3JYLA 4PLHA 1NQTA 3W6UA 3GLQA 3JQBA 3DEYX 1BW9B 1E3WB 1NR1A 1Z7EA 3V2GA 2JCXA 4PGFA 1EQ2A 4HFRA 1A27A 1GV1A 4Z3KA 2UDPA 3WGQA 3KVOA 3BAZA 1PJSA 4N54A 4RO0A 1LRLA 1KS9A 3KBOA 2O4UX 3HB5X 1MP0A 4XR9A 2EG9A 3EAGA 3V8BA 2UAGA 1WDLA 2CMDA 4KUGA 3PP8A 1E6EA 4WCDA 1MFZA 4IUYA 4GSKA 3ZHBA 2FZWA 2X1HA 3AFMA 3K96A 3BTSA 4KTVE 1RM3A 1ENYA 4NHEA 3LC2O 4H15A 1NM5A 4D43A 5BSGA 1C3VA 3FD8A 4CMEA 1LA2A 1UAYA 2H63A 4NR0A 5I8ZA 4OSPA 1SOWA 5A9TA 5CDSA 4GPD1 2Z1MA 1KC3A 4FFPA 3V1TC 3OMLA 3RFTA 4NQZA 1UXKA 1KEWA 3PLRA 3PQEA 1HDYA 2FP4A 4RVSA 3WG9A 2BI7A 2X5KO 2ZCVA 4XB1A 1K6JA 2BELA 4AL4A 2HMWA 3IKTA 1PZGA 1UH5A 3HHPA 1P1HA 4FC6A 4EZBA 2G5CA 1KERA 3C1TA 1P0FA 1HSZA 2CSUA 1C0PA 2ZB3A 4N18A 2CDAA 2IEDA 5TGDA 3IUSA 3KHUA 3WNQA 4S3MA 1HLPA 2FMUA 1NHGA 1M67A 3PWZA 3QVXA 4H7PA 4A2CA 4EBFA 4GX1A 3GA0A 3ZCXA 2VTEA 3GZNB 5AQ1A 1MG5A 2Y1FA 3ZU2A 3FI9A 1U4OA 5L7YA 1R0KA 5TNXA 3K92A 3WLEA 2DPGA 1EBFA 1AE1A 1LLCA 1NP3A 1UP4A 2EV9A 1YOVB 1T2EA 2AE1A 3GRKA 3K9QO 1K6XA 3INRA 3WJ7A 2AQKA 4MIOA 2Z5LA 1DFIA 3S2FA 1DC5A 1DFHA 2PKQP 1EDZA 4LVCA 2PKQO 1PJLA 5I9NA 1IOLA 1P3DA 2FPIA 4OOEA 2ZCUA 3ETDA 3L4BA 4PG4A 3DB2A 4I8XA 4N5NA 1PGOA 2VNAA 2X9VA 4GWGA 4BL5A 5JDCA 3MTJA 3P5SA 4ALLA 1PGPA 4XQGA 3HZZA 4DL9A 1G1AA 3RUAA 2WD7A 3ZWNA 3JCZA 4CLOB 1PJBA 3CPSA 3WR5A 3MJEA 3I9OA 2HMUA 3I9JA 4MP3A 3FBGA 2VRBA 3JYNA 2C82A 4DYVA 2FY8A 2X5JO 1XIVA 5IJZA 3B20A 4MPDA 3BHMA 5KJFA 4P38A 3H65A 1I5RA 1GYPA 1MG0A 4CLEA 1R0SA 3VZQA 1DAPA 2PGDA 1H6CA 3NT4A 4RPGA 4IINA 3ENNA 3V5NA 4YAKA 2OBYA 4BO9A 1DLIA 3OFSA 3JYQA 4WEOA 3EW7A 3ST7A 5KVQA 1DIBA 3KM0A 4BNZA 1YWGO 2Q2WA 4BO1A 3NTOA 4CLRA 4P22A 4CMIA 3CH6A 2J5RA 2PD3A 1ZK3A 3PQDA 5JC1A 3WS7A 4IDAA 4F6CA 3JQBC 3KYCA 4FC7A 5C5IA 5JS6A 1PQPA 1LDGA 1VPDA 2DQ4A 2ILTA 1SPXA 2PD6A 1IB6A 1G6KA 2XXBA 3HN2A 1LX6A 4PG5A 5IDWA 2WD8A 1R12A 1YS4A 3DZBA 3FWNA 1H9BA 2JAHA 1B8VA 4XKJA 1MXHA 4D3DA 1ZZEA 2QW8A 4JQCA 1AUPA 1IYZA 3PI7A 3W4JA 2DBQA 4YAEA 2J3IA 4QTZA 3ZWAA 1D1SA 2XAAA 1PL6A 3GPDG 1PX0A 3DZIA 1Z6ZA 1I32A 1ID1A 4NIMA 5DOVA 4BNVA 1ZFNA 2Y68A 1DC3A 1WMBA 3DOCA 4AJJA 3JQDA 1ZK2A 1VRWA 1UR5A 1UXHA 2HMSA 3EUWA 4WNIA 2P5UA 3C3XA 4ZJUA 3BA1A 5F5LA 1GCUA 3MCVA 2GO1A 4BMSA 1JWAB 5A3JA 2GRAA 1C0KA 5JW6A 2IE0A 5IZ4A 1MXFA 2OP0A 5JFOA 3NUGA 3DAGA 2DFDA 1MA0A 3WICA 1JN0A 3ZWMA 3U3XA 5K1SA 4J16A 4HKTA 1MFPA 1T26A 3LZ6A 3SX2A 1GUYA 1BHSA 3S2EA 3ZV4A 1O94A 3CSDA 3SC6A 5KTKA 4YEDA 5JCJA 1S7CA 1QLHA 2PH5A 3PZRA 3BMQA 4CMJA 5A06A 4CM9D 5TIIA 2NV6A 5G0TA 3DOOA 4IDDA 3T4XA 3W4KA 3R3SA 1NNUA 4BNMA 4HADA 4R4JA 5JXWA 3D5TA 3EK2A 5TC4A 2BGLA 4UUMA 1BGVA 2P4HX 1F8FA 4BO5A 3FN4A 4L9RA 1UP6A 5AXCA 4E2ZA 4B4UA 3VPFA 1E0DA 1GEGA 1W6UA 4D46A 2I5PO 1XR3A 4Q3EA 3IJPA 4XWYA 1MUUA 2R6JA 4AJNA 3U62A 2ZJ0A 3AOGA 5DCYA 3L9XA 3RU7A 4NK4A 3NTQA 2G0TA 4QO7A 1AHHA 1U5AA 1HDCA 1F17A 5H83A 2VT2A 3GZNA 3NEPX 5KNLA 4BKRA 1NQOA 3KYDB 4J1SA 2J8ZA 5JAZA 2O3RA 4R9RA 2BI8A 3WGOA 4WUVA 1VSUA 1YOVA 2GZ1A 1I33A 4K9DA 1YONA 2F00A 4XX0A 4JK3A 4EEXA 1VE9A 2VCYA 1DC4A 3RD5A 2DUUA 1IY8A 1NAIA 1XHLA 2B35A 5ICMA 3WNVA 2F1KA 4ZQHA 4CLHA 4J9UE 1K2WA 4GLLA 4PZEA 1I2CA 3UH1A 4YQZA 2C5EA 1GL3A 4NJOA 3EYWA 2WD7B 3U5TA 4GMGA 3PYLA 3Q9NA 3K30A 1H5QA 3HE3A 4BQRA 2I9PA 5JDIC 1U1IA 4QSMA 3N58A 1JDJA 1ISMA 3W8EA 2AE2A 4FSHA 1I10A 1ZJYA 3ORFA 1DAOA 4KOAA 3UUWA 4BNJA 3U0BA 1KVQA 1U3WA 1O6ZA 3HSKA 2I99A 5B4VA 5EQFA 1A5ZA 4CMBA 3LF1A 1VJTA 3ZNOA 2RIRA 5B12A 4IQGA 2GUGA 1DO8A 2DBRA 2E49A 4IXTA 4Z9XA 4XYGA 5GZ1A 2ZATA 3GVCA 3S2IA 3GN2A 1JKJA 3I9NA 1LTHR 4I5DA 1MB4A 4UVHA 5L51A 4LMRA 4RZIA 2X5OA 2ZB8A 4IDGA 4CMIB 1Y7TA 2DM6A 1PJ4A 3KYCB 1Y9AA 4CMCA 1KY4A 4JGBA 2X4GA 4NNJA 3NGXA 2AQ8A 1H6BA 1WVGA 4XA8A 4RVUA 4PLYA 4EITA 3HQ4O 1BXGA 2BFOA 3B1KA 5THKA 3VTFA 1X1TA 5JYEA 3ZWCA 5AOVA 4OQYA 1SMKA 1ZMTA 2GN9A 3OJOA 1U7HA 4DPLA 1EVZA 4DIFA 4J4TA 3GG2A 2GR9A 4A10A 4E31A 3G17A 5BNIA 1E7MA 1R6DA 4K6CA 5EJ2A 3DFZA 3ZHZA 4HV4A 4C7JA 5TSDA 1K0UA 2TMGA 4YXFA 1T2AA 4PLWA 5A04A 3DFUA 3QA9A 1EEHA 4JJGA 5EIOA 4CV0A 3GDGA 2J3HA 4AJEA 2DBZA 4CM3A 1E1MA 1WAMA 1KYQA 1PS0A 2ZQZA 1DLJA 1YJQA 1I2ZA 4EUHA 5DOZA 3ZN2A 1E3LA 3D4OA 4FFNA 3PHGA 1XG5A 2A92A 2PZMA 1ZSNA 3DZFA 3BHJA 3TZQA 2OGUA 4A73A 2QYSA 4AICA 4B79A 5L7WA 1JTVA 1LDYA 1ZIDA 4LSWA 2Y1EA 3CE6A 4DPMA 5CEFA 4R1UA 3MZ0A 1OBFO 5EESA 5CPBA 4RL6A 1SB8A 1ENZA 4FFMA 2Q1UA 4LMPA 5A02A 3D4NA 3PHJA 1VKOA 3I9MA 4P4NA 1ZBQA 3WFIA 1OZAA 5TJ9A 4TRJA 2O7QA 3BMQB 1ZK0A 3GNTA 4JP2A 2PLAA 2CNBA 1MC4A 2WSBA 3NKLA 1LLDA 3PJDA 1PZEA 3TOXA 1QRRA 5CDGA 1I01A 1P0CA 4UUNA 4BKUA 1NPYA 1YBAA 4KP7A 3PFWO 3TRIA 3L6OO 1J4AA 1E1NA 1TVEA 2AG8A 2HU2A 3NDRA 1QYXA 4NI5A 5AXDA 1R0LA 4MKZA 1NYTA 3NT2A 2UV8A 1EQUA 1ADBA 2PKRA 2JFGA 4RF4A 3I1JA 4ZU3A 3HWRA 4XD2A 3GHHA 1CERA 1N1GA 4KDEA 3FTNA 1HTBA 4C7KA 3RFXA 1IL0A 3GPIA 1H0KA 1UZNA 4BHTA 4R69A 1IUKA 2YDXA 2QRLA 4PG6A 4Q3NA 1I2BA 4WKGA 1C0IA 3KYDA 4GMFA 1ULUA 2NM0A 1EE9A 2GCGA 3KOUA 4BV9A 3AY6A 3TSCA 3UICA 5CFZA 2WE7A 3SLGA 5ENVA 2NSDA 5CEEA 3T7CA 1CDOA 3RKUA 4DMMA 2JCVA 5I9LA 1E3JA 4RORA 1PSDA 4B4OA 4FW8A 2PFGA 4CMKA 3N74A 3ZZNA 4A7PA 1DOHA 1Y81A 1LSJA 1EK5A 3AJRA 1MX3A 2J5QA 8ADHA 5JPIA 1RYDA 5BSHA 4E2XA 2JAPA 2EEZA 1VL6A 2D4AA 2I3AA 4PLVA 1JLLA 4R1NA 4CM5A 4GWKA 3WGTA 4BO0A 5DN9A 4DQVA 2IXAA 2YFQA 2YW9A 3KV3O 2B36A 3AM4A 5C37A 1D8AA 2IRWA 3QVOA 2H6EA 2W4QA 1O89A 4IXWA 4RPHA 4TMFA 1CQJA 1PTJA 5AXAA 4WECA 3WQRA 1QYCA 2HK8A 3FHLA 1N7HA 1YE3A 2NACA 1HETA 3H8VA 5BNFA 5KJEA 2ZYGA 4YACA 1YL6A 1PJTA 2Y1CA 3UFXA 4EGFA 4RZHA 2GNAA 3O26A 4E30A 5G0VA 4GKBA 1NTOA 5JMPA 1LRJA 1GPDG 1T4BA 3QHAA 2EGHA 4XDZA 3W4IA 3OA2A 1PR3A 1MC5A 4MVJP 4BNXA 5I7VA 5KKAA 4DTIA 3OM9A 2JD1A 1C1DB 4WOKA 1B26A 4DLAA 1ONOA 1BXGB 2E4AA 1Z74A 3AK4A 2HRBA 3AM3A 1KVSA 4H3VA 3ROKA 2X8LA 1J6UA 3ANNA 4GKVA 2NU6A 4NBTA 1P9LA 4IIUA 1PU2A 1NX6A 4J4HA 1CEQA 5KOIA 5L95A 1E3SA 4J1QA 4YWJA 2VQ3A 3GNQA 3TFOA 4AVYA 4FD3A 3MJVA 1U9JA 2HSDA 3GVIA 4UUPA 3UXYA 2RH4A 4WLVA 3I9LA 1M6WA 1KY5A 3UKOA 1KBZA 1QP8A 3H9JA 5LDHA 4LISA 1EK6A 1WPQA 2DTEA 1UXJA 4I5GA 3RUCA 1YQGA 5HM8A 1V3TA 5DCWA 3GH3A 3NAQA 3N7UA 3VH1A 2C7GA 3WX0A 3WWYA 4LK3A 4EJ6A 3QSGA 4XQEA 1ZO8A 4FFOA 5CAEA 3STHA 5CP8A 3QWFA 4YVFA 3IP3A 2QRJA 4D0SA 5COBA 4W9NA 4D0RA 4ALKA 4BNUA 3I23A 1H6DA 3KRTA 5J23A 5AVOA 3OIFA 3GK3A 4YAJA 4ALJA 5JNLA 2HQ1A 1E5QA 2HKIA 1T25A 2WWRA 5GZ6A 4BMVA 4BGUA 5JC8A 5CPFA 1LDNA 3DTYA 2YV2A 5EPOA 1PJ2A 3I3OA 4YJDA 3RVDA 1N9GA 2O3QA 1DB3A 1I3NA 5KJ6A 1XU9A 4BIIA 3KLMX 4DMLA 1VSVA 1UDBA 2WE8A 4IZIA 4A03A 4CL8A 1U28A 5IN5A 4BB5A 3WOHA 3TFQA 2EIHA 4K26A 4PCVA 4XIYA 3KUXA 4DIOA 4AJ1A 4L8VA 3BYZA 1TB4A 1NPDA 2RAFA 4JIGA 3HN7A 1PEDA 3KSDO 3TZCA 4CMHA 5GZ3A 3VKUA 3D7LA 4R68A 3EZLA 1XKQA 1NWCA 1ADGA 4E5YA 3Q9UA 2ZTVA 3ZNPA 3LLSA 1GAEO 5ADHA 1EVJA 4Q3DA 4R9SA 3WBBA 3LF2A 3LDHA 5EINA 3GFBA 1X7HA 4E5NA 5T67A 2PR2A 3FRJA 2X9NA 4ND1A 4BNKA 5KJ1A 4ZQEA 2NNLD 3JYOA 5DP2A 3JQGB 3DHEA 5DF1A 3H5RA 3GZ4A 4FBGA 4BKOA 2VUTA 4BV8A 1Y1PA 3KTDA 1VKNA 2P2SA 3QE3A 3IL2A 2B4TO 1EUCA 4BO4A 1YH3A 5A05A 3E9QA 1HYGA 4R5HA 1UZMA 3GEGA 3GR6A 3LQFA 1O8CA 1ZXLA 3DDNA 1HDRA 4M55A 4ALMA 4I9HA 4NBWA 2BFMA 4MOWA 1X0XA 4CL3A 1ONPA 2IDZA 3F47A 1WZIA 4QECA 4IMPA 2JFFA 3ANMA 4YTEA 3MTGA 2CF6A 1ZW1A 3R1IA 5C7LO 2NTVA 1ISHA 3WIEA 1XWFA 1BXKA 4CM8B 3R3JA 4CR7A 2VHXA 4HBGA 4I08A 1BWSA 1F0YA 4YT2A 5TRTA 4XGIA 1QR6A 4GVXA 4DYDA 3LK7A 3BMOA 1KEUA 3HADA 1IPEA 2C07A 1N5DA 1X0VA 3GY0A 1QG6A 1ZJZA 3JQ7B 1IE3A 3PFFA 5IG2A 4ALIA 1EDOA 3PDUA 4WNCA 3O03A 5JCXA 4I1IA 1BDMA 4NDNE 2Y05A 1HEUA 1PL8A 1C1DA 1TI7A 4LRSB 3VAZA 7MDHA 4YAGA 3O38A 4E0BA 4R3NA 1HDGO 1U5CA 3D4PA 3G79A 1KEVA 1D4FA 3H2ZA 3VHRA 3L4SO 4PN3A 1DC6A 2TMDA 1ZCJA 2X6TA 5A3VA 2CVOA 1DXYA 2IZ1A 4ND3A 4E3ZA 3IC5A 1IZ0A 5I7EA 4CR8A 2X23A 4Q3BA 2EWMA 1SAYA 3I4FA 2VYNA 3NT5A 5JAQA 4NH4A 3RC2A 3GQVA 2Q49A 2GASA 2NUAA 4XB2A 2OXIA 3WYCA 1QORA 3OETA 1TT7A 4E5MA 2D5AA 2HCTA 3GT0A 2BLLA 1WNTA 1W0CA 3JQ6A 5KVCA 3H7AA 3FWZA 3QWHA 2W2LD 1ZNQO 5DBGA 4EDFA 2FR8A 4AJ4A 3Q2IA 5C3MA 1CETA 2C20A 5KIAA 3IUPA 4WCFB 4KQXA 5H81A 1DEHA 4WK6A 1SOVA 4XYBA 1GD1O 1HE4A 3S8MA 3SJUA 4EEZA 5B4TA 5TS3A 4JCOA 4J1NA 1P45A 3QQPA 2ZYDA 1WDMA 3UAGA 2YV3A 5DP1A 4DGSA 2AQHA 4MVJI 1GTMA 2O2YA 1PS8A 3LVFO 4GI2A 1ZSVA 5CG2A 2ZTUA 1LU9A 3I6IA 1NQ5A 3GGPA 1AHIA 3L6DA 2VHYA 1N9GB 2I66A 4YRBA 1P1RA 1Z7BA 4J91A 2YYYA 3CTMA 4DQXA 1ISGA 1R37A 3KO8A 4OO3A 1QXSA 3AUSA 4IDFA 4OQZA 1HRDA 4WLFA 1PJCA 2GZ3A 5KJCA 3PQFA 1DDOA 4ZQFA 1YVEI 1Z82A 1NQAO 3GMSA 4HNHA 4NBVA 1CQIA 3UHAA 2OO5A 3E5RA 4D42A 3GG9A 1U2GA 5F1OA 3HDHA 4UVDA 3OF2A 2C2YA 4MINA 4OMUA 3TQHA 2WYWA 3Q1LA 4YCAA 4J2HA 2FHSA 2JD0A 4DWVA 4OYRA 5I8WA 3CZMA 4MDHA 3ANLA 2V6GA 4NG5A 5JO9A 2EERA 1ML3A 3V2UA 1PJ3A 4U6SA 4ZVVA 1G0OA 3BTVA 2CUKA 2VZ0A 1TT5A 4BUCA 4I9NA 2V65A 2NLOA 1ADCA 1B16A 2J3JA 3FNHA 3PIDA 4R5MA 3E03A 4XYEA 1K89A 2IYPA 2AXQA 4WJZA 3ETEA 2NWQA 1AXEA 4NU5A 5BQFA 4YA6A 3KEQA 2GZ2A 3F1LA 3D3EA 5EN4A 4ND4A 3JQGA 3A28A 3MJTA 5G4KB 3E82A 5CHEA 1P44A 6ADHA 2BGKA 1FF9A 1UZLA 4KUHA 4W7HA 4RDHA 3LSYA 4MVJG 4B7CA 4FS3A 3INGA 3QRWA 1T2DA 3TZ6A 3FR7A 3H3FA 2EXXA 5HS4A 2IZZA 1PZFA 4J3FA 3DMTC 5EMHA 2Q1SA 4D7AA 4YR9A 4J9VA 1HL3A 1A71A 2C29D 4PLZA 1XGKA 1UAGA 3GUCA 3VVCA 4HP8A 4LCEA 3W1VA 4YB8A 3ABIA 4N5LA 3QJ5A 2EP5A 2VWGA 3WYEA 4CM8A 2P68A 4AG3A 2YDYA 4AJIA 1NFFA 1P1KA 2GD1O 2QZ9A 4L76A 3PWKA 1DHRA 1XA0A 2AEJA 3OP4A 1DIGA 1HSOA 3AU9A 3BMOB 2GN6A 1N92A 2VUSA 4J90A 2DBVO 4XQCA 3WIDA 3OJLA 3JQ7A 4JLWA 1NASA 4M49A 1KC1A 2EW8A 4UAGA 5FWNA 5IXSA 1PWXA 2SCUA 3OHSX 2UUOA 4ROSA 5G0UA 4E21A 4NU6A 4B8WA 3AI3A 5CEJA 1FDVA 2D59A 2X0RA 4PLPA 1JA9A 3DONA 5C7OO 2OFPA 3H5AA 1U3UA 3GVXA 2J5KA 1TLTA 1E6UA 4WGGA 5HRUA 4D3SA 4XRRA 4M87A 5A9SB 1ZVMA 3JQFC 4U7WA 4XYLA 2X0JA 5JAIA 3LLVA 3OSUA 4NBUA 4W6ZA 4M8SA 4IMRA 1QYVA 4XR4A 3H5NA 4R51A 3V1YA 1A4UA 4XYMA 3P19A 3WQQA 2WEKA 3T7EA 1OMOA 2DAPA 1PWZA 4AJOA 3A1NA 2O2SA 1LBEA 3GMDA 2PNFA 4L75A 1EUDA 1EVYA 5LC1A 3WQSB 5EL0A 4Z9FA 4UEOA 3Q3CA 4PZCA 1CYDA 3VPSA 4Y98A 2I6TA 4WCFA 4CQMB 1FDTA 1SZJG 3K2EA 1PGJA 2DT5A 1LJ8A 2OORA 2Q2QA 3RC7A 1I30A 3EZYA 2B4QA 3ONFA 3ZW9A 3DBRA 4HX5A 3U49A 1K3TA 3WYBA 1ONNA 4Z0TA 3GGGA 4HFNA 2VZ9A 3U4CA 2YQ5A 2Q50A 4TVBA 3JD3A 3JD0A 1LDEA 1LLUA 3HUDA 2B5WA 5FI3A 2OHXA 3PJGA 1H93A 4IBOA 3P2OA 2UYYA 1GCOA 5IDXA 3R0IA 4E4YA 2O3JA 4TWRA 3MOIA 1EMDA 1PS9A 3TNLA 4YT5A 2HUNA 2VTDA 3GF4A 1LNQA 4U6QA 4YAIA 3C8MA 3ZNQA 1HDZA 3RJ9A 2CDCA 3IMFA 4K1LA 1X15A 2XPCA 4JBHA 1I24A 1NWHA 2GSDA 4MIEA 3RU9A 3V2HA 4O1MA 1ULSA 4J7XA 1G0NA 3ZWPA 4PZDA 1I3KA 2ZB4A 2BFAA 5FYDA 2PZKA 3TOZA 1P74A 4G65A 4ZD6A 4G2NA 5L40A 1CJCA 1T24A 1Y8QB 2HO5A 5ILGA 3RJ5A 5G0SA 5MDHA 3AU8A 1SC6A 3L77A 2JD2A 2OUIA 5LCXA 2YV1A 3GDOA 2VNSA 2OBNA 2QQ5A 3PVZA 3RIHA 2BHLA 3DZGA 4J4BA 5JMWA 5FEUA 3AOEA 1D7OA 2BRUA 4Z0PA 1M75A 5KVSA 4XJSA 2Y99A 3F4LA 3LT4A 3ZWVA 1GZ3A 4CM9A 2FR0A 1TT5B 3DHNA 4RPJA 3FNGA 4QX6A 3SBOA 4NK5A 4ZICA 3MOGA 3GDFA 4KDFA 3GEMA 2NTNA 1AGNA 5DBFA 3EC7A 4FFRA 3ADPA 5DULA 4B3JA 3I52A 1XSEA 1BG6A 4WLOA 4IGFA 4Y6RA 4PVDA 5G4KA 1LSOA 9LDTA 1UP7A 3WB9A 1HXHA 1X7DA 3BIOA 3ONDA 1I3LA 4IDBA 2FR1A 4OXNA 3RKRA 4EJ0A 1L7DA 1YL5A 3O4RA 4GX2A 4U8GA 5IDQA 3K2BA 3ONEA 4WLEA 1MV8A 2VUUA 5IXYA 2BKAA 3HDYA 3RC9A 3TL3A 4Y6SA 1BRMA 2Q4EA 3H3JA 3VDQA 3G1UA 4GSLA 4MVJA 4RPLA 4D3FA 2DUWA 2VOJA 1VJ0A 4YYZA 3RASA 3I4CA 4CJXA 1J49A 4IM7A 3PDJA 3CEAA 2D5CA 3GVHA 4ZRMA 4E5PA 2OOSA 1Z73A 4YQYA 4OIMA 4QEDA 4BO3A 4DLBA 4R16A 5TQVA 4AJHA 5I7FA 3ZHXA 2P91A 2FOIA 4BNWA 2VN8A 2JFHA 2WMDA 4CLXA 4EYEA 3WMWA 3PHIA 4XGNA 2O48X 2E37A 2O50A 2JHGA 4II3A 3MJCA 3LT1A 3VKVA 4AJLA 5B4UA 1U4SA 2Q1TA 1LC3A 1E7YA 1V35A 1FXSA 3COSA 3D5QA 1A7AA 3W8DA 4HY3A 2ZK7A 4GQAA 5L45A 1M66A 1J5PA 3ROMA 5DNAA 5A9SA 3AFNA 3U9LA 2B83A 1PGNA 3MJ4A 4O63O 2DKNA 4Z0HO 1Y9EA 1RM0A 1QV7A 3GRPA 5CDYA 2PH3A 4RVFA 3PPIA 3K8ZA 1X1EA 4OL9A 3ZHYA 4CQLA 2HAEA 1N8KA 4RLHA 1XCBA 1FMCA 4IY1A 1E1KA 2R00C 4L73A 1GYQA 1BVRA 1HDXA 1I36A 4MVJM 2H1SA 4YRDA 3PRJA 1LI4A 1E3IA 3ZW8A 2IEBA 4WE3A 1PZHA 4M86A 3L07A 4JJIA 1X7GA 2NADA 3DC2A 4CQMA 2NU8A 3HDQA 2Y0CA 1Y8RB 4FJ0A 5THQA 1BDBA 4YRAA 2ZKLA 1DRWA 1B0AA 1SB9A 1ZKMA 3DBRB 5ITVA 2W90A 1FDWA 3PK0A 4CMAA 2CVQA 2Z1NA 5KKCA 3AUUA 1I0ZA 1BXZA 4O59O 2Q99A 2ZJ1A 2AW5A 4AJ2A 3RUDA 3FR8A 2Y0DA 1YB4A 1T4DA 5ER6A 2V6FA 1ZEMA 4DREA 3JYPA 3AM5A 5G2OA 1SEPA 1CWUA 3WGHA 3AY7A 3ROPA 3S1LA 1ZMOA 3JQAD 5A1TA 4GVLA 3CKYA 3X2EA 5B1YA 1ZH8A 2I67A 4W7IA 2IXBA 1OI7A 1Q2XA 3C7CB 1V3UA 4BNIA 5JDCC 3OIDA 3PIIA 1Y8QA 5K0ZA 2QG4A 5DCUA 2AG5A 1HZZA 3F5SA 1YXMA 3GFGA 4FPXA 4BQPA 4BNTA 1EE2A 1A9YA 4UVGA 1U2DA 3IKVA 4GAEA 5TX7A 1P31A 2H5LA 1ORRA 2XOXA 3BMNB 4ZA2A 3ULKA 2WTBA 4W9NC 4BO7A 3QLJA 4XGKA 3C1AA 4MKRA 4BMNA 2UUPA 3IAHA 4GBJA 3ASVA 5A5FA 2PTGA 3OQ6A 1JKFA
chains in the Genus database with same CATH superfamily
4CMEC 1WMSA 2GHQA 2V4MA 5F98A 3KT0A 3TL6A 3AZPA 1D7AA 4Q21A 1XKLA 1G1MA 3G1WA 1ZJ4A 3BM5A 3C1OA 4YN3A 3OFND 3ZK8A 2YINC 3C4QA 5BYJA 2PX2A 4YYEA 5EMJA 4DSOA 3LKZA 1JNYA 3TCNA 3WGZA 3TVDA 4Q9LA 3DBVO 3R4CA 3CUSA 2R4TA 2VAVA 3LECA 3NHUA 3MK31 3IESA 3K31A 3MT9A 4KN6A 1PFUA 1NNI1 5JALA 4H4CA 2F55A 3DGFC 3X43A 4A5OA 4AUMA 1K1EA 3RC1A 2Q2OA 4EPXA 3EIWA 2JVIA 3BIFA 4QYXA 5BN3B 1KJNA 3MWDB 2GNPA 3K0SA 3W0LB 3ICPA 4CNBA 1Z3IX 1C5KA 5G4LA 3U48A 5IVDA 3LOUA 2W6JD 1C4KA 1YHZA 2O1XA 3AIMA 4JBIA 2P2LA 1RJWA 2O23A 3DULA 1YJ8A 1ZPDA 4YJHB 3TTVA 3VZSA 4POOA 8LDHA 3UPDA 1CR1A 1B0PA 1F8GA 2PLWA 1IG3A 2AFHB 1PR9A 4MW0A 3JQAB 2Z83A 2O5VA 4H7DA 5HOQA 2WJZB 1RRVA 3O95A 3SS9X 3GELA 1ZL2A 3BF7A 1USGA 2OPBA 4CF5A 5T6BA 3A3KA 1M6EX 3RYIA 1NXXA 2BFBA 4KDRA 4S1PA 2VK8A 3AUXA 3CVXA 4B3RB 1TA4A 1W52X 3UG7A 3PEEA 4XUCA 1LDMA 2DG2A 4BV2A 3QWIA 5AI9A 4BLOA 3ME5A 4HXFB 1WL8A 1XMPA 4TVOA 1JDSA 1K9SA 3OWOA 3GPCA 1MW8X 1I6LA 3GD7A 1PFGA 4YRSA 2I65A 2R00A 4LVUA 1W0KD 4P93A 5BV7A 3JD1A 3RVQA 5F3RA 4ER0A 3HVKA 2OL4A 4MKGA 1B6RA 2I87A 2B99A 1YDMA 3HJAA 3NXKA 4XVRA 5CA0A 4ZJPA 4IIVA 2XQFA 3ACCA 1M6VA 4WVFA 5CVJA 5K8VA 2Y8EA 4IQ8A 1BGXT 4MQ6A 2W8BA 3W6ZA 1GV0A 2PKYX 2O14A 3QI7A 1JEYB 5FTKA 1KZ4A 1CHDA 3JAWB 4RULA 2X22A 2CVZA 1Z6YA 4YUAA 2BMDA 3TW0A 3QVWA 4OHWA 1T3ZA 2XT0A 4NNPA 3T35A 1F60A 1DX6A 4HYTA 3QXXA 3A2KA 1WRBA 2IYVA 2ZWPA 2MTBA 3LYLA 4XB6B 3U7HB 1KI1A 4REQB 2ZPTX 3UGJA 3VDMA 3PENA 2EKPA 1IXZA 3TDKA 5FBRB 3DEIA 4DZZA 1K6IA 4QG3A 4E2YA 1O97C 1IBLB 2PX6A 4ZK2A 4EL0A 4PAMA 6GPBA 3QU7A 3F1KA 3STYA 2NU8B 1F38A 3WBFA 4RK4A 1QH1B 3UAZA 3O4VA 4YUYA 3W5BA 1OXUA 3WYGA 1FP1D 4UOEA 1Z29A 1USVA 3PTZA 1YRHA 5LWQA 3KTOA 2HFJA 1CULC 1M2NA 4JHLA 2LE0A 4EYOA 1SXHA 3SF8B 1MW9X 3KB2A 1HORA 2XTAA 4J43A 4RVNA 3ITKA 1N0IA 1Q6ZA 4TUYB 4NRDA 3EJWA 3E8XA 3EUAA 3TNDA 5JNSA 3KHSA 4FHZA 4BFZA 5JPDA 1XNQB 1YR3A 1KDTA 3QMVA 1OAAA 2A4KA 2A78A 1XQ6A 3NJ8A 4RVGA 3SK0A 5JY1A 2O8CA 5DRTA 1BCSA 3AW9A 4M8IA 3KJIA 1KZHA 4D9EA 5BPFA 4NV1A 4EVIA 5TLSA 1P91A 4B7UA 3CUEF 2Q4OA 5K4AA 5F78A 3W6OA 3SEQA 3DZKA 1XDUA 3I92A 5A2QA 4I55F 2OXRA 4JUCA 2BY4A 5IDYA 1FDRA 1QDEA 4YALA 3GNSA 3IAAA 1FUUA 1KRXA 4GMHA 1YMVA 1W581 3H2BA 3OECA 5KQRA 3K7EA 4KLRA 6PFKA 1Q1EA 1ZL0A 2AYZA 2DF8A 4HLNA 4X62B 2NVWA 2WRZA 2ZXUA 1QG2A 3RU2A 2F8SA 3WIUA 1FMLA 2QX8A 3KFXA 1RWWA 3PA8A 4PGHA 3K1JA 4URFA 3EZ6A 2DFVA 3SIRA 4C7MA 2CJYA 5C52B 1EM8B 3COVA 4LWQA 2A14A 4L74A 3TAHA 4AFNA 2IIVA 3H05A 1GDTA 3AFGA 4DPKA 4K03A 1V8PA 1V9LA 2ATXA 3KETA 4Y0VA 3VPBA 3WK7A 3ESDA 1NRIA 1RAEA 3BMNA 4MV7A 1NXQA 3DMPA 3VH3A 1ISIA 1XHFA 2FWBA 5CBKA 3HB7A 1F4VA 2FJ0A 2WHRA 4KNYA 5LXTB 5E2IA 2I03A 2VC2B 5FJIA 3EG9A 2BC9A 1S3SA 3OQ1A 3AUTA 2KBFA 3Q41A 1L5HA 1Z5PA 4OQPA 3S55A 3VR6A 1N2JA 2EW2A 3L49A 1P2TA 3LPLA 4L22A 3RGGA 1Y3FE 1PFQA 3ZU5A 5B6JA 2FZ5A 2X0IA 1Z7GA 2JS7A 4CIXA 4C9BA 4RJ2A 1ND6A 4HXYA 5AK5A 1G21A 1ZD5A 1JKXA 3HFRA 2PRZA 4E5KA 5LQRA 2J5BA 2VQ6A 4UBNA 4Q4AB 2PX5A 3ZWXA 2I9KA 3NETA 3H0KA 3QW2A 4JYBA 5T3YA 2PGXA 3L1UA 5F9FA 2HT1A 3T4EA 3OEED 3KLPX 4F3NA 4ZCSA 3CUKA 3NOXA 1ZYUA 1ND5A 1RMTA 2AF4C 5I9BA 4IH4A 4DIBA 3TBKA 1U6JA 4FOOA 4WA8A 1CE8A 2R2GA 3H2HA 3P2YA 4K9PA 3TGPA 4R9UC 4G1VA 3LHIA 4HAYA 2D3TA 3R7NA 1ZVJA 2OC9A 1NU6A 1WS6A 3FE2A 1Y1SA 3N8IA 3NTLA 3F67A 4UMDA 4W5TA 2YWJA 4P4SB 4DTCA 4IF4A 4LHWA 4QLOA 3H17A 4Y8VA 4AKIA 5JJCA 2GTIA 3NTRA 4KQ6A 4FCTA 1QRUA 4QDJA 1NUPA 3QVJA 5TARA 7ABPA 1OA1A 3VKGA 3WGGA 1R27A 2TSYB 4HAZA 4P5DA 3QLUC 2OK7A 1HMPA 5DLQC 2R66A 4XDYA 3MJFA 1RHMA 2FPPB 3EDQA 5LDGA 3V1UA 4IHAA 1YA8A 4RPKA 3S1AA 1AUQA 4O2LA 5DYIA 2H4YA 4MP8A 4ZT7A 2QGFA 2CDBA 1YQXA 3FPFA 1O6FA 2QJOA 1YR7A 5DSTA 3ZIUA 4G5XA 4ZGWA 4J3NA 1X6VA 4DBLE 2V7QD 2Q2VA 1GQ2A 2GEKA 1N7JA 1Y6RA 2HY7A 5FPPA 1MLDA 3OE7D 3I6BA 1YMQA 4LYYA 2J4CA 4K87A 2Q0SA 3EVAA 3FPAA 4RY0A 3UN1A 3BQ9A 1LV7A 4P4LA 1JG4A 2Z95A 1KAQA 4F4JA 1AH2A 3FHTA 1L2TA 1QANA 1GQYA 2IQ5A 2YRWA 3AB7A 4IHJF 3DVAA 2Q4DA 2X42A 3FJOA 4X0EA 2XQGA 4HGZA 4KRYA 4Q7EA 3A9CA 3EPHA 3VSBA 5DGHA 1W1WA 1NVFA 5KU7A 1FUKA 1IB0A 2B8WA 4JP3A 5DWQA 3OQMA 1CUJA 5IH3A 1EAYA 3P5BA 4AS1A 4PW0A 4B81A 1H3EA 2QY9A 1FUEA 3WTCA 4RMJA 2VP2A 3M81A 2JIZD 5BWCA 3JR3A 3QJGA 1Z6PA 2PUHA 1Y5RA 1ESCA 1MB0A 2VPWA 4R41A 2NVUB 4W5NA 3D4LA 2HTFA 5CCDA 4EG1A 1E3EA 1S2OA 3CC8A 3B6ZA 1A9ZA 3A3OA 1MVOA 4OSOA 4C4YA 2WU8A 2O57A 4OLAA 4WOJA 3JRWA 1A96A 4KFUA 2AL7A 4IZOA 4TSFA 2MDTA 3I6QA 1YCHA 2FKNA 3L9WA 3M9WA 1V6AA 1CZKA 2HA6A 3HXMA 1Z16A 3UUGA 1VIAA 4M54A 4N7RA 5K3FB 5LIPA 2CXXA 3OZDA 3PEUA 4FQ8A 4RS3A 4ETNA 4I4IA 1L1EA 1YAHA 1TQHA 3PXXA 3DFMA 3GUVA 4ZC1A 3WKAA 2ZQYA 3ZBQA 2IZ0A 3KZVA 4D8YA 3D6HA 2C7VA 3CLTD 3OZWA 3SZOA 1JJFA 2AFHE 2C42A 3ZLUA 2XKBA 1XLTA 3QP9A 2X7HA 4O4IF 3RTDA 1AKWA 1N1DA 3L82B 1V96A 2IYOA 1D03A 5NULA 1S9HA 1NVTA 4BO6A 2RJOA 2Z2KA 1TU4A 4NZYA 4I5FA 4OI4A 3H86A 4HB0A 4FJ2A 1OXSC 5JCPA 3HEAA 3NC4A 3LTNC 1WZEA 3EDRA 4V3CA 4BNDA 1QM5A 3ISJA 3QVUA 4G5GA 4ENPA 5F1PA 4NZZA 1ABFA 2PWZA 4GLOA 1X2EA 3SZUA 5CD1A 2RJ3A 1MNAA 4YDRA 1K88A 1UUFA 4ITRC 3TF5A 2JJ2A 4YAOA 4PPGA 1HOTA 3EEYA 1MOQA 1N3IA 4GDFA 1QX4A 4F7WA 5C5EA 3NYWA 4NCNA 4RF3A 3KYBA 3UT5A 3UOGA 1J0AA 4D79A 1A72A 4Y9DA 4AW9A 5KYWB 3ESRA 3QEOA 1R4NB 3BXXA 5I9SA 1F1BA 2PUWA 4KQEA 1M2VB 4E7PA 5B64A 5I48A 3MSXA 2I4RA 4LV6A 2XT9A 4BLUA 1NFRA 3JWPA 3F71A 2C5BA 1GQSA 2WWXA 4OJKA 4HWPA 2A94A 2J46A 4JC0A 3ZYZA 2ZAOA 1NMXA 3OA0A 2NU7A 4OOFA 4U5QA 3H5OA 1P5HA 3IAS1 3O9VA 2IGBA 1PFYA 2VWPA 3SZLA 2O4CA 3VU9B 1V5FA 3UM9A 2EL9A 1YE5A 4KG7A 1S8NA 4Y6PA 2IITA 1NI4B 2FSGA 3OESA 1EBUA 4F45A 5AO9A 4DBLC 1LC0A 4Q7MB 3HZHA 3Q2OA 4MVJE 2NSLA 2CXQA 5FV7A 4H0FA 5GONB 3DOEA 4EKEA 4GBGA 1QFSA 4FQ7A 4Q1DA 4QWMA 3Q8WA 1IWOA 2VDQB 2FRDA 3F98A 2RARA 2CNOA 3TD2A 3ZGYA 1K7CA 2DWQA 2IYEA 1LDBA 3CPJB 2QD1A 3LY8A 1FXUA 3MTIA 1D4OA 4IVPA 3U09A 3WLTA 2YXEA 1SZCA 3AOEC 2XZTA 4DUPA 3M3PA 4YV0A 5HKBA 1P9NA 3RVLA 3E48A 3GXBA 4LBZA 3CGWA 2C7BA 2YVQA 1DI0A 2IHJA 1PKXA 1Q0LA 1VJ1A 1UBTS 1WMEA 1K8XB 4ND7A 3HB4X 3OE5A 2NQTA 1KI6B 1BXRA 4DNFA 5ESRA 1H4VB 3TJZA 3D3WB 4EG7A 5A4JA 2JJYA 3DZJA 4MQLA 3W7BA 4OJNA 4MS4A 4BNHA 3U3OA 1U1GA 4IGKA 4OIFA 1B6GA 4IRXA 3TUIC 4E33A 2HRDA 1E8NA 4GOMD 5HA5A 5BUSA 2B4RO 1TO2E 3PHLA 1Y4UA 4P34A 2FVXA 1U7PA 3AR7A 2AEEA 4M76B 4QYIB 1E0JA 1JFTA 5DZSA 2B25A 2PYZA 2Y1XA 3ETGA 3NHLA 4IJWA 4A26A 2Z2ZA 3MIIA 4AROA 2ODNA 1G2PA 1RYBA 1Z6GA 4TMYA 2QY6A 4HAWA 4FMPA 3T9BA 3NHMA 3ZDZB 2P9HA 3AXSA 4XM0A 1KQPA 1T13A 1A7KA 1VCNA 1R7RA 2ZYHA 1AMUA 2XXJA 2OCLA 4FFLA 2AFRA 4RD0A 4Y2QA 1XP8A 4YP9A 1M0SA 1HG0A 2FPXA 3NZEA 4CODB 2CY0A 2OC4A 3BIXA 3TKYA 2AVDA 4MYHA 2C00A 3AO0B 1UAAA 2P3OA 4LGYA 5K8IA 3EXHC 4AQYB 3GVPA 3I2YX 3KXDA 1Z75A 4I4TF 1LLQA 3WLOA 4TTVA 3UCEA 3M49A 4EHNA 1K6EA 4S05A 3SBEA 1PLLA 4BV3A 2CJPA 3WVNA 1AC5A 5L53A 2OD2A 3AVTA 3ICCA 1LPBB 3JATA 4DQLA 3F5FA 1UT6A 4JQOA 2J3EA 2X0FA 5A5DA 1AGRA 2YOHA 1CJBA 3LZCA 5HILA 4ZVQA 2QIPA 5CXXA 3GEDA 4J7CA 2ZJ4A 1HT2E 2D06A 2VAMA 2C54A 3AHGA 4UEWA 2HLPA 1UCFA 1D3AA 1BA3A 4XJTA 2NPIA 1R2QA 2FW6A 2IELA 2ZU6A 3W5CA 3CNHA 1Z28A 1C41A 1UC4B 3PV0A 1IZ8A 4IIXA 2J6IA 1A9XA 2HJGA 5AW8A 3KC2A 2CHEA 4FHGA 1P2FA 2RIPA 4JLOA 4EY4A 1NR7A 3KR2A 4RDIA 4ZT4A 1RQGA 1ZISA 4WBNA 2QDXA 5FPYA 4KREA 5ALTA 4PAWA 4V0QA 1FX0B 4E6PA 2RB4A 2EDCA 4FIZA 1J56A 3O0DA 3WK4A 3X2SA 2YY7A 1XNHA 2QPLA 3OCZA 3HY6A 4QUHA 221PA 4YUZA 2B5VA 4G5YA 2FSSA 4OGWA 1QE5A 2JFBA 5CTAA 2AOXA 1J1UA 2JFZA 1ZRSA 3GC6A 5L3QB 4DV7B 3KPUA 1C8LA 2HJRA 5I9IA 1U04A 3G0BA 2MWMA 3JAKB 4JEUA 3THOA 2DJ5A 3SSNA 3TZEA 5C4MA 1W4ZA 1B00A 3NHYA 5T64A 3VC7A 2PS0A 1OWMA 1BSVA 1RRGA 3KZXA 3PRYA 4GYYA 3R9KA 4F6RA 4B46A 3FTDA 3AP2A 3NYIA 4KDCA 4KODA 5KNCA 1SVLA 5JLJA 3ABSB 1P81A 1E1DA 4TMXA 1IY0A 2ZG6A 3LSTA 3EUFA 1CY7A 3A27A 5KX5B 1RVV1 2HDNB 3IUQA 4RV9A 2ZIEA 5J40A 3CX8A 2R1TB 3C5HA 2G80A 3EA5A 2ISCA 4NVRA 4A1FA 1UPTA 4JI6B 3L4KA 2GK6A 3FNEA 3U37A 1T2FA 4RHYA 1K0FA 3PVCA 1YZFA 1G20A 1GCAA 1WMAA 3M6IA 4EPYA 1GZSA 1N25A 2VHEA 4WXEA 3IQDB 1ULTA 2YUTA 2WWTA 1QQ6A 1XP5A 3GJXC 1GG5A 2I22A 2XRZA 4GM0A 1AUXA 2OLJA 4POAA 3ZBUA 3OH8A 1TFRA 3FJ1A 3K1AA 4IWYA 5KTOA 5LMUB 5KWEA 4URYR 5DWVA 1K75A 3FXAA 4BKQA 1FMFA 2HU5A 4MHOA 4WFKA 1E7QA 3N5KA 4ND8A 2AD1A 4D4MA 3O8NA 3QUAA 2NU9A 3VUEA 5A4FS 5JD5A 4I99A 1NX9A 2PS1A 1KH1A 3WL4A 1ISPA 1T9DA 1YB5A 2ZUUA 4KQWA 1G8KA 2XW6A 4GI7A 1ZD4A 1VMIA 3E9CA 4WLUA 3VNBA 4BNLA 1RQ2A 2WV7A 1SZDA 2JDIA 5EE5B 2Y66A 5HKOA 5J4KA 3D8SA 2ETVA 4I66A 1I4WA 1AKTA 5JWHA 2QE7A 4B3XA 4Z6KA 5KYXB 3IBFA 1L4NA 3WWCA 2MINA 4JCCA 4CU5A 3U3RA 5FBVB 1HC7A 3E5MA 4DWWA 2ZJZA 4ZYLA 2VPZA 4XDGA 1JHRA 3DO6A 1OH8A 1OFGA 2J1LA 1Y4DE 2VDWA 1S2LA 3FMPB 4OHUA 3IP5A 5J43A 4Y6QA 1GKKA 1Z2AA 5AM3A 4KIGA 1QCDA 1P7YA 2PSJA 3CMMA 1RXUA 1L7QA 2Z1DA 3GLHB 4GECA 5ILOA 1E2HA 4YIKA 2E48A 5DEIA 1IQUA 3NOQA 3VXKA 3M89A 1G3QA 3CB2A 2RHJA 4LOAA 4JI4B 3H75A 4RF2A 3KQTA 2B1GA 1HLGA 4E07A 3DTVB 4IHJA 1TC1A 1Y5IA 4GKJB 1H2WA 5LBTA 1FP4A 3PC8A 4N01A 4TSKA 1Z36A 4K86A 3SS7X 4ZC8A 3U7QA 4XVCA 1IWBB 1WBBA 1HYHA 4HDSA 1FNMA 1E79D 4M0EA 2Y0EA 2WY2D 5K3OA 4MPPA 1QO0A 5GADl 3V97A 1VOTA 3IBSA 3NJ4A 1UM9A 3RK4A 3OZCA 2C0CA 1CCWA 4Q0MA 4UXHA 4UATA 2E82A 3OX2A 3JYHA 2J9ZB 3BZUA 1JJBA 3KVYA 1AKMA 1ZX1A 2WVHA 3EFHA 3GCZA 1EM6A 1XZCA 4L57A 4NJMA 4IJ6A 1BFUA 2VSYA 4R01A 2I8LA 2OFXA 1XDBA 2FJPA 2H2WA 3CIFA 4OTZA 2J48A 3N8HA 1KEEA 3UPTA 3F8TA 3MWYW 1JJIA 4PYNA 1XV5A 1KARA 4LV8B 4QBKA 4KTTE 4ZQCB 4R3WA 1EU1A 4QE3A 5L3RA 1EVQA 1TVMA 2G9QA 4JJZA 1PEYA 1WMDA 4B6EA 3EX7C 4MGZR 1EIWA 4NBKA 3SVTA 3Q3VA 1DX9A 4GL4A 1B8PA 2Z08A 1C14A 1JHZA 5C51B 4EI9A 1UK7A 5AM2A 2DU8A 4GX5A 4PAQA 5CB6A 4PF1A 4O4HA 2D2VA 4YWHA 4EAAA 5CRIA 3NFYA 5IKMA 2RH9B 3O73A 1IM2A 4AKGA 4HDRB 2BE9A 2CL0X 3FBWA 1P72A 2F43A 3A11A 3H5WA 3WGYA 5J47A 2JL1A 3DV0A 5H16A 3O21A 4ECAA 4L5BA 5E38A 3WL5A 3EVCA 4B33A 2FMFA 4BMXA 2DC1A 3WGLA 2NYUA 5E7JA 5K45A 5AJHA 1A8SA 3ENVA 4D9JA 4KMSA 4N5HX 4OK5A 4QARA 3MERA 2VHCA 1D5CA 4L9SA 1KFBB 3D0QA 2AZ4A 1VLQA 1RACA 4D9HA 2BWJA 4M60A 3UPUA 3B1XA 1NRJB 2YZ7A 3NBUA 4PLGA 4MVJH 1C1XB 3THXA 1K2VN 5HIAA 2DTDA 1UBRS 4RS4A 4BJ6A 2JG3A 4PSUA 2VQFB 4YBZA 3C7AA 1CDDA 4A27A 4YFVA 4JDPA 4X65B 4YRLA 1DKRA 3Q9LA 4MQFA 4PLFA 1CJKC 1OX4B 2H1VA 1TADA 1SIWA 2A1UA 5DHQA 3RYCA 2PS9A 2C3UA 3CE9A 4XEHA 3VR5D 4GC9A 5TJHA 4C4SA 4XWKA 4P1ZA 5JBQA 5CJ2A 1UDXA 1RQ7A 3FTCA 3IE0A 3QVSA 2R44A 4QXMA 3AKZA 3PNQA 3SKYA 4LCBA 1V41E 2PT6A 4FMCB 1ILWA 1M2GA 1BDJA 1QPBA 1ZOSA 2QI9F 4W8OA 3SLKA 4CLOA 2Q3DA 4NATA 2BGGA 4TRMA 2IPAB 4CIBA 1P4JA 3UOWA 3VPXA 1ZCBA 1U3CA 2F1OA 1Z4LA 2HXSA 1BVUA 3WNCA 5D1HA 5T4EA 3M34A 3MIZA 3RS8A 3G02A 4EPWA 1NBOA 2ZTLA 3TIFA 1NOIA 4HFJA 5K9ZA 3P9XA 2DKFA 4YP6A 4AUNA 3PYMA 1TJ4A 4PSAA 4YMWA 5CB4F 1J8DA 1ODSA 1L7EA 3SBDA 1NZDA 5FFFA 3V4VB 1DRVA 3OQHA 4HJRA 4QHYA 2C77A 4GZ5A 2IHKA 1GFWA 1MGOA 2HUPA 1X7XA 2FPUA 1XU7A 3DR3A 4MRSA 2JI6A 1J42A 2VP6A 1U9ZA 4IUDS 1L5KA 4AY3A 4BS9A 2XLCA 3EDMA 4MMYB 3LL4A 3VX3A 3RYHA 3G9ZA 3HSYA 3HPRA 4PRKA 1J8FA 5JAMA 1QHEA 4FFVA 1J90A 4WZBA 2GD2A 2OEPA 2PS3A 3MLEA 4ZI3A 2QGNA 3EAQA 1DADA 4KV7A 4BAGA 5KMGB 4B3GA 1KJ9A 3UF0A 5EJ9A 1IM5A 1P9RA 1U5BA 4P6VF 3HG7A 5LKRA 2YHAA 3RVOA 1XPRA 3C48A 3C7DB 2AS0A 1YRBA 3DL2A 1G3IA 3QY0A 4RCVA 4XGQA 4UJ5A 3ZV7A 5HM6A 1DUIA 2CVFA 2GRJA 4JJFA 1H2HA 4UHKA 5J2UB 3IJRA 1N6LA 3FNFA 2P2DA 5AXBA 5KCZA 2GM4A 3NHBA 1UBLS 1RWKA 4RKEA 3C39A 3KX2A 3ESZA 5ALKA 3JQBA 2FFQA 1FLNA 4IQFA 4KQGA 1Z7EA 4YO7A 3R7SA 4F86A 1A27A 1DKQA 3MFYA 4IGIA 1IN5A 4BQNA 1GLNA 4EUNA 1DKMA 2IEGA 4FI3F 5ERGB 2GILA 3RYFB 5C8VA 2XDQA 4L2IB 1LRLA 4MUFA 4WAUA 3MLBA 4RH3A 1U9YA 2AG6A 4ZO6A 4Z99A 4EHJA 3KBOA 2XMGA 3PS9A 2J9FB 3L1HA 4X1YB 4XR9A 4JLJA 1E6MA 1JKMA 4U5XA 3V8BA 4QU0A 3MS4A 2UAGA 1E2DA 1EA5A 1JGTA 2CMDA 2VHQA 3AETB 3KUUA 5ECWA 1X2BA 2G09A 5F2EA 1DWUA 1E6EA 1O03A 4WCDA 2BGRA 1UBUS 2QS9A 3LVBA 5BURA 2IBTA 1J1IA 2CNKA 2YN2A 2D1QA 5DSZA 4BFVA 2PE5A 2FZWA 5HW0A 2ZRKA 4D8TA 5I4IA 4KTVE 4M9QA 4IEFB 3C15C 1CUIA 2IL1A 5LMCA 3VJRA 4TYWA 3ETJA 1EH5A 5TMDA 3WLKX 4H1UA 1RLJA 5F3WB 4WXMA 4O4LA 5CVCA 4EFLA 1LA2A 4L8YA 2H63A 4F91B 1GNQA 2Q5CA 1XZFA 3EC2A 3GX1A 4LHZA 1LTQA 2WWYA 4NOMA 3OCVA 5A9TA 2ASVA 2YWDA 1DBSA 1IATA 4UNQA 5F7XA 1M0WA 3OMLA 4KE7A 3E7DA 5GV8A 2LIPA 3PQ8A 3NWJA 3OCXA 2IUUA 5JXGA 2CNDA 2EARA 3SD7A 1IHDA 5JAPA 3T3IA 3RJZA 4PHHA 3B9PA 1IJKA 4Q7LA 1P4HA 3OAAD 1MOZA 1RMYA 1W44A 1ZGZA 1WDTA 3TOSA 4TTQA 2CFSA 1UH5A 1WB6A 1CDEA 1QFZA 4EZBA 3WC4A 1KERA 3E3LA 5ITZA 1MGPA 4F9GA 1U3DA 1JFFA 1KAHA 3A1EA 1QRAA 1KZ1A 3OZBA 1YULA 2IEDA 4HTFA 1GRNA 3D4BA 3WI7A 1GFIA 2TRSB 4M7OA 1PP4A 1OHHD 2JFNA 1UMCB 4BTLA 4F12A 4Z53A 1AGPA 2FMUA 2W83A 5CH5A 5ALNA 2PQMA 1XMIA 5EMKA 1PWEA 3VR4H 1NT2A 2R84A 3I1YA 4FYYA 3UK0A 4A2CA 4EO7A 1NNEA 2CEAA 2PJZA 1JZTA 1IK6A 3MPOA 3RWOA 1I4LD 5E1DA 3Q87B 4YGYA 3UBMA 2OVBA 1GPH1 3CCCA 4MGEA 2P9QA 1TMKA 6YASA 3FDJA 1NP3A 4D0GA 1OVMA 3GRKA 1YOVB 1H3FA 1EDBA 3INRA 5ERXA 3ES9A 2AQKA 4XX0B 3RU3A 1SWWA 4F4IA 3HU5A 4US0R 3HJNA 2WT8A 4OB7A 2VS1A 1DFHA 4QOSA 4AJ9A 4D02A 4PR3A 2VPQA 3TG8A 2YWFA 2UVPA 2NG1A 5I9NA 1QONA 4IJQA 4XD7D 1NSYA 4DJDC 1JEQB 2PSDA 2ZCUA 2A3NA 4OOEA 5CUQA 4ER7A 3DB2A 2H51A 4IVRA 1ZDMA 4LWZA 1SCKA 2RHOA 4GWGA 4AMUA 4G0NA 3MNFA 2ZUFA 4LJ6A 5AFSA 1C4WA 4ALLA 1PGPA 3K0KA 4DV0B 4DR1B 2DWCA 4DL9A 2C9DA 1J2UA 5LBIA 2ENUA 2WWVD 3QKRA 1PJBA 1VHQA 3CPSA 3MJEA 2XMZA 4M0LA 2JIQA 3MCTA 3I04A 4Q9JA 2PPVA 4CZ2A 1XVAA 1XB2A 2G9NA 2JC3A 2P40A 3R0XA 4BWFB 2HYIC 4BQSA 4LY3A 1T6BY 2X5JO 3WP1B 4CIYA 2I6SA 5JT1A 5K09A 3BBLA 1HFKA 4GOJA 3TW8A 3TB6A 1VE1A 2P4EA 4ZDWA 2I2XB 2OAGA 2PGDA 4TXMA 3Q0IA 3VZQA 4LF5B 3NT4A 5DJ5A 1O6CA 3E7FA 3JWJA 3H8SA 4YAKA 1KF0A 2XBUA 1DLIA 2W6ZA 3OFSA 4H08A 1LBIA 4LSGA 2PXAA 4G01B 4R2MA 3EW7A 1JKJB 4G5QA 5KVQA 3AM1A 3PTAA 3KM0A 4N1AA 4QUGA 2QAGB 1ODTC 1I14A 2Q2WA 3KQWA 3L7KA 1MF7A 3TFWA 4BNZA 1LNSA 2QVBA 3BXFA 4P22A 1V11A 2NUBA 2IUYA 1ZK3A 3IQZA 3TIXB 3U16A 3T15A 3PSAA 4QFMA 3C8HA 2C97A 1U0BB 3LL7A 4C7BA 5LL6P 5EJEA 1T6YA 5E1BA 5C1OA 1SPXA 2FSUA 3K70D 2PD6A 2HYDA 4PG5A 1G6KA 4RE5A 4MNTA 2ZCJA 3GO4A 5DVZA 3R6TA 5K3CA 1R12A 2MSEB 4UAJA 4TPKA 2VATA 3D6UA 3G7UA 1H9BA 2HHAA 3R44A 1JQLB 1NXPA 2QL5A 3KWJA 3Q5DA 3QXGA 5AP9A 3DE6X 2FVYA 1QVVA 5FNVF 1Z0ZA 1GZ7A 2XNCA 3WLPA 1AUPA 4AXXA 1HT1E 4MRVA 5EIAA 3SE0A 4EA7A 3SP1A 3PC3A 4NLLA 4KW7A 2XE6A 4LXTA 4YAEA 2XB2A 1TVKA 2VEOA 5EZYB 4GZ6A 1D1SA 1PL6A 2DE0X 1PX0A 3KYIB 4OA8A 1NLMA 3EPLA 1ZFNA 2C2GA 3FPGA 3I9V6 4G5FA 5FXMA 4AJJA 3JQDA 3R9IA 2NZ2A 3SR0A 1UR5A 3PR1A 4RFLA 4KMMA 1J00A 3K8QA 4RUKA 4TV9F 4LYDA 3NP9A 1RYZA 5JZOA 3MG9A 1FU4A 5F5LA 3A10A 3K0HA 1CY2A 4NTZA 4GVPA 4Q5IA 4XVUA 3MCVA 5FB3A 4LNUB 1RCTE 4BMSA 5LIRA 4D9CA 2XMDA 2INGX 3HN6A 2GRAA 4RPIA 2OUKA 4C04A 1MXFA 1DKPA 2IXDA 4BRWA 4AG6A 2IUEA 3DAGA 4ZMBA 4BRSA 1WETA 4EGQA 4XDHA 5K8TA 1MA0A 1OFUX 1GSIA 4BUZA 3ICVA 1JN0A 2Z43A 1JJAA 3TTYA 4B44A 4RKWA 5T3UA 4BTEA 1G19A 5IM4F 4J16A 4HKTA 3PEWA 1U9IA 1PO7A 2D4HA 4FT2A 4JASB 4CQJA 4C2UA 1BHSA 3ENWA 3UMSA 3MRVA 3KQMA 3DDZX 1W7AA 3RW9A 2RGBA 1A8UA 1OFIA 3B48A 4ER3A 4BRZA 2PRJA 5DIZA 2C99A 5HS6A 3OEEA 5TGZA 4WGFA 3X44A 1VJ5A 1NU8A 3DOFA 5ALQA 5DTEA 3PZRA 2PH5A 4D8WA 4CMJA 1SPBS 2RGNC 5A06A 1WVMA 3FM9A 3J81k 2NO4A 3AESB 2H92A 2ZRAA 4OK3A 3T4XA 1D4ZA 3BCRA 2MOKA 5P21A 3PPYA 2PH7A 5DLDA 2JJMA 3NQ41 5REQA 1H2XA 3L0IB 1F8FA 3AV0B 4L0CA 4BO5A 4EVRA 3HXPA 4E2ZA 3T3DA 1YS7A 4HOYA 2FMHA 3WO1A 2O06A 2RD2A 1DU4A 4XUDA 3CSUA 4Q3EA 3I53A 1YK0A 3N8GA 2HR1A 3SR4A 4AJNA 1E6LA 1S2IA 2OQ2A 4YAWA 2Z8ZA 1OW3B 4HUTA 2CLIB 4PPFA 1QWOA 4ZXPA 3IP7A 3NTQA 1Y9ZA 2G5PA 1U5AA 5AVWA 2KI5A 2VXOA 1P39A 4OI2A 3OCCA 1Y6GA 1J2JA 2Z2YA 3BXEA 2JLXA 2ZUVA 1NE7A 5GP1A 3FYCA 3K6KA 1NQOA 4QGFA 4BKRA 4UTNA 3A36A 1OGYA 4LF4B 2IHZA 5GGYA 3UJ3X 1QBGA 2APJA 4KEAA 1VSUA 1YUBA 4LQ4A 5FP0A 4AZ0A 4W7SA 3DJYA 3CZCA 5AM5A 1NSTA 3OOWA 5JU6A 4EX7A 4Z86A 4LBYA 3ZHVA 4EEXA 1Z0DA 3MQFA 3SYNA 1RQPA 5E1OA 1RRFA 1T8WA 5KYGA 1EX1A 1P6XA 1Q12A 3K0FA 2FPIB 3RSCA 2F1KA 3EOBI 3ITNA 3KFLA 4L8WB 4Z7QB 1K2WA 4GLLA 4UUBA 3EPRA 4YQZA 4NKRA 4BYGA 3WIVA 5GV7A 3EYWA 4HEJA 4Q1AA 2HSZA 2VBIA 1GGJA 4UBJA 4F4HA 3PYLA 3Q9NA 3K30A 2JGNA 1H5QA 2FN3A 2KWIA 4JKOA 4N03A 5HCUA 4CE6A 2V3WA 2I9PA 3IBTA 1G5QA 1U1IA 5F51A 4QSMA 2BHSA 2CEKA 4RMIA 5LOVF 2P67A 2P27A 4K1XA 2AFIB 4RPCA 4RA9B 1I9CA 2AE2A 3B1YA 4NCXA 3ASZA 1QF6A 2XA1A 4C4ZA 2C92A 1JAIA 3PUJA 5HFAA 1FSFA 1KNXA 1YGPA 2CXPA 4D3ZA 3LF1A 1SJ9A 5ESDA 2FEOA 4MEBA 2VF8A 3I6ZA 1ZIYA 4D4IA 2FMKA 3V8QA 5GZ1A 4JGGA 4KNVA 3SQMA 3GVCA 3KJZA 4D92A 1SCJA 3E22B 2OO5C 1T43A 3I9NA 4BJ5A 5M29A 1YCGA 3I76A 3N0RA 4PYQA 4BCCA 3IE1A 3GPLA 5KTNA 1MB4A 4UVHA 5D3KA 4NS4A 4CL2A 3O8OB 4G25A 4X63A 5ELXA 2ZB8A 2NAFA 3VO8A 1Y7TA 1IOZA 4KX5A 1M33A 4IOJA 1ISSA 1BOOA 5GWXA 1DBPA 1T1EA 2PUTA 4CMCA 3FPEA 2AQ8A 2DT8A 3N2EA 1WVGA 2VDRB 4ZVSA 1P19A 4MV6A 2C57A 3FUTA 4RZXA 4GP9A 1TCBA 4AZ3B 4HLQB 1LPPA 1NDHA 2OD7A 2Y0PA 3GGCA 3PB3A 4NDZA 4R81A 3SDZA 1MO3A 3EWSA 3KQYA 3L7JA 3TRDA 5BWMA 1CJSA 4OQYA 4WINA 2V45A 2GN9A 4YDQA 3ZVNA 1UMBB 3FUWA 4Z4FA 1T6XA 4DPLA 1E5XA 1EVZA 3BKXA 3GG2A 4QICA 5WRFA 3WAKA 3DDWA 4W9MC 3PIRA 4BVGA 2JFXA 3IKJA 2VNHA 5AOBA 1E32A 1E2MA 1E7MA 1R6DA 2JLBA 2ECPA 4RKRA 4XIGS 4ARAA 4ESHA 1FYXA 5CXQA 1JDVA 4MDFA 3LGAA 4HAIA 2MMCA 1SOUA 1YS6A 1V1MA 2TMGA 3T41A 2VP3A 1M9NA 3H0EA 1NG1A 1E61A 1EEHA 5A04A 1WF6A 2X4LA 5EIOA 4ZOQI 4L3VA 2QRGA 1DWPA 2IX3A 3GDGA 4PNEA 1N5MA 3OCYA 3SICE 1Q95A 4AJEA 4LTNA 1E1MA 3H1AA 1E96A 1DLJA 1YJQA 2XMSA 1NATA 2OFWA 4CFYA 1JHAA 3ZN2A 2H2FA 1XDZA 4RZ2A 3D4OA 5B30A 3PHGA 1DWQA 3VHXA 3DZFA 4MV5A 1W2GA 3S70A 3RARA 3DD5A 3USCS 4GUAA 4A73A 4AICA 1GLVA 1M1YB 1XZMA 2EBFX 2Y1EA 3CE6A 4HDMB 1OBHA 3V4OA 4A8HA 5CEFA 4N0QA 3MZ0A 1JQDA 3WMFA 4TMKA 1Z37A 5FL3A 1NVVQ 1XTTA 2RGGA 4FFMA 5J1TB 1TF7A 2Q1UA 3O2NA 5EKDA 3NR2A 3QITA 1E6CA 3PHJA 1DX4A 3C3CA 4DQ0A 1II8A 1T2VA 2D74A 5DV9A 3ROEA 3UB4A 4D3YA 4TRJA 3G8AA 4V24A 2EYQA 2OBMA 3RIXA 5LN1A 3RYTC 3BMQB 5BV8A 5HE9A 4HI0E 121PA 3IB6A 2ACEA 4C08A 1MC4A 4NFLA 3CLTC 3CQ9A 3NKLA 2J59A 1LLDA 1AKNA 2GBIA 2V7VA 1D0IA 3IKMB 1SZPA 3TOXA 4QJIA 3PD1A 1QRRA 4I6GA 4RELA 2G77B 1SBTA 1VHWA 1RR6A 3CU5A 2J07A 3FOCA 1AT1A 2B30A 2ZUCA 4BVFA 2KMLA 2FDRA 3O2SB 3L6OO 1RLOA 2PU7A 3TRIA 2J33A 5B57C 3EIUA 2XJ4A 3OPMA 1WSBA 3VYVA 3ZC3A 1R0LA 1DQSA 3CB4A 2Z4SA 3I8OA 4CTNA 1NYTA 3A05A 4C0XA 1OIVA 4EZIA 4DSTA 4KVAA 4RETA 1SG9A 5CD9A 1C9JA 1XI2A 2XGOA 1UWLA 4JYAB 1Z12A 4MCAA 2FQWA 1N1GA 1XAJA 2P0YA 1VXRA 1T3TA 2F1IA 2L82A 4B2LA 3GLKA 5JTTA 1K5PA 4C7KA 3AEQB 5DISB 1VJCA 4MV0A 3KNZA 4JU8A 4P35A 1UZNA 4BHTA 4EH1A 4R69A 5KTMA 1IUKA 3M0EA 4DEXA 1NBMA 2OORC 3QE4A 5ALXA 1BH2A 4WBSA 2RI6A 1EXMA 1JUDA 2OV8A 4D82A 2WLSA 1G5IA 5F2NA 3PQ7A 4NSNA 4TTTS 4NYMR 2NO1A 1P2GA 2NM0A 1OWPA 5J5CA 1LPAB 2IIPA 1H8HD 3AY6A 3HJGA 3O0TA 4UZEA 3UICA 5JZSA 2PO5A 5KZMB 5CEEA 2NSDA 2OBFA 3AKEA 3PUKA 4CTJA 4DMMA 5I9LA 4R98A 1XCOA 1FLAA 1GT91 1ESMA 1T36A 3EISA 4FW8A 4G5RA 4QVIA 2B8JA 2PFGA 4OM7A 2J85A 2XTMA 3N74A 4P4TA 5IS2A 1B1CA 1DOHA 1Y81A 1P9WA 1I2DA 3B89A 5A2GA 1XA3A 4KO2S 3F6EX 5EWMB 5SZKB 4AT1A 2I3AA 4R1NA 1DRKA 2PT9A 4R84A 1XTBA 4ZO9A 1Z2OX 4BO0A 1NJGA 1QIIA 2H59A 2VBFA 3EXIA 3TTSA 4EHDA 2IXAA 4ZPJA 1U1DA 2YFQA 1SVWA 4K9MA 3ZHRA 4ZFNA 1VXOA 1UJ2A 1W47A 4DMGA 2Q27A 3QVOA 2BZ1A 2IEIA 3RVMA 2W4QA 4JEMA 3TEMA 4LYGA 5AXAA 1TUBB 1NQXA 1QYCA 2HK8A 3ILYA 5CVTA 2NZWA 2CZQA 1N7HA 1YE3A 2J45A 2A5YB 3DV9A 4MRMA 3R0JA 3UA3A 1STOA 3KJQA 1JQEA 2ZYGA 3EF3A 3SC2A 4DJTA 2X77A 1MB3A 1YIAA 3DUFA 3VR0