1PL6A

Human sdh/nadh/inhibitor complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
356
structure length
356
Chain Sequence
b'AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorbitol dehydrogenase
molecule tags Oxidoreductase
source organism Homo sapiens
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
total genus 114
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl6A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl6A01
1Q0LA 3DWFA 2BFMA 3RU9A 4MJLA 1T2EA 1ORRA 1QXSA 4Q3CA 2OL4A 3FWZA 5ICSA 3UICA 1N9GB 1R0SA 3GAFA 4LCJA 1VM6A 3LDHA 3V1YA 4CM1A 1EVYA 3M2PA 3FNEA 3EZYA 1PGOA 2TMDA 5EQDA 3RVDA 4ZN6A 5DOZA 4TSKA 5TGDA 4YAKA 1P1KA 2Q4BA 3EUWA 1YL6A 4YJGB 4U6SA 1BMDA 1SO8A 4ESOA 4BQRA 3ROMA 3RKUA 4B7CA 3ZNPA 2WDZA 4YB8A 3U62A 3GEDA 1PL7A 3ICCA 4XB1A 3QY9A 3QWFA 2C7VA 4AICA 4L4SA 3PFWO 4AJJA 5K1SA 5KWEA 5JW6A 2D2IA 4UEOA 5K0ZA 4AFNA 2Q2WA 4D7AA 4J2HA 3LVFO 3AY3A 3MOGA 1IULA 4MVJA 2GYYA 4R9SA 4E12A 5JE8A 1F12A 3HZZA 1B8UA 3WYBA 1PZGA 4LGVA 1UXIA 4CV2A 3K9QO 3LT0A 1QSGA 2VYVA 3I9OA 4YJGA 3BIOA 1NNUA 3F5QA 1PZEA 3PHGA 5LDHA 1KEUA 2Q2VA 5JC1A 1M2WA 4W9NC 2DUWA 3VPHA 4O6VA 3HSKA 2BFPA 4B8WA 4DTIA 1ISFA 2D0IA 2NADA 1EEHA 4TROA 4E2ZA 3PHIA 4CQMD 4TZKA 3RIHA 1NVTA 4YRBA 4I9UA 5KKCA 4BNWA 3T7CA 1P1FA 5L95A 5L9AA 3AW9A 2ZYAA 3F47A 4QEDA 4U0JA 4OSPA 1E5LA 1Y8QB 4P22A 2PTGA 2VRCA 1DIRA 1GDHA 4XD2A 7MDHA 5L4NA 3LU1A 2I9PA 4DWVA 3AOEA 4J3FA 5U4QA 4E30A 5IDXA 1W73A 2GRAA 3VH4A 1XU9A 4CMIB 4IDFA 1LBEA 1OC2A 3FI9A 2GF2A 3H7AA 1UZMA 3U9LA 1ZIDA 5EIOA 3O4RA 4WASA 4NU5A 4WLOA 3GC6A 3NDIA 2EW8A 5BNTA 3QHAA 1T25A 3RAJA 4AJKA 4NJMB 3DAFA 3GMDA 2FWMX 3O8QA 1ISIA 3W4KA 4NFSA 3SJUA 1VI2A 4J7UA 4OQYA 4DIFA 1NFQA 1ENPA 1TI7A 3K5PA 1BWSA 3OQ1A 4J49A 4NMHA 4EUFA 1IZ0A 3RUHA 2PD3A 3FWNA 5G2OA 1R15A 1KVQA 3NRCA 4Q9NA 3HDQA 2FR0A 3GHHA 3Q2IA 2HQ1A 3EYWA 1Y1PA 4MO2A 1A72A 1A9ZA 2YV2A 5CEJA 4CL8A 4FIZA 2HK7A 4B4UA 1HSOA 2HMTA 4B3IA 1K2WA 3F1KA 3PGJA 5ES3A 4CMCA 4IXTA 4TVBA 2GN6A 5BQFA 3GDGA 1E3EA 3VH1A 3WICA 1LSSA 4Q3DA 5EESA 4LISA 3AY6A 3INRA 1D4FA 5A3VA 3FD8A 3UFXA 2FSVA 1HYGA 2RHRA 3E1KA 3JQ7B 2VHYA 1UJMA 2O7QA 3F4LA 3GLQA 4II3A 5A3JA 2BF7A 4JBGA 4NBTA 1GZ6A 1HT0A 4QFCA 5AXBA 1MC4A 1B8VA 1A5ZA 4RPKA 4XQGA 1IZ9A 3ULKA 3KVOA 3WQSB 4B8ZA 2V6MA 3Q9NA 5KVCA 2HUNA 2HCTA 2ZTMA 2J5KA 3HDYA 3JD3A 4J2OA 3Q2KA 4Q3BA 5F3RA 1CWUA 2NTNA 2O4CA 3WG9A 4ALIA 1DOHA 4R69A 3IIEA 3OIFA 3ZU3A 4EYEA 4FFOA 1YKFA 2QX7A 4YT2A 2O7SA 3OF2A 5GZ6A 3OJLA 4MKZA 3PPIA 3U49A 1FDVA 4ND5A 4BOYA 6ADHA 5CEEA 1G0OA 4CPDA 1H6DA 3ZWAA 1YRLA 4JBHA 4EZBA 4UAGA 1UUFA 4I1IA 2WEKA 1LLCA 5MGBA 1BW9B 5F5NA 1EQUA 2D8AA 2NU9A 2BH9A 3U09A 1PR3A 3KSZO 1GUFA 4ZRMA 2NTVA 1R4MB 5JYDA 4B4VA 5KJCA 2EW2A 3D0OA 1PGPA 3WQQA 3B20A 4LSWA 2CVQA 1AXGA 1CYDA 2POQX 3VC7A 3ONEA 4N5MA 5A03A 3Q6IA 3GPDG 4NPCA 1RJWA 2EXXA 3W1VA 1QRRA 1A27A 2P91A 2VNSA 3ZGYA 5ICMA 3K6JA 5TX7A 4GQAA 4XA8A 1I24A 4JCOA 2X5KO 4NJMA 2Q2QA 5I7FA 2ZYGA 1E7WA 5LDGA 1ZNQO 1LDGA 3SEFA 4HWKA 4BV8A 4RVUA 4D3SA 2AEMA 1T26A 2VTDA 4YDRA 5KJ1A 1MC5A 2ZATA 3NYWA 3WOHA 5IAAA 1KBZA 1JKJA 2QHXA 3KYBA 3OJOA 4R68A 4MIYA 3VTFA 5DP1A 3OEWA 2ILTA 2PWZA 4PG7A 2LDBA 2NSDA 1U9JA 2E48A 4BMSA 2B4TO 3BTSA 3NTQA 3VPSA 4CM9D 4OGWA 4GI2A 2BI7A 4NBWA 4BQPA 3QE3A 4TKLA 4BO4A 3GRPA 1NYTA 4XYMA 4NZ9A 1EDOA 1R4NB 1CQIA 3TZHA 1ZFNA 4MVJM 3TFQA 4Y98A 3QV1A 4RO0A 2GO1A 1CDOA 4L4XA 4YJFA 4BO9A 2DKNA 1Q1NA 1P45A 2GZ3A 4GX1A 4WNIA 1ISHA 2AEJA 2LDXA 4UEJA 4WCFA 1PQUA 4K9DA 4PG5A 1ID1A 5KJFA 4TVOA 5K6AC 2RIRA 4FOSA 3OFSA 4E2XA 4BNIA 1HE2A 1GV0A 2Y05A 1NX6A 4M1QA 5KCZA 1ARZA 4E21A 1GYQA 3FTPA 3W4JA 4HNHA 1I10A 2X5JO 3U4IA 3LT1A 5I7VA 4WE3A 5DCYA 4DUPA 1B3RA 1BHSA 1NASA 1NVMB 1R16A 2BFAA 2E82A 5DBIA 1JQBA 4L75A 1SBYA 2Y68A 2HMVA 2IXAA 2HK8A 4NBVA 1TT7A 3I1JA 1Q2XA 1BGVA 4ZGWA 2HAEA 5ER9A 2X58A 4BGUA 3JQ8B 5EN4A 3LQFA 4CQMA 1A9YA 1E1MA 3SVTA 1N1GA 5F5LA 5CDSA 4Z9XA 3DAGA 4AJOA 2ZTVA 1IYZA 3VOSA 1ZUD1 2PA3A 4F3YA 4K26A 5L45A 2DBVO 2EKQA 3FN4A 1SB9A 5A06A 3T4EA 4P4LA 4YT8A 3MJTA 4L74A 3BZUA 2OUIA 1MA0A 5HWSA 4J7XA 4ALMA 4H15A 2AE1A 3DEYX 4HADA 1U2GA 3I9JA 3I3OA 2X4GA 5AYVA 1B0AA 3ZNNA 3BA1A 3D64A 4FN4A 4A5OA 1JTVA 1QLHA 1BXZA 2EG9A 5ILGA 2ZQZA 4WEOA 4YRDA 4QX6A 1KIFA 4R1SA 4UVIA 1IUKA 1DC6A 1EVZA 2I3AA 2W2KA 2O48X 1XKQA 3KRTA 2YV3A 1TLTA 3CKYA 3RD5A 4D42A 2Y67A 4XGKA 4XWYA 3JQGB 4ROSA 4D41A 2DBZA 3MWEB 1YQGA 4BNGA 2QRLA 4AJEA 4JLWA 3AFMA 1DC4A 2O3UA 4IINA 1ZBQA 4A26A 1ONPA 1SMKA 2OXIA 1U2DA 1E7RA 2WYVA 5CG2A 4CJXA 3H3FA 4DVJA 3F4BA 1HF3A 1ZSVA 5GZ3A 4GVLA 4EEZA 3AWDA 4U5QA 1IL0A 1GL3A 1OFGA 1W8DA 4NU6A 4RF2A 3S2EA 3PHLA 1GEEA 4B79A 4XZ3A 5JPIA 4NFYA 3ZV6A 4D45A 4EGFA 4MIOA 4I5DA 4J43A 1PJQA 3OECA 1YH3A 1HKUA 4WNCA 1NHGA 5FF9A 1MFPA 5DP2A 3WGTA 1JVSA 2Q50A 4NDNE 4LSMA 3AM5A 4U7WA 4CR7A 3C1TA 3Q3CA 4XKJA 4ZQGA 5TSDA 4RDIA 5HRUA 2J3IA 3GUCA 1C0IA 3FTNA 4OM8A 3U4CA 2QIOA 4LK3A 1OBFO 3GR6A 4N18A 4QUKA 4OYRA 1QV7A 3GNQA 4YT4A 3LYLA 2HJRA 1DB3A 3FR7A 4GWKA 4J91A 4Y6SA 4HP8A 2EERA 5T8KC 4A2CA 3QW2A 4BHTA 1ZEJA 3QVSA 4JN6B 4JROA 2FZEA 3K92A 1FXSA 4IIVA 3KYCA 4FD3A 1PGQA 3F3SA 3VZSA 4H7PA 3WX0A 1KVUA 1KVSA 4YVFA 2ZB7A 3H8VA 2PZKA 5JLAA 1NPTO 1EUDA 3AOEC 1IPEA 1PR9A 3JCZA 3B1FA 3NT2A 4BO3A 4DQXA 2PKQP 1U28A 4PLWA 1VJTA 1TEHA 2W90A 2EJVA 3CIFA 3VZPA 1X15A 2P2SA 1DIHA 4LW8A 3WGHA 1EMDA 1VKNA 2IZ0A 4GBJA 4IZHA 3BTVA 3GGPA 3RBZA 3ZU5A 3HHPA 4WUVA 4WJZA 2NNLD 2NUAA 4MKRA 1ZSYA 2Q99A 2Y1EA 5CFZA 2OBNA 2FZWA 1LUAA 5TJHA 2C59A 1L1FA 3MTJA 5I7SA 1PQWA 2EJWA 4C7KA 2WMDA 3PIIA 4GL4A 4JNKA 4PLTA 4DRYA 5JAIA 4KDEA 2I66A 3EY4A 3E5MA 3KB6A 4DMLA 5C3MA 4CM5A 1KY5A 1QORA 1YQDA 2XXJA 3ZHZA 3KHUA 2JCXA 4BNJA 3PJDA 2E4AA 4J90A 4EJ6A 4URFA 3A9WA 3SXPA 2X9NA 4LMPA 3JYQA 2Y93A 2CMDA 2OBYA 3CZMA 3PEFA 4QSMA 5T8KA 4IQGA 3SX2A 5TC4A 5KJ6A 1B3BA 4R16A 2G17A 1DO8A 2D59A 2Y1CA 1PJLA 4E4YA 4RJTA 5JAQA 3IKVA 1J6UA 2NU8A 2ZB8A 2W2KB 3OJFA 3JD2A 3AK4A 1YOVB 2BGLA 1C3VA 3GT0A 3WR5A 3UW3A 3VZQA 2DBRA 4XX0A 3QA9A 5TIIA 3MWDB 3RFXA 2B5VA 4U8GA 3L9WA 4RPLA 5DULA 3LF1A 4OXKA 3EAGA 1DRWA 3ZWPA 4TRNA 4RZHA 5A5FA 5IJZA 2B35A 5GZ1A 4OHUA 5JSFA 4TRJA 4J16A 1DBVO 3C3XA 4I08A 3PWKA 5IDYA 4L73A 5F1PA 1S7CA 5H83A 4OQZA 4FCCA 4RPGA 1KVTA 4FJ2A 5FWNA 5IF3A 4OL9A 2P4HX 3F46A 1I32A 3RBXA 1AE1A 4IIUA 4A10A 1DFGA 3PJFA 4ZQHA 3B1KA 5L51A 4J6FA 3GVXA 4MIEA 1M75A 3LC1O 4IJUA 5IN5A 2O23A 4TWRA 2J5RA 2P9EA 1N1EA 4JP3A 2JFGA 3E82A 1E7YA 4MVJI 3PZRA 1AHIA 1P3DA 1XQ6A 3ZWMA 5A9SA 3EC7A 2NQ8A 1CF2O 1WAMA 2NU7A 1JAYA 4GGPA 5KKAA 2OFPA 3ZHYA 2Y0CA 1YJ8A 4HFNA 3WNVA 2RBEA 3WGQA 1XHLA 4FFPA 4PG8A 3VPFA 5B4UA 2PKQO 3AU9A 3PI7A 1DSSG 2RHCA 2PGDA 2WWRA 2UV8A 1ADFA 1YGYA 3I9MA 4GLOA 4MVJH 2UUOA 3OHSX 3E9QA 4CL3A 5IN4A 3I4FA 5COAA 3UHAA 2YQ5A 3CSDA 3DQPA 1H2BA 2HKIA 3BMNB 3DB2A 2GR9A 3VKVA 5GY7A 4LCEA 1GV1A 3BAZA 4E33A 3NV9A 4GPD1 3U4DA 1XELA 4J4BA 4CMBA 3KO8A 2V6BA 4XJTA 4NIMA 4GGOA 3DXFA 1HL3A 5I9MA 4IGFA 1HYHA 4YR9A 4BO0A 3RC2A 2BMAA 3JYLA 3CUKA 2NVWA 3MJSA 3JQ9C 1J5PA 4WCFC 1AGNA 1NR7A 4Z9FA 3ANNA 4BO2A 1X14A 3KETA 2EGHA 4E2WA 2YQ4A 2NACA 2VHVA 4OMUA 3LZ6A 2PZMA 2I76A 1Y9EA 1D3AA 2GDZA 3K73O 1HTBA 1ZKMA 1N7HA 3K30A 2RCYA 3DMTC 2VYNA 4IDAA 1LI4A 3VZRA 3UAGA 1YONA 3LK7A 3EVTA 2AQIA 4OKIA 1F06A 1MV8A 4HBGA 4CM3A 3ST7A 4YPOA 3C1OA 3D4PA 3Q0EA 4CLOA 3MJEA 4INAA 1DHRA 4JXKA 1YWGO 3AI1A 4NJOA 4XYGA 1PJBA 2A4KA 3ASUA 3I52A 3E6AA 1SCUA 4E5NA 1CIVA 2NTJA 2RH8A 2C07A 4R3WA 1I36A 1Y5MA 2G5CA 1T2FA 3R3JA 4UVGA 3KYCB 2X5OA 5CPFA 3H65A 3UF0A 1ZZEA 1SEVA 3MZ0A 1JN0A 3PWSA 1LDBA 4C7JA 5G0TA 5JDCC 4RZIA 3ANLA 1KETA 2ZIZA 1E1LA 2BD0A 1DEHA 1XCBA 4CV3A 4DPMA 4KTTE 1ML3A 2PY6A 4BNNA 4MVJF 2VWQA 4RVHA 1ZK2A 3IL2A 3PDJA 3BHJA 3NUGA 1DRUA 4FGWA 3W4IA 5C5IA 3PQFA 5TRTA 2O3JA 3RWBA 4AL4A 3L07A 4J4TA 3T4XA 2J6IA 3EW7A 3C85A 3BYZA 4L8VA 4YXFA 3G3EA 4N5LA 4DYDA 1MG0A 4Q3EA 3WMWA 4CLHA 2PNFA 1N9GA 3LT4A 1YBMA 3FNHA 1T24A 3GVHA 4BKPA 3C24A 1O5IA 1AXEA 1L7EA 3JQAD 4CLOB 2D1YA 4PZEA 4ND1A 2WYWA 1EFKA 4CMJA 2E37A 4J1SA 5DNAA 1TT5A 5BR7A 7ADHA 4B3HA 5IXYA 2EGGA 3E18A 3H9QA 5T6BA 4ND2A 3PVZA 5H82A 3PYMA 1X1EA 3DBHA 4BO6A 1IB6A 1XWFA 4HNGA 4XDZA 4HY3A 4E5PA 2DBQA 4AG3A 2DAPA 1GUYA 2DFDA 2I99A 3JQCA 1NTOA 1GQ2A 2B5WA 3PXXA 2IXBA 2HSDA 3ORFA 3MJCA 2C2XA 1DLIA 3PP8A 4PRKA 4LMRA 1RPNA 1UDCA 2VHZA 1R0LA 1KC3A 4BO8A 3D5TA 1C0LA 1WLYA 2DPHA 3ADOA 1GCOA 3INTA 3G1TA 4BNVA 4EJMA 2JHGA 1EQ2A 5EPOA 3AUAA 1WMBA 3N74A 1T4DA 2JD1A 2V7PA 3GNSA 4RPHA 4CR8A 4QT0A 3DZFA 2I3GA 3ENNA 1O9BA 3TQHA 3DZJA 2DUUA 3ZNQA 5K9ZA 1C1XA 3O03A 1Z7EA 2PZJA 4XGNA 1ZMTA 1GAEO 3WFJA 4AJIA 5CG1A 4FFNA 5LC1A 1I2CA 4HUJA 2VT2A 4PCVA 5TQVA 4PLHA 3PFFA 4BNUA 5BNIA 1RM3A 3GDFA 5KVVA 1ADBA 3QVXA 2H9IA 1U8FO 4PVDA 1A7KA 4YJHA 1FDSA 4CM4A 2SCUA 4O5OA 2H6EA 5A5EA 3TOXA 3WGGA 4CM6A 1G1AA 3FHLA 2Y1OA 3IMFA 4L4RA 5L40A 2PGJA 3PGXA 3EVNA 4XB2A 1UP6A 4YEDA 3STHA 3C7CB 5TJ9A 4IMRA 3I9NA 1D7OA 2EV9A 5MDHA 4O59O 4W4TA 4NQZA 1YB4A 4XCVA 4KTVE 4EBFA 4ZQEA 3AFNA 3L4BA 2JCYA 1U5AA 2V65A 4DLLA 3A06A 3BHIA 4IXWA 3B70A 1EBUA 1FMCA 2R00C 3I23A 1I3MA 3RUAA 2EP5A 4FJ0A 5JDIC 2WTBA 5EQFA 2CFCA 5HS4A 1QMGA 4IQ0A 2Y1DA 3OM9A 3I6IA 1O89A 4A27A 2CD9A 3S8MA 4KUEA 3GHYA 4EUHA 2WYUA 4J0FA 3UXYA 1HDRA 4E5MA 5ADHA 4IZIA 2Q1WA 1ULSA 1OAAA 1SC6A 3RBVA 4E13A 1ZXBA 4JQCA 3ZWNA 2C2YA 2B69A 1E5QA 3GH3A 3V1TC 1E3LA 3HFGA 1X0VA 3ZV3A 1LC3A 1M6WA 4W9NA 1MFZA 1UR5A 1VL0A 2BHLA 3ITKA 1NPDA 3VVCA 4BS9A 4E5KA 1O0SA 1R4MA 3DTTA 1QYXA 4R1TA 4WLVA 1DFHA 5TS3A 3SLGA 5CPBA 3HADA 3JSAA 5L4SA 3OQ6A 2XXBA 3GN1A 3P19A 1PWXA 4BKRA 3JD1A 2XF8A 1J49A 3C8MA 4CR6A 3JQ8A 2Y66A 2TMGA 3PQDA 3WLEA 5A9SB 3WIEA 4CMHA 1WZEA 4A73A 1D1SA 1T2CA 2BI8A 4DL9A 1EVIA 2BELA 3L6DA 1LTHR 3CXRA 3JQDA 4BGEA 3OH8A 2X6TA 4CV0A 1KEPA 1B15A 1EBFA 1QP8A 3FSRA 1UAGA 3RJ5A 2W98A 2YJZA 4OAQA 3WYCA 1X7GA 5G4KB 3H2ZA 1XIVA 1F0YA 4R3NA 3UKOA 1BW9A 2B4QA 2CVOA 5A05A 2PGLA 3VHRA 2IRWA 4AVYA 1JWBB 5DBFA 2GZ1A 4X54A 3TDKA 4ILKA 3O38A 1LLQA 1N2SA 1IHYA 1WXDA 2C7GA 3D3WB 3NGLA 6LDHA 1SEPA 2YUTA 3K2BA 4RF5A 4R5MA 1OI7A 1WDMA 3KEOA 4B4WA 3W6ZA 4J0EA 4DC1A 1EK6A 4RVGA 3H9EO 1AUPA 3MEQA 2CVZA 1XR3A 4W7HA 3BMOB 4A03A 4PG4A 1VLLA 1Z74A 4H16A 3WYEA 2UUPA 1Y8RB 2VTEA 1SB8A 5JAMA 1WVGA 4LN1A 3F1LA 2Q49A 2AG5A 2B4RO 3JQAA 4F45A 5B1YA 1B14A 3H2SA 3IDSA 2DVMA 4RLHA 1BVRA 1N5DA 3L4SO 3NTRA 2GD1O 4XQCA 1SNYA 4NG5A 1P77A 4UVHA 4ALJA 2Y0DA 1N92A 1PJ3A 3W8FA 1NP3A 3UGKA 1XG5A 4JJGA 1DRVA 4AJ1A 1GPJA 1V6AA 3ASVA 4M54A 4QTZA 3PIDA 3RFTA 2H1SA 2HRZA 1X0XA 3CE6A 4CM4B 1KOLA 3VDQA 1E3SA 5TT1A 2IYPA 4YJHB 4UEKA 4UREA 4MP3A 4FDAA 2YW9A 4DBZA 4ND3A 3ROKA 4E0BA 4Q39A 4YRAA 1VPDA 2IE0A 1I3LA 4YAJA 2OZPA 3S55A 4DPLA 1F8FA 1TA4A 4K6CA 4BB5A 1DAPA 1Q0QA 2CDCA 1WDKA 1ZJYA 5HS6A 4QECA 3QSGA 5BNFA 4IM7A 2C0CA 1XQ1A 4QO8A 2DM6A 1YS4A 1Z73A 2X0JA 4JK3A 4PLGA 5FFFA 4FFLA 4UVDA 5DDIP 4IJVA 4AJ4A 3AM3A 2OORA 4Q3NA 4D3FA 4GX0A 1ULUA 5JCJD 2PD6A 4J1NA 2D3TA 2CDBA 1YDWA 3GZ4A 3BMCA 4EJ0A 1EE2A 4RVDA 3CINA 5F1KA 4MVJD 3U4HA 1GPDG 3QIVA 3TN7A 3NKLA 5KJEA 1FF9A 3U3XA 5L7WA 2UVDA 2IYOA 3KXDA 3D7LA 3JD4A 4YCAA 1Y8QA 2CNBA 2IEDA 3CMMA 4AJHA 2I5PO 4YJDA 3H3JA 1LC0A 4UVEA 5CEFA 1NFRA 3DHYA 4Y67A 4ZRNA 5G0SA 2WD8A 3ZI0A 1Q0HA 3L9XA 4HXYA 4QFDA 3GZNB 4XQ9A 4GLLA 4CM7A 3MJ4A 4OH1A 5BSFA 2VCYA 3TWOA 2NV6A 2C20A 1V35A 3GVPA 4OKNA 2GN8A 3I83A 5COQA 2QRKA 2AXQA 1XDWA 3AUUA 3GVIA 3RSHA 2HK9A 1E3WA 4B7UA 4Q3AA 4MVJE 3WB9A 4H3VA 4P8RA 3TPCA 3CH6A 1UP7A 2R2GA 4BIIA 4BUCA 2WD7A 3GNTA 1B7GO 3M2TA 3AI3A 4PFJA 3WJ7A 4CUJA 3JYPA 3FPCA 4I5GA 5LCXA 4OJNA 3ZCXA 3CTMA 3OEYA 2J8ZA 4WLFA 1ZEMA 2WJPA 2VN8A 5JMPA 1PSDA 3LLVA 5A04A 3O9ZA 1C1XB 1BRMA 2PV7A 2ZTLA 1ZCJA 2Y99A 3VPXA 5AXDA 2F1KA 4BMVA 2O3SA 5THQA 2HMSA 3WDSA 1H6AA 3FNFA 3NGXA 4M89A 5IZCA 3MTGA 2FMUA 4B3JA 4O63O 4CMGA 3P2OA 3AY7A 1XYGA 4Z0PA 3ZU4A 5T67A 3O26A 1TVEA 1GFSA 1VE9A 4ONEA 3TSCA 1TB4A 1YOVA 2O3RA 3G79A 2H63A 4EDFA 2Q3EA 1KS9A 3DHEA 4CM9A 1NFFA 3OJEA 3PDUA 3AUSA 4OSOA 3WJAA 5HM8A 2VNAA 4WECA 1PWZA 2E6UX 2UDPA 1P1IA 1XGKA 3PTZA 1QYCA 3JQFA 1YL7A 4AJ2A 2GZ2A 2AQ8A 5L7YA 1FDTA 1JA9A 4DREA 1Q7CA 3KUXA 3GOHA 2GNAA 4XQEA 1ZK1A 5GMOA 3C7AA 3DFUA 4EEXA 5AQ1A 3WGYA 1O6ZA 5I9NA 1PJCA 3E9MA 3NTOA 4XIYA 1VL6A 1WNTA 4AJLA 1B16A 1LRJA 1V8BA 4JJFA 3TZ6A 2X86A 4WLEA 2JJYA 2ZJ1A 3BTOA 4DLAA 1XSEA 1HE5A 5CHEA 3NX4A 4BB6A 4EUEA 1ZSNA 4GSLA 4FSHA 4NR0A 5JS6A 2HLPA 3NDJA 4BKUA 1YVEI 2GCGA 5ITWA 1NM5A 1MGOA 4BGVA 1W4ZA 4JJIA 1ZH8A 1BXKA 9LDBA 4GVXA 3WNQA 2X9VA 3GAZA 1ENZA 3KZVA 3DBRB 3RC1A 2J3KA 3JQ9A 4NK4A 4CMIA 4LVCA 3GDOA 5IG2A 4FFRA 1ZVMA 4YAEA 4DGSA 1H5QA 3UCFA 1SAYA 1P33A 4YWJA 1LJ8A 5TLSA 3WBFA 2Q4EA 2JD2A 2CY0A 1MB4A 4FB5A 1YO6A 2UAGA 1HWYA 2VHXA 3RUCA 5IXSA 2VZ0A 1K0UA 3JD0A 1M66A 1V0JA 1C1DA 3WBBA 5F1OA 4E3ZA 1DIBA 1ADGA 1RM0A 4HV4A 2VOJA 3JQ7A 3GZNA 1I2BA 3ZHBA 2CUKA 4D3DA 4KWHA 2W4QA 3DBRA 2BGMA 2DTXA 1RM4A 3H4VA 3HE3A 5AXCA 4BO1A 2GN9A 2VHWA 4YTEA 1LDNA 3GFGA 1P0CA 1A7AA 1KEWA 1MXFA 4QQRA 2DLDA 1VSUA 3T7EA 3DC2A 1VL8A 4F46A 4EI2A 4PLVA 4GX2A 3LLSA 4OOEA 4YA6A 4N54A 5EINA 3NJ8A 2VYND 4D44A 3GGOA 4UUPA 3QRWA 1P0FA 3KOUA 4P38A 3I9KA 1YDEA 4RCVA 3VH3A 3H9UA 3UOGA 3NT5A 1ZK4A 5I8WA 3VAZA 4IPTA 4ALLA 4WCFB 3AM4A 3QVTA 2F00A 4R4JA 1YE3A 5F21A 4OXYA 2WSBA 4PVCA 4L9RA 3JQBA 3HJAA 2X0IA 4E32A 3A28A 1E77A 3PLRA 3RUEA 1YJQA 3CPSA 3HN2A 3G49A 2Q1SA 2W2LA 2QYSA 4XIJA 1T1RA 1UZNA 4ZD6A 5KTKA 4YBZA 4TZTA 3BMQA 1Y5RA 4IGEA 1R37A 3JQEA 1I3KA 1J0XO 5G4KA 4E2YA 4ITUA 5DCUA 5AOVA 3WSVA 4CLEA 2YHIB 4TRRA 1DLJA 1KY4A 1QYVA 5TNXA 5U9CA 2NLOA 2OMEA 1JW9B 1W0CA 1NHWA 1P9LA 4FW8A 4OOFA 2P4QA 3TL2A 4ID9A 4QO7A 2A94A 3KYDA 4EITA 4A7PA 4DBVO 3ZWWA 3RKRA 5J23A 2AEFA 2I6TA 1U8XX 1ISMA 1OOEA 5KOIA 1JWAB 2X1HA 1HYEA 3GVCA 1MLDA 2QYTA 1IHXA 5ER6A 5L53A 4CUZA 4FR5A 3FRJA 1LEHA 1LSOA 4CMEA 1AHHA 4FJ1A 5AXAA 3K2EA 1BSVA 2JFHA 2YHIA 5FI5A 3WGOA 1AN9A 3N58A 1LLDA 2PLAA 2O2YA 1JVBA 5B12A 2EIHA 3ENKA 4W99A 5KVQA 1JKFA 1TT5B 1CETA 1A71A 3DDNA 1XA0A 3JV7A 2J5QA 2W8ZA 3H9GA 5THKA 4IQ8A 5A4DA 1JU9A 2IZ1A 4UUOA 3OMLA 3RROA 3S1LA 3TZQA 3KV3O 2X8LA 3D4NA 4J1QA 4BNHA 4BV9A 5G0WA 1GZ4A 3IP3A 3DZGA 2BKAA 1YBAA 5B4VA 4F6LA 3GMSA 4S3MA 1U3TA 3S2IA 3GUYA 4HX5A 2IEBA 1PEDA 1IY8A 1RKXA 4G2NA 2HMWA 3L77A 2BLLA 3PHHA 3WIDA 2QG4A 3LSYA 5JCJA 3P5SA 3RI3A 3WGZA 4XYLA 1H0KA 1DDOA 1GU7A 3E8XA 5JDIA 1I01A 1VKOA 4RORA 1EE9A 2R00A 5G0UA 4AJPA 3GPIA 5JCXA 2Z1MA 3QQPA 5DBGA 3K96A 3L4BC 1GQYA 1OC4A 1LA2A 1HETA 1IPFA 2NWQA 3JQBC 2FHSA 2GN4A 3WLFA 1GY8A 4FC6A 1E1NA 9LDTA 1Y9AA 3A1NA 3NAQA 3R1IA 1GCUA 3HQ4O 1UH5A 4J4HA 3WSWA 1FJHA 3DMYA 1HDOA 2VWGA 2B36A 2ZB3A 4DQVA 1S6YA 4L0QA 4PN3A 2JAPA 2PH5A 1NWCA 1DC3A 3LF2A 4XR9A 2VUSA 3D3EA 1PL8A 2YV1A 5HBRA 1NR1A 1YL5A 2NM0A 3PWZA 4QXMA 3HDJA 3IOYA 1GZ3A 1C14A 1I33A 2RAFA 1JAXA 1XLTA 1GD1O 3D4OA 2ZCUA 3NT4A 1T2AA 4CQLB 4CM8B 3WGIA 3ZZNA 2ZKLA 1LXCA 1K6XA 2GSDA 3ITDA 4XEHA 2A9FA 3WMXA 5CDTA 3LT2A 3EHEA 2HJSA 1YB1A 1GEGA 2FPIA 1U5CA 1ISJA 4NK5A 1BDMA 3V2UA 3EMKA 3ZWXA 3WWYA 1GADO 1RM5A 2VT3A 3R0IA 1QV6A 5JO9A 3W8EA 3L0DA 3KEQA 3H5RA 3Q1LA 4RDHA 2XOXA 3FPLA 4TRMA 1UDAA 4W7IA 5ENDA 1KVRA 3AJRA 2VUTA 2O4UX 3OP4A 2VWPA 3OQBA 4WOKA 3WTBA 4DMMA 1LNQA 2Q1TA 4CLRA 1GQQA 1LQTA 1PS0A 4YQZA 2VZ9A 4D0SA 2AQHA 3BHMA 3VDRA 3GA0A 3HWRA 4DC0A 4BO5A 1HDXA 2YFHA 5BT9A 2AG8A 3E9NA 4WGGA 4Z0HO 5DN9A 4TMFA 3V2GA 1V9LA 1D1TA 1R0KA 1HLDA 4MDHA 3OJ0A 4ZQFA 4KDFA 4CLXA 4MKXA 1V3UA 3INGA 4E6PA 4PG6A 3DOJA 4NH4A 3F6YA 3KSDO 1Z6ZA 4FFMA 4CUKA 2DFVA 1X7DA 1UXGA 5C7LO 3ZNOA 1PJSA 3ZU2A 3GF4A 4C4OA 2Z1NA 2X7HA 3AOGA 3OA0A 4ZVVA 1J4AA 3M1LA 1K89A 2Z95A 3DZIA 4CMKA 3HFSA 3PJGA 2P5YA 3OIDA 2QRJA 3ABIA 2C5EA 4J9VA 1WZIA 1HDCA 1WPQA 1QYDA 2J3JA 2XPCA 4ZICA 3JQGA 3DZKA 5EMHA 4Z3DA 4RVSA 3ONDA 3DAPA 4IDGA 1QR6A 3G0OA 3GN2A 1NPYA 4M55A 2VUUA 3GQVA 4J9UE 3OBBA 4FGSA 1QLJA 4MP6A 1KEVA 2O3TA 5HTOA 3GK3A 1UXKA 3NJ4A 3BMQB 4K28A 1GUZA 3HG7A 1P1HA 2DU8A 3CZRA 2D5CA 1F17A 1OMOA 4WOJA 3ZV5A 2BFOA 3ROPA 1X1TA 2DC1A 3TNLA 1G6KA 5K6AA 4AJNA 4KZPA 3RUIA 3IJPA 2ZJ0A 4CQLA 4O0LA 3ZWBA 3ROQA 1LLUA 3KYDB 2JAHA 1LRLA 1NWHA 2DT5A 5EL0A 1OZAA 1U1IA 4IY1A 1VSVA 4GH5A 4P4GA 3H9JA 4GSKA 3D1LA 1HLPA 2PH3A 3ETDA 3P2YA 1EDZA 4RL6A 4Z6KA 3P7MA 2P5UA 3B1JA 3ZWVA 3I9LA 3GY0A 4FBGA 5DT9A 2NQTA 5KIAA 5JAZA 2G82A 1NVGA 4PLFA 2P9CA 2JL1A 2X22A 5ILOA 1SOWA 3WS7A 1UXJA 3SC4A 1NQAO 1ENYA 4W82A 5FI3A 5A9RA 2V6GA 2CF6A 2VWHA 1I8TA 4BGIA 3DBLA 3ANMA 4BNFA 4R54A 2O50A 1B2LA 4Y6RA 2W2LD 3JQ6A 4XYBA 1H2HA 4IJKA 3MOIA 3H5AA 3EZLA 1T2DA 3ON5A 3EK2A 1N7GA 1NQTA 1PS8A 3PYLA 4RQUA 2CSUA 4N7RA 1K5HA 2B83A 3IP1A 1Q7GA 5C7OO 2C82A 1E92A 2VZ8A 1GYPA 1H6BA 4NI5A 3B6ZA 3LC7O 3QP9A 3QWBA 3PQEA 4WKGA 5T64A 1V3TA 4JBIA 2FR1A 2VYVD 2WM3A 1RWBA 2UYYA 3OSUA 4GMGA 2D5AA 1U7HA 2CZCA 3L6OO 2Y1GA 3PLNA 3V1UA 4NFHA 2WD7B 2P68A 4B7XA 4I5EA 1DFIA 4OIMA 3ZWOA 1ONOA 2DPGA 5BSEA 4Y9DA 1LU9A 1CEQA 3TZCA 4GWGA 1MG5A 3UUWA 4I9HA 3KBOA 1HE4A 2HU2A 2EHDA 2GLXA 4RVFA 3COSA 4R5HA 3X2EA 1ZXLA 2O3QA 3E03A 2QZ9A 5CDYA 3DOCA 2J3HA 4I9NA 1P1JA 2G76A 1HEUA 5I7EA 1IE3A 5JC8A 3ICPA 1NQOA 3SBOA 4Z9YA 2PZLA 3DBVO 3UCXA 4DQUA 2ZTUA 3HB5X 4BNZA 3X2FA 2YFQA 1Z82A 1MP0A 3G1UA 3DBLB 5IDQA 3TF5A 2FY8A 4NBRA 1WWKA 3WXBA 3FBTA 2DTDA 3GEGA 4YJFB 2O2SA 3E48A 4YACA 2PFGA 4CV1A 4E5YA 3VH2A 1DIGA 2Z5LA 3TOZA 1BG6A 5ENVA 3RUFA 1NAHA 4WLUA 3VKUA 2Q1UA 4K6FA 1ONNA 1BVUA 1SPXA 2AMFA 3E5RA 3G17A 5A02A 5BSHA 5KNLA 1KC1A 2VOEA 2Y1FA 1XEAA 4II2A 2PD4A 5DCWA 1X13A 3M1AA 1UZLA 3VTZA 1A4IA 1BDBA 4OO3A 4DIBA 5BSGA 3IAHA 4P4NA 3V8BA 2Y0EA 5IDWA 1PZHA 3R3SA 4G65A 4FOOA 4S1VA 1UXHA 1I30A 1W6UA 3KTDA 4MVJG 3ONFA 4ND4A 5A9TA 1F8GA 4I8XA 2CF5A 3PRJA 1CERA 5JY6A 2YY7A 5U1PA 3FBGA 2CDAA 3NEPX 4U6QA 4BVAA 1LX6A 2OHXA 5ITVA 3K31A 2HDHA 3DZHA 1E6EA 4NBUA 2GUGA 1MXHA 4BL5A 3AI2A 2C29D 4R9RA 3IQDB 4UUMA 4J7CA 4Y6PA 2A92A 4HFRA 5L3ZA 3CEAA 2GASA 5DOVA 1SZJG 3K8ZA 1WP4A 1ZK3A 1H93A 2ZK7A 4BKQA 2OO5A 4IS2A 1U3WA 3TL3A 4K1LA 3BMOA 3ZHXA 4YYZA 3R6DA 4JX8A 3IUPA 3GG9A 4BNXA 1QG6A 2AQKA 3KM0A 3QLJA 1M67A 4G5HA 1E7SA 4J1TA 4CMEC 1PX0A 2E49A 1GYRA 3JQAB 1K3TA 2JCVA 5HA5A 1DJQA 1HSZA 4NNJA 4RV9A 2EP7A 3RJ9A 3RCBA 5IZ4A 4ZA2A 1SOVA 5T57A 3KSUA 3VVBA 4ZJUA 4R01A 1LRKA 1PIWA 1E1KA 1ZK0A 1NQ5A 3C7DB 1E3IA 2GERA 3DOOA 2HRBA 1MX3A 3QWIA 4WK6A 3FF4A 1O8CA 1E3WB 1XU7A 5JNLA 3ZH2A 3DHNA 1E7QA 2VRBA 1M76A 1JLLA 3W8DA 1U7TA 4DA9A 3I6QA 3IKTA 2HO5A 4DIOA 3SLKA 4MOWA 2EEZA 2PK3A 2VRCD 5L4LA 2IZZA 2D4AA 2H5LA 3Q11A 2FP4A 2ZQYA 2OP1A 1T1SA 4XRRA 1PGJA 2OOSA 1EK5A 1DXYA 3M6IA 4CM8A 4DYVA 1CQJA 2FPPA 3ETGA 4PGFA 3QWHA 1UP4A 3F9IA 4RF4A 5H81A 4BMNA 1I5RA 1K6IA 1C1DB 4GKVA 4A0SA 4DLBA 5JFOA 2AA3A 5DF1A 1L7DA 4M87A 1PJ4A 3DO5A 8LDHA 1DIAA 4LVUA 4E31A 1LSJA 3OETA 3FR8A 1QKIA 4KUGA 3PZBA 4N5NA 2G1UA 4UULA 2XAAA 5I9LA 1ISGA 3FNGA 1D8AA 4HFMA 4WPGA 2YDXA 1I3NA 4XR4A 4M8SA 4R1NA 1DC5A 4IBOA 4YQYA 1EVJA 1C0KA 1FDWA 4YT5A 4R51A 4MVJP 4HFJA 2FSSA 3ADPA 3WWZA 1H9BA 3DL2A 1Y6JA 3DONA 1H94A 4PLYA 2X0RA 1B26A 4IS3A 3I4CA 1G0NA 1PZFA 1IOLA 2EKPA 4IDBA 1JKIA 2DTEA 1DJNA 1ENOA 2DQ4A 1Y81A 4PLCA 1ADCA 3IUSA 4D46A 3GRKA 3IC5A 1GTMA 1Q7BA 5JBIA 3ZWYA 2AHRA 2ZB4A 1E0DA 1HZJA 4IDCA 5AVOA 3GFBA 2FOIA 3PK0A 4O1MA 3EDMA 3RFVA 3S2GA 1KYQA 3DR3A 4D79A 1WDLA 4GAEA 5CP8A 4IJWA 1HDGO 2NVUA 2Q46A 3MCVA 1I2ZA 4U0KA 5IFLA 2G0TA 4RLSA 1CJCA 1E7MA 3AU8A 1P31A 3BXXA 5G0VA 3GGGA 1ZO8A 2EF1A 2X9GA 5EERA 3RUDA 2AE2A 1MUUA 4JGBA 4MPDA 1M6HA 3A4VA 1DAOA 2JKVA 5L7TA 1EZ4A 3RC7A 2P9GA 2JD0A 1O95A 5JYEA 1H9AA 3WFIA 4BNLA 1LSUA 4LRSB 1F14A 1YQXA 1C0PA 3GEMA 3HUDA 3N7UA 4XJSA 3PHJA 4B4OA 3QJ5A 8ADHA 1VC2A 3SJ7A 5TT0A 4GMFA 3FCOA 1PU2A 4KP7A 5C7IO 2WE8A 4DPKA 1YXMA 2JHFA 1DHTA 1E6UA 4YAIA 3KLPX 3V5NA 1CRWG 1NBOA 3L6EA 1QYWA 4IDDA 2ET6A 1Y7TA 1FDUA 1HDZA 3JQFC 3HNPA 2YHUA 2I65A 3KLMX 1YB5A 4KWIA 3RC9A 4CMAA 3HN7A 2PKRA 2EWMA 2AW5A 2GPTA 4RPJA 2B0JA 4FQ8A 3IS3A 4I5FA 5A1TA 3HB4X 3ZV4A 1H6CA 1P1RA 1X7HA 3O8QB 1P74A 1PJ2A 5IZCC 2YDYA 1EUZA 3ZW9A 4BKOA 4GX5A 2Q45A 3HDHA 4XYEA 3TZKA 1V3VA 1RYEA 4JP2A 3MJVA 5JMWA 4YAGA 2FRDA 4FS3A 1JDJA 4WEQA 2JFFA 2C5AA 3I5MA 2NVBA 2QQ5A 5JDCA 3U5TA 4GKBA 4BNKA 5CDUA 4R41A 5JY1A 3AUTA 4MINA 2OGUA 4XDYA 4ZQBA 1PQPA 1PS9A 4CQMB 1KERA 5B4TA 3ETEA 4RF3A 1LDEA 3BMNA 3UH1A 4ALKA 4Y8VA 1EFLA 1B8PA 3F5SA 5FEUA 2X0NA 3Q9UA 3ZWCA 3DTYA 1K6JA 1VRWA 4EW6A 4HKTA 4XGIA 1HRDA 2WE7A 3DBHB 4F6CA 2ZYDA 3UCEA 1TXGA 4CODB 5COBA 4WCDA 1NAIA 1HZZA 2OP0A 2I67A 3SC6A 1VJ0A 3V2HA 3DMTA 3WQRA 3ZDFA 4OXNA 4ZU3A 3RASA 4DXHA 1O94A 1DPGA 3QWAA 3LC2O 2YZ7A 3WTCA 1LDYA 3UVEA 4XRGA 1U4SA 1BTOA 1E3JA 4PZCA 4PIVA 1Z75A 3OIGA 1U3VA 1FK8A 4D43A 4D0RA 3A14A 2PR2A 4Z0TA 4CLDA 1R6DA 1PGNA 4W6ZA 5DZSA 1RYDA 3CMCO 3TJRA 2GGSA 1Y8RA 1GR0A 1NXQA 2V6FA 4M86A 4KMSA 1PL6A 3JYNA 5TF4A 1LDMA 1E6WA 2RH4A 4ALNA 3D5QA 4FPXA 3ZW8A 4M49A 1PTJA 4BNMA 2QZZA 3H5NA 2QW8A 4KOAA 4PLPA 5T5QA 4JIGA 4TQGA 1I0ZA 2C54A 3D3WA 4G81A 3DFZA 4UUNA 1A4UA 3OA2A 3C1AA 2VQ3A 5CAEA 4L76A 4TKMA 4IDEA 3IJRA 4IUYA 3JYOA 4BNTA 2X23A 5KVSA 4PLZA 3NDRA 1HE3A 3QVWA 2ZCVA 4IMPA 5JXWA 1WMAA 4KUHA 3QVOA 2NVUB 1ZMOA 2IODA 1WW8A 3PYXA 4WLNA 1VJ1A 3DZBA 3EGOA 4R1UA 3TFOA 3JTMA 4RGBA 3OICA 3W6UA 3U0BA 2R6JA 2FR8A 1ZJZA 5EJ2A 1T4BA 2HMUA 5CDGA 4FC7A 2IDZA 2NU6A 4ZHSA 4CLRB 2FN7A 1R4NA 1R12A 2A35A 4RQTA 2B37A 4Z3KA 1Z45A 3VPGA 2BRUA 5C37A 5JO0A 1BXGB 1YBVA 1ZW1A 1UDBA 1PJTA 1N8KA 3TRIA 5FYDA 1BXGA 3H6KA 1U3UA 2EKLA 3BMCB 1HDYA 4PZDA 3GG2A 1P44A 1U4OA 3UN1A 4BNYA 1HXHA 2BGKA 2FPGA 4PRLA 4BO7A 3BTUA 2YYYA 4MP8A 3RU7A 1LQUA 1EUCA 1Z7BA 4KQWA 5B37A 3S2FA 5I8ZA 1R66A 3RQSA 3ZN2A 3PJEA 4KQXA 1UAYA 4NHEA 4LRTB 5G4LA
chains in the Genus database with same CATH superfamily
3EVFA 5I7OA 3A1VA 4L8FA 5J58A 1Q19A 3PI6A 1T2EA 4LHEA 1YR1A 2JJMA 3BBPA 4MJLA 4A3SA 3CVYA 5HFNA 1GKUB 3FWZA 2A88A 2G63A 1R0SA 1KKLA 4YRQA 4BQFA 2HO4A 4R71A 2ZI6A 4LCJA 1VM6A 1NJGA 1NMYA 2ZRMA 3G2MA 2QLMA 4UXIA 1CRQA 2PT5A 3DOIA 4JDUA 2RHMA 4G97A 5DGHA 1OY1A 1RHUA 2TMDA 4PE5B 1RW4A 2B1QA 5DOZA 5TGDA 1QIMA 1KMMA 1P1KA 1SK9A 2PGOA 1YL6A 3K35A 2RG1A 3PBKA 4C0XA 1BMDA 1BE8A 1J97A 4GU5A 1J70A 1DP4A 3GBPA 4IDNA 1DKQA 4JUFA 2OAGA 4OBEA 4Z9AA 3RAFC 2PUFA 3RKUA 3QI7A 3AR9A 3ZNPA 5CBPB 2WDZA 3U62A 2WJ6A 3UV7A 2JK0A 3K4QA 3MMSA 1XYYA 1ZH2A 2P77A 3EXIB 1U1GA 4AICA 4DSAA 3CLVA 1E4EB 4XH9B 1B4DA 2PUVA 3PX3A 4GP9A 4MQFB 3QVGA 4YV0A 3EMVA 1P62B 4XWTA 3LVFO 1ZXXA 4NV3A 1IULA 1FUYB 4E12A 1RXEA 4R9SA 3TO5A 1EHCA 4EW3A 2BDTA 1Y1RA 4QFMA 3IIMA 1T29A 2ODTX 4L7QA 5MN6A 4BEVA 2F8MA 1K06A 2DUMA 5FOTA 1KQGA 3AY0A 3K9QO 3LT0A 1ZIYA 3ZY5A 2JGJA 2LR0A 1VDZA 4R7ZA 5CYPA 5CTJA 4HUQB 3EB9A 1A9SA 4JP1A 4DCVA 1GZDA 2Q2VA 3H75A 3HACA 1MD9A 2D62A 3S1AB 1AK2A 2JFWA 3ABQB 2Z2IA 1PV4A 3CCCA 3F2IA 3GJSA 1PRYA 2P9BA 4N0EA 1KJJA 3FOAA 3NV7A 5F51A 4HQRA 3FB1A 4CQMD 5JYCA 5K7SA 1SY7A 3F90A 2ZRCA 2OZLB 3S2YA 4E5VA 2R4UA 5CFQA 3H1AA 1VCOA 3R76A 3E81A 3R4VA 3SQNA 3CGGA 1EM8A 1NVTA 1UBMS 1EDEA 4I9UA 5DI9A 5E6UB 4TL8A 5ITZA 1HE1C 5KKCA 1E61A 4WV3A 1QUEA 3BJRA 2XNKA 2ZYIA 5I4CA 5L9AA 1UWVA 1Z5OA 3D4BA 3F47A 1MT3A 2ZRJA 4ZC1A 1Y8QB 5DK4A 4C6SA 1EFUA 5JD5A 5K09A 2J4CA 2PWBA 1GDHA 7MDHA 2G6TA 3R3UA 5J59A 1L4LA 3SDSA 2JGNA 4C0AC 4LY6A 3ER6A 1K27A 3AHCA 2ZULA 5AJYA 5KAMA 3UB2A 3HVJA 2Q3CA 5H4HA 2OFFA 2NT3A 4CMIB 2Q0QA 4U8HA 2HR1A 1LBEA 1QO0D 2XTAA 1L5VA 1P8AA 4RVNA 3H18A 1R8YA 2XUJA 5K3EA 1ZIDA 2LXNA 2R1UA 1WHSA 1P5ZB 4WASA 3DZ8A 4B7ZA 2HD4A 2MYUA 2PZ8A 2UKDA 4K6HA 3G2JA 3PL5A 3SHTA 4MROA 4F5WA 1T43A 1P39A 2AKAB 3U1BA 3O8QA 2C31A 5FFNA 1ISIA 3W4KA 4NFSA 4NS1A 3NIBA 3AX6A 1CD5A 2H9YA 4OQYA 1NFQA 2Y77A 5EHNA 1ZINA 1YULA 3OQ1A 4RHFA 2TYSB 3JR3A 3HJNA 1IZ0A 4FSDA 4E7OA 4O4HF 1KVQA 3P0HA 4Y2GA 1RZUA 2CMFA 3E5NA 4KIJA 1L5GB 2W6NA 3CS3A 3SGLA 2GM4A 1OIXA 5HGJA 4HZIA 4Q9NA 4AW9A 2C9DA 4B3FX 2HQ1A 4YV2A 5DWDA 1SKQA 1A72A 1A9ZA 3THOA 3BGDA 2G5GX 4Z99A 4GYWA 1S0UA 4M1OA 4CL8A 2Q4OA 2XNDD 5JSZA 2E4XA 1CP2A 4B4UA 2HUPA 4X66B 4B3IA 1USGA 3ESYA 3GJ5A 2CUNA 1K2WA 3SMQA 3JPYA 1CT9A 5ES3A 4B5LA 2C5FA 3TTVA 1R00A 4F11A 4O4JA 1JAHA 1KDVA 2C1XA 3G2HA 3VH1A 3MM4A 1CZLA 1T6NA 3IAUA 4X8LA 4Q4JB 4QG3A 3PE3A 3RS3A 2NX2A 4Z9BA 2BFFA 5A3VA 2G72A 5DCLA 2VF7A 2XQVA 3UFXA 3WWEA 4EB0A 1QFYA 1RT9A 4AZ3A 4BJ1A 3QJGA 3NTXA 4B32A 2VHYA 3AGQA 3QXGA 5ESWA 2EX4A 5BOSA 1M1YB 3F4LA 3GLQA 3R5XA 1LPMA 2QUZA 3T7DA 2QG9A 2WTXA 1MX1A 1EPUA 1GZ6A 1HT0A 3KX2A 1GTJ1 4KEAA 1A4RA 3DMNA 1MC4A 3MJFA 4RPKA 1CY1A 2WKSA 4H60A 4XQGA 1PUIA 4B8ZA 4BIMA 5FX2A 1GGFA 5KSPA 4K9OA 3WG9A 2G7ZA 2O4CA 2G6BA 2IS6A 2E2WA 1S3GA 3AVQA 2V55B 3W5SA 4RTNA 1PWEA 1YKFA 2WT4A 4QGGA 3DE3X 4OK3A 3FJ1A 1TRHA 2PMCA 2ISQA 4PWZA 1Y7LA 2UYQA 1BA3A 2VP3A 3GJ4A 1ONSA 2CXRA 3OJLA 4OQEA 3O0DA 1FQWA 3V4PB 4BOYA 1WEHA 4ESEA 2H85A 5LMZA 4CPDA 1H6DA 2AG0A 2UVQA 2VAWA 4V0RA 5K3OA 1YRLA 1XNQB 4EZBA 1XZLA 2R8PA 2RGUA 2JBHA 1ZA2A 3DE2X 3GV0A 3LKBA 1ODCA 4HTFA 1U9ZA 1V5GA 5MGBA 4YRLA 1Q1QA 1TJ4A 2NU9A 1GKYA 4BBJA 1OFHA 3KSZO 3U09A 3HO1A 3OFVA 1JPNA 1T0JB 2PL3A 2Q28A 3MGBA 4B4VA 2VDWB 3LOUA 4RGYA 3B20A 4YMGA 2CVQA 3BWEA 4HWTA 3REQA 3VC7A 3N70A 3PNPA 4PO8A 4O29A 4E08A 5C53B 3R2JA 2YHBA 4NPCA 2D3WA 4ZWNA 1G2OA 1QRRA 3BVPA 1CUXA 2FRXA 3K9FC 2VNSA 5BR1A 5FADA 3S7ZA 5TX7A 4P33A 4GQAA 3T1YB 1I24A 5DNEA 2X5KO 2VF8A 3CG4A 5KYXA 2ZTSA 3BXOA 2I2AA 2NZXA 2G67A 2ZYGA 3C6ZA 3VR5H 4HGNA 4KK3A 1TO1E 4ZZ3A 5DX1A 2H7CA 3HJBA 4PSKA 2D7CA 4EPVA 1O94C 4BEWA 3SEFA 3VU3A 2D4HA 2FF5A 4HWKA 3ENVA 4RVUA 1PCXA 4D3SA 2AEMA 1YC2A 2WWFA 1HBJA 2MR5A 3Q7QA 3R09A 1ODIA 3HU5A 4RPIA 2IK8A 3ZWPA 1JR3D 2ZATA 3NYWA 5JZBA 3BIXA 5E4TA 4MUEA 2A3RA 4R68A 5DI3B 4D25A 5ELLA 4H1WA 2XOKA 4NOMA 4V0SA 1W49A 4KR0A 1DADA 4LVNA 5LMNB 1PL0A 1PT7A 2DJIA 2YN2A 4GD3Q 2B4TO 3AC0A 4GUDA 4Q7LA 3VPSA 2GESA 3SZUA 3GDWA 3KWLA 1EGMB 2BI7A 4H1HA 1C8KA 1DWQA 1ZUNB 3D0QA 3QE3A 4HNSA 3VR1A 1NYTA 4NZ9A 3KAPA 3FCYA 3E7FA 1FPMA 1R4NB 2CEAA 4FWTA 5JASA 1C7QA 1ONBA 3TFQA 3W2IA 2G7MC 4Y98A 4Y7CA 4CCSA 4B6RA 2R79A 4D4MA 4ZYXA 3I53A 4K9QA 1GUDA 4M1YA 2YZMA 1D9XA 2VDUE 4BO9A 3OFND 3DZDA 1P45A 2GZ3A 2JH3A 1TCCA 1KI6A 5D86A 3V8NA 4UEJA 1P7YA 3KQSA 3OPQA 1G98A 1KI7A 2FB9A 3CLHA 5F4ZA 4BWGA 1XQXA 1S4QA 3OFSA 4Q1BA 3WQHA 1JHRA 3DTVB 4TM7A 2I9KA 1KRWA 4W1SA 1BX3A 1BMQA 2BP7A 1H1LB 1MIOA 1RHQA 2FW8A 2XMPA 3D81A 1GYQA 2A8YA 5DW0A 4HNHA 3W4JA 3ZE7A 2X5JO 3TSOA 3U4IA 1ZHFA 3GRFA 3SCZA 4P92A 4DUPA 3RLFA 2OCBA 3EFEA 4ND8A 2ZS9A 1L4GA 2HHAA 3P8ZA 1NASA 5CT6A 1INLA 2BFAA 2E82A 5DM2A 1JQBA 2M32A 3N1UA 4QYIB 2HMVA 2HK8A 3E1GA 1HTTA 1WXFA 4N0MA 3ZTTA 4BNDB 3GB9A 5CB4B 2HA0A 3I1JA 3N2ZB 2VJAA 3WHIA 4RJKA 1BGVA 4N47A 3BXPA 4EFMA 2X0EA 2HAEA 2JRCA 2XB9A 4OAPA 5ER9A 5IKEA 1DINA 2X58A 4BGUA 3PTLA 3LQFA 3SVTA 1E1MA 2N75A 3AG6A 1MVOA 1UMBA 4WK2B 3VYSB 1N1GA 4CTKA 5CDSA 4B40A 3DAGA 1E2HA 2B8TA 1SCKA 2XNHA 4DIEA 4RE5A 1D1PA 4Q02A 1T9CA 1KXJA 1TM5E 1E2FA 3HA5A 3CZ4A 3Q6NA 4WINA 1E9BA 3J80A 1GNVA 1F8XA 1SFRA 1SB9A 3LA6A 5D00A 5A06A 4P4LA 5A5DA 3BZUA 3DF9A 4UBKA 3ESZA 4D9JA 2OOKA 1CY0A 4J7XA 2GPWA 4KWTA 4NABA 4ALMA 4EKYA 1T8UA 3SVZA 5ARBA 1W47A 2WT9A 8ATCA 1Y8ZA 2INGX 4YI5A 2A67A 3BRQA 1AKMA 1RRMA 4NATA 1J8QA 1JTVA 2X4DA 2ZIXA 4KWCA 2AJTA 5ILGA 5C18A 2F3SA 3JPWA 13PKA 4WEOA 2Q4TA 1ZAYA 5AVZA 4QX6A 4XSGA 4UVIA 1IUKA 1DC6A 5FXMA 3S6JA 1L4KA 4MJXA 5DM70 1YHZA 1E2IA 2YV3A 3EGXA 3ZC3A 2CNNA 2F2TA 1Y6GA 3LKDA 1YQ9A 2FX3A 1W7AA 3K70B 1Y4UA 2IPXA 5KDOA 3U48A 2DKFA 4AJEA 4FOTA 3E53A 4JLWA 4BN5A 2O3UA 4PRZA 4IINA 4RHUA 2BCJQ 4A26A 4TS3A 1UJBA 4HH0A 4Y1FA 3SP1A 2XXAA 1R0CA 1NATA 2P8JA 3E22A 3L7BA 5H3HA 1QRDA 1PFWA 4HGQA 2VNJA 4XUGB 4CJXA 1HF3A 2VFAA 1ZSVA 4JT9A 5KB3A 2WM9B 2X4LA 4NDZA 5GZ3A 3M5WA 2WJVA 4GVLA 4PQEA 3AWDA 2P69A 4H3KB 4TLCA 5K0CA 4RE6A 1JXQA 1W8DA 4NU6A 1NF9A 1T15A 1XTTA 2H8GA 4OU4A 1I3OA 4B79A 3RRJA 3HFRA 3ELWA 3MYYA 1XUOA 1E4OA 1ZICA 4ZDJA 5I5GA 1QO7A 1PJQA 3BFJA 2L82A 1L5KA 1COWA 1NHGA 1QTIA 4X44A 3UT0A 1Q77A 1ZCAA 3A32A 1MFPA 3IHLA 4GM1A 1L2TA 4IIXA 1D2GA 1BMFA 1XXLA 5I45A 1Z13A 2I2DA 3GP3A 4AMBA 3AM5A 4MPRA 4OB7A 3C2QA 3S1AA 3IE2A 4DMRA 2OV6A 3L49A 4HN9A 3Q3CA 4ZQGA 2EFJA 3KUUA 3O6VA 4ZO7A 2C4MA 2PUCA 3GUCA 1IJEA 3RYTC 1QM5A 3FTNA 2HMYB 1HTWA 4Y0VA 2QIOA 3IIKA 1N4AA 3C6KA 1OBFO 3GR6A 1JSRA 3M5DA 3I04A 4QUKA 3WA6A 4LJ9A 4Q15A 2HJRA 1DB3A 4GWKA 4J91A 4MS3A 4QAJA 4TMKA 3SNKA 4YMUA 1OAOA 4MHTA 4JQOA 1TK9A 4BHTA 3RT9A 2JIBA 2QM3A 3QVSA 4KRXA 2XZLA 4P3XA 3RE1A 3LH5A 3EZXA 2FZEA 1FXSA 4IIVA 3AMVA 2A78A 3IERA 1PGQA 4NH0A 2OO3A 4OHYA 3OE5A 3WX0A 1Z6GA 5KX5F 3ZOKA 5HQJA 1JKMA 4IJQA 4ZOLA 1KYTA 3ILSA 3O95A 5JLAA 1ADYA 1XD8A 1H8EA 1NPTO 2NG1A 3QEOA 4RWZA 1AGYA 1KI4A 5DVZA 2BT4A 3T3HA 4DY6A 4E5DA 2I29A 3DDUA 3A2MA 2PT9A 4XX0B 5CH8A 2PKQP 3K16A 4G0PA 1U28A 1KP9A 3BS4A 3DNMA 4NEGA 3TM4A 5BSWA 3U6KA 1YTUA 1X15A 3N59A 4NKRA 1NULA 2P2SA 4LW8A 4TT8A 3FCUB 2IZ0A 4TS1A 3ZCSA 4IZHA 1TM2A 3BTVA 3HYCA 3NBZC 2HGZA 2XUZA 4R81A 3RBZA 2YOHA 3IUYA 4KQFA 2E5LB 2BDUA 3B2EA 2B30A 3DH0A 3OLCX 2ZSEA 4NCHA 4WUVA 3CR7A 3EN0A 4C6HA 4ZKDA 2F3RA 2XMSA 1E9FA 1ZSYA 4RKWA 5ESRA 5CIWA 1FXWF 2Y1EA 2OBNA 5TJHA 1L1FA 3WYFA 2C59A 4PC6A 3MTJA 4WY8A 1ZRMA 4LY3A 4CDRA 5L3SA 5LOVA 1D9ZA 2A9JA 1I4OA 4FXPA 4HZUA 4C7KA 3OQMA 1Z5WA 2QAJA 2ZJFA 4JNKA 4DRYA 1OFTA 1NONA 5FBLB 4ZAWA 5D6NA 4KDEA 3EY4A 5JAIA 3D6NB 3KB6A 4DMLA 2BHRA 1S2GA 4EGJA 3HB7A 1OI3A 5LNK6 4JI3B 2XYGA 3BWMA 1FS5A 3B1WA 1EA7A 4RD1A 2Q5EA 4Z7JA 2IIVA 3CUEF 1OH6A 2RGDA 3ODPA 4FGJA 4NX2A 1E2LA 3GP5A 4URFA 2ZITA 1QHFA 4R8RA 1Z6QA 5JCZA 2OBYA 3PEFA 3SYNA 4QUIA 3SX2A 1USIA 5TC4A 4LZOA 5HKBA 4S1TA 3H1TA 2ZJ2A 3PUIA 3ZG6A 3MELA 3A0RB 3EGDA 4PAGA 1PJLA 2Y1CA 2HNBA 5CM2Z 4OJQA 2I3BA 3LPCA 4YRZA 3IR5A 3RRFA 1IBKB 1OXKB 2CDNA 2QN8A 3BB1A 2Q6TA 4UTZA 3JZIA 3TEJA 2VJQA 2W2KB 4B7AA 1NJ5A 4EHBA 3LXXA 3MAAC 5JJKA 2WTAA 5CK4A 2IHZA 2GZHA 4LRWA 1P2FA 3QA9A 3ITNA 2PFKA 3MWDB 4JMLA 5D5HA 4QHSA 1RBMA 3N8HA 3RG8A 2J48A 2H07A 3UZUA 4D9NA 5JFTA 1K7FB 1P19A 2JVIA 4G6ZA 1T9DA 4U8GA 1UC8A 4RPLA 4FMDB 3ELUA 2W43A 2H0RA 4TRNA 5A5FA 2YYSA 2F8TA 2PKXA 2WMOB 8MHTA 2CBXA 2FWNA 5GZ1A 3BXEA 4RCZA 2IPLA 2QW0X 4F4DA 5FULA 3U16A 2FN9A 4BJHB 5LD2C 2I6UA 2P9FA 4RK7A 2UYCA 3C3XA 1QVAA 4I08A 4MA0A 4MMYB 3OFJA 5DM1A 3UNXA 5F2KA 1Z63A 1ISRA 1S7CA 3D7RA 5H83A 2AG1A 4OL9A 2P4HX 2FRVA 4MWGA 3RBXA 4KODA 1IMJA 4IIUA 3GRRA 3PJFA 4A10A 4Z1MD 4PNPA 5DKFA 4UHHA 3TTXA 4UOZA 2X2FA 5G1PA 4PYIA 5BOSB 1IUNA 1QONA 3AVOA 1AH2A 2QL5A 3GVXA 3NR2A 4F7DA 4TZ0A 1OLSA 1M2VB 2ERYA 4IJUA 2ZJYA 3EXEB 4UNIA 1XI2A 3SI7A 5G3YA 1E3MA 3PE6A 2CLLB 3E82A 1WMEA 1VYHA 3TLBA 3II6X 4ZI5A 4X0EA 1AHIA 4TTAA 2EQBA 5LXTF 5KKNB 2IYEA 1J56A 3PC8C 2GLUA 3G6KA 1JE0A 2ZUBA 1YCGA 3NVDA 1ZRNA 5C46F 4CBVA 2XRYA 1USVA 1XNJA 1P18A 1NLFA 1NVUQ 2NZJA 2XCUA 5EVJA 2FFAA 4D6XA 2PN1A 1SUEA 1XHLA 4FFPA 3VPFA 5LQRA 1NVAA 2P2LA 1DSSG 4NZNA 2OM6A 4ZJYA 4OB8A 2D2FA 1WZNA 4ARCA 2DOKA 1S7GA 2WNIA 4X41A 1QNFA 4MQEB 4OYYA 3VR4D 2A1UB 2XNDA 1Z0DA 1BO6A 3QU7A 3E9QA 1NSYA 3VR6D 3I4FA 4CL3A 2WMNB 5CYOA 1R3DA 2OHOA 4KPEC 4EO4A 2DEUA 4NU0A 2DHDA 1XZQA 3BMNB 3JWEA 4H7JA 4QPCA 5JCPA 3VKVA 2QSYA 3BFKA 4D56A 3WB0A 4GR9A 3CF4G 4AWAA 1JKXA 3H16A 4J4BA 3NVMB 1LNSA 3KHTA 3KO8A 1S2NA 3QOYA 3KYJB 2G77B 4XJTA 4B47A 5EAIA 1M34A 3DXFA 1HL3A 3DR5A 1W4CA 3R23A 3NVAA 4MRNA 1UXOA 3E22B 4IGFA 1HYHA 4YR9A 3R44A 4YRGA 4BO0A 1GAWA 3ACBA 3RC2A 4AKSA 1NUHA 3TS1A 2BV3A 2EJBA 3O8CA 4BMYA 3ROZA 4ZAVA 2IZOA 3CUKA 5ERXA 4WCFC 4WDRA 1AGNA 5E9QA 4BO2A 3KETA 2DH6A 2OWDA 2PX2A 2YQ4A 5BO5A 3TM5A 5ALIA 4N9QA 3AJDA 3D9QX 2PZMA 3HGTA 3OZSA 4Q1DA 1Y9EA 2PS9A 3LSTA 3NONA 4KGZA 5EZ6B 5LMUB 1HUQA 1PSZA 1RJ9B 1A2OA 3CCFA 4IVNA 2AOXA 4IDAA 3MTIA 3VZRA 1U1EA 3I92A 3DJYA 1YS6A 4L3WA 3SZGA 1GWNA 2DPMA 3B13B 3O21A 5ENZA 2FEPA 5TGTA 2PXCA 1Z2OX 1ZC4A 2GTIA 4G9GA 4ZHQF 1HGXA 3R24A 5T7BA 2BL4A 5DT2A 1BQEA 1SRQA 1UBGA 1YWGO 2H3HA 2A4KA 2VZLA 3AI1A 3CBGA 2W2PA 3IQWA 2QVBA 3PITA 3I52A 3E6AA 4P98A 3WRYC 3HU2A 1M8PA 3R6LA 2ZYRA 5LQDA 1F2TB 2PWAA 3UHPA 3LCVB 4R3WA 1PFKA 2G5CA 1S2MA 4G8JA 2Y9MB 4MQMA 5C1IA 2H2FA 2YQZA 3NOXA 1CHDA 3C14C 3FLBA 5F35A 1U7XA 3KJEA 3H1EA 4LA4A 3RS9A 1K88A 4UE2A 2VHUA 1GN9A 2YS7A 4UPDA 2Z4TA 3WRXA 2H0AA 4ZFNA 4DARA 1O3YA 1SCBA 3DFFA 4ICIA 3AHIA 1XNGA 1JN0A 2WYIA 4MWDA 4QXPA 2P0AA 4M1TA 5LUBA 2BGUA 2F62A 2J4FA 3TAXA 4K9RA 1X8JA 2KBFA 3ANLA 4GXQA 4LMBA 2A0XA 3DDHA 4MGKR 1KETA 5LYJF 4NCJA 4W5RA 2Q3JA 3GJ3A 3TOCA 1XCBA 5KTRA 4DPMA 4EO7A 1KFJB 1UT5A 1JH9A 1V11A 2VWQA 1EWRA 1KH2A 3PDJA 1ESEA 1FSGA 3NUGA 3OOHA 4LE1A 4MV8A 1RRVA 4RS4A 2XYHA 5IVDA 5LBTA 3SHQA 2VTBA 3LI2A 5PGMA 2O3JA 3IAS1 2J6IA 821PA 4QDUA 3C85A 3FY4A 1OXBB 2A0FA 4K1XA 2UYHA 5AKLA 1JFFB 3G3EA 2O2IA 4N5LA 1U2TA 3D6TB 5EUQB 2PNFA 3A6PC 1HEIA 1ULAA 2ONZA 2ZU6A 3L6CA 4KACA 4UEQA 4U00A 5E8RA 4INOA 4TTPA 3IVXA 4LC9A 1T24A 1OR8A 3UXHA 2CSXA 5K4HA 3WLHA 4BKPA 1YZLA 1O5IA 3CZCA 4GOMD 4NECA 4KR3A 4E07A 2ODBA 3TMYA 4R0NA 2E37A 5EUCA 1TT5A 3LX6A 2IV2X 4DCPA 4F71A 7ADHA 5IXYA 1B73A 4M22A 3SOPA 3T5GA 5DXAA 3UA3A 3ZCTA 3E18A 1KZ7B 2GZMA 2JI7A 2XMCA 3F96A 2J3EA 5GV8A 4ND2A 5T6BA 3DS8A 3RVOA 2EGUA 2C7QA 1M2EA 2I2BA 4K46A 1VQ1A 2GT1A 3R7NA 1XWFA 2YRXA 3V1KA 1WXXA 4GR4A 1O8BA 4AG3A 4Z7OB 4G56A 2DAPA 2HF7A 2Y71A 1GUYA 4L0DA 4X1OA 5GOZA 4HDRB 3FHCB 4IUBS 4HYQA 1CBUA 4Q7KA 2Z6VA 5EPEA 3DEZA 2GEVA 3VUFA 3CYFA 4OSEA 1WE2A 2IHKA 3H05A 5EKUA 4L0MA 3AR2A 1H5UA 3PHCA 5JJCA 3O82A 3RV3A 3A10A 3MJCA 1NN3A 3OTHA 3FOBA 1RPNA 2YWHA 3QI2A 4LMRA 1KC3A 4DADA 5A3QA 1D6MA 2X77A 2PYDA 3D5TA 3PWTA 2XX3A 3AHHA 4GOXA 1FFCA 1J8MF 3GOQA 2H1VA 3RPEA 3V8EA 4BNVA 4EJMA 1SVIA 2JLVA 1PZXA 5JAHA 2YYZA 3D8UA 3CGWA 1ZS9A 3P2MA 1NU8A 1KKUA 2UZ1A 2IYUA 3B5JA 4D4LA 3ZDEA 1T4DA 5CB4A 1W35A 2H52A 3LOPA 4U9UA 1U2PA 4QT0A 5G3ZA 2K7FA 4JEUA 3U80A 2O06A 1CUVA 3ZIDA 2I3GA 1FTQA 5EMMA 2DUUA 2FHPA 1C1XA 3W78A 1HR0B 2NMVA 1FYVA 2ZRGA 3UMMA 3WL4A 3B8HA 4AZWA 5CG1A 2NYRA 3ZCQA 4FFNA 3ZQ4A 2OG1A 3ROFA 3VOAA 1V48A 2H59A 1RM3A 3GDFA 3NG1A 2HA3A 4D3YA 1NYQA 3CZ9A 2J09A 1U8FO 2RI6A 1MW9X 4W1PA 4CWAA 1SCNE 1IN7A 1Q0SA 1ECCA 2P9QA 2QT9A 4E88A 4X1KA 4O5OA 1VLHA 3V42A 1ORHA 4K6OA 1LV8A 2GKSA 5HE9A 4CM6A 1KY2A 3RW9A 4ND7A 5I9IA 2YZGA 5D1HA 1CUIA 3EVNA 4XB2A 1UP6A 3ZQUA 2M9MA 4BN0A 5AW7A 1M5TA 1VLZA 1C29B 4R9UC 2XVMA 5TJ9A 2H1IA 5MDHA 5LQAA 4O59O 4W4TA 3ZVNA 4X1YB 1C80A 2RDMA 5LP6C 2C95A 4ZQEA 4DNXA 2WM2A 5FTWA 2W6JD 2V65A 1P29A 3FZEA 1U80A 4W5JA 4DLLA 3BHIA 5JZVA 3PFKA 2NU9B 2FYTA 5I7AA 3NVKI 4UNPA 2GEKA 2IBTA 1ZH6A 4YRJA 1KYVA 4GM4A 1I3MA 3HGMA 4JVMA 4FJ0A 3B3AA 3RUAA 3VMFA 2LD4A 2WTBA 5JDIC 5KYYB 3R41A 3PCRB 4EJSA 2V7QD 4KFRA 2Y1DA 1UT6A 4KXYA 4TV9F 3I6IA 1LJLA 3MHTA 2W93A 3S8MA 4KUEA 3SJCA 3U0VA 4EABA 3UXYA 1FA9A 4OUDA 1OX5A 1OAAA 1ULSA 3ZX4A 1LF0A 1ZXBA 4BB9A 1VI5A 3Q3HA 4FYIA 1TKRA 3W2GA 2C2YA 4I4TA 3A4IA 1CQIB 3F6CA 4F93B 3GFSA 1WP9A 3Q7TA 4GECA 1RQNA 5E7QA 1E3LA 4M0LA 3FVQA 5A3RA 1OT3A 5A6SB 1VJDA 3I0NA 5K2MA 4R98A 1UR5A 3OJWA 2HLNA 1RKQA 1WLSA 2WRZA 2HV8A 3FFTA 3E15A 1O0SA 3BJZA 4UTNA 1P6QA 3HJUA 5CH5A 3THSA 1I7PA 1QYXA 4R1TA 4WLVA 1B93A 1KE1A 1QH1B 3SLGA 3HB1A 5K3SA 3HADA 2QRZA 2GK4A 3OQ6A 1NVXQ 3I58A 3ACDA 4CR6A 1NBHA 3C8MA 4BGDA 5AVWA 1UBCA 3JQ8A 5LUAA 3OF5A 2WHRA 2TMGA 3P26A 1AT1A 2NZYA 3L0IB 3WIEA 1WZEA 4DLVA 3KJZA 4OFXA 4KQ2A 2H2DA 3MRTA 1T2CA 3PVSA 3UANA 1EVIA 4WZAA 1O4WA 4B84A 4C43A 3JQDA 3MAGA 3VO8A 5TF0A 4FYWA 3MMPA 3KJNA 3KZOA 3AKEA 3NNSA 4GBED 2X6TA 4MB0A 2G5TA 1M7GA 1EBFA 2VL7A 1L5QA 5D1NA 4DG5A 2XKAA 4EY4A 4Y2VA 1UAGA 6YASA 3RJ5A 4LXYA 3UJDA 2IHJA 4OAQA 3V9PA 5IYZA 4NCIA 3WYCA 5K1SA 2OCGA 1XZEA 3H2ZA 3UK1A 1OYYA 1F0YA 4R3NA 3DDSA 3VHRA 2IX9A 1CW2B 2VHCA 3C3CA 2H0QA 5KNBH 4EECA 4W5TA 3I2GA 3TDKA 2IUUA 3KTAB 2TMYA 3G5AA 5G53C 2PFSA 4HJRA 2O8VA 3X43A 4Q4CA 2XRZA 4ILKA 1LLQA 4OL0A 3E1SA 4ZCMA 3NGLA 4RF5A 1I7DA 1Y48E 5BV2P 3K0SA 4QYXA 3TKYA 3W6ZA 4L0CA 5H68A 3RQIA 4MSUA 1AZWA 2YJNA 3H9EO 1AUPA 3F73A 4ZTZB 4OI0A 4CKEB 3OKAA 4A03A 3EA5A 4PG4A 3K1ZA 3F78A 3C3YA 5C7YA 3TW8B 4Z4IA 3TTWA 3WYEA 3E2PA 4JC5A 5D3ZA 5HR5A 1Y8RB 1F5NA 3PF9A 1WKBA 4QUJA 3TAUA 4KI0A 3OEED 3UQYS 2IEGA 2D2EA 5DHFA 1KPIA 2B4RO 1QHYA 1R88A 2EFDB 3IDSA 3ORRA 5JVDB 1RP1A 4F8EA 4GWLA 4LYAA 3NTRA 1J23A 3CEHA 3LP5A 3EDRA 3QEJA 1VP3A 4NESA 4DCOA 1UEIA 2QTHA 3OO0A 4NG5A 4UVHA 3RYFB 4BLPA 3AYXB 5KX5A 1N92A 2YHAA 3NNDA 1FTWA 4JJGA 4RIIA 5JFGA 4G5QA 4XASA 4L8LA 5E0OA 5GZ6A 5L3SB 3EIUA 1FU7A 4TLBA 1GPJA 1IK6A 4ACAA 4AN4A 5BN4A 1BQ3A 3PIDA 2WOOA 2HRZA 3CE6A 4L28A 4CM4B 4M60A 1SBZA 2D2VA 4J0HA 4YJHB 5T3YA 1VBKA 4UREA 2X0DA 4Z5XA 4N40A 4G0UA 4KN6A 4QJIA 1UZUA 1JHOA 1AS3A 2PSEA 3RM3A 1OGJA 4ND3A 3UK7A 3ROKA 4M1EA 2VSFA 2GDJA 4YJ3F 1T8PA 4O4IB 1I3LA 2EFYA 2OZPA 3RK4A 4Y2QA 5ARCA 5KSOA 3FG9A 2YOGA 4K6CA 4BB5A 3U7GA 4MJ3A 3AR3A 3PGMA 1WDKA 1IVYA 5ALPA 5P21A 2D1SA 1OIWA 1TE2A 2HREA 2HJGA 5IBCA 1PFUA 1M8GA 9MHTA 3FNRA 4AAYA 5LQNA 2AS0A 3V6MA 1NJFA 1YS4A 1Z73A 2X0JA 4JK3A 1JB9A 4R40A 4FFLA 4R8SA 1CR4A 2JLRA 4OEHA 2J9FA 2OORA 4GZMA 4C9BA 2ID9A 1HFJA 4TSRA 2WHEA 5IAKA 4I1UA 1ULUA 5JCJD 4PQGA 4JKIA 2W4MA 3PD1A 4RK0A 4N65A 1MAVA 5INTA 3MWGA 1I5OA 4R83A 1EE2A 2GAOA 4WSOA 1HL7A 3BE8A 3CINA 2A57A 3CU5A 4MVJD 3LX4A 3TQQA 4L6AA 5KNCD 4DV2B 3SIXA 6REQA 1H2AS 3N2EA 1MC1A 3PB3A 3RWOA 4AT1A 2ZU0C 3R6TA 1O6CA 5FQNA 3ZLTA 1QK3A 2JGEA 4XB6B 3U3XA 3D6UA 1EINA 1G5IA 2UVDA 2O0MA 3M6VA 3RS2A 3G89A 3MJHA 2XDQB 1VA5A 3A11A 1X77A 4L50A 3AR5A 3TK1A 1KTVA 5DBHX 3MB5A 5E2IA 4AJHA 1RS0A 3FLMA 4IZ6A 4UC0A 1TU4A 1KMHB 3OF3A 2HN9A 3W04A 5DTIA 4AF6A 1NFRA 1NM5C 2IYSA 3PFBA 4TMXA 2ZJZA 4ZRNA 1DZIA 4AY5A 5YASA 4F85A 2IY9A 4GMHA 1AC5A 4JLSA 5JZSA 2Y3IA 5IH3A 1L5NA 4DDKA 4MCJA 3RS0A 3GEHA 1UMBB 3GA7A 2RK4A 3FYDA 3O9VA 5DXJA 5KYNA 3TWOA 3KKZA 2C20A 1V35A 2WKQA 3ID6C 2GN8A 3I8OA 2WC1A 4HEA1 1YRBA 3L7MA 3W0LB 4D02A 5I7FA 2YY6A 3WISA 1SBIA 3B3QA 5F23A 2MSEB 4NSNA 3GVIA 2ZSUA 2QK4A 4L8WB 2A30A 5SYMA 1E3WA 4DLNA 1TMOA 3HI6A 4Q3AA 4MVJE 3WB9A 3TPCA 3AHJA 3CH6A 2H3EA 2R2GA 4M9CA 3U26A 2JI8A 4BUCA 1O0BA 3MD0A 3W5IA 3M2TA 3AI3A 1RVV1 4PFJA 3SM9A 5KHLB 3FPCA 2JF0A 3QVGB 5LCXA 3HV0A 3LUJA 4ZREA 4CF6A 2J8ZA 3SEQA 2CXQA 1J2YA 2HSGA 2ZRDA 4PO9A 4PYJA 2PL1A 2ZIAA 4PXYA 1E6LA 1AGRA 2REOA 3LLVA 2FLWA 4L57A 4ZVKA 2E4VA 3P9QA 2P3SA 1C1XB 2PV7A 3UFBA 5T3UA 4A2WA 4P3OA 2OZKA 2ZTLA 1NRJB 2FGKA 3ELDA 1T6YA 4FD2A 5CNKA 4FYVA 5FEMA 2PA0A 4IIDA 5LPNA 4O25A 1OW3B 2F1KA 2JLBA 3K0KA 4D26A 4O4JB 1H6AA 5CW1A 4FX2A 1J07A 2B7LA 1FRNA 5LVAA 3PHBE 4QREA 2YWGA 4O63O 1EFRD 4BATA 1X6VA 2X9LA 3P2OA 4AB1A 3AY7A 3N2GB 2GCOB 3OPYI 4DDWA 2XT9A 3NFYA 3QX7A 3TNDA 2IQ5A 2QZ4A 4ENUA 1ZGJA 2ZSJA 3TSCA 2RAPA 5DGIA 3HBAA 5E8JA 3AZQA 3G79A 2WJWA 2Q3EA 3DHEA 3FCAA 1NFFA 2X8WA 4HPWA 3PDUA 4ABYA 1EX1A 3WJAA 1VMEA 2VNAA 4Q0MA 4TKUB 3O4HA 1V25A 4WECA 6GPBA 3GLFB 2ZREA 1XQWA 3RS8A 2JAOA 1P1IA 1XGKA 2PXAA 2XECA 3JZAA 3WRXC 1E9DA 3CA8A 1XVAA 4MW7A 5M7EA 1M7BA 2JLZA 4UKDA 1G4UR 4ZCTA 2AQ8A 3QM1A 3NDBB 2Z9CA 4CCWA 1KEEB 4C1NA 4RELA 4DREA 4LHWA 2GF9A 4EAQA 2GNAA 4D9KA 2QJWA 1N6HA 1JSLA 1S2OA 3EXHC 5GQSA 4EEXA 1DTWB 2WJ4A 3Q3IA 4L5JA 1O6ZA 2PRKA 3MXOA 4I4CA 1FFAA 1N6IA 2Z57A 1L3IA 3K20A 4XIYA 5ILQA 2F43A 2VI5A 4AJLA 1KHTA 3QVUA 5AICA 3KP1A 2RAUA 1TQHA 3C3DA 3MF4A 1VLQA 3NX4A 1E94E 3T8YA 4A5SA 4LFBB 5BNWA 3KUDA 4NR0A 3ZBUA 3QKUA 1GSHA 4TWZA 5KX5B 2HLPA 3E7XA 3N2LA 1XPOA 4H3HB 1MABB 2F9FA 3E8MA 3VM6A 1HNNA 2AFHA 3BICA 3L6UA 5ADVA 1YF3A 1CUAA 4JJIA 1JHAA 3TQRA 5I4BA 1KGSA 2OZVA 4RMNA 4HZGA 2WQ7A 2DFTA 2PWPA 4ZI7F 1VKRA 3G0HA 2PO5A 4PTLA 3WGUA 2J9ZB 2R65A 1NKVA 1E5TA 2YIDA 2V54A 3QKRA 3GDOA 5CA1F 3AEYA 4IP0A 4O4HA 4YAEA 4DGSA 2ONJA 3QLTA 4CTNA 1P33A 4HG2A 1LJ8A 4G0QA 5TLSA 1Z4NA 2OHVA 3RF7A 1BAPA 5EIEA 1REQA 2ZWPA 2UAGA 3B7PA 4FB5A 4TYYA 2CLDX 2I7CA 3VDNB 2BTEA 1QK4A 5FL3A 1K0UA 3JD0A 1M66A 3H5VA 4LKRA 4FFVA 1DQSA 4L02A 1V0JA 1N2XA 3NC4A 2WFLA 2X1MA 3U7FB 3V46A 1ZH0A 3S27A 4QYWA 2A58A 1EFRA 3LMKA 3FOFC 1FVHA 3CNHA 3DT6A 4N6NA 4L5BA 3OC6A 4PM4A 2WSYB 4F5ZA 1U2EA 1I2BA 1RJFA 3SQMA 5ALGA 3H4VA 2VH2A 4R6WA 3NKFA 3W1WA 3ZVLA 3DOHA 1CVLA 2A9VA 2B5OA 3O4GA 3HDTA 1LDNA 5IK2A 3GFGA 2ZRAA 3ZKAA 1P0CA 5I4KA 3DE5X 2ON6A 2DLDA 3HA3A 3T7EA 1TGVA 1E2GA 4FE3A 4GX2A 5BMVA 3HVRA 4Y2YA 3L7LA 1DXQA 1W87A 5ALWA 5CGZA 3BGSA 3NJ8A 4PSDA 2VYND 1HG0A 1TEZA 2ODEA 1L5FA 2IUTA 4RA9B 4XVRA 3QRWA 3K9WA 3EFHA 1U8AA 1YDEA 4KYVA 1CZNA 4AKEA 4EFKA 4O3MA 2ECFA 1NDHA 2C3MA 3NT5A 2M6LA 3C4QA 4HNUA 1OPXA 2ICAA 5CTAA 3VAZA 4ALLA 3TIVA 2X8AA 3AM4A 2F00A 1CLEA 1FC0A 2O7NA 1YE3A 6Q21A 5F21A 2PUAA 1Z56C 2Z6UA 4N7JA 1OX4A 2BLNA 4EY6A 5HDQA 3OOSA 2WSBA 3BSYA 3ETLA 3FPHA 3JQBA 3IVCA 5EVCA 3HJAA 2X0IA 1YIAA 4IVPA 5J4LA 3V8MA 3W05A 3ICWA 4G0MA 4RZUA 4EF4A 5HRCA 3G49A 3PR3A 2W2LA 1T1RA 1UZNA 4B6GA 2YJGA 3G2KA 1S8AA 3OQIA 1Y5RA 3DMDA 3G5MA 2FEKA 1SVMA 2DECA 3SSOA 1JIUA 1QPGA 4FDTA 5AOVA 3WSVA 3MGKA 4E2YA 1W88A 2YHIB 3KSAC 4M1MA 3BB3A 2IXEA 3SFVA 4FDLA 1GZUA 1UJ2A 2OMEA 1HNZB 1IY1A 3R9KA 4G9EA 5KINB 4JOQA 3AFHA 5LL6P 4QO7A 5KO2A 3DV9A 4MV6A 4MV1A 5BMVF 4QTYA 4DBVO 2PTHA 1Y3FE 2IUYA 1Y89A 5BN4B 5JT1A 3EZNA 3PPWA 5BMOA 3IAM6 2QPTA 2X1HA 3GVCA 3W3ZB 4GHWA 3V4RA 1IHXA 1E63A 1RXIA 4CUZA 4EQ6A 5KYUB 1E18A 4FYKA 4U2CA 2WWTA 3FRJA 2QX6A 1LSOA 3JVVA 3M82A 3PUWA 4AZVA 5LXTB 2JCSA 2VPZA 3ABOB 1BSVA 2YVAA 4LBVA 3WGOA 2AZTA