1PL7A

Human sorbitol dehydrogenase (apo)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
356
Chain Sequence
AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sorbitol dehydrogenase
total genus 120
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl7A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl7A01
1O95A 3RI3A 1G1AA 4YAEA 2JFFA 2NADA 3P2OA 3GVHA 3R1IA 5CPBA 4UREA 5JLAA 2AG5A 2Y1DA 1GUYA 1Z7BA 3V2GA 3AY6A 4PLZA 2Q50A 2DBZA 4H16A 3ZI0A 3DZIA 1ZBQA 1KYQA 1EUDA 5G2OA 3JQ6A 4BKUA 4IINA 5C7IO 3ZV6A 1DAPA 4EZBA 2GO1A 4CL3A 5AXCA 3NDIA 4BO3A 4FOSA 2AQIA 4OAQA 2A35A 2FPPA 2VYNA 2Y0DA 4RLSA 2PD3A 4QECA 3H9EO 2I9PA 2G17A 2LDBA 1TT5A 1ZW1A 5A4DA 2PZJA 1PQWA 4NR0A 5COBA 5TIIA 2VWHA 1LEHA 2JD1A 3C1OA 4YAGA 3W4JA 3U4DA 1X1TA 3LC1O 3O03A 4I5FA 3U4CA 4PZDA 4OSPA 3U3XA 4DIOA 2ZKLA 1FF9A 3S2IA 2QHXA 4E5NA 5A02A 1LC0A 3GG2A 4Z3KA 5L4LA 2W4QA 3LF2A 3VDQA 5IF3A 1R0SA 3GN2A 3UN1A 3GRKA 2BI8A 3W8DA 1ISMA 3JQBA 5DT9A 1J5PA 1DPGA 3ONFA 5B37A 2RHRA 1AXGA 2HMTA 1J6UA 4R1TA 2VHYA 3PIDA 1I2BA 3PJFA 2NTVA 4ONEA 1NWHA 3RU7A 4J1TA 4K6FA 2IZ0A 4CM9D 1A9YA 1P1RA 4CMEC 1SEVA 3HN7A 2PWZA 3JQEA 2CVOA 2Z1MA 5HM8A 4P8RA 1YQXA 1LSSA 4JJFA 1DSSG 4E5KA 2JCYA 3EY4A 4IZIA 3KYCA 4E0BA 4ZN6A 2AE1A 1LSOA 3G3EA 3PYMA 1YBAA 1LUAA 4CLOB 2OO5A 3M2PA 3WGOA 3MWDB 2DTEA 4YYZA 4FJ2A 3TZQA 1VPDA 1R15A 1FDWA 2V6GA 5JE8A 1VSUA 4W9NA 1H9AA 3I9JA 3RUEA 4A26A 2W2LD 1VL8A 1KERA 2RAFA 2X1HA 3HZZA 4R5HA 5DCWA 4XEHA 5JAQA 5U4QA 3GRPA 4CM4A 4IMRA 4TROA 3JQ8A 4D43A 7ADHA 1HE2A 1SB8A 4FR5A 3CIFA 1HDCA 3DOJA 2O3RA 1YDWA 3ZHBA 4UUOA 3S1LA 2QRJA 4BMVA 4BIIA 3QP9A 1SAYA 4TRNA 1HLPA 1Y8QB 3NTQA 3W8FA 2X0RA 4Z6KA 2VHWA 3NTOA 4AJ2A 1PL8A 6ADHA 1R6DA 1EEHA 3QWIA 3H6KA 2I3GA 4DBVO 4EJ6A 1HDZA 1NM5A 3ASUA 5JO9A 3SEFA 5IFLA 5TLSA 1Q1NA 4B8ZA 1R12A 3AW9A 2GN8A 1QLJA 4C7KA 1PJSA 4PVCA 1EE9A 1B3RA 2Q45A 5TJHA 4Q3BA 4JK3A 3ZU5A 4IDBA 4D7AA 4DLBA 1P33A 5GY7A 1JKIA 5HA5A 3TOZA 2GYYA 2B4QA 2NWQA 3HQ4O 4J0EA 3MJTA 2BRUA 2IRWA 4WLOA 3AM4A 2JCVA 2POQX 4ND2A 3BMOA 3WJ7A 1EVJA 3HFSA 3DZGA 3ZU3A 2WM3A 3KM0A 1HZJA 1TEHA 5A9RA 5K1SA 1DRVA 2B5VA 3HFGA 3VOSA 2FHSA 4ILKA 1PSDA 2X0JA 4LMPA 2V7PA 3W1VA 1UP7A 4OQZA 2WD7B 4NFSA 3V1TC 3CSDA 3GEGA 1G6KA 3NKLA 2CD9A 4J1NA 1ZVMA 5IDQA 5ICSA 1PEDA 1VKNA 4IS3A 2HU2A 3OQ6A 2HAEA 4YRDA 2VTDA 3H9QA 1I33A 1ZK3A 2O3TA 5DN9A 5JDCA 4QUKA 5CDUA 1M76A 3GPIA 4HADA 1M75A 4BUCA 5L45A 1B26A 1PJTA 1KY4A 5I8ZA 2C7GA 5IZCA 1S7CA 3H5NA 4BGUA 4LVUA 2WMDA 4AG3A 3H2ZA 1Y9AA 1NQ5A 4CMHA 3K5PA 4CLOA 3FBTA 2HDHA 1SCUA 3VHRA 1HSOA 3ANMA 4ZU3A 2X86A 4KQXA 1DDOA 1CRWG 3S8MA 4BS9A 4EDFA 5JCXA 4M87A 1A27A 3L4BC 2Y0CA 3AFMA 3GEMA 2Y68A 3Q3CA 1U5AA 4O0LA 1VSVA 3NJ8A 5TRTA 1NP3A 4PGFA 5L3ZA 3Q11A 5CDSA 2HRBA 1Y8QA 3U4IA 1W73A 1PGNA 3H3FA 3D3WB 3VZPA 4FGWA 2FP4A 3K92A 5DBIA 1MXHA 1OMOA 1SNYA 1QKIA 1L7DA 2DUUA 2BI7A 2XF8A 4KTTE 4XQEA 4MIOA 2UV8A 1VJ1A 2J6IA 1MP0A 2A9FA 4Z9YA 1OAAA 2FSSA 2PFGA 4R16A 4CMCA 1V9LA 4L4RA 3PYLA 4LSMA 3K30A 4HNHA 9LDTA 2WWRA 3DHNA 2VWGA 4IJVA 4O63O 4ZJUA 4YR9A 3ETGA 1C0LA 3OECA 2PH5A 3UCXA 5JXWA 4ZQHA 4YXFA 3JYPA 4L8VA 4TRRA 1QLHA 4QX6A 5I7FA 3UAGA 1BXGB 1UXHA 4WUVA 2P91A 3U49A 3LU1A 4ALJA 4BO2A 5HTOA 1O89A 2PV7A 1WWKA 3CUKA 4A03A 3AY7A 3RUIA 1ZXBA 2D59A 1RKXA 5EIOA 2W2KA 3RJ5A 3ZWYA 1JQBA 4JBIA 2B35A 1E3EA 1N9GB 2IDZA 3SVTA 1NAHA 2PZMA 3GT0A 2JCXA 3F9IA 2Y1CA 1T1SA 2DLDA 3NDRA 3PGJA 4U7WA 4DVJA 3F6YA 5DBGA 1C1DA 3SX2A 3KETA 3HDYA 3DDNA 3PQEA 5ER9A 2VRCD 1DO8A 3UCEA 1JLLA 4HFRA 3WICA 3PHIA 3E9QA 1HT0A 3AOGA 1Y1PA 4J7UA 4HV4A 5JMWA 4J3FA 3OETA 4NFHA 4NK5A 4WASA 3MCVA 1JKFA 2CMDA 5IXSA 4XIJA 4YQZA 4PLFA 4EEXA 4XB2A 3NV9A 5F3RA 1E3SA 3E03A 1TT7A 3I1JA 1C0KA 2DPGA 1XELA 2X6TA 4CMBA 2WD8A 4ZICA 5B12A 4JXKA 4YJGA 5DP2A 1R4NB 3BMNB 4QQRA 3NJ4A 1C0PA 2CY0A 1LQUA 2EEZA 1DHRA 3ETDA 4AFNA 3GEDA 1NVMB 3RKRA 4QO8A 1L7EA 2R2GA 1JWBB 2Y1EA 3ZWWA 4TRMA 3RUAA 1ONPA 4JP2A 1VI2A 4U0JA 4BO0A 4RLHA 1OC4A 1P44A 3FR7A 4YBZA 1E7SA 3HB5X 2O2SA 4S3MA 2CDAA 4DUPA 1YQGA 2HQ1A 1GV1A 2O3QA 2O3JA 2Q4EA 1I8TA 1SOVA 4YJHB 2BH9A 5KJEA 4RO0A 5H82A 5AXBA 4DWVA 3D7LA 3DB2A 3RFTA 2OGUA 2PA3A 3GQVA 4YTEA 3HN2A 3D3EA 3JYOA 3NEPX 3D5QA 5JW6A 2PKQO 4YRBA 1KBZA 4CM3A 1VRWA 2IXAA 5EQFA 5KJ6A 4J1SA 5JYDA 4PLWA 4Q3AA 1Y81A 3H5AA 3FPLA 4OKNA 1FJHA 2BHLA 3OA0A 3Q2KA 4XYEA 3DWFA 4KDEA 3JQ7A 3LT2A 4BNZA 2PTGA 3VVCA 4DREA 2UVDA 3KYDA 4RVGA 3RSHA 4AJPA 4DQVA 2R6JA 2OP0A 4B3HA 1SMKA 4EJ0A 5ER6A 2GASA 4DA9A 3IIEA 4BNWA 2GF2A 4IXTA 1MG5A 2ZCVA 2VQ3A 1A71A 2EIHA 2XAAA 7MDHA 4WK6A 1ZEJA 1M2WA 1VJ0A 1YOVA 1FXSA 1ZK1A 5BT9A 2V6MA 4GWKA 3U9LA 4E21A 2IODA 5HBRA 5DOVA 1GQYA 2YV2A 2EKPA 3BYZA 5KWEA 3HDJA 4IDDA 2Q3EA 2P5UA 4WLNA 4XQCA 4TZKA 3FSRA 1Q2XA 1OI7A 1P1IA 5F1PA 3RBXA 4FFNA 2Y0EA 2O7QA 2XXBA 3SBOA 3ASVA 1YJQA 3C85A 1SEPA 3GVIA 5JPIA 3HB4X 3VH1A 3WGYA 1YJ8A 4FD3A 1R0LA 2EF1A 1E6EA 3W4IA 1FDTA 3UFXA 2HK9A 3JD0A 1ISJA 3QVSA 4WLEA 1YS4A 1QORA 4E5YA 4W7IA 2EG9A 3AOEA 1KS9A 2WYVA 3DONA 3LVFO 4K9DA 2C5EA 4BNNA 1PR9A 4UVIA 4AJJA 3PPIA 3WTCA 3N74A 2OORA 2AW5A 4GAEA 4L4SA 3EC7A 3JCZA 4XD2A 3H7AA 3JQGB 3DC2A 5L7WA 4RQTA 4BMNA 2NNLD 1YVEI 3DTYA 5GZ6A 5CDYA 4TMFA 5FWNA 1IPEA 3UICA 3FNEA 4JJGA 4NDNE 2YUTA 3Q1LA 1H6CA 4PLPA 1ONNA 5U1PA 4WCFB 1V3VA 3B1JA 4XYGA 2Z95A 5ITWA 1DBVO 3ZGYA 1HTBA 1JKJA 4XRGA 1DJQA 2R00C 3GGGA 3QV1A 1HF3A 4NQZA 1H2HA 4YA6A 3PLNA 2C2XA 4K28A 4JIGA 2BF7A 1QR6A 1NQOA 3ON5A 1QG6A 3MWEB 3DZBA 5TT1A 3FTNA 5A3VA 1B0AA 4GLLA 4WCFA 4MKRA 2LDXA 4XJTA 2X8LA 3JQ9A 2EJVA 4IUYA 3QW2A 4UUPA 3OJFA 1KVRA 4PG6A 1Y8RA 3DOOA 3FWNA 4OHUA 2A94A 4J2OA 4Q3DA 1UJMA 2ZK7A 2CDBA 4XYMA 3OEYA 4J9UE 3AM5A 4CQLA 4R3WA 2GZ1A 2Q49A 3ZZNA 2BKAA 4PRLA 1E1MA 3EVTA 3K8ZA 3WBFA 1PZEA 3FBGA 2BGLA 4RVSA 4E5MA 3TL2A 4CM5A 3INGA 1CQJA 1GYQA 4U8GA 2DTXA 3QY9A 2DFDA 4HP8A 4C7JA 3AFNA 4R01A 2HJRA 3WOHA 1BMDA 3GHHA 3I6IA 1DIBA 1LU9A 2YW9A 3QQPA 3D64A 4MVJH 4WOJA 4CLXA 3B70A 1EVZA 4HNGA 3L6DA 3ZV3A 4GKVA 4FPXA 1FMCA 1MC5A 3C8MA 4WPGA 4CM6A 4A10A 1LRKA 5F1KA 1EK6A 2VNAA 4QT0A 1Q0HA 2VZ9A 5LC1A 3Q9UA 3TSCA 3JD3A 3H9UA 1ULSA 3F4BA 3RASA 2FZEA 3R3SA 2QZZA 3GGOA 1HDGO 4ALLA 4R3NA 5CEEA 2IXBA 3PVZA 4XX0A 1I30A 2HCTA 2B36A 3A1NA 1UAGA 2DC1A 5T8KA 3TJRA 4CM7A 5G0TA 4EUFA 4IQ8A 2NTJA 4MJLA 2HRZA 5ITVA 1GL3A 1P0FA 2Z5LA 4PG7A 3ANNA 3PZRA 1MLDA 5BSEA 4D3FA 2FR0A 3WGZA 1AUPA 4CMIA 4BO5A 4RDIA 1EE2A 4D3DA 1GTMA 3UH1A 4NMHA 4FFPA 1I36A 3DAFA 4MKXA 3BMOB 4JGBA 1Z75A 1W4ZA 2BLLA 4IM7A 3V2UA 2BELA 4EUEA 1E7RA 4Q9NA 3CE6A 5DNAA 4J90A 4Q39A 2NVUB 4F46A 4K26A 5H83A 5KJCA 1HDOA 5FI3A 4B7CA 4MVJE 5L53A 1E1LA 2QQ5A 2BFAA 2D0IA 1H6DA 2X5JO 4ALMA 5F5NA 4R9RA 4XDYA 2DFVA 4O5OA 3PK0A 5DCUA 3ZHXA 1PR3A 1NVTA 1BHSA 1ZZEA 1QV7A 4GLOA 3ZWCA 4WKGA 1I24A 1QP8A 4I8XA 4ZVVA 4G5HA 3TN7A 3DBLA 3E8XA 2GPTA 1QSGA 1ML3A 4FIZA 3GFGA 3KEQA 1X15A 4BQPA 5JNLA 4CMJA 5L95A 4B4OA 1J0XO 4CPDA 3F1LA 3QWHA 3A4VA 3RCBA 4YEDA 1NFFA 2ILTA 3BTVA 3DXFA 5BNFA 3WFIA 1I01A 1M6HA 3KOUA 4GSLA 4LCJA 3TZKA 3SXPA 3JQ8B 2CDCA 4QFDA 3WGIA 5AXAA 5JCJD 3I9LA 4XQGA 1F0YA 4RVUA 1C1XA 4E2ZA 3UW3A 2G5CA 3VKUA 1UDAA 4BMSA 1E92A 3KO8A 3IUSA 3I6QA 2QW8A 3TNLA 1V3UA 2G82A 4FB5A 4CMAA 2WE7A 1PQPA 2PNFA 1NHGA 2FZWA 4PLTA 1E1KA 4ZRNA 4TKMA 4AJIA 1GEGA 4Z3DA 2ZYAA 5A5FA 4MINA 1V8BA 1RM3A 4IDEA 3E5MA 3OP4A 4PLCA 4BV9A 2WYWA 1HZZA 1GU7A 1H94A 1H6BA 1YRLA 2QRKA 1DB3A 4MVJF 2C54A 2C20A 2PD6A 3QHAA 1U3VA 1XGKA 3OJ0A 3OH8A 3IAHA 2W2LA 3QIVA 4Q3CA 3GA0A 3GZNB 1PJBA 1XQ1A 3OA2A 4BNYA 2ZQZA 4HBGA 3ZNOA 3MJEA 1WMAA 4XA8A 3DOCA 4BNTA 4IQ0A 3UOGA 3ZWXA 1CDOA 1U5CA 3IJRA 3QWAA 1CYDA 1DAOA 1GZ6A 1HDYA 3QSGA 1VKOA 2QRLA 2VOEA 3VKVA 2VOJA 2BGKA 4FFLA 1C1XB 3FWZA 3GC6A 1EVYA 2Z1NA 3ADPA 3LZ6A 1MFPA 4Z9XA 3P7MA 3RC1A 3KXDA 2FR1A 1E3WA 1NHWA 2C5AA 2HUNA 1VE9A 3RKUA 4EUHA 2B5WA 2DUWA 1PS8A 3T4EA 3EGOA 5FEUA 1MB4A 5BSGA 1GADO 1D1TA 2Q2QA 1OOEA 2I6TA 1NPDA 2Q99A 2BD0A 1Z7EA 5FFFA 1DRUA 1H93A 4DBZA 4KZPA 1ZMTA 3OHSX 2RHCA 2WTBA 1GV0A 4FFMA 4E31A 2NTNA 4ITUA 5KVSA 4N18A 3KVOA 4J43A 4YT2A 5TT0A 1CQIA 4PN3A 1IZ9A 2V65A 2EHDA 4Y9DA 2B4RO 2J3KA 1HYGA 1YGYA 2IYOA 2CF5A 4ZQFA 1GD1O 2OOSA 1M67A 1YB1A 2FPGA 4LRSB 2ZTLA 5CAEA 4MIEA 3BTSA 4JNKA 1E3IA 1V35A 4CODB 9LDBA 1UP4A 3PDJA 1KY5A 1X13A 2Q1TA 2C7VA 3VTFA 3ZWMA 1Z73A 2VCYA 2IE0A 4EBFA 1ONOA 4GX1A 4URFA 3LQFA 1H5QA 4I9UA 4AL4A 4RPHA 5JFOA 3E18A 3GNQA 2CUKA 3RVDA 1K89A 2HMSA 2WD7A 5CDGA 4AJHA 1ULUA 1BRMA 2VUTA 2D5AA 3ZH2A 4WGGA 3KBOA 1QRRA 5KKAA 3L07A 2UAGA 2YYYA 1GUFA 3PWZA 4OXKA 5TS3A 4JROA 2FWMX 5BNTA 4QO7A 3JYNA 1GY8A 2I5PO 5HS4A 5L40A 3O9ZA 3KUXA 1UXKA 2H1SA 1TVEA 5G4KB 2P5YA 1ZK2A 4KTVE 1OBFO 1B7GO 1VJTA 4WEOA 4BKOA 3CMCO 4LRTB 2AE2A 2G1UA 3BMQA 3B1KA 2F1KA 1E6UA 4B4WA 3D4OA 3VPGA 4Z0PA 1Y6JA 4Y6PA 1PWXA 4YJDA 1MA0A 1MGOA 4U5QA 2Q2WA 2O7SA 4JBHA 3GVXA 3JYLA 3QRWA 4I9HA 1NR7A 4XYLA 3C24A 4B8WA 3IUPA 5TGDA 4CV0A 3K2EA 4HFJA 4J1QA 1K6IA 4XR9A 1JTVA 4IPTA 1O0SA 3U5TA 4TKLA 4RZIA 1N5DA 4BVAA 2X9GA 1OC2A 4ESOA 4MVJG 2HMWA 3GF4A 4D0RA 3WNQA 1BWSA 3T4XA 4M89A 2EGHA 3AJRA 2B4TO 3KLMX 5C5IA 3SC6A 1J4AA 2FRDA 4RORA 5EQDA 4J2HA 4CM4B 5TF4A 1UXGA 3L6OO 4QXMA 2WE8A 1LDNA 3PQDA 5IXYA 5DCYA 2DBRA 2HMUA 3DBVO 4RVDA 1GAEO 1LDMA 4IQGA 4YCAA 4W82A 1I32A 1NVGA 3JD1A 3WMWA 1CIVA 3MEQA 3R6DA 4CM8A 4E12A 3EHEA 3BA1A 3PIIA 1A5ZA 4GQAA 3CH6A 4H7PA 1NTOA 1NFRA 4PLYA 2VRCA 4YAIA 4LK3A 3PJGA 4NIMA 4ALIA 2ET6A 1X0VA 1T4BA 5A1TA 4ND4A 4AVYA 4G81A 3WX0A 5CEJA 2X23A 2E37A 3PXXA 4DXHA 1HXHA 1N7GA 1KOLA 1P1JA 5THKA 4CQLB 3PEFA 1Q0LA 5DOZA 4IIUA 2VT2A 5HWSA 3MTJA 3DMYA 2Y66A 4PCVA 5F5LA 5JMPA 4PG8A 4WEQA 1U2GA 4JN6B 3ZWVA 4UVHA 4BB6A 5JDIC 2DKNA 4W7HA 3NT2A 1LDEA 2OHXA 3V8BA 4ND3A 1KEVA 4BNKA 3ZN2A 1IULA 2V6FA 3L4SO 2VZ0A 5AVOA 5CDTA 2OUIA 3ZDFA 5CG2A 4NH4A 4W99A 3OJEA 4PLVA 3QLJA 2Y1FA 2YV3A 3N58A 3QVTA 4GI2A 1R0KA 2IZ1A 1N92A 4OM8A 2JJYA 3LT0A 4I9NA 4PVDA 3WJAA 1MG0A 3GDFA 2J3JA 2FR8A 4PG5A 3RBVA 2AHRA 4DC1A 1U8XX 1DEHA 5T8KC 1XU9A 4E2YA 2AG8A 4XB1A 1DXYA 1T25A 1ADCA 1NYTA 5LCXA 4P22A 1LDYA 4L4XA 5T67A 3WWZA 4JCOA 1PJ3A 1GPJA 2F00A 3B20A 3I3OA 4WECA 1H6AA 2UDPA 4L75A 4MVJM 3ROMA 4E5PA 3ZWOA 1QV6A 1WAMA 3ENKA 3UGKA 1HL3A 3ITKA 3KYDB 2V6BA 5G4LA 1HE5A 1LDBA 2YHIA 4NPCA 4YPOA 5GZ3A 5KCZA 2VZ8A 3WGHA 3ZV4A 5BQFA 1SPXA 2GN6A 2J8ZA 3IQDB 5DF1A 4IGFA 4TWRA 2EW2A 2CSUA 3D4NA 1J49A 4J4TA 3QVXA 5C7LO 3KSUA 4D45A 4L0QA 1VL0A 1CJCA 2ZYDA 4RVFA 3LF1A 3F47A 3DBRB 2D2IA 4IDCA 3C1TA 4LW8A 5F21A 3GNTA 3L9WA 3H3JA 2P4HX 3WFJA 1AGNA 1PGJA 2QYSA 1KC3A 4ZRMA 1E7YA 4DYVA 4II3A 3PWSA 4ZGWA 1MX3A 1UH5A 4CUKA 3L77A 3RC9A 4E32A 1YOVB 1ISGA 4OOFA 2GDZA 3GOHA 3INRA 4LISA 1P31A 3NGLA 4HKTA 5IN4A 1D1SA 3WIDA 2PZLA 5TQVA 5I7EA 1B15A 3HG7A 1PZHA 3NUGA 3DBRA 4ROSA 4WLVA 2AEMA 4EJMA 1SO8A 3UXYA 4J0FA 4H3VA 1TI7A 3AOEC 3E9MA 1F14A 4NBTA 4CR6A 4F45A 3OQBA 2ZB4A 4CM9A 1U7HA 3TZHA 2CVQA 3HUDA 4PLGA 4B79A 1IOLA 5A06A 4Z9FA 2ZTVA 3WS7A 2BFMA 4B7XA 4BHTA 5JO0A 1RPNA 3JYQA 1JWAB 2PD4A 5H81A 1LLDA 4XYBA 1LSJA 1V3TA 5K6AC 2B69A 5I7SA 4M49A 5AXDA 1MXFA 3H5RA 3SC4A 3WDSA 4MVJA 2P4QA 5A9SB 3R0IA 4YJHA 3FHLA 2D4AA 2J3HA 4IZHA 4GL4A 1BG6A 1PGOA 4Y67A 2OL4A 4UEOA 1Y5MA 2EP5A 1WDLA 5JAZA 4JJIA 3PWKA 4TSKA 2NLOA 3DO5A 1N9GA 4FW8A 1Y7TA 3L9XA 3PYXA 1MC4A 4J91A 1XYGA 1DLIA 3Q6IA 1Z82A 1VL6A 2W2KB 1ADBA 3TF5A 4KWHA 1PS9A 3DZJA 2BFOA 2X22A 3VVBA 2GUGA 1R4NA 1T2CA 3CZMA 2P9EA 1R4MA 1ZKMA 3LLSA 3VDRA 3MJVA 5I7VA 2GCGA 3DBHB 3D5TA 1HE4A 3S55A 3E9NA 1BSVA 1GDHA 4I5GA 2NVWA 3RC7A 1TLTA 4HUJA 3TRIA 4FFRA 4FSHA 1BGVA 4E13A 3AI3A 1NPYA 3E5RA 1AN9A 3TDKA 4LN1A 1E7WA 1Z74A 1QYWA 2OMEA 2QIOA 5JAIA 2NVBA 3T7EA 1C1DB 3ROQA 3W6ZA 4D79A 4DLLA 5I9MA 3MJSA 1TXGA 3ZW9A 4IJKA 1PZGA 2ZIZA 2AA3A 1K3TA 3E82A 4Y6SA 3WXBA 1T24A 1BW9A 4O59O 5ILGA 1N1EA 1P3DA 4E33A 1BXKA 3GG9A 2ZTUA 3WR5A 5J23A 4RF4A 2AXQA 1B3BA 1NBOA 2VYVD 3PRJA 1BXZA 1D8AA 1MFZA 4UVGA 1DJNA 4OSOA 3GUYA 3RBZA 3WQRA 1YWGO 3VC7A 1E1NA 3DQPA 4E2XA 4N5NA 2GN9A 1ZO8A 3DHYA 2X7HA 4TZTA 3ZHYA 4CM8B 4AJOA 4L9RA 1XDWA 1Q7GA 2CVZA 4PIVA 5KOIA 4JQCA 1YL6A 1I2ZA 1ADFA 4PRKA 4N5LA 4XKJA 4CQMD 1LI4A 3MOIA 4CL8A 4I1IA 1JAXA 2Q1WA 2NU9A 1IZ0A 1WLYA 1R66A 4CQMB 1H2BA 3G79A 3H8VA 1EQUA 4E30A 3GDOA 4DPLA 5B4VA 1PJLA 1WDMA 2EKQA 3PJEA 3DTTA 2QZ9A 2JFGA 3LT4A 1W8DA 3OSUA 3GLQA 1PGQA 3DZFA 3EZYA 3QJ5A 4XIYA 3IP1A 4OGWA 3DBLB 3BXXA 2DQ4A 5A9TA 4X54A 3JQDA 4CLRB 2CZCA 2VYVA 3P19A 2PGLA 1FDUA 2B83A 4XR4A 3O8QA 4ZQBA 2JD0A 1WVGA 3WYEA 3O26A 1C0IA 3AY3A 5A05A 5JC1A 1G0NA 1LLUA 4AJLA 5ICMA 3N7UA 1DLJA 1WXDA 3JQAD 2C0CA 4MKZA 1EFLA 5EN4A 1JA9A 3WGTA 4U6SA 2YDYA 3JTMA 5G4KA 4BOYA 3WLEA 4RZHA 3GVPA 2E48A 1O8CA 5G0WA 5L7TA 3ADOA 3VPHA 3K2BA 3BIOA 4F6CA 5L7YA 4CLRA 5DZSA 1LA2A 1PS0A 2G76A 1I0ZA 3K73O 5L51A 1ZSNA 3ZWPA 1PJ2A 2QX7A 2VT3A 4IGEA 4AICA 4AJNA 1WDKA 2YJZA 5COQA 4J49A 3WQSB 1I2CA 3FI9A 2HJSA 1NR1A 2JD2A 4GX5A 4K1LA 4BNXA 3AI1A 4MO2A 3BHMA 2DBQA 1EMDA 2RIRA 5FI5A 4B4UA 4GBJA 5JY1A 2CF6A 3WG9A 3BMCA 2PKRA 4CJXA 1KEPA 5ENVA 1GZ4A 4L73A 1E0DA 3PI7A 5TX7A 3ZU4A 5BR7A 3GMSA 2VUSA 5U9CA 1GR0A 4YT5A 5A03A 5EERA 1EDZA 3K31A 2WJPA 3E6AA 1EZ4A 5B1YA 4CLDA 4UVDA 1DC6A 1UZMA 2VHXA 3RJ9A 2ZB8A 2TMDA 4CV3A 1DC3A 5KJ1A 4J7XA 5JSFA 2QYTA 4NJOA 1JU9A 4Z0TA 3VZRA 3LDHA 4YWJA 1ARZA 4DLAA 1EFKA 3WQQA 4BO7A 1X7HA 4Y6RA 5JBIA 3QWFA 1MUUA 2GSDA 1P1HA 2NV6A 2YQ4A 3OF2A 2AQ8A 4DMLA 5IJZA 5T6BA 3TFOA 1YH3A 1LC3A 1BW9B 3FNFA 3GDGA 1O6ZA 4HFMA 3CINA 1E3WB 1HRDA 3AUAA 3PTZA 4W4TA 5EL0A 4OMUA 3GY0A 2NM0A 2H9IA 2NQ8A 3UUWA 4BNGA 3RC2A 3UVEA 1M6WA 4M8SA 4CR8A 3VZQA 5G0SA 1CETA 4WLUA 3RD5A 2OBNA 2JAHA 4MIYA 3RWBA 5FYDA 3VH4A 2DAPA 1V0JA 4Y98A 3C7AA 1KIFA 1HYHA 1A72A 2VRBA 3GH3A 3PZBA 5DDIP 3VH3A 4OH1A 1AHHA 4BNVA 3KYCB 2IEBA 5C3MA 4P4NA 2JHGA 3KZVA 3LC7O 3GZ4A 3WNVA 2IYPA 5IDWA 5IZCC 2WSBA 3MTGA 2AMFA 1W0CA 3RU9A 2J5RA 2AQKA 3GZNA 3FRJA 5KNLA 5IG2A 1IB6A 5JDCC 2YZ7A 2ZB7A 4TVBA 1X7DA 4BNHA 1LLCA 3B1FA 4XDZA 3U09A 1U4SA 3RUDA 1U3TA 3GFBA 1RM4A 3ST7A 1OFGA 3JQCA 3NGXA 3HNPA 4UUMA 4MPDA 3X2FA 1NAIA 4XJSA 2X5OA 1HLDA 3TL3A 3AM3A 4BNUA 1T26A 2I76A 3C7CB 3IMFA 3BZUA 3ZNQA 1V6AA 1ENYA 1JN0A 3JQGA 4YVFA 3GR6A 3HDHA 3W8EA 3ZW8A 3RUHA 2AQHA 3C3XA 3DFUA 4MP6A 3ZU2A 4E3ZA 1T2EA 3WB9A 4OO3A 2O3UA 3P5SA 3M6IA 5GMOA 1KVQA 4JLWA 4INAA 4BQRA 4BGEA 1XQ6A 1ZK4A 4XGIA 4WNCA 1ZJYA 3S2FA 1YBVA 1UXIA 1P1KA 3IOYA 4KOAA 1TT5B 1YE3A 2FN7A 4A0SA 2GERA 1ISHA 3VZSA 3DL2A 4BV8A 2J5QA 4R69A 3VAZA 4WE3A 4YRAA 1ORRA 3U62A 4J7CA 4A5OA 4DYDA 4PZCA 3IC5A 4D46A 4KUGA 2HSDA 4YB8A 1SOWA 1U4OA 4UUNA 4GPD1 3S2GA 3PQFA 2XPCA 4FDAA 4D44A 2OFPA 1T2FA 3I5MA 4LSWA 3I23A 2HMVA 3HSKA 4YQYA 3PP8A 5A9SA 1CF2O 3G49A 4QSMA 1T1RA 3T7CA 3KEOA 5ADHA 4R1UA 1SBYA 1N8KA 3FD8A 3ROKA 4PZEA 4W9NC 1A4UA 5IAAA 4XRRA 5CP8A 2Y67A 4RF2A 3UKOA 2GGSA 4CLEA 2VHVA 2BGMA 3OEWA 1PIWA 1ZJZA 4XWYA 2VNSA 4IS2A 4NBUA 2X0IA 2NVUA 3FF4A 2O48X 3GMDA 3NAQA 2YHUA 3A9WA 2PR2A 2HO5A 3SLKA 4EW6A 1TA4A 1Q7CA 4R68A 5CFZA 4U6QA 3W4KA 2HLPA 4J16A 2ZCUA 2YHIB 5T5QA 3BAZA 4BO4A 4NG5A 1L1FA 3I9KA 4RVHA 3RAJA 2ZYGA 1ZUD1 1E77A 1JAYA 2D8AA 4MP3A 2W90A 5G0UA 4FS3A 4EI2A 4FQ8A 1YONA 2PZKA 3OIFA 4KUHA 1NX6A 1M66A 3TZCA 3CKYA 1IHYA 1ENZA 3HADA 1U2DA 3EZLA 3FNHA 2Q46A 1LRLA 2GD1O 2GZ3A 3D0OA 3OJOA 1E5LA 4WLFA 3RFXA 2VTEA 3KB6A 3PJDA 4RV9A 5C37A 3ICCA 2RH4A 4FCCA 5JYEA 5COAA 1IHXA 2HK8A 1ZIDA 4H15A 5JC8A 2X58A 1KEWA 2I99A 3F3SA 2P9CA 3O38A 1YBMA 2C2YA 3WYBA 1KVSA 1KETA 1F17A 3QVOA 1ZH8A 1LSUA 1E7QA 5TC4A 4ID9A 4DRYA 1EVIA 1C14A 3DHEA 2ZJ1A 1W6UA 3JSAA 3WGGA 1EUCA 1D4FA 4YT8A 1A9ZA 1DFIA 3ZCXA 3IS3A 3HE3A 3MJCA 1WW8A 1EBUA 4P4LA 3STHA 5A3JA 3IKVA 4B3IA 3DEYX 4K6CA 3C7DB 1A7KA 1E3JA 2JKVA 3NYWA 1G0OA 1HYEA 1MV8A 2Q4BA 4GX2A 2X0NA 5JDIA 2UUOA 4IIVA 4ZQEA 3HDQA 1F12A 4OXYA 3WYCA 1U9JA 3KHUA 4KP7A 4UAGA 1ISFA 4HX5A 1CEQA 2PH3A 5EESA 4DQXA 4EYEA 2PLAA 2GN4A 3LK7A 1Q0QA 3JQBC 2X9VA 3DR3A 1GQ2A 3JQAA 2JAPA 3LT1A 4XGNA 4FGSA 3IL2A 4IJUA 4NHEA 4DPKA 3G17A 4IBOA 3NT4A 1Z45A 4Q3NA 4GVXA 1B2LA 2FY8A 4UVEA 4E2WA 5BSHA 3HWRA 3ZNNA 3S2EA 2WEKA 5B4TA 4BB5A 1I3LA 3ZNPA 1T2DA 2YDXA 3EYWA 1U28A 1RWBA 4YAJA 2OXIA 4P4GA 3A14A 1WP4A 4OOEA 3W6UA 4YDRA 4FOOA 4ALNA 3RROA 1D3AA 4XQ9A 2O4UX 3CPSA 4NBRA 2RCYA 2BMAA 3WWYA 1RYDA 3OQ1A 1AHIA 2SCUA 4GSKA 4TRJA 1UP6A 4M86A 5KVCA 4RPGA 4FN4A 1P0CA 1P1FA 3JD2A 4R54A 1E3LA 4QTZA 4NBVA 3OIGA 2RBEA 3CZRA 2H63A 2FPIA 2ZQYA 4JP3A 3D3WA 3ROPA 4ZHSA 3EAGA 3JQFA 1VC2A 3DAGA 3EMKA 4RF3A 3WIEA 5MGBA 1XWFA 2E6UX 4R1SA 3PHHA 2D1YA 3NTRA 1HE3A 1IY8A 1WZIA 1SC6A 2OZPA 1K0UA 3DZHA 5EJ2A 3WSWA 4ND5A 1AXEA 5FF9A 1PU2A 3OICA 4IJWA 1ENOA 2GLXA 1IUKA 1X7GA 1GPDG 2O4CA 4ZD6A 4A2CA 1YKFA 1XCBA 3R3JA 4CUJA 3BMQB 1PJQA 2ZB3A 1UUFA 1DC5A 5BNIA 1E7MA 5ILOA 4NZ9A 3LSYA 1PJCA 4GVLA 2YFQA 4AJ1A 4GWGA 3IDSA 1E6WA 2IZZA 3GNSA 4J9VA 1XEAA 1BDMA 3OFSA 3H9GA 5C7OO 4S1VA 1JVBA 3FR8A 3MOGA 2VHZA 4N5MA 5KJFA 2DU8A 4OYRA 4FJ0A 5CHEA 3UF0A 1QXSA 5GZ1A 1XG5A 1D7OA 5IDYA 3TFQA 1ENPA 4WCFC 4BL5A 4M55A 2P68A 1E5QA 3P2YA 2DBVO 3I9MA 2AEFA 2DT5A 3F1KA 1U7TA 3KSZO 3JQ7B 4WJZA 3DMTA 3PHGA 1Y5RA 4ZA2A 1AE1A 3A28A 5I9LA 5HRUA 2FMUA 2IEDA 1HEUA 3AUTA 4NJMB 8ADHA 4E4YA 1JDJA 1WZEA 4KWIA 5LDHA 2RH8A 4R4JA 3RFVA 1B8VA 3JV7A 4PG4A 4HXYA 1C3VA 4B3JA 3UCFA 4J6FA 1XU7A 1H9BA 3PGXA 1DC4A 4YJFA 3EUWA 2FOIA 4DQUA 3C1AA 4BNFA 2D3TA 2E49A 4WOKA 2NUAA 3D4PA 3WMXA 2OBYA 4QFCA 5MDHA 8LDHA 1TB4A 4N54A 4FJ1A 4NNJA 5DBFA 3RQSA 1DFGA 4CV1A 2VN8A 1I3MA 1NPTO 1P45A 3BTOA 3WGQA 1NQTA 1GCUA 4G65A 1BTOA 4OL9A 3DZKA 4IDAA 3X2EA 3BMNA 3K96A 2JFHA 3RIHA 3UHAA 1U8FO 2FSVA 5K0ZA 3CEAA 1RM0A 3Q0EA 2YY7A 3ZWAA 2PY6A 2J5KA 3EDMA 1XLTA 4MVJP 1EDOA 3ZV5A 2O23A 4RGBA 1I3NA 4M54A 1SZJG 3A06A 3JQFC 2B37A 1RJWA 2PGDA 3EW7A 4OIMA 1FDVA 4CMGA 2O3SA 5ES3A 4CM1A 4XZ3A 4B4VA 2ZJ0A 1WMBA 3VTZA 4OQYA 1EUZA 3K6JA 4L76A 4FBGA 1HSZA 3FPCA 5AYVA 3DAPA 4BKQA 3V5NA 1ISIA 3ORFA 4GGPA 1LX6A 1DIRA 1R16A 4PFJA 5AOVA 5JS6A 1OZAA 1B8UA 1DIAA 1YO6A 1GCOA 1GFSA 1DHTA 3Q2IA 3BTUA 1X14A 3KTDA 3F5SA 4AJ4A 3I52A 2EXXA 4OXNA 1ADGA 2EV9A 1P74A 5T57A 4CMKA 1QMGA 1UR5A 4ZQGA 4ND1A 5A04A 1BXGA 4NI5A 1BVRA 1F8FA 3I4CA 4BO6A 3E48A 2NU6A 5L4NA 4CUZA 1ZXLA 2ZATA 2NU7A 2PK3A 3KLPX 2H5LA 1HDXA 1ZFNA 1NASA 4I08A 2UYYA 1GQQA 1Y9EA 1N1GA 2X4GA 5K6AA 3ZWBA 4BO9A 4KUEA 1Z6ZA 1BVUA 3L6EA 4RF5A 4UULA 1HETA 2OP1A 5BSFA 3DBHA 4CV2A 3QVWA 4AJEA 5CEFA 4A27A 1R4MB 4BNMA 3AK4A 3GK3A 3CTMA 1LDGA 1QYCA 3GHYA 4OJNA 4P38A 3ONDA 1VLLA 4O6VA 3WLFA 3AUUA 1ZSVA 1LBEA 3FNGA 4RQUA 2JL1A 4G2NA 3DMTC 4UEJA 4D0SA 1S6YA 3CMMA 2AEJA 4R1NA 1DIGA 4GMFA 1LLQA 4JX8A 3MJ4A 3ANLA 1UZNA 4GH5A 3H65A 1WPQA 4LVCA 1LJ8A 1DOHA 1XA0A 3I9NA 1EK5A 4J4BA 1QYVA 3JD4A 3OMLA 4TQGA 2CFCA 1UZLA 4KMSA 4YJFB 2UUPA 3M1AA 3DFZA 3GPDG 3ICPA 3OBBA 4RJTA 2GNAA 2EWMA 4NU5A 5I9NA 3HHPA 3HJAA 2X5KO 4R5MA 2C82A 4LGVA 1WNTA 1XIVA 1XR3A 3ZHZA 4RCVA 3I9OA 1K6JA 4F3YA 4XGKA 3KRTA 2C59A 3BMCB 1KVTA 1XSEA 5TNXA 3ITDA 4B7UA 3RUCA 4GGOA 5EPOA 5KKCA 4Q3EA 4AJKA 1XKQA 3B6ZA 1JVSA 1RM5A 3K9QO 3LLVA 2YQ5A 1VM6A 2Q2VA 3G1TA 4MVJD 5KTKA 3KSDO 1T4DA 1P9LA 3V2HA 2DPHA 2Y93A 4IMPA 3U4HA 3ETEA 2A4KA 3V1UA 4MDHA 3AU8A 3OJLA 5KVQA 4KDFA 1NWCA 4W6ZA 3U0BA 2Y1OA 2GR9A 3GN1A 4D3SA 3KYBA 1ZK0A 2EGGA 4YACA 4CR7A 1UXJA 3BHJA 2C29D 4C4OA 1DRWA 2EW8A 5EMHA 4DPMA 2YFHA 1I3KA 4NJMA 4EGFA 1NQAO 4IY1A 1BDBA 4NBWA 3M1LA 4RPJA 4BNIA 5I8WA 1YB4A 2Q1SA 3O8QB 3OIDA 1A7AA 4DIFA 5L9AA 3EVNA 4BO1A 5TJ9A 3IP3A 1F8GA 1EBFA 1NXQA 3VPXA 3GUCA 3QA9A 4UEKA 4YT4A 2NSDA 3FN4A 4CMIB 4F6LA 2Y05A 2P9GA 4GKBA 4DIBA 3F4LA 1FK8A 1IL0A 1F06A 2DTDA 4DGSA 3QE3A 4L74A 4EEZA 2Y1GA 4LMRA 2CNBA 1Q7BA 3L0DA 3NT5A 1PJ4A 1YL5A 2PGJA 2VYND 3INTA 3GAFA 3KV3O 3TWOA 1YQDA 4BGIA 1DIHA 2TMGA 3CXRA 4CQMA 1EQ2A 1Y8RB 4I5EA 4Z0HO 2ZTMA 3NDJA 4R41A 2I3AA 5ENDA 3ULKA 2HK7A 4J4HA 3TOXA 1GEEA 1ZEMA 3L4BA 3OM9A 4MVJI 3TQHA 2WDZA 3PHLA 3ONEA 2WYUA 1YL7A 1PX0A 1O9BA 4NK4A 1LQTA 2J3IA 3FCOA 4TVOA 3IKTA 4IDGA 3BHIA 3GVCA 4NU6A 2O50A 1YB5A 2H6EA 1PWZA 1DFHA 4OKIA 1K6XA 4GX0A 2VWPA 1LXCA 2DVMA 5AQ1A 5CPFA 4DC0A 1FDSA 4A73A 5JAMA 1X0XA 2PKQP 4R51A 3TZ6A 4EITA 1N7HA 2NU8A 4NFYA 1P77A 2Q1UA 1CERA 1CWUA 3QWBA 4BKRA 4JBGA 4PLHA 4N7RA 4BNLA 1KVUA 2W8ZA 3WTBA 4FC6A 1QYDA 4GMGA 2EJWA 4DL9A 5THQA 5IZ4A 3G0OA 3M2TA 3LYLA 5KIAA 5L4SA 4A7PA 2JHFA 2XXJA 1GUZA 3NX4A 3LC2O 1U1IA 4WNIA 3VH2A 4WCDA 2A92A 1H0KA 3PLRA 3VPFA 4E6PA 2EKLA 3O4RA 1I10A 1R37A 2I65A 4DTIA 1ZCJA 5K9ZA 5LDGA 4FFOA 4R9SA 4CMEA 2R00A 2G0TA 2EERA 4IXWA 4BGVA 3F5QA 1O5IA 3VPSA 5JCJA 2VUUA 3COSA 3V1YA 1ID1A 3AUSA 4IDFA 2E82A 5HS6A 5JY6A 1UAYA 4QEDA 1YXMA 2P2SA 3JQAB 3G1UA 1ZMOA 1T2AA 4RPLA 1IYZA 4MP8A 1PZFA 1B16A 5IN5A 3I4FA 1ZNQO 3AU9A 1XHLA 5TSDA 1A4IA 3GAZA 4MOWA 3GGPA 3RUFA 4KQWA 1PQUA 1UDBA 1GZ3A 3PDUA 2EP7A 1HKUA 1PGPA 1K5HA 4RPKA 4FC7A 3JQ9C 1B8PA 4RL6A 5KVVA 3I83A 4Y8VA 2GRAA 1KC1A 1LNQA 2Y99A 1I5RA 4YAKA 4D42A 5T64A 2I67A 3D1LA 2NQTA 3SJUA 3EK2A 5IDXA 1JW9B 3PFWO 3H9JA 3SJ7A 1HDRA 3WBBA 2O2YA 1GYRA 2XOXA 2BFPA 1KEUA 4DMMA 1YDEA 4ALKA 6LDHA 1N2SA 4LCEA 3MZ0A 4XCVA 1B14A 1NFQA 3E1KA 2QG4A 2DM6A 4BO8A 5CG1A 2C07A 4RDHA 1QYXA 1PL6A 1HWYA 3FTPA 2NACA 5A5EA 4HY3A 1UDCA 3ENNA 2X9NA 4BKPA 1NNUA 2I66A 1U3UA 3ABIA 4HWKA 4HFNA 4II2A 2HKIA 2VWQA 4O1MA 1U3WA 4BNJA 1IE3A 1K2WA 4U0KA 2YV1A 3SLGA 3AWDA 3F46A 3IJPA 3TPCA 1PTJA 5F1OA 5B4UA 3Q9NA 3PFFA 2D5CA 1GYPA 1LTHR 1ZSYA 2W98A 5EINA 1X1EA 4D41A 2E4AA 1O94A 4CLHA 3ZWNA 5DULA 4YJGB 5G0VA 1RYEA 1LRJA 3H2SA 3PHJA 4M1QA 2GZ2A 3AI2A 2B0JA 3H4VA 3NRCA 5DP1A 4I5DA 1SB9A 1PL7A 3WSVA 1IPFA
chains in the Genus database with same CATH superfamily
5E2AA 1XQXA 2F67A 1ODLA 1VMAA 4YAEA 3AJDA 3SS9X 3PE4A 1R6VA 2JFFA 2O8EB 4LZJA 3U19A 1JXQA 5HP4A 3R1IA 2GAAA 3GVHA 5CPBA 1EUYA 2P79A 1Z7BA 1ZVJA 4Y0VA 2BR3A 2JJQA 3KUCA 4X9XA 3AY6A 3NWPA 4PLZA 1PUIA 3V2GA 3GXOA 2Q50A 2I29A 3AR3A 3DCNA 5DM1A 4C0AC 4F8JA 2F62A 3FXAA 4G5RA 3CO5A 1WSWA 3LUGA 2GAOA 2RHBA 4BKUA 1Y4DE 1Z4OA 3FYCA 3G2KA 4IINA 1U04A 1FXUA 1J2RA 3B9PA 5FQOA 5FWDA 3TOCA 3TQFA 2GO1A 1ZX1A 2CJYA 4HG2A 5K0LA 3QTLA 1I2DA 2XTNA 4DM3A 4PBTA 3ZCTA 4BBZA 4ZAZA 1C7JA 5K2OA 3EY9A 3DZ8A 1ZZGA 2M6LA 2A35A 2FPPA 4NAHA 1X1SA 2Y0DA 4QPNA 3OE4A 1IY2A 2PFSA 3VUFA 1ULBA 3BCUA 3KQMA 1F8XA 4YLEA 4B3CA 4MKFA 1PQWA 1WCXA 3ZGNA 1E5TA 5TIIA 1ND5A 1LEHA 3EC1A 2MINA 4YAGA 3WISA 2GH1A 3U4DA 4Q4DA 1KRWA 1OYYA 3MAGA 4PZDA 2XUFA 2OGWA 3ZHTA 5HKKA 3W5AA 4RY8A 1LC0A 3EIHA 4HGRA 5LP6B 1H2AS 1TTHA 2RH9B 1K5PA 4Z3KA 1NBMA 2ZU0C 3FY4A 3D0KA 1J0CA 1G4UR 3T12A 1L4UA 1R0SA 3AF1A 4YJ3A 1P1BA 1YTUA 1ZS9A 1K6EA 1EK2A 2D1TA 3ND8A 2Z30A 1HG0A 1T4CA 4UDNA 2BI8A 5ALEA 1ISMA 2ZYVX 2ONKA 2V7GA 3BX1A 1J5PA 4LTMA 5DT9A 2R62A 2XTJA 1AXGA 2ORYA 1GFIA 3FLEA 4KO1S 4MO9A 4R1TA 4F92B 1I2BA 2I6SA 3PJFA 4RTRA 2IYAA 2FJUA 4K6FA 2WWHA 1M5RA 1SEVA 3DLIA 2PG3A 2PWZA 4YRPA 1J09A 1E2DA 2CVOA 3DDUA 4EY8A 4BJ5A 4ZEWA 3D3QA 2Q5EA 1RBMA 2GZMA 3L8CA 5CYFA 5AI4A 2Q4RA 3PVCA 2AOWA 3M49A 4TWZA 5DB4A 1L6IA 2GYUA 4HSGA 3IODA 1UOEA 1W0JA 2AE1A 5EWJB 1YS6A 1VB3A 3IJEB 4CLOB 1QKJA 1QAQA 2X8WA 3M2PA 4L5YA 3JALA 2Q8QA 1EWVA 2G5PA 3NKVA 4FJ2A 5AJYA 1VIVA 1UKVY 3TZQA 3KKMA 3ZHSA 1QNFA 1FDWA 1BYIA 2GCOB 2V6GA 4NCBA 4NLLA 1XZNA 4Y9SA 2W2LD 2F1IA 1KERA 4R8VA 5JAQA 5ADWA 2W2XA 1O95C 1NJ6A 5AVSA 3C6YA 1RWPA 3IMEA 1FVFA 3N59A 2QD3A 4N49A 4TROA 4DMCA 3HXOA 5E3JA 3JQ8A 2YXBA 2LCQA 4PFSA 7ADHA 1HE2A 3T7DA 4FR5A 3SR3A 4Z4EA 2VCHA 2O3RA 4QLAA 1ZU4A 5JXGA 5D2CA 1U3DA 3GFOA 1ZNYA 3HXTA 1YDWA 3IEUA 3ZHBA 4C87A 2X0DA 1IBCA 1YF3A 3K2IA 3USES 4BIIA 1K92A 1SAYA 3QP9A 4TRNA 4E7OA 1MHTA 2I71A 5EKTA 4O2AB 3E61A 1RJGA 4JXJA 4BMDA 4PZPA 1OU4A 3LDGA 4L27A 3WV5A 4DCCA 1PL8A 3LKZA 6ADHA 1R6DA 2QY6A 4MPJA 4B84A 3HKBA 4DBVO 4EJ6A 2M6SA 2X6QA 3ASUA 4B2YA 5TLSA 5DFAA 1R12A 5HMLA 3EDQA 5MN4A 4C7KA 3PKIA 3W3ZB 4P33A 4O4IB 5KUTA 1EA5A 1GHTA 3OC6A 4G1CA 2Q45A 2DZDA 1U9IA 4JK3A 4ZP1A 4YAUA 4I6GA 1PW5A 3DMPA 2XCLA 1VG0B 3W8NA 1P33A 5KU1A 1TUBB 2ZUCA 5EJ6A 3IKMB 3AZOA 4LNUB 4L4UA 4MJ7A 2G06A 3TOZA 4K46A 3HQ4O 2D2FA 2AX4A 3M7IA 4X8HA 1BGWA 4KRYA 3QVJA 2BBOA 2PT6A 5H7XA 1T5LA 1V71A 1EVQA 1C9EA 2RG7A 3QFCA 4A9AA 4CMCA 4RBNA 4LZOA 3F7NA 2EJBA 1WUKS 1NIPA 3KM0A 3K7EA 4HVTA 1TEHA 1XV5A 4MUNA 4N8DA 1UBKS 5IVIA 2QBYA 3PR3A 4CG3A 2OSVA 2FHSA 2HHCA 1ADJA 2X0JA 3KR0A 2Z57A 4ENPA 3NTLA 3D1VA 4NFSA 3V1TC 3DLAA 2UZ4A 2PMFA 3GEGA 4QDUA 3NKLA 5CFLA 5DXJA 5IDQA 4AP9A 2PGOA 4TTIA 4KE8A 4LWPA 5IS2A 5J3JA 1QGOA 2FNAA 3TLAA 3OQ6A 3BIJA 3FNIA 2YVUA 1B76A 1I14A 1X7WB 1Y1QA 4HSEA 3GCZA 2EDAA 3EC2A 1SCDA 3TRDA 1FLAA 1W4CA 3DJYA 3G2NA 3IT0A 4LNUA 4XIFA 5DNWA 1DT3A 5BV8A 3WMFA 4X41A 1GFWA 2HW8A 2F55A 3QQ5A 3B1ZA 4BUCA 5L45A 3SF8B 3KUUA 5IZCA 1ZAYA 4GD3Q 2X7JA 4BGUA 1M8FA 4AG3A 3H2ZA 1NQ5A 4CLOA 5P21A 5LJLA 4LV6A 2XUPA 2HNBA 3EQ2A 1CUDA 4EVSA 3CH5A 1SCUA 3VHRA 4OHYA 1HORA 1V26A 2P8SA 1L9KA 2QUBA 2IUTA 1O7JA 4M7PA 1TNDA 1XJCA 1U81A 3GCDA 3MD0A 1FTYA 4M87A 4MQ5A 4TWAA 4UARA 3W3AD 1JR4A 5FPQA 3A2LA 2C1EA 2XNCA 4CEHB 1NP3A 4ZO6A 1WDWB 4EA7A 5CDSA 2PGIA 1MJFA 4G1FA 1KAMA 2PUJA 2HRRA 2HRBA 2R8YA 3U4IA 4UBMA 2HCFA 3NAMA 1OWPA 2G1PA 2HF7A 3IP8A 3LUJA 4NAUA 3IXLA 3BE4A 1EX6A 5SY6A 3K92A 3C14C 2WICA 3DNFA 4UHJA 2QV7A 3W6NA 1OMOA 1W8IA 1QHHB 2RHWA 4OCZA 1MOQA 1KJWA 1M2KA 2BI7A 3TINA 1N5LA 3PUYA 4DKXA 2UV8A 1IHOA 2ORED 2CVFA 1MP0A 4JHLA 1OAAA 2FSSA 4YRTA 5ANRB 3S2UA 2J9ZB 4WA8A 1DRKA 2BEUA 3EH1A 4H1WA 1DTWB 3IIIA 2YIMA 2WA1A 3IR7A 1ZBDA 3ETGA 4LVOA 3AEZA 2EW1A 1NSTA 4KOEC 3COPA 1P7WA 4KXNA 5IMBA 3UCXA 1US8B 5JRDS 2GXAA 1GGMA 5DNDA 3L1HA 5LQAA 1X3LA 2JH3A 5HVNA 5KTNA 3ADDA 5AJXA 4YMIA 2M9MA 3LD9A 2P9ZA 5EP2A 4MITA 3U49A 2ZS8A 4BO2A 3IHWA 4ND7A 2JW5A 2XA9A 3QMWA 4RHFA 4A03A 3RNLA 5D7NA 1Y8CA 4YRJA 1RKXA 2CNDA 4ZAVA 5LA6F 5CVJA 3NKFA 2O8BB 2CXUA 2I62A 1JQBA 2B35A 1X19A 3OD1A 2GA9A 4EB0A 3IV6A 2IDZA 1G5HA 1S1CA 4GPBA 4K7JA 5KTSA 3DE6X 1JBKA 1M8KA 3C1UA 4KSBA 4ZTBA 2YOFA 4EHJA 4QEZA 1S2LA 4GMXA 2JCXA 4UHFA 3CZAA 2AFIE 3TK1A 4HT3B 2KM1A 4PC1A 3VU9A 3PGJA 2CKDA 1WU8A 3F6YA 3IE2A 4GWLA 3KETA 4DLSA 4B5KA 4HNAA 4C0BA 2A9PA 4WINA 4BKMA 3VAAA 2RBGA 3UCEA 4BMYA 4QYSA 1XJ5A 4RK1A 1KQ3A 1HT0A 1N2EA 1Y1PA 3E9QA 4LMBA 1XZLA 4J3FA 4QDJA 4I1OA 4C4TA 4HV4A 4M0CA 3H4MA 4WASA 3CBQA 5CMLA 3EJWA 4BZWA 3QMPA 2QAGB 4EUNA 4YQZA 4UUQA 3JWEA 1IMJA 5EWLA 2WKRA 2ZANA 1NF2A 1PLKA 2M6RA 3NV9A 1E3SA 1XT6A 3E03A 4XB2A 2FPKA 3I1JA 1C0KA 5E9WA 1YMQA 1DUVG 3PE3A 3ENWA 3RYHB 3B2EA 3R9XB 1A8QA 3TSZA 5TMBA 4C7OA 4G0NA 3WYGA 1U8UA 2RGGA 5EZ5A 2PMEA 3PXAA 3TW8A 2EEZA 4L51A 4DCOA 3GLIA 3GEDA 5FFNA 2R2GA 4I9FA 3K1JA 3QG1A 4KEAA 2FGKA 3V8PA 2GPJA 4X3PA 1N7JA 4QC2A 2HM7A 4K8RB 3LPAA 1YZFA 3IERA 1OC4A 3EZ9A 1NJSA 2HBYA 1XTRA 4I46A 1P1CA 4MHOA 1AVTA 2VO1A 3Q5EA 4HDAA 4KQKA 4S3MA 3KJQA 1XKXA 3HH8A 2O3QA 2XDQB 4S1OA 1HG1A 1XL0A 4FLFA 1BJRE 2BH9A 4YJHB 3B5IA 5LXTF 1DEAA 2QL5A 1TQ8A 3HKCB 1Y42X 1CDDA 3D7LA 4G0XA 4DILA 3TNJA 3DEAA 1SHLA 3GU3A 4OD0A 4YTEA 2JH9A 2V7UA 3D3EA 3KLOA 4PX2A 2H1RA 3BKXA 1T6YA 1IWOA 4MYCA 5SZJA 5BMVA 3R0XA 3KQNA 3DE7X 1MEOA 2VDWA 1NVVQ 3RHFA 3IEXA 4ZDKA 2X3YA 4KLAA 4UBNA 4CM3A 4JI2B 5EQFA 3QEJA 4AWAA 2XW6A 2Z6VA 4PLWA 3W78A 4DOMA 5ICGA 5CXXA 2B3DA 3HKEB 1JBEA 4URUR 3ZI4A 1HNZB 1H69A 1Z56C 3M0EA 3LT2A 2EARA 2PCLA 3VVCA 3VVLA 4BNZA 5IJ0B 4DREA 1A3CA 7YASA 2DULA 1LK7A 4RVGA 4I4IA 4DR7B 3AL2A 3DYBA 3IR5A 4KQ1A 4ARVA 2R6JA 4DJFC 4EJ0A 2GFIA 2PX0A 4RMIA 1N5RA 3WIUA 3RKSA 4R7ZA 2OXEA 3RGWS 1NBWB 1RZ3A 3UTDA 4IXTA 1KXJA 1MG5A 3U17A 7MDHA 1H23A 2R2AA 2XAAA 4M3NA 4OQFA 1M2WA 4M8KA 3ZHCA 5BT9A 4GWKA 4Y2UA 4TL7A 1WZ2A 3ORRA 5HBRA 2IF2A 2XZLA 1VCHA 5IULC 3ZG6A 2BZSA 5FUYA 4Q01A 2Q3EA 4LDAA 3HMQA 4TZKA 4XQCA 5GVSA 1K7EB 3RBXA 1NF3A 4FFNA 4Y1GA 4IOKA 5I9IA 2O7QA 4N7BA 3SBOA 1IN4A 1AHNA 1QFMA 1SEPA 3A9RA 3GAAA 1N9KA 5EP1A 1G6HA 5HILA 4DR4B 2JVJA 3KPWA 3HB4X 2G77B 3WGYA 1AF7A 1YJ8A 1A8PA 1P0IA 5AFSA 1R0LA 2UKDA 1E6EA 3EGIA 4OHOA 4TM8A 1SRRA 1AGXA 1YS4A 3K1AA 5ECGC 2FSVC 4EG6A 5K3AA 2Q6TA 3KOMA 3LE8A 1WTAA 2O8DB 1WP9A 2E4ZA 1AO0A 1I6MA 4FT4A 5JVDB 4HD8A 3O73A 3NPMA 4O5AA 2Z83A 3LVFO 5IYZF 5HK9A 4OHVA 4BNNA 1ONBA 1PR9A 3E7XA 2WY2D 4PV7A 4Z7NB 2W6IA 2HJHA 2AW5A 4HDNA 3EC7A 3D4BA 4LYFA 4XD2A 1JHQA 3PNYA 1UFKA 2OEPA 4RQTA 5DHRA 2CHVA 3VHLB 4ZT4A 1V45E 1OIWA 1Y6GA 2ZYTX 2UYGA 5AM3A 2NU8B 1QTQA 2Y9PB 3ZCRA 5LBTA 5IC6A 5CDYA 5JH7B 3K20A 3HK2A 2B94A 4TMFA 1PR4A 4UQOA 2HF8A 2ZYWX 3N2KB 3O8NA 1PNRA 2E2WA 4LOKA 1PNVA 4JJGA 1MH9A 2XTZA 4NDNE 3OEHD 4S2EA 4P98A 1G8FA 3EXHC 4B40A 3DCIA 3LP8A 5LYJA 3N76A 4ZDJA 2X3UA 3BFPA 3E0QA 3MWEA 4M1KA 3CZ9A 5ITWA 1TVCA 3V1MA 2X40A 3WLOA 1DXHA 2WA2A 3ZUGA 3N0WA 4XRGA 1A96A 5D5QA 3VOTA 2YXNA 1H2HA 2IPXA 1QGDA 3IDAA 3QFRA 4RD2A 4YA6A 1YDHA 3H75A 3VU3A 2P62A 3QVMA 3OT4A 4FTWA 4K28A 3OX2A 3T4UA 3KG2A 3CN9A 1QR6A 1A9QA 4XSGA 4F38A 1NQOA 1I1NA 3FBWA 3CM0A 4IDNA 3WLJA 3ZJ5A 3PPXA 1MT0A 2AG0A 3VNRA 2QMHA 2XMRA 1B43A 5TF0A 1C9JA 4MKRA 3U4GA 1I80A 1UWKA 4K9KA 2X8LA 5A7FA 4X1OA 4UUPA 1D0VA 4G8CA 3QW2A 4IHAA 4CIBA 4PG6A 4BEWA 4JJ7A 1FLDA 4IFBA 2FWRA 2JFOA 3HPQA 3L7CA 2PPLA 2GZ1A 4QYIB 1K6MA 2YIVX 3AEUA 4PRLA 1O97C 1J0AA 1RQ2A 1FUKA 3K8ZA 4KRXA 2WFLA 4ZWNA 3PXGA 4EF6A 1Y6RA 2YHBA 3PEWA 2ROQA 1EI9A 3LXUX 4KR9A 1Y3AA 2CD7A 1I6LA 3FOBA 4JYZA 2CJWB 2DFDA 1HTTA 4LX0A 1MORA 1V4VA 5B1EA 2OT3B 3GA7A 3TTUA 4OHKA 1BMDA 1CJMA 3GHHA 3TFWA 2YW9A 2BI4A 3MW8A 4MVJH 4CDNA 2HLNA 5JWHA 1IVNA 4HNGA 5JR3A 5ECYA 3ZV3A 5KEIA 1OJ7A 4GKVA 1N1MA 2XE4A 4WZBA 4GZ3A 1N2HA 5T6MA 1N32B 2PS1A 3EEYA 4CM6A 2PXXA 4EKNB 1DP4A 1XZIA 1GKIA 2XMCA 1CP2A 2Z0MA 1SXJD 2VNAA 4QT0A 1ISRA 3WDKA 2DH6A 2VZ9A 4UE6A 5LC1A 3PXCX 5AVVA 2VDJA 2VF5X 3RASA 5ESXA 4EGQA 4RNCA 2GN2A 4C01A 3S2YA 5E7JA 4ALLA 4PYOA 4GI5A 1G19A 4XX0A 1I30A 1T34A 2HCTA 4TTJA 3NHSA 5EOVA 3TPZA 1UAGA 3ZWDA 3BK1A 3BXPA 3PUHA 4G5GA 1Z8DA 4A8JC 4DE5A 3H6HA 3TTXA 3AHIA 2NTJA 3DWEX 3ASZA 4NENB 3NI2A 3ANNA 1GZ5A 4PSCA 4RJJA 3BORA 3ZPXA 4D3FA 4G4IA 1JFVA 4ACAA 2OAQ1 2VJBA 2DECA 2BBTA 3S8YA 4BO5A 3CX4A 1EE2A 1E2QA 1F60A 2NYAA 4Q16A 1M73E 1GTMA 3R8XA 2WTAA 1ODKA 4KQFA 1MQ9A 2QKYA 2B8TA 4NMHA 4Z2AA 4FFPA 5C2JB 1JSCA 1FSPA 2YXDA 1WXQA 4KACA 4MKXA 1Q3HA 1XMXA 5B1DA 4CTOA 3CE6A 3UG7A 2VF4X 1RKQA 3WGKA 4Q39A 4AXXA 1NL3A 5KJCA 2Y1WA 1K1EA 4S35A 1MT3A 1OGYA 1ZN7A 4CYMA 3WAJA 3A1FA 1GA4A 1UBEA 1V48A 1MDBA 3IILA 4I3GA 3L04A 5D6NA 1VA5A 3S68A 1PJ8A 1EAMA 3PD0A 1S7GA 3QYPA 2C2GA 4ZOAA 1PV2A 3LUBA 1O6GA 3BD8A 4ZKDA 2PSSA 2FDRA 3NWBA 4W8OA 1UQTA 4D82A 2NP7A 4GLOA 2MWMA 2XDQA 3T34A 3N0XA 4OVKA 1M2JA 3BWVA 1P4GA 3I2FA 3H1FA 2QT1A 1JDNA 4TS9A 2E3JA 5LJIA 4B4OA 4CPDA 4R40A 5DM2A 4CCAA 2EATA 2XAUA 4K8OA 4LRQA 4P1ZA 3JWJA 4S0XA 5HF9A 4UEQA 5BNFA 3RVKA 3WFIA 4GSLA 2XD4A 1XWWA 2BN4A 3NANA 4IR7A 4LCJA 4Q9IA 4AIIA 4P3YA 1KHHA 3K9GA 2VIIA 3P45A 1H4VB 4C6RA 3Q41A 1DXOA 3S3TA 3ES9A 5A4MS 1Y7LA 5AXAA 1P0PA 3GUVA 3OOYA 3TCNA 1J00A 2V3VA 4R1LA 5ALWA 4E2ZA 1QAOA 1R8YA 2MSKA 2N46A 2KPOA 2FE1A 4PYRA 4WN9A 1WLSA 2HLHA 2V9CA 2WOJA 3VR0A 3X44A 3KO8A 2VF8A 4V1CI 1UL1X 4YLYA 3I6QA 5AJUA 1HKHA 3MT8A 1KK1A 4KXWA 1ZIYA 1V8ZA 1HFJA 2G82A 2CYBA 3BDIA 4M0LA 3TLZA 4FB5A 3OZAA 4JUAA 2VAXA 4L2IB 1VLQA 1IBSA 1JLHA 4UC0A 1NHGA 5B7PA 4PLTA 5JADA 1E1KA 3DLBA 1Z0KA 1ZJ5A 2YMLA 1XZBA 3FF1A 1KZYC 3L0ZA 5A5FA 1CLUA 3OZSA 4MINA 1V8BA 4EGSA 3E5MA 3OP4A 2YHSA 2LRHA 2B3TA 1JQKA 1X1QA 2CL0X 4Y6OA 2XWQA 3C8UA 3O3OB 1GU7A 4KLZA 3ZD9A 4PYQA 3HFRA 2YXPX 1X1DA 2QRKA 3K16A 4EWLA 1DB3A 5HRAA 5FPPA 2VP6A 2PD6A 3VGPA 2A9JA 1C30A 3WOVA 1BU5A 3E9EA 721PA 3LX4A 1F2UB 3OH8A 3PNOA 4Q7JB 1C3JA 1M9NA 5HTKA 1LW7A 3KPYA 1O54A 1XQ1A 1PF7E 1Z6AA 2ZQZA 4IG4A 3UC9A 1BHQ1 2I1WA 1U5BB 1RI1A 2RGAA 4X1YA 2H7YA 3X1DA 1FP4A 1RVV1 1CDOA 1NKTA 2HF2A 2RHGB 1BRTA 5F7OA 1DAOA 4C05A 3SPXA 1GUDA 1DBWA 1UJNA 4WXRA 1VKOA 2ADOA 1D5CA 4NCXA 2QRLA 3CBGA 3LYHA 2XCRB 3W5BA 1WVIA 4HN4B 1G59A 1S0UA 4GT1A 2BGKA 4CHTA 3GC6A 5HCNA 1XWIA 3ND7A 5AVWA 2QX9A 4GR5A 2QT0A 1Q17A 4IHJB 3RC1A 2J45A 1FC0A 3AZPA 2C5AA 3BVPA 3RKUA 4CKYA 1MX5A 3D7KA 5EE9A 5AQEA 5AVKA 1K7XB 1UQRA 5IWCA 2IPMA 3EXHA 4D97A 3VZBA 1GADO 3AKZA 1D1TA 1WF3A 2Y4OA 2YZKA 1GG8A 1Z7EA 1H93A 4ZVQA 3R5HA 4KZPA 3OHSX 3RAGA 2ZJ7A 3RRYA 1GV0A 3PC2A 3Q5GA 4K86A 1TTQB 1ULTA 2NUAB 4MH0R 2GAFA 4N18A 2R7KA 3SSAA 4CKEA 4YT2A 3VTAA 5KVSA 1M1ZA 4Y9DA 3UJ9A 5U4XA 2B4RO 2D00A 1LI7A 1EGHA 1FNMA 3LHDA 2C2WA 1S8FA 1GD1O 1SM4A 2YRXA 1RQRA 5BR4A 3UMMA 3Q0TA 5CM9C 5JCPA 1XVVA 2XMBA 2Y6VA 1YB1A 4Z49A 4TVSA 2ZITA 3Q7IA 3BTSA 4MHSA 1SIUA 4RHYA 3DFKA 1E3IA 4G5OA 3GRVA 5DIFA 1E0KA 4D3YA 1ISSA 4X6YA 1UP4A 2J67A 2SICE 2WW8A 3PDJA 5GV8A 3M6AA 4AS3A 4MWTA 5LSAA 3AJ8A 3H5WA 5HKAA 2PX4A 2G4CA 3ZDBA 1XFAA 1WBBA 2IE0A 4LDJA 4F04A 4AROA 4MYHA 3KJFA 3U1VA 3LQFA 1M5UA 1T8SA 4I9UA 5HDQA 4XD7D 4EPXA 4B5LA 5JFOA 3E18A 2CUKA 2E87A 2W71A 1K89A 1OV6A 1ULUA 4ARCA 2TS1A 2FHPA 4CDMA 2F9LA 5BNWA 4P32A 4B3XA 4C6TA 2ABWA 3ZH2A 3KNZA 3TG8A 1OYVA 2ODAA 4UJ3A 3RSCA 5FDFA 2D7DA 4PHHA 3L07A 2JVKA 2YYYA 1GUFA 2HV9A 4KI0A 1RBYA 1GY8A 2I5PO 3H11A 3TXYA 4CN8A 5HS4A 2HIMA 3R7WA 2XUJA 5L40A 1VL2A 2UYQA 2YNMC 2JZOA 2H1SA 1GPUA 1TVEA 4DV0B 2P5YA 3WC4A 2RSLA 4KTVE 3BFVA 1UK6A 5F2OA 1YFKA 2LCFA 1VLJA 3DE3X 3HCOA 1GRNA 3KT0A 4D81A 1U1DA 1YVUA 4JYAB 3B1KA 2H4JA 2F1KA 3R7AA 5HIJA 4IILA 1KFEB 4Y6PA 1QC5A 2QTHA 3N6VA 4YJDA 1QRSA 1R0WA 4BWGA 1MGOA 3IVCA 1G3UA 1P6UA 1NZDA 2PU7A 1BOFA 1PRYA 5TQ2B 4OI1A 3QRWA 1NR7A 2IYYA 1V7PC 5TGDA 2CNNA 3EA5A 3K2EA 4KFSA 4Q1CA 2XYQA 4EARA 3V97A 2FUG6 1TYCA 4MCAA 1O0SA 3U5TA 1GAWA 1VE6A 4KAAA 3T5BA 3OTHA 1N5DA 2JHAA 2P9TA 3BREA 3M6LA 3T3GA 4BVAA 4C3ZA 1OC2A 3B1WA 4HZGA 4ESOA 4MVJG 1IQRA 3GJTA 3IP5A 2WBLC 1Y9ZA 1MF7A 3GF4A 4KAXA 2AJDA 4D0RA 4XOUA 1ATZA 3B3GA 1W88B 2X4DA 4M89A 2P9JA 4C04A 1VYVA 3DVAB 1I4TD 3AJRA 2B4TO 3GLTA 3KLMX 4TUYF 1UPAA 1YA4A 4WVFA 3HYTA 4MVYA 3SC6A 5C5IA 1H4SA 4CTNA 4J2HA 4QU5A 3Q7PA 1UPUA 3MA0A 3U6BA 1QFZA 3VO9A 5K05A 5FKJA 4N76A 1IZ8A 2B30A 3A1TA 3W2GA 4WBXC 5L3QA 4LF4B 1H0HA 3N2ZB 3T0FA 3CUVA 3FPFA 1H2ZA 3PQDA 4FYWA 3R5SA 1CNEA 3DBVO 3I0NA 3U3MA 3DULA 2R6AA 3M1IA 4RVDA 1LDMA 1Z88A 1SC4A 1E0JA 4X6UA 2IYEA 1QF6A 1I32A 1XZCA 3I2GA 3V34A 1ZGHA 1CIVA 1RYMA 3PXDA 3DF9A 3R6DA 1XMIA 3RYCB 1QGUB 5HNKA 1QO7A 3B1VA 1CS0B 2QVBA 2ZTSA 3BKWA 3EW9A 2VRCA 1GITA 2NSJA 5K0EA 1P9RA 2PYZA 4LK3A 1Z4IA 1AV7A 1JLMA 2H5JA 3PJGA 4ND6A 3WIVA 4OYLA 4ALIA 3NFYA 1EH5A 2J87A 5CLQA 2MCFA 1YZKA 1TC1A 4KH0A 5BN3B 4G0VA 5FUVA 1GU0A 3RVNA 1KDTA 1LQ2A 1U1EA 3CNLA 4G81A 5D85A 3VR6D 4BLUA 3EPKA 2X23A 3AJ9A 2E37A 2WYIA 1R9NA 5LXTB 4FHZA 2XGJA 5AI0A 3LFUA 1NW8A 4LHZA 5THKA 5DOZA 4U9HS 3FCUB 4GC5A 4BQSA 2BH2A 4H7KA 1S3SA 2VT2A 1RI2A 4B3BA 3LKBA 1BMTA 1RRVA 2Y66A 1G63A 3DMYA 5JMPA 3W7AA 2V7BA 3MWGA 2QXYA 3VSAA 1QIFA 3MYRA 2OY0A 3BJZA 3PUXA 3RC8A 2DKNA 4RULA 3SXUA 1LDEA 4KFUA 4QJIA 1RVDA 4ND3A 4QXPA 5KQSA 1QBKC 1TZMA 2IIPA 1KMCA 4L08A 2J4FA 5EZYB 4G23A 4QXRA 2VZ0A 5AW5A 1FVXA 2XOEA 3B3QA 5AVOA 5CDTA 4DADA 5CG2A 5DYTA 4TT3D 5KNDA 1BNCA 3AVVA 4PLVA 1BDJA 4L4YA 3KWMA 1R1DA 3O21A 1Q1QA 1HDEA 3NQ41 3ZE8A 3OHPA 3V7YA 2WWGA 2YJ3A 4EMBA 5CA0B 2P2LA 2AV6A 4RA9A 1L5KA 2HX1A 2QSJA 3V8EA 1UODA 3RVMA 4BC0A 1R0XA 3EF1A 1WZNA 3CH4B 3WJAA 3HDTA 1L4BA 2FR8A 3T94A 4G85A 4YCDA 5DW0A 1U8XX 4ZYZA 1EUDB 4PX5A 1DQZA 3GLIE 4Q9DA 4V3BA 3FKSD 1DMSA 1VGRA 3ORHA 4UM7A 1OPXA 3RHTA 1T25A 5FBHA 5MGNA 4X71A 4GOLD 1JXAA 5LCXA 3UAXA 3WWZA 3BICA 4W8HA 1QVVA 4J0CA 1MAAA 1GPJA 2ZSUA 2X2PA 1RJFA 4PS0A 1WETA 3ZH9B 1T2NA 4L75A 3EFEA 4MVJM 3UHOA 1QRUA 1WAMA 3ENKA 5JVDA 3M9LA 4WOPA 3BQMB 5HIAA 1IOZA 4EI9A 2YHIA 5SYAA 4IGKA 5BVHA 1N77A 2I6GA 4KR3A 1X42A 5GZ3A 3ISJA 3BQNB 4HGNA 3KOOA 3MUFA 4HRXA 4TQAA 3DA8A 3ZV4A 1SPXA 5H16A 3SFZA 1EHCA 2X8JA 2QYHA 4LY3A 2FQ1A 3IQDB 4AKTA 2XRFA 4TWRA 3GLFE 2HIHA 3U1BA 4DG8A 5TE9A 4EPRA 3R44A 3SZRA 4M38A 1FUUA 1UDRA 2JJ1A 1L7MA 3HDVA 4KLNA 3C1TA 1OXXK 3H19A 3IUEA 3H3JA 2P4HX 3EUEA 1SR8A 3DE1X 3D54D 2RDMA 1O4VA 3HN6A 5CVUA 4CDRA 3M5CA 3OT1B 4C3VA 1DWOA 3HDGA 2WJYA 2GDZA 3GOHA 3OZBA 1ZITA 3INRA 3A6HA 4A3SA 4F5WA 5K8TA 2VRNA 1MOZA 4RTOA 5I51A 2LP4Y 1SXGA 1OFTA 2VJYA 1E79D 2A9OA 1EAYA 2ZI9A 4EQ6B 1PZHA 4GEGA 1QFYA 4EYGA 5ALNA 2VTVA 4L9WA 4Y6LA 1NNEA 2HDNB 2XJ9A 5DGDA 4Z9BA 1F14A 3OE7D 4NBTA 2FMFA 4JQSA 4KWTA 4KK4A 5C8YA 4EUEA 3ORQA 2AZXA 2OXRA 2ZB4A 4HAIA 4R9NA 3QIAA 1U7HA 2CVQA 3LUFA 1QPGA 4YH1A 3QX3A 3ZKAA 3QU4A 4HK4A 3CLVA 4L5IA 3C98A 1NF8A 3PXEA 2BFMA 1HL7A 4O4HA 2QPOA 1QDLB 2ZRBA 1EFVA 1BD4A 2VPQA 5DM0A 3MXOA 3IP7A 5BWNA 5ETJA 1TIPA 5JJ5A 1L8LA 2FQXA 1LLDA 3IOMA 5H81A 5B57C 1LPBB 1U8EA 4DJ5X 5KKNB 2B69A 2QP4A 2QZSA 4M49A 5D3ZA 4FOTA 5AXDA 3SC4A 1ORHA 1VKJA 1Z0IA 4H18A 4UOZA 4QGFA 1NTRA 5B3LA 2P4QA 2ZWVA 1PEKE 3R0IA 4YJHA 2IHBA 1W581 1V7CA 4IIEA 4IZHA 2ASEA 2J3HA 5ALFA 1JWLA 1PGOA 1DZ3A 1CRQA 2EFEB 1M2GA 4G26A 1Y5MA 1DO0A 4M7OA 2NLOA 1N9GA 1R4ZA 2VL7A 3O2SB 4LZZA 2GVNA 5CRIA 2BEKA 1ZRNA 2HWKA 3PFNA 1UMDA 3NZEA 2Q0XA 5L3VA 1TZKA 2W2KB 4R8LA 1ADBA 4ESEA 3TF5A 3TLYA 4KWHA 3QBVA 5DIZA 3DZJA 3DUWA 4HNQA 3VVBA 2BC9A 2LWIA 4YUXA 2UZ1B 2J5BA 4X6LA 1JZTA 4BQEA 1QG4A 4Q47A 3LVBA 1TW3A 2NVOA 1PVVA 1L4HA 2P9EA 3LLSA 4GI3A 4ZREA 5EVCA 4UW9A 3VDRA 2GCGA 1N8NA 2BFDA 3W34A 3WXMA 4QGAA 3E7WA 5K51A 2QAGA 4I5GA 5DEOA 2XQVA 3UPUA 2IBMA 1T1IA 1TLTA 1A9XA 1WKVA 3UYKA 3HCAA 5EWMA 4NE7A 5DH9A 2V98A 4RLFA 3KYIB 4IDQA 1ECJA 3AW8A 4PPGA 4AUEA 5C5DA 1Z2AA 4P3PA 3HBFA 3TLGB 4UAUA 4AURA 3TUZC 1RHKA 3EGDB 3T7EA 1O1YA 1C1DB 1E1RA 4NYJR 4Y30A 3INYA 4RHCA 3U31A 5AHXA 3W6ZA 3H0CA 3MJSA 3OP1A 4IJKA 1XCPA 4TLEA 4QHSA 3UIEA 1Y5IA 4E51A 3Q3IA 1AM4D 5BSRA 1G64A 5AKZA 3KQQA 4C88A 2PRJA 1N1EA 2ZSEA 5H4GA 2FP4B 3GG9A 5J23A 2ZTUA 1H42A 1U2RA 1GCIA 4MR9A 5BWMA 1B3BA 1NBOA 3COVA 1BXZA 3OSZA 4ZDWA 4OSOA 5KQGA 3CVJA 3GUYA 1GKKA 1M6VA 3WQRA 4LOAA 3EVBA 4Q7QA 4AS1A 1N2JA 1UWCA 1VECA 1XAIA 3BOSA 2AJBA 2X7HA 3F5FA 4KBGA 4TZTA 5AKXA 4BTEA 2L19A 4M53A 4I55A 1XDWA 2XV1A 3H2YA 4L9SA 1L9XA 1UJ4A 7ABPA 1Y1KE 4ZTZB 1D2AA 2E9SA 5DSZA 1P4SA 1AH2A 4U00A 1EP1B 4TXNA 2PMBA 2ZG6A 1WB5A 2ZWAA 4NMWA 1RYFA 2FKAA 3CH7A 3HCRA 3K35A 1V8DA 1TUEA 3D43A 4I1IA 4CL8A 2QSUA 1MIOB 2R86A 1CE8A 1DKUA 2Q1WA 3OJCA 3N8NA 5EIFA 5EJGA 5LUBA 3MRVA 3DZDA 5LZ4A 4X3CA 2AUTA 1QRDA 1AS3A 2NP6A 4TWJA 1YJ5A 4LQLA 2MIIA 2AFHE 2XTAA 3F9CA 1WDMA 1QHHA 1ZHFA 4EF5A 1W36B 3AR2A 5I7UA 3RRXA 2MOKA 5DM60 5I9BA 4WK4B 1W8DA 1PGQA 2C95A 1DKOA 2VJNA 3WIOA 3COZA 3EZYA 3NEAA 1IJBA 5FPKA 3UUFA 1V1MB 4Y2XA 2J3DA 1PD1A 4IGIA 2AN9A 3A6PC 5IUKC 3MWKA 1P29A 3S29A 3PC3A 2HHLA 4CLRB 6GPBA 3CVYA 2CZCA 2P75A 5CIYA 3P19A 3GPLA 1DGQA 2B83A 2ISCA 3CNOA 3O8QA 3H4IA 4FHFA 4ENWA 1T3LA 1QC5B 5A05A 5DTMA 5J4LA 3I45A 1CY8A 5TPWA 2P35A 4OXIA 4WNAA 1V1JA 3KDSE 3H1GA 4MKZA 2PL3A 2DHQA 2QJWA 1SA0A 2V45A 2YDYA 3PGMA 4YMTA 4BOYA 3CHYA 2J4CA 3L7IA 4R1MA 4X8MA 3GVPA 5L7TA 1O8CA 4DDVA 4WBNB 2CLSA 4F6CA 4LXYA 4EA8A 2B6NA 2H0QA 2H59A 1KNQA 3CLRC 1BX3A 3E3LA 1WB6A 3JR7A 5DZSA 1JSXA 1E6KA 1LA2A 3DHWC 3PC4A 4HWPA 1MAHA 4JT9A 4INOA 4AICA 1S89A 2AEEA 2GMWA 3DAYA 2R6GA 5COQA 4PIMA 4ECAA 1KOJA 3HU1A 4JBXA 4FFWA 1T8PA 1QZZA 2JD2A 2D13A 4LXIA 1CD5A 3AI1A 4MO2A 3CZ5A 5E6SB 4E09A 3I4LA 2O05A 4RAOA 3G0GA 4L8GA 1PW7A 1D1QA 5FADA 4W5QA 1GT6A 3ZVRA 3CX3A 3FWPA 3O3MB 1KEPA 1S9DA 1WHTB 5ENVA 4EYSA 4PNZA 4L73A 1FNNA 1E0DA 4UTOA 1EGAA 4P0PB 2F43A 3EARA 3FLAA 1OU0A 4X60A 5D00A 5BR7A 2AJTA 1O94D 1NUUA 3G5UA 4X45A 5EERA 4KIFA 4TTPA 1PK8A 4PO9A 1LBTA 3JAWB 1NW6A 2VHXA 3KELA 4HEA6 4IV8A 3RJ9A 3WGLA 4CV3A 4HH4A 4DUGA 3CPJB 1PSZA 5KSZA 1YD7A 1KO1A 1XJQA 2W6ID 3RK0A 1UM9B 4ER0A 4NJOA 2OCAA 1JU9A 1X94A 3MRXA 1DJOA 4ETNA 5EHQA 3PC6A 5HOQA 3MMNA 3VZRA 4UD6A 2ECFA 2PX5A 3K72B 4I6EA 4V0NA 1HBJA 1JGTA 5A2QA 4JLJA 4KYVA 2FQYA 3IQZA 3REFA 5ALXA 1E2FA 2NV6A 3PT9A 5AOBA 1G8GA 1PWEA 1FRFS 3E7FA 3TIFA 5JEDA 1P39A 3TFOA 3THXA 2F3RA 3WP1B 1PE0A 3OBIA 3RRMA 2ZUFA 4EO4A 4HZIA 4HFMA 1W36C 2H54A 3AUAA 2FAXA 2JA2A 3FOCA 3ESZA 4OMUA 5EL0A 2NM0A 3QOXA 3G88A 2NQ8A 3N75A 4CKZA 1ODIA 4NL4H 3A2KA 1HE8B 1CR6A 3OPYI 1V5GA 4DNFA 1NRXA 1YI8A 3C7TA 3NCTA 1W30A 1Y3CE 2WABA 2FZ4A 4M8SA 5IX8A 5G0SA 5HIKA 4B74A 3WRXC 4YUAA 2JEOA 1JPNA 2EX4A 4NYMR 2VJCA 3TTWA 3TEJA 5HKOA 1E99A 3GW8A 1ZL0A 4FBMA 1VDZA 4QSHA 2P6PA 3GH3A 4EMUA 3UB2A 2OENG 3KYCB 2IEBA 4I50B 4QTTB 3GLHE 4X1YB 4D80A 2WU0A 1FA9A 2P6MA 2DGDA 4F97A 3BH7A 4YDQA 3SR0A 3OM0A 2BAGA 4AN0A 5IDWA 5ADUS 2BFFA 3C6BA 1Q1GA 5K8IA 2R0QC 1ZMRA 5TVGA 2W48A 2WI8A 5IG2A 1IB6A 4B73A 3AP3A 1XCGB 2YZ7A 3OZXA 1FQOA 3RUPA 4D5EA 4TVBA 4BNHA 1LLCA 2PX2A 2Q3CA 3ET5A 4V2UA 5PNTA 3RUDA 3UBMA 2P9YA 3LUKA 2KBEA 2FRXA 4RHTA 3JQCA 4UUMA 3X2FA 1NAIA 5JS7A 1VP3A 2ZVQX 4HDMA 5DP1A 1AS2A 1HLDA 3SG0A 3TL3A 1NN3A 4C03A 2I76A 1OFUA 1YOBA 4K6HA 5F5XA 3ZNQA 1ENYA 3FIUA 3R76A 1OLSA 1DBRA 1FNDA 1HEIA 2ATIA 1CT9A 2HU8A 2YOGA 3A3NA 1FYFA 3GIWA 3IALA 3NIBA 4L3VA 4YLGA 3W8EA 3FZEA 5JSUA 3WRXA 4NCJA 5P8WA 3SF0A 2J3LA 4Q4HB 4GL2A 1D6NA 3ZU2A 4RTLA 2ADMA 1KKLA 3PC8A 1Y5LA 1FIUA 2RB5A 1W4RA 4L8FA 3VU1A 2A2ZA 1FYXA 4ZHQA 1WV0A 3GJ5A 5E6UB 4DLRA 2J0QA 4PC7A 4LWQA 3OCVA 1U7UA 5HUQA 1NRJB 1M74A 2PL9A 4GRDA 3KL4A 2FN7A 2Q4DA 4A0SA 2G3YA 4HH0A 5AIAA 4RKFA 2BY4A 4A36A 2J5QA 4D6PA 3VAZA 4KSYA 4PZCA 4R2LA 1GA6A 4ZOL