1PL7A

Human sorbitol dehydrogenase (apo)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
356
Chain Sequence
b'AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorbitol dehydrogenase
molecule tags Oxidoreductase
source organism Homo sapiens
publication title X-ray crystallographic and kinetic studies of human sorbitol dehydrogenase.
pubmed doi rcsb
total genus 120
structure length 356
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.14: L-iditol 2-dehydrogenase.
pdb deposition date 2003-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pl7A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1pl7A01
4JJGA 1V3VA 4YB8A 3L4BC 2HRBA 2NU7A 4NBVA 4RF2A 2V6FA 3C24A 1J6UA 4MIEA 4RQUA 3ZGYA 3C1TA 4DYDA 4QT0A 3LF1A 4ONEA 3VDRA 1DHRA 1XCBA 2NU6A 3WOHA 1EQ2A 4XGKA 3U4HA 1XQ6A 1KEPA 1I2BA 1FMCA 4E2ZA 4H3VA 1YJQA 2V6MA 5CG1A 1R16A 5L7TA 3GVXA 4IJUA 4FFLA 3L77A 3OJEA 3GG2A 5GZ1A 4HX5A 2AQIA 3DMTA 1N2SA 4GH5A 1R15A 1BGVA 4YVFA 1IHYA 3LT4A 5EIOA 4XX0A 5F3RA 2GERA 4E5PA 1KERA 3EVTA 4ITUA 3ZHBA 4ZICA 4P4GA 2I99A 1NPDA 5K1SA 1X1TA 1LLUA 4XYEA 4TMFA 1R4MA 3LT0A 4FJ1A 5COAA 3OH8A 1HE2A 4RF5A 1JWAB 3INTA 1QP8A 1KVSA 1X0VA 2GYYA 1K2WA 3KXDA 2UUPA 1GUZA 1QLHA 4ZQGA 4RVDA 3ZV3A 2D3TA 5F21A 4KQWA 4YJGB 5DOZA 3HDQA 3H7AA 1MXHA 1SOVA 5L95A 1CIVA 4BNWA 3JQAB 1E3IA 3VH2A 1ADBA 4YAKA 2GN8A 5I9NA 1UDCA 2EIHA 1K3TA 2C7VA 3CH6A 5BNIA 1GZ6A 3HB4X 3ZNOA 3Q9UA 3ZU4A 4L73A 1Y1PA 1DSSG 5U9CA 4M86A 3QW2A 1LBEA 5IXYA 2YV1A 1MV8A 5F1OA 2EKQA 2QG4A 4F46A 1B8PA 1XGKA 1IY8A 3GDGA 2EF1A 3GRPA 4P22A 1F8FA 3SBOA 4BMVA 3H3FA 4GX2A 2B4QA 4HNHA 4Z6KA 3GHYA 4FDAA 4RVHA 3C8MA 2O50A 2NSDA 3AUUA 1MA0A 3U4IA 2PGDA 3DZKA 1VL0A 1Q7CA 3ADOA 3KBOA 1ZW1A 1HZJA 3IOYA 3OIGA 1YBVA 1HDCA 3QVWA 1YB1A 4WLOA 4PGFA 4YJFA 4DC1A 1LRLA 1H5QA 1YL5A 4WLFA 1NAHA 3PDUA 4B8ZA 4ZQHA 1YVEI 1QORA 3H4VA 5CDYA 1XA0A 4BO6A 3RUHA 5I9LA 4BO5A 3BMQA 3BHIA 2R00C 4JJIA 4CR6A 4I08A 1YO6A 4PLHA 3ROQA 4E33A 1PEDA 1P33A 1R0SA 4YBZA 5BT9A 4F3YA 5JC8A 4MVJI 4M49A 4W9NA 2VUSA 4ZQFA 3GN1A 4ZD6A 1C1XA 2DTEA 3V2HA 3WSVA 2G0TA 3BMOB 4BKQA 2ZKLA 1GUFA 3RFVA 4CLHA 3GDOA 4DBVO 3NTQA 1B16A 1EUZA 1NFQA 1SCUA 1ISHA 1EVZA 3QVXA 4YPOA 4KTTE 5THQA 3AY7A 3TFOA 3L4SO 4RPKA 2YHUA 1UZLA 5HBRA 4GWGA 4UVIA 3O9ZA 5DULA 5JY6A 1UH5A 2ZB3A 3B1JA 4OJNA 3QRWA 4JBHA 5TLSA 5DP1A 2Y67A 4EEZA 4QSMA 4AJ2A 4BNHA 4M89A 1P3DA 1T2CA 2FMUA 4O6VA 4JN6B 3C3XA 4FN4A 4YDRA 3X2EA 1EQUA 1I30A 4PG4A 3V2UA 3WX0A 4TRNA 1NVGA 4OH1A 2OMEA 5EQDA 2NNLD 3TWOA 4E2WA 4BO2A 3F47A 1PGJA 4YRBA 4DC0A 3MOIA 2RBEA 2QW8A 4UREA 4S3MA 1U8XX 3W8EA 3VC7A 1VL6A 2FR1A 5TX7A 3VPHA 2IXAA 1BMDA 3AUTA 3ZWAA 4ESOA 2VTDA 3HSKA 4UUPA 2VWHA 3WGYA 3Q9NA 3GGOA 3PHJA 2O4UX 2UDPA 1E3JA 1NX6A 2W2KB 3AU8A 2FPGA 2HJSA 1YBMA 3HFSA 4J6FA 3UKOA 4D79A 4E21A 2EG9A 1OBFO 1OOEA 3B70A 5L7YA 2FPPA 4PG5A 2Y99A 2X0JA 4KUGA 1LQUA 1QV6A 3WGQA 1I3MA 1OI7A 2W4QA 1BG6A 2VNSA 4XDYA 4UEKA 5GY7A 3OEYA 2XXBA 3DZJA 4KWIA 4OMUA 1PZGA 5IG2A 2DAPA 1C1DB 3EDMA 3EGOA 3R3SA 4R9SA 1WVGA 1E5QA 4BKPA 5A02A 4XKJA 4BNNA 4B4VA 1OC2A 4S1VA 2RH4A 3RI3A 1D4FA 4XA8A 3PYMA 3WLEA 3HN7A 1C0PA 2Q45A 2FWMX 1E7YA 1EFLA 1GYQA 3KYBA 3V1TC 6LDHA 4YA6A 1UDAA 4OGWA 3BYZA 1PS8A 1C0LA 3UCFA 5ILOA 4DPMA 1DIAA 2YV3A 3WGIA 1Z7EA 3L4BA 3UICA 1DRUA 2DPHA 3O26A 3ORFA 1C3VA 2AEMA 3MJSA 4RZHA 1ULSA 3CE6A 4NH4A 5TGDA 2AHRA 3KVOA 3WGGA 4CQLB 3ZI0A 4O5OA 3VH4A 3RROA 4DBZA 3F5SA 3I4FA 1Q1NA 5B4UA 4K1LA 4RVFA 4IS3A 5GMOA 3OP4A 4H15A 1UXHA 3ANNA 3OIDA 1E3WB 3HQ4O 4I5EA 4Z3KA 2OO5A 5ILGA 3K96A 2C20A 1J0XO 3GH3A 3NUGA 1U2GA 3JQGB 1LRJA 2X4GA 3JQ9C 1B3BA 3JQEA 2PTGA 1VSVA 3D64A 4HP8A 4AJHA 3QVOA 4CM4B 3CKYA 3JYNA 4G2NA 4PLYA 2Y93A 4U0JA 1E1LA 4L0QA 1P1KA 1WPQA 2ZQYA 3WBFA 3RFXA 2P9CA 1X7HA 4M54A 3GT0A 1I10A 5HA5A 4F6CA 2VUTA 4YJHA 1JAYA 1K5HA 5G2OA 3RUEA 1VKNA 4OXYA 2X6TA 3NAQA 4BGEA 4WCFC 2WE7A 3D0OA 1ISJA 1M67A 2E82A 1RWBA 3M2PA 4Z9FA 2Q1UA 4QFCA 2FY8A 3JD2A 3ZCXA 4J7UA 3U09A 2RHCA 1Q2XA 4W7IA 3NT2A 3N74A 2G17A 4LISA 4ZRNA 1I2CA 5LDHA 4MKRA 3U4CA 1EUDA 1DFGA 2Q1SA 4J1NA 4YAJA 3D3WA 1VRWA 5I8ZA 3WR5A 3I1JA 1DJQA 1U8FO 2WMDA 4IDBA 4KUHA 3H65A 1UR5A 3JQ8B 3PZBA 3AK4A 4BNXA 3WYBA 1NWCA 4BKRA 4DIBA 1MX3A 4A73A 4K28A 3OBBA 2YHIA 1Z45A 3Q6IA 4BO0A 4E13A 2NU8A 5L4SA 2V7PA 1EBFA 3ZWCA 2AQHA 1U3VA 3GR6A 3H9QA 2RHRA 3FBGA 3A06A 1LJ8A 4LSMA 5AYVA 4HFMA 1MXFA 3TL3A 3TQHA 3OQ6A 2UVDA 4QTZA 1NYTA 2EP7A 1YOVB 4RPGA 4CMCA 1ID1A 3M1AA 3DAFA 3LU1A 3F1KA 1DAOA 2PNFA 3G1UA 3HNPA 5IN5A 5DBIA 4N54A 2OBYA 5CDUA 3KETA 2QRJA 4RVSA 4PLCA 5TT1A 3VKUA 3AU9A 1S6YA 4Q3NA 1V3TA 2XF8A 3BMNB 3DO5A 4D0RA 4ZGWA 3V2GA 3RC7A 4PLGA 3PQDA 1C14A 4QEDA 5DOVA 2C0CA 1GR0A 5L40A 1EK6A 1VC2A 2OP0A 4ND1A 1E1NA 2NVBA 3BIOA 5JO9A 1GQQA 5JDIA 3WTCA 4II3A 2QYSA 3W1VA 2AEFA 4NMHA 4YT2A 3RUAA 3EK2A 2NTNA 3WG9A 3V8BA 5FWNA 2I6TA 2VHYA 4GX5A 2PKRA 5G4KA 2GD1O 2HMUA 2Z1NA 4XGIA 4CMGA 5L3ZA 4A03A 1FJHA 4AJJA 4WJZA 5A9RA 3MOGA 3HADA 1E7WA 3MJTA 4ZQBA 2GPTA 1PZEA 3OIFA 4GI2A 3GUCA 3RWBA 4ALLA 1H93A 1XKQA 2VTEA 3ASUA 1CQIA 3ZDFA 1CF2O 2C07A 5TC4A 2Z95A 1XSEA 3PFFA 4BGUA 1O94A 3ZWMA 5CAEA 2H1SA 1V35A 4Y9DA 1E7SA 1U9JA 5T8KC 3Q11A 3JQFA 5U4QA 2P91A 3OFSA 4FFRA 3JQAA 2A92A 2NV6A 3WQRA 1I24A 2PD4A 2D8AA 5JXWA 1DFHA 3ZWWA 4XQCA 4HADA 4BL5A 1EBUA 2H6EA 1Q0HA 3HDYA 1JVBA 1X14A 3R3JA 4ALNA 1IULA 4R1NA 1HXHA 3ABIA 3TL2A 4ALIA 3ZU5A 4CUJA 5AXCA 4CL8A 4HBGA 4GBJA 1NAIA 3KLMX 4DQVA 3COSA 3F1LA 1ZJZA 3DBLB 4KMSA 3C1AA 3FPLA 1KS9A 1JN0A 3F5QA 5ER9A 3DTYA 2J8ZA 4XQ9A 5A9TA 1HE3A 3GC6A 4CUKA 4EUFA 1UXJA 2PZMA 3I6QA 3OEWA 1HYEA 3RUDA 3ZNNA 1N9GA 5ADHA 2QQ5A 2X0IA 2F00A 2Q4EA 3QE3A 1Y8RB 2O2YA 3DZFA 2EW2A 2PD3A 3CMCO 4EW6A 4Z0HO 4BO4A 3LF2A 4C4OA 1Y8QB 4FPXA 1PGOA 2AE2A 3PDJA 4PG6A 5TRTA 3LLVA 4E2YA 1HLDA 3KM0A 2FSSA 4MKZA 4PRLA 4WKGA 3WYCA 4UUMA 3F4BA 3GNTA 4TKLA 3U5TA 2HRZA 4UEOA 1GCUA 1U3UA 1XEAA 3WMXA 4FJ0A 2X5OA 2A9FA 3QV1A 3UVEA 4Z3DA 2BI7A 3ZWBA 4DYVA 1ULUA 3GVIA 4FJ2A 1T24A 1T2DA 1SBYA 1U7TA 5I7VA 2GZ1A 3R0IA 3ASVA 3QP9A 3WFJA 2BH9A 1GQYA 5B37A 4ZRMA 4CM8A 3MCVA 1T2AA 2CUKA 4ND3A 1GV1A 4ZQEA 1ZZEA 4OQYA 2WYUA 4YT8A 3AFMA 1IZ0A 1R4MB 5TS3A 4IUYA 4NIMA 1AUPA 1TT5B 3UH1A 3GPDG 1NXQA 1ZFNA 2A4KA 2J3KA 3CTMA 1U4SA 7ADHA 2ZYGA 4CLOA 4W4TA 2ZJ1A 1JQBA 2AXQA 4XYMA 4B7UA 4XB2A 3ITKA 4BO9A 4PRKA 4J3FA 2YDYA 5IDYA 4N5MA 2J3HA 3WGTA 3DAGA 3JSAA 3ZV5A 2OL4A 3FI9A 1MC4A 1LLCA 4CLOB 4E0BA 5KJCA 2JKVA 4YTEA 4CLRA 3JQ9A 4ILKA 4ALJA 1AHIA 3QHAA 4MIYA 1I0ZA 1WAMA 5MGBA 3NKLA 4HY3A 4PVCA 3JQ7B 4FOOA 1YB5A 1FXSA 1O95A 4CMKA 1NQAO 4IDGA 3SVTA 3RUCA 2HLPA 2C5EA 3EMKA 4YAGA 4CL3A 1KETA 2GDZA 2P4QA 2O3TA 2ZATA 3ONEA 1LTHR 4RV9A 1CERA 4XJTA 4NFSA 5JPIA 1SEVA 3JQDA 2NLOA 4BNMA 1CDOA 2YV2A 1ENOA 3V1UA 3WSWA 4WLVA 2UAGA 4B7CA 1PR9A 2P9GA 4BNJA 1LRKA 3JCZA 4UVHA 2BD0A 1BTOA 1ISFA 4WEQA 3R1IA 4N7RA 4C7KA 1UDBA 2PV7A 3PK0A 4EGFA 4K26A 1E6EA 4QECA 2IODA 3FCOA 1K6XA 2Y1EA 3EC7A 4NDNE 1PL7A 2QRKA 2JD2A 2V6BA 2X23A 3RSHA 4F45A 2RH8A 1B7GO 3OA2A 4K9DA 4CQMA 2DBVO 1HSZA 1A71A 5BQFA 5KVCA 3B6ZA 1ZH8A 4D3SA 3CUKA 3VVCA 4YAIA 5A3JA 1HDOA 4GX1A 1ZO8A 1LDEA 2DU8A 4EZBA 4DMMA 4IMPA 4RLSA 4L76A 3S2FA 3P19A 3VH1A 3N7UA 3KB6A 4IJKA 4MO2A 3IUPA 3IP3A 1FDUA 3TZCA 1CEQA 4WK6A 3RKUA 4BO7A 5BSHA 1PQUA 4QX6A 3CZRA 4EBFA 3B1FA 1BXGB 4AJIA 1TVEA 2AA3A 4YACA 4E5MA 4FSHA 1KVUA 2Y0CA 4OAQA 3HDJA 3PQFA 3SXPA 1Q0LA 3GDFA 2CFCA 1U1IA 3PQEA 3DQPA 3DOOA 1HF3A 3PJFA 3UCXA 2OHXA 3FN4A 2O2SA 2HAEA 2X5JO 4P4LA 5JDIC 3VH3A 3TF5A 1CETA 5LDGA 2Q2VA 2D1YA 1E77A 1XHLA 2OXIA 1ORRA 1HTBA 1Z73A 4LN1A 3DL2A 2I3AA 5T8KA 4D41A 1CJCA 1PJ3A 3DHEA 1UZNA 4JNKA 1T2EA 1HKUA 3GEGA 4CV0A 3CEAA 5EESA 4O0LA 4MVJF 2B36A 3BMCB 1IUKA 3WMWA 2Q50A 1UAGA 2J6IA 4QQRA 5BNTA 1NR1A 1HE4A 4XIJA 1ZJYA 2B83A 3PHHA 3R6DA 3I9NA 3P5SA 3UN1A 1DC3A 2WYWA 1ADCA 2BF7A 4ND4A 1ENPA 5ENVA 4CMEA 4Z0TA 2CF5A 2HK7A 3D7LA 1FK8A 4MIOA 3IC5A 3GFGA 3MJ4A 5THKA 1XU9A 2DBQA 2VYVD 3ZU3A 3I9JA 1YE3A 5JW6A 4UAGA 2YYYA 3S2IA 5I8WA 1ZSNA 3D5TA 5IDWA 3IUSA 3IIEA 1Q7GA 4GLLA 3E1KA 1HE5A 1TB4A 4MP6A 5A05A 5C5IA 1C1DA 3PHLA 2YW9A 3JYLA 2BELA 1MGOA 2FZWA 3PI7A 3RBZA 4J4TA 3TDKA 2NUAA 2UUOA 1GUYA 1Z82A 3FF4A 4MJLA 4IINA 4WECA 4WLNA 3GNSA 5I7SA 1A7AA 4RQTA 3MZ0A 1Y5MA 5G0WA 2QZZA 4DVJA 3FRJA 4L8VA 4EUHA 5L45A 2JD1A 1ZK0A 3DHNA 3FNFA 2I76A 5JSFA 4FS3A 3ENNA 2JFHA 2YQ4A 2B35A 4E4YA 4GL4A 3H5RA 2GCGA 3L9XA 1H6AA 1NWHA 1PJTA 3H8VA 2HMVA 4ZJUA 3EY4A 5ICSA 4B4OA 2NTJA 1WDKA 3HHPA 1YS4A 3E5MA 4YWJA 3DDNA 3L07A 3FNHA 4JROA 5B4VA 2XOXA 2BFMA 5EMHA 5JYEA 1VSUA 4G5HA 4NBRA 5A5FA 4W99A 3VZRA 4A10A 1D8AA 3CIFA 2X9GA 1B26A 3WQQA 1DLJA 1R4NB 4A5OA 4RDHA 2VT3A 3L6OO 1DHTA 2ZB8A 1PR3A 3PWKA 3ZW9A 2WE8A 1ZK1A 2W2LD 1U4OA 4CM7A 4E5KA 1H0KA 4GGPA 5K0ZA 5L7WA 4GQAA 3QJ5A 2AQ8A 2WDZA 3HJAA 4TZKA 3K73O 2B5VA 1J49A 1U2DA 3K31A 2E49A 4RPJA 5T6BA 2VHZA 5IZCC 2JFFA 2X86A 2BGKA 3O8QA 2POQX 3NDJA 3DB2A 5JLAA 5KTKA 4R1TA 1Y5RA 2BGMA 1AGNA 5BSEA 2ZYDA 4AJNA 3LQFA 4EEXA 1H6CA 1N1GA 3QLJA 4HWKA 3JQ6A 1I32A 2BI8A 3ST7A 4RO0A 1QLJA 3G3EA 4EJ6A 5KNLA 5HWSA 4WPGA 3GOHA 1DC6A 3KO8A 2ZTMA 2JFGA 4PG8A 3BMOA 2GN6A 1PJ4A 4J1SA 5JS6A 1IPEA 4AJLA 5F1PA 2BMAA 1GCOA 3NV9A 4J1TA 1UXKA 4HFRA 1ONNA 1ZMOA 4JXKA 3MTJA 5GZ6A 4AJ4A 1K89A 2WWRA 3M1LA 4LGVA 1KY5A 3S55A 4XB1A 1MFZA 2IXBA 1R66A 2ZK7A 3IMFA 2D59A 3L6EA 3PJGA 3GGPA 3ICPA 4RF4A 4UUOA 1PJ2A 4BO1A 3AI1A 4J7CA 1E5LA 5JBIA 4OM8A 1DIBA 1P0CA 2PKQO 3VTZA 3AI3A 1GEEA 3AW9A 4DIFA 4TSKA 5C3MA 3EZLA 3VPXA 1V0JA 3LT2A 2FN7A 4FGSA 2V65A 3WNVA 5AVOA 2C59A 1N7HA 4DPLA 5DZSA 1ZBQA 4YT5A 4IPTA 4BB5A 1ISIA 5C7LO 1YL6A 3QY9A 4FFOA 3FTPA 2YQ5A 3D3WB 4XEHA 4A2CA 3W8DA 3A9WA 4NBUA 4ZU3A 2R6JA 3K6JA 1KEUA 3Q0EA 4WLUA 4O1MA 4XQGA 3M2TA 2Y1GA 4Z9XA 4B79A 2ZTLA 4DLAA 4D42A 4NI5A 2VRCD 3DONA 4WNIA 3VDQA 4IDCA 1EFKA 4CV1A 2JD0A 3NJ8A 1M2WA 4YAEA 1W4ZA 3KSUA 4DL9A 1ONPA 3KEQA 1VI2A 5L4LA 1RPNA 2JHFA 5ES3A 4QFDA 3TZKA 1JWBB 1GYRA 3OJ0A 2X0RA 3LC2O 3HZZA 3JYPA 2G82A 3HB5X 1DB3A 1QG6A 3KHUA 4CUZA 3F46A 4Q3DA 3RFTA 5BSGA 2H5LA 2OP1A 2Q4BA 3C1OA 5KKAA 1M76A 2J3JA 3EVNA 3WGZA 4FGWA 5KJ1A 1YH3A 1K6IA 4E30A 5B1YA 4PG7A 1J5PA 2ILTA 2VCYA 4RGBA 1QMGA 1UXIA 1CRWG 2DM6A 3WQSB 3L0DA 1PGQA 3HFGA 4LRTB 4P8RA 4Q3CA 4IGFA 2W2LA 3ZWNA 4ZN6A 4JK3A 3VHRA 5KJFA 3FD8A 3U4DA 2D5AA 4WCDA 3WWZA 5FEUA 2EEZA 4BHTA 1P44A 4KTVE 2VWPA 4FB5A 4K6CA 4BNZA 2TMGA 2VHVA 1EEHA 1EK5A 4AFNA 2GNAA 3H5NA 2ET6A 4II2A 5I7FA 3ZW8A 1Q7BA 5H83A 2D5CA 2OBNA 3ONFA 4HUJA 4MVJA 1XQ1A 3VAZA 5L51A 1P1HA 1X7GA 3RJ9A 4DWVA 2B0JA 1LXCA 2UYYA 3SEFA 3DWFA 1XU7A 5JCXA 2ZTUA 1W8DA 1HETA 3ROPA 3U3XA 5L9AA 3WGHA 3PWZA 3E03A 5KOIA 2LDXA 3SJUA 3ONDA 2VWQA 4R51A 3OA0A 1O0SA 1EE9A 4H7PA 4I5DA 3OM9A 2BFPA 1MG5A 2XXJA 1RM5A 3AFNA 4YJHB 1ENYA 3RASA 3RIHA 4TQGA 2VZ9A 3PXXA 4L4RA 1JTVA 1ZSVA 3M6IA 3KYCA 3ZWPA 2DPGA 2QIOA 2DQ4A 3TOZA 2FOIA 3W4JA 5CG2A 3LVFO 3OF2A 3TPCA 1KEWA 2WSBA 3MTGA 2F1KA 5CPBA 3HUDA 3PJDA 3QWHA 4GPD1 3RCBA 1VE9A 2B4TO 2BFAA 3NX4A 2JCVA 2E37A 3PYLA 4DQXA 3TJRA 1RKXA 3PWSA 3D4NA 1F17A 3E18A 5ER6A 4FR5A 4IS2A 5B12A 1TEHA 1DO8A 1LQTA 5JCJD 4IDAA 4XD2A 1SMKA 3IS3A 3ZNPA 1HWYA 1N9GB 4Z0PA 1PJLA 3DZGA 2DUUA 3P7MA 5DN9A 3ZWVA 3DBRB 4LMRA 2FZEA 1DIHA 1Y7TA 3HG7A 2BRUA 3LZ6A 3VPSA 1B0AA 1IOLA 3AUSA 1YGYA 1Y81A 3OQ1A 3PLNA 4J0FA 3KYDA 4CM3A 1W73A 4YEDA 2VYVA 1WZIA 2E6UX 1JVSA 1SOWA 5DBFA 2HDHA 3HDHA 2AE1A 3FWNA 4B3JA 4FIZA 1HDYA 1XELA 4YQZA 4CMBA 1ZIDA 1UZMA 2O3RA 2PGLA 2QHXA 3GRKA 2HO5A 1GY8A 1NFFA 2DC1A 3RAJA 2JJYA 4LVUA 1X7DA 3TOXA 3DMTC 3AI2A 4JBGA 1X15A 1N1EA 2HU2A 3C7CB 4W7HA 1X13A 4NBTA 1E6WA 2DFDA 1VLLA 4JBIA 3F9IA 2FP4A 4EI2A 4R3WA 4RLHA 2P4HX 3ZNQA 1RYEA 1BXGA 2R2GA 3PJEA 1GEGA 1YL7A 2V6GA 4NPCA 3VZQA 1ZXLA 4L74A 2ZB7A 4INAA 2I3GA 4OYRA 2CDCA 1HDXA 4WCFB 2NU9A 1KYQA 4GX0A 4JCOA 2RAFA 1RM4A 4OXNA 3FSRA 4Y8VA 1ZK2A 1JKFA 2NADA 4R1SA 4YRAA 4BNFA 5EJ2A 4RVGA 3DXFA 4AG3A 5F1KA 2GN4A 3LYLA 4U5QA 1C0IA 2ZJ0A 1EVIA 1SPXA 4FBGA 1M75A 5EL0A 1NQTA 3ZN2A 1P1RA 4BNVA 1B8UA 4J16A 3EZYA 2C54A 2PLAA 2PH3A 3RJ5A 1AN9A 4CM6A 1ZVMA 4B8WA 5HS6A 4LSWA 3WYEA 4U0KA 1E3WA 1BDMA 1LDNA 4D7AA 2GZ3A 2YFHA 3JD3A 3T7CA 4E32A 1FDVA 5DT9A 1E92A 1NASA 1IZ9A 5LC1A 1TI7A 2TMDA 3E9QA 1YWGO 2H63A 4HKTA 1D1SA 4MVJP 3O03A 1H6BA 2W98A 3KYCB 1P45A 1JW9B 2R00A 3S2GA 3SLKA 5IAAA 4BGVA 2PZKA 3RBVA 5CEJA 1V3UA 1HYHA 3JQAD 4YYZA 2J5RA 4PZCA 1P74A 3F3SA 4GKBA 4Q3AA 3UW3A 3WJAA 5AOVA 4NNJA 4BNIA 4K6FA 5TF4A 1XYGA 5CEEA 1NTOA 4I8XA 3UAGA 6ADHA 2OOSA 1BRMA 4WUVA 4FQ8A 4RCVA 1E1MA 1F06A 4R54A 1T2FA 1F12A 1NM5A 4BNTA 4J9UE 1MB4A 4PIVA 3A14A 1VM6A 3UFXA 4IIUA 5CDTA 1I3LA 1MLDA 2DTDA 1ZK3A 1CWUA 1ZNQO 4LCEA 3IQDB 3AY3A 3GK3A 1Y8RA 4TVOA 5KVSA 4UULA 4CLRB 4XDZA 3ZH2A 2G5CA 1XR3A 3C7DB 4R69A 1WP4A 3QIVA 3GHHA 5TJHA 3IJRA 1EDOA 4AJOA 3Q2KA 3VKVA 2CDAA 3AWDA 3GZNA 4NZ9A 4Z9YA 1DRWA 3AM3A 5K6AA 3FWZA 2YDXA 3GAZA 1LDMA 1PGPA 2VHXA 3DZIA 3GG9A 4J49A 1FDTA 3AOEC 3MEQA 1XIVA 3ZV4A 3VPGA 3TNLA 1B3RA 5G4KB 5C37A 3UUWA 3OJOA 1E6UA 4WNCA 5HS4A 2XAAA 4BGIA 3EYWA 3KYDB 4IDEA 2CVOA 2EGHA 1I36A 2A35A 3KUXA 3BTOA 4CM9A 5EINA 3I83A 4ND5A 4JP3A 3LDHA 1WDLA 1P0FA 2UV8A 1E7QA 2P9EA 4XRGA 2SCUA 3LK7A 1R12A 4RVUA 3H9UA 1NPYA 1LX6A 1PJSA 4BKUA 1T26A 3DZHA 1NQ5A 4EJ0A 3KZVA 4PCVA 1OC4A 3DR3A 4Q39A 4Q3EA 2Z1MA 4B7XA 2BFOA 3IJPA 2PFGA 1LDGA 1R4NA 4GLOA 5TT0A 4C7JA 2VNAA 4M87A 4R41A 3SX2A 3OETA 2BKAA 2X7HA 1AHHA 3O8QB 4PLZA 3G0OA 4D43A 2IDZA 1YQXA 3TN7A 5JC1A 5C7IO 3UOGA 1KIFA 1ZUD1 2HK9A 2CNBA 4CMJA 5JAMA 3QWFA 4JGBA 3PVZA 3U49A 1ISGA 1LUAA 2B4RO 5IF3A 3Q1LA 5JCJA 1T4DA 1W6UA 2ZB4A 5H81A 5A04A 2O23A 4B3IA 1PTJA 3N58A 4ALMA 2AEJA 3DOJA 4UVDA 3GVPA 3GFBA 1JKJA 5DF1A 1DDOA 1BVRA 3D1LA 3TSCA 1A7KA 2YHIB 5FI5A 1NQOA 5JNLA 1WDMA 3CZMA 3UXYA 1MUUA 1UP7A 3QSGA 2NM0A 3TZ6A 2WD8A 4NFHA 1V8BA 4RPHA 2X9VA 4BNLA 3CSDA 2YZ7A 1YXMA 3IAHA 4PLFA 4OL9A 1SNYA 4BQPA 4ROSA 5DP2A 3A28A 1IB6A 4CM8B 1PWZA 2IRWA 3W8FA 4QO8A 3K2BA 3ZV6A 4LW8A 1YOVA 4WLEA 5JE8A 4UUNA 1E7MA 4MINA 3FTNA 1AE1A 5CDGA 2JHGA 4AJEA 4XWYA 3DHYA 2IE0A 1PJQA 5IN4A 3DEYX 2OZPA 1PZHA 5EPOA 3K30A 4OQZA 4FFNA 3X2FA 3GGGA 1PX0A 1Z74A 4AJPA 1YONA 4D45A 1OZAA 3GMSA 5A4DA 5EQFA 2O4CA 4CMHA 4J2HA 4EJMA 3RQSA 1B2LA 3LC7O 2GF2A 4NHEA 1IE3A 2BLLA 3C85A 1QKIA 3ANLA 4PZDA 4P38A 4B4UA 1WZEA 3PP8A 2ZCUA 3DMYA 3INGA 5I9MA 3OECA 1GAEO 3GF4A 4FC7A 3ZWXA 2I67A 1EDZA 4JLWA 4M8SA 9LDBA 4CM9D 1JU9A 2OGUA 2EERA 3TZQA 1WLYA 4L4XA 2GZ2A 4ND2A 5I7EA 3ZHYA 3OMLA 5DDIP 1VL8A 3GEDA 3I23A 4HFNA 4IZIA 4CMAA 1PU2A 2VT2A 1HT0A 3WJ7A 3GAFA 3BHMA 1JAXA 3BMNA 3PTZA 2GN9A 3MWDB 3PFWO 1R37A 1LLQA 1B15A 2X58A 3BTVA 4WCFA 1UAYA 1HDZA 1EZ4A 4KOAA 3JTMA 4EYEA 4E5YA 2GGSA 3Q2IA 4ZHSA 1LNQA 1RYDA 3MJEA 5TJ9A 5KCZA 1GPJA 5HRUA 3RU9A 3S1LA 4YR9A 2EV9A 4JJFA 4XQEA 1HDRA 4KP7A 4BB6A 1U5CA 1DJNA 2VRCA 3SJ7A 3GNQA 5DCWA 3QQPA 4MOWA 4MP3A 4P4NA 3E82A 3ULKA 4PLTA 4DLBA 2Q1WA 4RF3A 2B5WA 4XR4A 5AQ1A 2Y1DA 1ARZA 4I9NA 4M55A 4WE3A 5CFZA 4J7XA 4IJVA 1TT5A 3TFQA 1OMOA 1P31A 2VYNA 5HM8A 4Q3BA 1TLTA 4CM4A 4IXTA 2WD7B 2VOEA 4NU6A 2O7QA 4A26A 3C7AA 5FYDA 1NPTO 3LC1O 4IXWA 2HMWA 3D5QA 3A4VA 1R0KA 4LCJA 4BO3A 1Q0QA 2D0IA 5BSFA 1A4UA 1SC6A 2AQKA 1I3NA 4FD3A 3TZHA 4I5FA 3INRA 1ISMA 4IQ0A 1V6AA 1QSGA 1F8GA 3PIDA 4IQGA 5CEFA 3CPSA 3NTRA 1KBZA 2DFVA 2JCXA 2VZ8A 5G0SA 3BXXA 4TRRA 4YCAA 1DXYA 3JQ7A 1KY4A 3K9QO 4MVJE 5K6AC 2O7SA 4O63O 2PZJA 5F5LA 1IYZA 3PIIA 1E3SA 1O8CA 4L75A 4J1QA 4AJKA 3NEPX 2AW5A 2VUUA 4XYBA 4YQYA 3NJ4A 5GZ3A 3CXRA 4R68A 4ZVVA 4L9RA 4IDDA 3BMCA 2OUIA 4G65A 3SC6A 1EMDA 2YFQA 3V5NA 4IGEA 5CHEA 2AMFA 5FI3A 1FDWA 3GZ4A 1P1IA 4GAEA 4RJTA 1LC0A 1LSJA 1VJTA 4ZA2A 5A9SB 1HL3A 2Y1CA 4W82A 2W90A 3K5PA 3ETEA 4NQZA 3JD4A 4GSLA 3UCEA 4TVBA 1NNUA 3O38A 1I8TA 2CVZA 3I9LA 5J23A 2DUWA 3ZWYA 3PRJA 2JAHA 1YKFA 1XWFA 2WJPA 3U9LA 3JYQA 1NHGA 2WM3A 4KZPA 2X8LA 4GMGA 4UVEA 3NGLA 3JQFC 3CMMA 3KOUA 1ZKMA 2WD7A 1L1FA 5IZ4A 2DBZA 3GA0A 2JCYA 4OIMA 1B14A 4NJOA 5G0VA 4R16A 3BMQB 3LT1A 5JYDA 1HZZA 2GRAA 1BW9B 2I66A 3PLRA 1GADO 4R1UA 3T4XA 5IFLA 1P1FA 8LDHA 4J43A 1LDYA 5CPFA 1JDJA 1JA9A 4PFJA 1ONOA 4AJ1A 1SO8A 4OO3A 1J4AA 1M6WA 4Y67A 2J5KA 4NU5A 1A9ZA 1JKIA 4RORA 4OSPA 3RVDA 4JX8A 1LDBA 1ADGA 3O4RA 4IDFA 3DFUA 4OXKA 3W6UA 1C1XB 2HJRA 2YY7A 2Q2WA 4BMSA 1W0CA 2C29D 4BKOA 2NTVA 4CR7A 4BVAA 3K92A 2Q2QA 1C0KA 4MVJM 3U0BA 1A4IA 1EVJA 2O3JA 3DBRA 1U3WA 3D3EA 4G81A 1E3EA 1GL3A 1G1AA 1ZCJA 5TQVA 2QYTA 3FR7A 3HN2A 2O3UA 1H2BA 3FNEA 1U7HA 3G49A 4YT4A 1QYDA 4MVJH 5CP8A 4XYLA 2Q99A 5DNAA 3DBLA 2I9PA 3E6AA 1P77A 1R0LA 3I3OA 4OKNA 1HSOA 2FRDA 3BA1A 1T25A 3I9MA 1DBVO 1HEUA 4YRDA 5T64A 4WGGA 1PZFA 1YBAA 4FOSA 3HWRA 1DFIA 2IZZA 3JD0A 1WWKA 2ZYAA 2C82A 3WIDA 4D0SA 2DVMA 3H2ZA 1H9BA 3BHJA 4E31A 5T67A 4PVDA 1LSUA 2Y0DA 4IBOA 5JDCC 1QYVA 1GV0A 1KEVA 3IDSA 4RL6A 1EE2A 3STHA 4FC6A 1BW9A 2HMTA 3BTUA 5JAQA 3ON5A 4CM1A 3PGXA 1PQWA 4JIGA 2VWGA 1AXGA 4KUEA 2EXXA 3U62A 4W6ZA 1GD1O 9LDTA 2ZCVA 2I65A 3WBBA 1F14A 2NQTA 4GGOA 1VJ0A 1Y8QA 1DIRA 1SB9A 1BXZA 1XG5A 1ZEJA 3GMDA 4R5MA 3WFIA 3GPIA 5DCUA 2Q46A 1KVRA 2Y1FA 3JQGA 1I2ZA 4WASA 1Y9AA 5G4LA 4NJMB 3W4IA 3IL2A 1UP6A 3F4LA 4X54A 2D4AA 3PHIA 1G0NA 4WOKA 3OQBA 1HRDA 4N5LA 3WXBA 3ICCA 1LU9A 3H5AA 1Z7BA 4MKXA 2P5UA 3ANMA 2VRBA 4HNGA 1E3LA 2Z5LA 3QA9A 4PZEA 3WDSA 2OORA 3PGJA 1BWSA 2FR8A 2X9NA 1NP3A 3KRTA 4WEOA 1CQJA 1LSOA 4HFJA 4RZIA 4BIIA 4CV3A 3E9MA 2GUGA 4J9VA 2DKNA 3MJVA 3RU7A 3DBHA 3RD5A 3KV3O 2C2YA 3W6ZA 2E48A 4Y6SA 4NG5A 1FDSA 2CZCA 4E5NA 1OAAA 3AM4A 1VKOA 4I5GA 3NTOA 2D2IA 3CINA 1PS9A 2EHDA 3HE3A 5AXBA 1QYCA 1EUCA 4DIOA 3FNGA 4XR9A 4CQLA 3BAZA 2NVUA 4H16A 2QRLA 5B4TA 4J91A 3ENKA 1RM3A 1N8KA 4MDHA 1KVTA 3BZUA 3OICA 4GVLA 5A1TA 1VJ1A 4WOJA 4TKMA 2E4AA 3EW7A 1DRVA 1PJBA 1LA2A 1L7DA 2I5PO 3G79A 1D7OA 2FPIA 2IZ1A 1H6DA 3I5MA 4QXMA 4OOFA 1WMBA 3I9OA 3GLQA 3VZPA 3D4OA 4TRJA 5F5NA 1TT7A 5JY1A 1XDWA 4XCVA 4KDEA 5TIIA 4MP8A 1DPGA 1MFPA 2P5YA 3E5RA 3FPCA 4TRMA 1DLIA 3G17A 4M1QA 5FF9A 2YJZA 1NFRA 4XRRA 3JQBC 4BNYA 1H2HA 2VOJA 1UP4A 1WW8A 2CSUA 2FSVA 4TWRA 3NDRA 1YQGA 4R3NA 4PLWA 4DQUA 4XGNA 5TNXA 1GZ4A 1RJWA 1DC5A 1KC1A 3QWBA 3E8XA 1OFGA 1P1JA 3PYXA 3S2EA 1N5DA 3VTFA 1KVQA 4IZHA 1EVYA 3WTBA 1BSVA 1IPFA 3RKRA 4CR8A 1ZSYA 4OOEA 4U6SA 1I3KA 2VQ3A 5DBGA 2DBRA 1LEHA 3AOEA 2ZTVA 4Y6RA 4FCCA 5L53A 3I4CA 2PK3A 4I9HA 4LRSB 4CMEC 4GSKA 4DMLA 1R6DA 3WS7A 3UF0A 1Z6ZA 1SAYA 1A5ZA 2GLXA 2BHLA 1WXDA 2JL1A 1PS0A 2PA3A 1IHXA 2RIRA 4CLXA 4RDIA 4CPDA 1PSDA 3ITDA 2RCYA 1NR7A 2VZ0A 4KQXA 4J4BA 5K9ZA 2QZ9A 4XYGA 2A94A 4BOYA 3G1TA 4YJFB 5JMWA 4NK4A 4DXHA 4B4WA 2IEBA 1CYDA 4YJDA 3B1KA 2CVQA 1GQ2A 4NJMA 4LMPA 2Q49A 2QX7A 2NVUB 1PL8A 1YDEA 3FHLA 4J0EA 1GTMA 5ICMA 2IZ0A 1N92A 1Y6JA 1ZXBA 3GVHA 1FF9A 4BNKA 4NK5A 5IJZA 3T7EA 5MDHA 4CMIB 2PGJA 4OSOA 1YB4A 1M6HA 1NHWA 3IKVA 2B37A 3ROKA 1HYGA 3IP1A 4O59O 1LSSA 4ALKA 4CJXA 4DUPA 5DCYA 3FBTA 3WGOA 2NQ8A 3KTDA 1QRRA 3DBHB 3PPIA 1T1RA 5ITVA 3OSUA 3NRCA 4N18A 2EGGA 3NGXA 5EN4A 1D3AA 4E3ZA 3H3JA 4J90A 1AXEA 1DC4A 2WYVA 1DAPA 3F6YA 3PEFA 1O9BA 4PLPA 4U6QA 3WB9A 1MC5A 3VZSA 4MVJG 1V9LA 4F6LA 3B20A 3KSZO 1MG0A 4DREA 2Y68A 3PHGA 2EJVA 4CV2A 1U28A 4YJGA 4CMIA 5AXAA 1TXGA 4GVXA 4U8GA 4CQMD 2C7GA 4BO8A 1QV7A 2P68A 3PZRA 4A7PA 2C5AA 4EITA 4NR0A 1Y9EA 1ZEMA 1PIWA 1L7EA 3QWIA 2IEDA 4XIYA 3RBXA 3RUFA 1RM0A 4NFYA 3RUIA 3UHAA 3AUAA 3VVBA 4BS9A 2PH5A 2PKQP 4OHUA 4URFA 2PWZA 5A3VA 4RPLA 1O89A 1GDHA 1U3TA 5G0UA 1A27A 3QVTA 3AOGA 1X0XA 1H9AA 8ADHA 5JDCA 5COBA 1A9YA 4CQMB 1NBOA 3GUYA 5IDXA 2VN8A 3ZU2A 4IQ8A 2VHWA 3ETDA 3H9JA 1ADFA 5ITWA 3I9KA 1KOLA 4FW8A 2NACA 1UUFA 3DOCA 4E6PA 4L4SA 1SB8A 3H9EO 5KJEA 3H6KA 1QXSA 2Y66A 2J3IA 5KJ6A 4LK3A 5HTOA 1D1TA 3Q3CA 3H2SA 4PN3A 1SZJG 2J5QA 1S7CA 1PL6A 2NVWA 3OJLA 4MVJD 5IZCA 2WTBA 2ZIZA 2O3QA 1GZ3A 3DBVO 4BQRA 4BNUA 5A06A 2C2XA 4D44A 3P2YA 3NYWA 1LI4A 4R4JA 4R9RA 3GY0A 3L6DA 3IKTA 3ADPA 2Y05A 4IMRA 3S8MA 1ML3A 1E0DA 3ZWOA 3P2OA 2GSDA 4QO7A 4Q9NA 4BNGA 4AL4A 2EWMA 4MPDA 2WEKA 3I52A 5CDSA 4GWKA 1O5IA 2VYND 1H94A 2PD6A 1LLDA 1K6JA 5A5EA 4I1IA 5H82A 5TSDA 1DOHA 3DC2A 1M66A 1QYWA 1T1SA 3ROMA 3V1YA 4DGSA 5BR7A 1ENZA 1U5AA 4EDFA 1PWXA 3VOSA 1BXKA 2G76A 2PR2A 4FFMA 5KWEA 1ZMTA 1GFSA 5JMPA 5AXDA 4DRYA 1PGNA 3EAGA 1G0OA 1GYPA 3KLPX 1WMAA 5T5QA 2FHSA 4IY1A 3L9WA 2HSDA 1WNTA 2EKPA 2NWQA 3FR8A 4JP2A 5KVQA 3SC4A 3KEOA 1BHSA 2EKLA 3JQ8A 5A9SA 4A0SA 3RC9A 3DZBA 3E48A 1PJCA 4J2OA 3WNQA 4AVYA 5JAZA 2HCTA 1YRLA 4UEJA 2PZLA 5KKCA 3WIEA 4LVCA 5ENDA 4W9NC 4R01A 5IXSA 3TRIA 1N7GA 2FR0A 1BVUA 2G1UA 2H9IA 3JD1A 3NDIA 5EERA 3VPFA 5JO0A 5L4NA 4OKIA 4D3FA 3D4PA 3JQBA 3MJCA 4ID9A 5G0TA 2JAPA 2HQ1A 2YUTA 3OJFA 2P2SA 3ZHXA 3NT5A 4TZTA 1UJMA 1P9LA 3QVSA 4XJSA 4XZ3A 2AG8A 1JLLA 1B8VA 3I6IA 3WLFA 3EUWA 4R5HA 2LDBA 2IYPA 1A72A 1MP0A 4AICA 4YXFA 5COQA 4CM5A 4HXYA 4IIVA 2B69A 1IL0A 4J4HA 3UGKA 1T4BA 2PY6A 3K2EA 1GPDG 1O6ZA 4HV4A 2EJWA 5T57A 1I5RA 1I01A 4BV9A 2Y0EA 3AM5A 3T4EA 5LCXA 1UXGA 1YDWA 3ETGA 4DPKA 2ZQZA 2IYOA 2X1HA 3JQCA 5BNFA 1TA4A 1I33A 2HMSA 3EHEA 3GZNB 3RC2A 3QWAA 5U1PA 3RC1A 4UVGA 2XPCA 1SEPA 1E7RA 3LSYA 1Z75A 2DTXA 1E1KA 4GKVA 1YJ8A 3GN2A 3DFZA 2HKIA 5A03A 1G6KA 2CY0A 3OHSX 4U7WA 1YQDA 3GEMA 4FFPA 4Y98A 5FFFA 3AJRA 2Y1OA 3H9GA 3DTTA 4DTIA 2CD9A 1QYXA 2OFPA 3GQVA 5KIAA 2GASA 4KDFA 3ZZNA 1QR6A 3K8ZA 1LC3A 3WWYA 1NVMB 1GU7A 1F0YA 5KVVA 4EUEA 3NT4A 1BDBA 4QUKA 3WICA 2X22A 3GVCA 5JFOA 4B3HA 1K0UA 2DT5A 2GO1A 1XLTA 2Q1TA 2O3SA 1PQPA 3LLSA 1NVTA 2BGLA 2X0NA 2AG5A 3KSDO 1DEHA 4PLVA 2O48X 3JV7A 4D46A 4DLLA 4CLDA 1X1EA 3BTSA 5C7OO 3JYOA 2GR9A 4JQCA 1ZK4A 2CMDA 5JAIA 2CF6A 1DIGA 4E12A 1KC3A 3ZHZA 4IM7A 4E2XA 2X5KO 7MDHA 2W2KA 3SLGA 1HLPA 4CLEA 4KWHA 4BUCA 2DLDA 3AY6A 4BV8A 4NBWA 1VPDA 3W4KA 4A27A 3MWEB 2CDBA 2HUNA 2Q3EA 3A1NA 2EP5A 5IDQA 1HDGO 4GMFA 3E9NA 4N5NA 4D3DA 4CODB 4DA9A 4Y6PA 4BMNA 4IJWA 4TROA 2W8ZA 3DAPA 2HK8A 4I9UA 2EW8A
chains in the Genus database with same CATH superfamily
4RK7A 3D54D 1H1DA 2JAWA 1FTNA 1JLRA 3BFPA 3BGVA 3L4BC 4XM2A 4YB8A 3T8YA 3Q7SA 4TYMA 3QXCA 5CIYA 3GGJA 3G8DA 1IN5A 1SIUA 1HA3A 2IHYA 4XGKA 3WLQA 5J43A 2VJAA 3A1DA 4IIJB 1FTSA 1KEPA 2PZAA 3LCUA 1FMCA 2BTQA 3P0EA 2FEWB 1XA4A 2Z4RA 2JAXA 1OXKB 2ZPUA 3TRJA 3IBTA 1XZBA 4QRIA 4F92B 3C8UA 3PNMA 1U0NA 4EOGA 2CL5A 4CFYA 5AR1A 3EA5A 2FJ0A 5J63A 1FFAA 1WXIA 3K32A 3L77A 3I34X 3ROGA 3VOAA 4MGKR 1U11A 3BVPA 1WB6A 4D0GA 5GZ1A 4LRQA 3WWEA 5IVHA 5IVPA 1N2SA 1U2GC 2LNDA 5HKLA 4E11A 3UUEA 1UMBA 4DLWA 1R15A 1BGVA 1J25A 3MCZA 3RVKA 4KLRA 1G7SA 2Q5LA 2C57A 1Y6ZA 3HB1A 4LJKA 2XCOA 4HZGA 5HDQA 3FB1A 4BUJA 1JDPA 4A8JA 4YMIA 3ZHBA 2WFMA 4W5OA 4P4GA 2I99A 2LE0A 1DKRA 1KH2A 1L7NA 3IQEA 4P3NA 4XYEA 2CVFA 4FFVA 2CXRA 3VR4A 3LT0A 4FJ1A 2RGWA 5HFNA 3STYA 4WZAE 3INTA 1KPGA 4Q3OA 1KVSA 1FMJA 4JEHA 1GNQA 2HA7A 3KHTA 1K2WA 4ZK2A 3D7MA 3EOBI 3OIWA 3EGXB 4KR0A 4NG4A 1VJCA 3VFDA 1DADA 1QLHA 2OK8A 1TCBA 4RVDA 2IHJA 5F21A 3HRIA 3HR7A 4M1EA 2A5FA 5AK0A 2JNWA 1JPUA 4IF4A 3OFKA 2OGSA 2PKYX 2VTVA 3H7AA 4HH4A 4PWZA 4LQCA 4MIKA 5EHXA 1GQSA 2OG1A 4B76A 1CIVA 2ZJAA 1CU1A 4BNWA 3PKJA 3VH2A 5KNBH 1ZGCA 1F3LA 3P2JA 2C7VA 2SCUB 4LXTA 3BFJA 1T0HB 3ER9A 2WLTA 3HB4X 3VO8A 3ZNOA 5AESA 4L73A 1Y1PA 1VMKA 3IUMA 3M6FA 4I99A 3G5TA 3SYLA 1S3GA 2Q5CA 3QW2A 2WP8J 4M86A 1Z0UA 4PZAA 5CURA 4D8WA 5CAEA 2BSAA 1MV8A 3BHNA 4EKIA 3NFYA 3GLGE 1Y34E 1UBGA 4F46A 4D9GA 3KWFA 5LL6P 3OEHD 2EF1A 4IO1A 2JLAA 5DLEA 4DHWA 3DMNA 1F4PA 4BMVA 2MDTA 3CWQA 3H3FA 4GX2A 2B4QA 4FGUA 4HNHA 2NSYA 1Y6RA 4NARA 3A3PA 4QYXA 4UEQA 4XXHA 4RVHA 3ZLVA 3ZHRA 3C8MA 4KE6A 4QHYA 3CNNA 2NSDA 3RGGA 1FFWA 3U4IA 3BIFA 1M1YE 3P9NA 4JBXA 3DZKA 1UL1X 1Q7CA 3ADOA 4Q7QA 1ZW1A 4AUMA 1ZWLA 4KXQA 1HZJA 3DT6A 5CA0B 1QFSA 1CZNA 3OIGA 4F91B 4X65B 1HDCA 2IHNA 1YB1A 2IYUA 4WLOA 4YJFA 4DC1A 4EGQA 2IUYA 1SBCA 1G7TA 3AVQA 1LI5A 3FZNA 5DEOA 2Q7DA 4ZQHA 1QO0D 1S8FA 3N2NA 5SYAA 2SECE 5JARA 1X39A 1JG6A 1AKVA 1ZRNA 2BVNA 3HBNA 5E3JA 2CLDX 4P5DA 4CNQA 5I9LA 2XA1A 3OX2A 3AEZA 3M0EA 3ZTTA 1FNCA 1XKXA 5H0IA 2X4LA 3NV7A 1JVNA 4I08A 1Z4NA 4XVQA 2WILA 4PLHA 1U2QA 3ROQA 1BH6A 1PEDA 4JLBA 2FPGB 2FW0A 1ATZA 4PE5B 3ZDAA 4YBZA 1RQGA 1M2HA 4CTKA 2RHDA 2VUSA 3GRCA 4YONB 4ZQFA 1W4LA 3NTXA 3VR6D 1P4RA 3EGIA 1AUQA 2ZWPA 3TW8B 1NW6A 2DTEA 3OCWA 4M9QA 2M32A 4RK0A 2G0TA 2XQIA 1TTQB 2F8LA 2MJLA 1NW5A 4TM8A 3TRDA 4CN8A 5BPFA 2ZZMA 3COJA 1OHHD 1GUFA 3ESXA 2H4XA 2G70A 2MYTA 1R9GA 5AICA 1MR3F 4CLHA 1TGVA 1NFQA 1EUZA 2F62A 1JH9A 3G88A 3KPYA 1EVZA 2YJNA 4PW0A 2K7ZA 4UBOA 3TFOA 2IHZA 3L4SO 4HQOA 5P8WA 1OI2A 2GMWA 4N82A 2OHHA 2ZRLA 3W3ZB 4BTVA 3O9ZA 4MQMA 2GK4A 4D9CA 4QA9A 2CEKA 3S29A 5KAPA 4DV0B 1SVMA 1USKA 1H2EA 3B1JA 2X6QA 2QY9A 4OGKA 3WLJA 5J47A 1JP7A 1CZLA 3E05A 3H3XA 3CA8A 3PS9A 1UMKA 2IEGA 2J0UB 4HUTA 4AS1A 3AIKA 1U7OA 1PWEA 3I37X 1V71A 3Q72A 1XRPA 3PT5A 4Q3KA 1XPUA 4FUQA 4BNHA 1KZ9A 1JHDA 1HY3A 1FL9A 2CYCA 3C3XA 1GCGA 4YDRA 4I8DA 3S27A 3X2EA 4U7DA 4PG4A 5HJEA 1JAZA 4JOQA 4BX8A 2IYSA 4PZYA 1EE1A 3D8HA 3UUGA 3V2UA 5AVKA 4NYJR 4YAOA 4E7PA 4TRNA 1P9OA 2BPOA 3GT3A 1D07A 2VEOA 4I5IA 3TWOA 1CQJB 2CL7X 2M1ZA 1I2DA 1D1QA 2EFDB 2H18A 1E0KA 3G9UA 4S3MA 1H1LB 3SOZA 4C9BA 2HCJB 1VL6A 3V4VB 1TYEB 2FR1A 3LGSA 3UT6A 5TX7A 1NUUA 4D9MA 3VPHA 2IXAA 5FWYA 3AUTA 1DMRA 4M7PA 5JJBA 1INLA 1OCEA 3HSKA 2R0QC 2VWHA 1K68A 3FLAA 4HGOA 1CEEA 2DQYA 3C3EA 4M0CA 3NHUA 2XMPA 1JMVA 3CLKA 2CN1A 3AO0B 4RVOA 1Y98A 1NF2A 2YC4C 1E6MA 3DE4X 3UOAB 5IYZB 3SR3A 1FOEB 2FPUA 4BJ5A 4RIHA 4R2IA 3NCTA 3UKDA 3UM9A 2QN7A 2ZJ7A 1GFIA 1S89A 3GYGA 3V9AA 2ES4A 3AZPA 4KE7A 4CTOA 3P0JA 3NGMA 5L7YA 2FPPA 1US8A 3P9PA 4PG5A 1YRQA 2BSQA 2VJOA 1BWQA 2IHVA 3MLBA 4A8JB 2QD3A 2I6FA 5AHOA 3PRYA 2IH5A 3IEVA 2ALJA 1OI7A 4FN5A 3RSSA 4XDYA 3OUTA 2XXBA 421PA 1XJ0A 2C9MA 1PZGA 3O8RA 1MQ9A 1C1DB 1G8GA 2EBFX 2FVXA 4UNPA 1RMTA 1E5QA 4XKJA 4BNNA 4BFXA 2RH4A 3TPZA 3LRPA 4TSRA 1D4FA 3F71A 4XA8A 3RRXA 1VSBA 1W5BA 3R75A 4M8NE 1ORDA 2PXCA 1E7YA 2VAWA 2BTQB 3R77A 5AW7A 3D8TA 4M6WB 4YA6A 2EEPA 4OGWA 2KPOA 4HZUB 4QODA 4XEUA 2GD6A 3K9WA 1WZCA 3AKYA 3UCFA 3OZFA 1XFDA 1CJVC 2RGXA 3L4BA 2I80A 3O26A 3TR5A 3BXFA 1FJGB 2WHPB 1U0RA 1ULSA 3IUBA 2B25A 1NJ8A 2PGAA 5TGDA 3SC2B 4KVFA 1P2GA 3KWMA 4BU1A 1JHOA 1VIYA 4CQLB 3MBKA 1X74A 2RHWA 3JARA 5JJIA 2E4VA 3Q9SA 1A8UA 3UJNA 3I4FA 5CT5A 2BYTA 3K0HA 1FXWA 4JP5A 4LV5B 5E9JA 1H22A 4OGLA 5BPHA 4C4ZA 4PQGA 2ZRCA 1CNEA 3RHFA 3EGDB 2AKAB 3BL8A 4ESVA 4L50A 4M98A 2J08A 1PSZA 4GR4A 1IH8A 1JE1A 5MGNA 1WL8A 3HQ4O 2B1RA 4EG1A 1X19A 3BX1A 3ESZA 3K96A 1S9HA 4OYHA 1CG6A 1PG0A 4HQFA 4TMZA 4NCBA 4A0GA 5MN4A 1JQ3A 1YVUA 2CXPA 5FUYA 3PUWA 3JQEA 4ZCPA 1VSVA 1F6DA 2CCGA 5F78A 5M29A 5MHTA 1AV6A 4CM4B 1CE8B 4G26A 4ZYLA 4JFRA 4BBJA 4U0JA 3S4YA 1XJWA 1ZD8A 4PSVA 3WBFA 1XXHE 5HA5A 4X94A 3O8CA 4Q7LA 3FYUB 1NBMA 4RQBA 3HBAA 3RUEA 3L92A 5B1DA 621PA 4KRGA 4BGEA 4JJ4A 3K0FB 5CLFA 3D0OA 4Z9FA 1RWBA 3F7OA 1G8AA 1QJ4A 2ZYWX 3OJXA 5CJPA 3UJ6A 4EVIA 4E46A 3OZEA 3U09A 1Q2XA 1RQ2A 1ZAKA 4LZNA 3UATA 3N74A 1ORWA 1VCOA 1JJ7A 4PHTA 5KOHA 4AWXA 1YCDA 2Q1SA 4J1NA 4YAJA 3A1TA 3I1JA 1DJQA 1U8FO 4IDBA 3PE3A 4KQ2A 4OJTA 2F3SA 4KUHA 5K09A 2XB2A 1LQ2A 2FGKA 1N6HA 1A95A 1TU3A 2GKGA 4PNEA 3JQ8B 3PZBA 2JCSA 1XNHA 4OA5A 4BKRA 4R98A 1NMXA 1MX3A 3I39X 3OBBA 1Z45A 3GCGA 1HFJA 5L3QA 4OSEA 5HGXA 2ZRFA 2V7PA 3KL4A 4RENA 5KNCA 3ZWCA 2AQHA 1U3VA 1D2CA 4CVNA 4UD2A 4IWXA 2CHEA 3H9QA 4MB0A 1J2JA 2RHRA 1D2GA 3MWKA 5LWQA 1LV8A 2NMVA 3A0UA 5D3KA 3ZVMA 4RV5A 2RFLA 1S2DA 3TL3A 2P6RA 2UVDA 4FGKA 2I2BA 4MUYA 5DT2A 1YOVB 4Z1MD 2N42A 2ZS7A 5JG7A 3M1AA 3Q85A 2PNFA 4QGGA 2W37A 3FFWA 2QF7A 3IT2A 1ZN2A 3DVAA 4RVNA 2E7ZA 3TXAA 1BXRB 5IUJC 2FSHA 4PS0A 3VKUA 1DQYA 3AU9A 3OZWA 1S6YA 4Q9KA 1IY9A 2XF8A 5HKAA 3WWDA 2ZITA 1NGSA 5AT1A 2QTHA 5J2TB 3WZMA 5CD1A 1V6CA 1ZR4A 2QS9A 4LXYA 5JI2E 5K3DA 1VG0B 3SZ3A 2H2FA 5DNUA 2Z04A 2CJPA 2IP4A 3ZZMA 2V98A 2AEFA 1UDWA 2UU9B 4ISCA 3PVSA 1UPXA 1XVIA 4LWQA 3TGWA 1Z8DA 3V8BA 4QRDA 4BP8A 1DPFA 4UXHA 4C2BA 3GNLA 2QRVA 2D5BA 1OLXB 1U3GA 1X1AA 3LXMA 3C5WP 3MOGA 1YZUA 4WJZA 4AJJA 5DJ5A 3WA7A 1E9VA 2VPXA 1CVIA 5FYQA 4YN3A 5AW5A 4ZQBA 1C29B 4C0AC 4PN7A 4ENSA 1UFKA 3V7UA 4BNDA 5F7XA 3K9LA 4GI2A 4C01A 3FNRA 1SKYE 1LBIA 1H93A 1SQSA 2D0DA 2ZJBA 3EOAI 3WYDA 1CQIA 1OWMA 3INYA 1ZYUA 4BGUA 3PFFA 2BTEA 3LSTA 4MUHA 4HAVA 5ERGB 5IPFA 5T8KC 1QH8A 3Q11A 5EJMA 1UBLS 1WIWA 5U4QA 1RI1A 1VFNA 2NV6A 3WQRA 5IXJA 4MLCA 1YB6A 1NOIA 2PD4A 2D8AA 2XODA 1XYVA 2G72A 3G89A 4HNAB 4PQRA 4RABA 1DFHA 2F67A 4RC9A 2GS9A 1WW3A 3TW6A 3UPDA 3U0VA 3ZWWA 1ZJ4A 3ZJ4A 5KTSA 3FMFA 2P9YA 3LD9A 2VHQA 4XQCA 1EBUA 5ABPA 1T8PA 1X14A 2QM7A 2FPRA 1X2BA 1V16B 4HZUA 2D06A 1UK9A 4B87A 3ABIA 4ALIA 4OHWA 5EUQB 2WG0A 4Q5IA 1I6MA 3EW9A 1BHJA 4GBJA 4ML3A 4WNAA 4V38A 5SY9A 1XMQB 2DFNA 2FPIB 1N4DA 5DO9A 4QLBA 2XQFA 1NUAA 4Z49A 1V8OA 4M4SA 3ZDQA 3FFBA 3FPLA 3UGQA 1KS9A 3QKWA 5ER9A 4CT4B 4RKEA 5J4LA 1E9RA 3I01M 1ZGGA 1UC4B 1KI2A 3GWZA 4N5DA 5BV0A 2OSVA 4CUKA 2BTOA 4EUFA 2A9KA 2FH5B 3ETCA 3I6QA 3NYRA 2Z4TA 1GAQA 3K1TA 1HYEA 4P81A 2OXRA 1N9GA 5ADHA 2O1XA 1NMYA 4MH0R 3KB1A 2P9BA 4FBLA 5JS2A 4BRZA 3DZFA 3PC6A 3AVVA 4S2EA 3DO6A 1PR2A 1OA0A 2QR2A 3KT8A 1VBNA 1Y1TA 1ZNYA 4ENQA 5E95A 3C6BA 4EW6A 1Q0TA 3DKRA 3IPAA 1CR0A 1YR6A 1J39A 1Y8QB 3H11A 4PAQA 3EXIB 1RYMA 2XY4A 1Z7WA 4EATA 1MMFB 3PDJA 5MN6A 3EG9B 4XJXA 5TRTA 1QU3A 4FT4A 4RZ3A 4FVTA 1NMZA 3KM0A 3X1JA 4FS8A 5E6UA 3KJZA 4OL0A 6GPBA 5IABA 1CKEA 3ZIAA 5BW6B 3F4BA 4XPZA 1HQCA 1T4MA 3CGWA 3AVPA 2ZWAA 3LOUA 1GCUA 2PMCA 1DAGA 4NTZA 3U5TA 1E9AA 1N2XA 2X5OA 4MRSA 1E69A 3QENA 2GNOA 3JR3A 3QV1A 2PQ2A 4I1VA 2OV3A 1E4EB 1ETHA 4RK6A 4REQB 5DFAA 3NC0C 3ZLJA 2NIPA 2JIOA 2SNIE 4I4IA 4ZJPA 1I9CA 1IONA 2GZ1A 1DV2A 2CFIA 2IYQA 3A3OA 4XFKA 1SVOA 4KK4A 1GRRA 3EPRA 3EWAA 4ZOLF 4ZRMA 4MUIA 4WADA 4DWOA 3SZOA 3G59A 2CUKA 4ND3A 2Q0HA 5HZMA 1LGYA 4WESA 4ZOLA 1F2DA 4BVEA 3HO8A 3H2GA 1JQ5A 4BX3A 3OIVA 4II7A 5DBEX 8OHMA 3R6LA 1ZFNA 1I7PA 2F55A 3U17A 2CKMA 1KFJB 3FPJA 3SE7A 2ZYGA 2O14A 1U1CA 1XAGA 1WA5A 5ALRA 3KKPA 1HG1A 3ITKA 1RXWA 2YASA 4BO9A 1RWQA 4J3FA 3DFFA 2C3PA 4HAZA 1MPTA 3Q3IA 1VB5A 2J3HA 3IR5A 2G9RA 3A1EA 3HKDA 3NOQA 1K63A 2R6HA 4HNRA 1EFVA 2I03A 1AMUA 3PDIB 4WHMA 2J87A 5DN6D 3DQQA 4E0BA 1ZIPA 4EFKA 1FTWA 2VBGA 3MXOA 1VKRA 4YNBA 2CBZA 4M53A 3V4ZA 1I0ZA 3TW8A 4BYGA 1EGQA 1YVPA 4IHKA 3D31A 3NVAA 5AVWA 3RVSA 3HBJA 4JUAA 3W2IA 2XVMA 3TSZA 1FXSA 1RHKA 1QVVA 1O95A 5CJJA 4EKNB 1NQAO 1TJYA 3SEZA 3RUCA 1L5QA 4UOQA 1YDMA 3HCPA 4Q1FA 1J8QA 4EPRA 4ZYUA 4NMMA 3AB3A 3EQ7A 3MAGA 5J2TA 3S8YA 3KOZA 3AC0A 4BWFB 2BHNA 4XJTA 1GWNA 4IDPA 4R40A 5JS7A 4OXRA 2BGIA 3ZU6A 3AGQA 2ZBGA 1JIVA 1NVDA 4Q9DA 5CW2A 3JQDA 3NEYA 4Y30A 4BNMA 2ZYUX 2YV2A 4ERNA 1ENOA 3WSWA 2OVBA 4I4TB 1JXAA 3U3OA 1PR9A 2P9GA 8GPBA 1JEAA 1K4KA 2ZR0A 5DK6A 1C41A 5LLDA 3K1JA 3AMVA 3DTVD 1KJWA 3LP5A 5FAXA 2MYNA 4WEQA 4ZPXA 2Q2NA 4YIHA 1E9EA 1U9CA 4TS9A 1Z4MA 3NHZA 4ZVSA 4MAAA 3OM0A 1D03A 1E6EA 4K26A 5ITZB 1CRZA 3Q87B 1K6XA 3MG9A 2FVYA 3EC7A 3RSQA 3MRVA 2QRKA 2IPAB 3LUBA 3RSHA 2IKSA 1K9SA 3ZKWB 1SHJA 1WU7A 3OA2A 4CN9A 4K40A 1YFKA 3W05A 3UJ9A 1HSZA 1FNNA 3U19A 3I61A 2PIAA 1K06A 4TKUA 2IVFA 2R4QA 2J0SA 3LQ1A 3VZCA 1OLUB 3V8NA 3ED1A 2HV8A 3UGTA 5B1EA 1GGFA 5DTQA 1ZM3A 4GX1A 5EWMB 4LCBA 1ZO8A 4NHOA 3GP5A 1L5MA 5CB6A 4EZBA 1MB0A 1A88A 4IMPA 1L7OA 4DMMA 3D2LA 3S2FA 2X8WA 4INOA 5E8JA 4WN3A 2QA5A 3IP3A 3TZCA 1CEQA 1L4KA 1C7JA 2XYRA 4WK6A 3TJMA 1PQUA 4QX6A 4DJ5X 3DEIA 4YACA 1ZR2A 3I9V1 1FRZA 1GZ7A 4FSHA 4N8DA 4YJ2B 5GP1A 3GFVA 2DUJA 5D5PA 2VS1A 4RTOA 3SYTA 3ICQB 5DIFA 3SXPA 4FWBA 1Z18A 3ZGZA 3GDFA 2REQB 1U1IA 1QVRA 2AR7A 1ND6A 1H3NA 3DOOA 1HF3A 3HUTA 2A84A 3QUCA 4RHCA 5FA6A 1TF7A 2WZQA 4S1PA 1PBTA 2HAEA 4TN1A 4G0PA 2X5JO 1SOAA 2YXNA 4HNAA 4MLPA 1GPBA 4G4IA 4OMCA 3R9KA 1CETA 4MUEA 3DFMA 3FYTA 2YC2C 3B5IA 1YIDA 3IUJA 3NHFA 4OQFA 4XIIA 5A4KA 4BMXA 3MWYW 3GJTA 1FMTA 3DMGA 1CR1A 4LN1A 3RVJA 2HRCA 5IJAA 2B4KA 2ETXA 2HJWA 3GJ7A 2QMHA 3KXKA 3MTAA 1C3OA 3WIUA 3KZ1E 3TAHA 3A1CA 3ABRB 5IASA 4L28A 3CONA 2D2VA 3IKJA 1IUOA 2C5LA 4L51A 1Q84A 3HZHA 1Z2NX 5DMHA 1II8A 4BPRA 4FE4A 1BU8A 5HCUA 4E3WA 2AR9A 2VHUA 2B36A 3BMCB 3BSYA 4MVJF 2HADA 2XYPA 3WMWA 1Z7YA 1EUYA 1NW8A 2B83A 1ZMXA 1Z6AA 3P5SA 3UW1A 4OLFA 2WJYA 1Q1AA 2ZTSA 4X45A 1UWKA 1ENPA 5MFPA 1R0RE 1CQPA 4M8IA 4CMEA 4FGLA 4Z0TA 3CVYA 3BJIC 1TDJA 3FMGA 2XLBA 2IV7A 4GKJB 4MIOA 4MQ5A 2ABWA 3IC5A 1N2ZA 2WI8A 4Y9TA 3F98A 3ZGNA 3QYPA 1W48A 2DBQA 1ZC4A 4HXEB 4JCCA 3WHLA 4B6FA 1YE3A 1QPGA 4AF6A 3ADBA 2XNJA 2C5FA 2B3DA 1G60A 4G09A 4HLCA 1NJ2A 4NZMA 1F5NA 5I6DA 2YYYA 1F9AA 4M7OA 1ZSNA 3R7SA 5IDWA 3IUSA 5IM4F 1GU1A 1RXEA 1EU1A 1NXWA 4GD3Q 4X6XA 4MWCA 3NTVA 2ZDGA 1I4TD 4MP6A 3U7HB 2GTPA 1VGVA 2FWAA 3Q3JB 5EYPB 3CM0A 1A3CA 1SVLA 1Z68A 3DE1X 4H4EA 1C1DA 2XYQA 2IGBA 4EGSA 2QTLA 3KJGA 3WAGA 3PB3A 3PI7A 3BK7A 3G0CA 5AK5A 1E9DA 3A6KA 2VXOA 3JAWA 2UUOA 3FF4A 2VRWA 1Z82A 2PU7A 5FL7A 4QDUA 4ZDIA 1TCAA 2LW7A 2QDXA 3GNSA 5I7SA 1L5LA 3W1WA 4A1OA 1F7VA 4ACBA 4DVJA 3FRJA 2BI4A 1YR2A 3CT6A 3HJCA 1QO0A 3SHFA 5L45A 4KR6A 4H3SA 2H16A 1ID8A 1OKKA 3Q0IA 5FORA 5JSFA 1L3CA 2ZP1A 1XTKA 3CNHA 5EE3A 2B35A 3ENWA 4GL4A 4E4YA 3H5RA 1EDDA 2GCGA 1PJTA 1NVWQ 1YE5A 1T9GS 2J9GA 5AHXA 2XKJE 2NTJA 3HHPA 2RGAA 1CUUA 3E5MA 3DR5A 3KR2A 2ZUUA 5F77A 4C4SA 3F73A 4DUGD 2IDJA 3O4GA 4L5IA 2BMEA 5FUQA 3IE0A 2XOXA 1LVUA 1WMEA 2ZUBA 5EMHA 1VSUA 1DEKA 1RHMA 1UT5A 3BKXA 1BCRA 3MYRA 3PIRA 3MWDA 2F4NA 3CIFA 3TD6A 3U7QA 3ZX5A 3WQQA 4A10A 4CF5A 1R4NB 4A5OA 1XPRA 4FZ3A 3FE2A 4LWPA 5DI9A 3AIOA 3R5XA 5TV2A 3ZW9A 1GA6A 2JEYA 4P0QB 1HYBA 4E5KA 3NO4A 3DMRA 4GGPA 5K0ZA 4V0OA 4L5BA 3LCVB 3QJ5A 2YIVX 4EMUA 3LI2A 4KPEC 3RS8A 2FW6A 1CS4C 1TM4E 4TZKA 3RIMA 5JQGA 1B8NA 5M34A 4C29A 4DSZA 3C41J 1XF9A 5T4EA 5LUBA 4JYAB 5IZCC 1MJFA 1FSFA 2RI0A 3DFKA 4MV9A 3ET5A 5LDDC 2WKQA 4YCDA 2R6ZA 2P1RA 2C4NA 3KFLA 4F11A 3O8QA 5HQTA 1QCDA 1VHJA 4K3UA 2PJUA 3I2HA 4E07A 4GC5A 1LCIA 3TOCA 1G98A 2BGMA 4PYLA 4Z99A 2FZGA 1SGWA 2N75A 3CZ4A 2YQZA 4QKQA 4EEXA 1GDTA 1P4JA 2C9BA 2JLYA 1QB7A 5DSXA 1Z37A 4BECA 2VP5A 2JFYA 3JQ6A 2CW5A 2BI8A 4ZZIA 4TTJA 4P5EA 3AERB 3ST7A 3FM9A 2P8SA 3G3EA 3TTXA 4EJ6A 3O74A 1WV0A 2WJ6A 3IERA 4BC1A 5TB5A 2IFTA 5KTPA 2JFGA 2GZHA 4GPBA 5JV5A 1K8QA 3FW1A 2H2WA 1PJ4A 2G77B 2C2ZA 2KMLA 5F1PA 1J7KA 2I4MA 1GCOA 3NV9A 4QPDA 3NWOA 1ODKA 3L1VA 3KWJA 4LDNA 3B3GA 2W4MA 1A8IA 4FDLA 2P2NA 3NALA 2WWTA 4RS4A 2CJYA 4DZZA 4DV3B 1VZ2A 2CV2A 1KY5A 3VM6A 4RD0A 3ISJA 4LOAA 4C7XA 2DH5A 2YV5A 3NORA 1T0UA 3DTVA 4AULA 1G64A 3N76A 4BZZA 3K5HA 5I9BA 2D59A 2MR6A 3C4JA 1PZNA 1PJ2A 3KQLA 3IELA 2GZSA 3AI1A 4J7CA 4UJ5A 3ZTWA 1H3FA 1P0CA 1RHQA 1DUIA 2PKQO 3CF0A 3G5UA 1ZM9A 4YLEA 4D6XA 5FLXA 3AW9A 3E1GA 4Y9SA 3B36A 3EZLA 3LTEA 1FFYA 1Z0AA 4G1VA 4UTOA 2R62A 3E4DA 3P9IA 2FN7A 2EFYA 1U31A 3QYJA 4RTLA 2Z4SA 5EE0A 1CLEA 3DZDA 5DHQA 3BD6A 2ERYA 3GLHE 1V1MA 2LCFA 3DYIA 3A1UA 1ZBQA 3DEJA 3LWBA 5DZSA 4DPLA 2WIDA 4IPTA 2OENG 4BB5A 5BVHB 1IK4A 4YRKA 2Q3DA 2VH2A 5KCMA 4ZMRA 3KJNA 5JRJA 3LQ4A 3QY9A 1BQEA 3NCHA 1V8ZA 2GESA 4JI3B 4F12A 3JZAA 1TAUA 4QPZA 1I5EA 4WL0A 1E59A 3A32A 2FEMA 3R5JA 2R6JA 4G8JA 3LYHA 4NBUA 2Q6LA 2X4IA 1EFPB 1B2RA 2GF0A 5BV1A 1SXJE 3IE2A 4O8ZA 4XQGA 2BGGA 1UPBA 2QSYA 3DV9A 1UFQA 4LTMA 2DRIA 4EJSB 1Q74A 4H0FA 1XRSB 4KQ6A 3K0FA 3WAJA 4ZI7F 1V39A 1EFKA 1KQFA 3MGAA 1MQSA 5HKKA 1E1RD 3D6MA 5BYBA 3L5OA 1OH7A 4E5UA 5DCLA 5KDLA 1LD3A 5C8YA 1RPNA 4HPWA 5ES3A 1YZGA 3TZKA 4C4YA 4W8HA 3IQIX 3O4IA 4PHGA 5EJFA 3CG0A 4FX2A 5KKNB 3THXB 4DIKA 2C61A 5LD2B 3HZZA 1A8PA 3LUHA 2FPSA 4B33A 4P80A 3BIJA 1C9KA 3OPXA 3KD2A 1B0ZA 3D4LA 3P2EA 3RFTA 5BSGA 2Q4BA 4AWBA 3NHMA 2OWEA 3LWZA 3T0GA 4JLMA 3L0SA 2CLLB 3T3HA 1G5RA 2P2DA 3JRWA 1NXOA 4GDMA 4DDHA 2WQ6A 2AFHB 4E30A 4RELA 1KDYA 4R83A 2FWIA 3Q10A 2Y0BA 1QMGA 1UXIA 4LHXA 2OCPA 3H2KA 1JDBC 1QAQA 1N8SA 3I1FA 5CXXA 1PGQA 2XOKD 4P8RA 5H16A 2WHEA 3DYBA 4IGFA 2OFFA 3V7NA 3ZWNA 4L6AA 4DSNA 5EIBC 2OCLA 2RB4A 3FD8A 4JB2A 3C3JA 3DF7A 3WWZA 1Y80A 1N5IA 2ZVPX 5F7ZA 4BHTA 4EF5A 5K20A 3O82A 1P44A 1VXRA 4KTVE 4D1YA 4ETNA 4ZI7B 2O8CA 2VHVA 1EEHA 1JHAA 4QUHA 2VFAA 3QLTA 1NNEA 3ZW8A 4C7MA 3R9IA 3MXTA 5H83A 1YZNA 1SCQA 2OBNA 4EEKA 4CRWB 1E2KA 1N1DA 1NE2A 3IQZA 3HYSA 1TGYA 4TMTA 1CUCA 2VBIA 1X7GA 1QNLA 4R01A 4AN4A 1WABA 3IGFA 4BAGA 3ELUA 4DWVA 2JPDA 3SEFA 4DLTA 3N7AA 5ULLA 2P69A 2YWEA 4RIIA 1PLLA 4LRUA 2PUBA 1OWLA 1PUXA 1UFOA 1XD9A 3QBJA 4OY3A 3FYHA 3WGHA 4L8LA 4ZJZA 2JC3A 3ZZ0A 2FP4B 1ECLA 2LDXA 5AOBA 2EZTA 3JRXA 1JQEA 3SJUA 3ONDA 3CVWA 2BKUA 4KN5A 3QPUA 4OHOA 1ZOOA 3HMKA 1E0AA 3PHBE 4FE7A 4R51A 4YP7A 3U26A 5JCOC 1YCGA 4IHJA 5AKKA 2BFPA 1MG5A 1PKXA 2H5JA 3AFNA 5ALEA 1FE8A 3V4OA 4EHBA 4EMTA 5IWCA 3PXXA 2PMFA 1BOFA 1AX9A 1LI7A 4KN8A 1JTVA 3MAJA 3ZWPA 4UBNA 1J00A 5KI6A 2QM8A 4DYHA 2VRNA 1GG9A 3HXQA 1I80A 3LVFO 4B46A 2GD0A 1KEWA 1N8TA 3MTGA 4P6VF 5CPBA 4Y2QA 4BFVA 4MICA 2Y1LA 3MCUA 1XCJA 3INNA 2B4TO 8AT1A 1EUDB 3RV3A 3GH1A 1MZPA 1SJ9A 3P96A 5BNZA 5L6MB 1WP9A 2BFAA 2UZ1A 2GZRA 3M4JA 3TJRA 1B42A 3HABA 5HZHA 3D4NA 2NXEA 2HY7A 3QXHA 4DRXA 4NAVA 5JCJD 5LUAA 5TPZA 1Y1SA 2FDCA 2RJOA 1SMKA 1H66A 1K08A 3H86A 1YZLA 4R9UC 4B85A 4JQOA 2CXQA 4RJIA 5H4HA 4B2YA 1IJKA 5BSMA 3QXSA 2XYGA 5DN9A 1NT2A 4LDPA 1CUXA 4WDRA 4KN9S 1H8HD 1PJRA 1RJFA 2PH1A 5AJHA 4EYSA 1FS4A 3LZ6A 3T1HB 3H5IA 4I3GA 5EZ5A 1Z83A 3ESQA 4RM2A 1B0AA 5JNWA 5M2QA 1RWNA 1YGYA 1SELA 5ILQA 1N0WA 3OQ1A 3PLNA 2WAOA 2IA5A 2QTZA 3WC4A 4CEHB 1JLKA 2V7TA 4XDHA 1WZIA 2WMYA 3QLUC 4PYKA 3UANA 2E6UX 2H65A 1JVSA 3CG4A 4AO6A 1ABBA 4Q6BA 3D9QX 1VGQA 2V7UA 2VL7A 3FWNA 4YV0A 2H59A 4FIZA 5EMMA 5ICEA 4X6LA 2ZSHA 4XJVA 3FDXA 2OEPA 1GCAA 3HKDB 2QX6A 2JDIA 2JJYA 1KMCA 3M1IA 3EEYA 2WR8A 4H7KA 2X7XA 3FMPB 4I9FA 4HDMB 5EHZA 2HU2A 3B7WA 4W7HA 3KTFA 1X13A 1JG3A 1W1IA 2EKBA 3SZUA 4Q00A 3KELA 1GR1A 3E7XA 4C5AA 3O1JC 3H0CA 2GK7A 4MYDA 1OLOA 4AMZA 4EB3A 3DNFA 4V0LA 3ZKAA 4DQDA 3EIOA 3TNDA 2V6GA 3OMWA 4KXNA 4BC0A 1G8SA 5T4HA 2ZB7A 4D57A 2I3GA 5A0FA 3IOCA 5FPYA 4LDZA 2COKA 3ML1A 1HDXA 4WCFB 4ARVA 2PS3A 4LBWA 4B8YA 2GJ8A 5JYBA 3PBKA 3HS3A 2VT7A 2X3UA 3RTCA 2E5LB 2RONA 3RSFA 2OC9A 1TMYA 3DZ8A 5KOJB 3L0IB 1ZK2A 1M1YA 3LGXA 3AL3A 1JHRA 4TOIA 1ORTA 4MR9A 1VDMA 5CFQA 4BNFA 1GSHA 5C9ZA 4NATA 4BEJA 1F3OA 4EM6A 4N6OA 2YXDA 1MDFA 4LV6A 3LYLA 4BEWA 5KUTA 1AH2A 3FGOA 1C0IA 4AP5A 1EVIA 1SPXA 5JWOA 4AM8A 1NQTA 2VDMB 3QU7A 5ITZA 3PQ6A 4AWAA 1B8UA 1BVYF 3EZYA 5ALFA 4Z54A 1E1DA 1JHXA 2BFDA 3KT6A 2GILA 5J5VA 2PH3A 3AHIA 4DQKA 1G19A 3WLSA 4R2JA 4CM6A 1WXQA 4FOPA 5HS6A 4LSWA 2JKZA 1ILWA 4GPZA 1BDMA 1LDNA 1SXGA 2WMNB 3F3MA 3JD3A 4FZRA 2WT4A 3R7AA 4CT0A 2XD4A 1PLJA 5A1JA 1NASA 1XRMA 4AS2A 1BMTA 1YWGO 2BZ1A 2FEOA 4QEKA 1XAHA 2Z3WA 1N4AA 5KQRA 1VRCA 1H6BA 1DTSA 1OTYA 1P45A 3CCCA 4LNHA 4XWOA 5GIOE 2R00A 5IAAA 2A1TR 3NU1A 1COZA 4NF2A 4QTTB 1V3UA 1HYHA 4OBEA 3RBVA 4MPRA 2OXEA 3DL7A 4DDKA 4PXSA 1TYCA 2RD2A 1N5OX 3F3SA 4GKBA 4B43A 4AQ7A 2VHTA 3BXPA 4NNJA 4BNIA 3IFSA 1T3SA 5CEEA 4HQNA 4US0R 2X6RA 4I8XA 1JIJA 4N49A 4Q93A 4FQ8A 3OQJA 4V02A 2G4LA 2VXBA 3WA6A 4R54A 3ZHUA 1F12A 2P75A 2JFWA 4NZOA 5CCXA 1LVHA 3AR3A 3UIEA 4LE0A 4I14A 2V1UA 1EG2A 2I34A 3I64A 1VM6A 4PIVA 5E4TA 4QUGA 5CDTA 1M83A 3EVEA 1MLDA 2DTDA 2XCUA 2JH8A 1JIXA 5FWYB 1IDN1 2WNHA 1FJ2A 3NBFA 1O87A 2C00A 1ZUWA 4DRZA 1ZMBA 1W36B 1Y8RA 1L4BA 4LWOA 4TVOA 2PLNA 4UM7A 4LX0A 3TTVA 2JFQA 5TY0A 5KVSA 4TXJA 1DOZA 3UJ8A 2AN1A 4LOIA 2W6JD 2QR3A 3OO0A 3OF3A 2G09A 3P5BA 4BEVA 4KRFA 2LCQA 3JATA 1YF3A 3TQQA 1BKYA 1XCGB 2C03A 4DYDA 1DRWA 1C9EA 5K6AA 1O97C 2BGTA 3FWZA 5C1BA 5DNWA 4GQBA 1Z39A 4J49A 3VBEA 2OCGA 1QB8A 4PBSA 5LBTA 2AN9A 2GAFA 3VTAA 4ASUA 1VSTA 1T3LA 1C8LA 2DQZA 2QL9A 1NY6A 3HJNA 3KVNA 4BFZA 2ZIVB 3WE7A 2Z1DA 3K8OE 3ITNA 1U8EA 5K1ZA 1OFVA 1A97A 3AYXB 3LK6A 3P0HA 2QY6A 1GQOA 2YS7A 3GFOA 5G4KB 5BW8A 4IX9A 1APBA 1QHIA 5CD9A 1E6UA 3SX4A 3MJRA 4LYHA 4KMRA 4QDZA 5HS4A 1W29A 1CZKA 1CUJA 4MV8A 2AVDA 2CVOA 1I36A 2QUKA 2GYUA 2PMDA 1E4EA 2QL5A 1L6RA 3QX7A 1G8YA 4KE8A 3TNYA 4DHEA 5KQPA 2AI2A 2GHIA 2LR0A 2UV8A 4FQ7A 3LBIA 4I1YA 4RLQA 3WADA 2EDAA 2P9EA 2QZPA 4GYYA 3AR7A 2IEZA 4KWEA 3EX7C 3MLAA 4RVUA 1RDFA 2I6XA 4JFAA 1JDUA 1F2VA 3H1FA 5CVEA 5DHTA 1T26A 3HKEB 1P0QA 4TPKA 2BJWA 4NMXB 3V8RA 5DNDA 3KOWA 3W7AA 4EJ0A 1G6OA 1WHTA 1K5GA 3BWCA 4RGQA 2ZDQA 4Q3EA 4QTUB 1BQ4A 4B7XA 2WMOB 1SXHA 2BFOA 1G9SA 2ZRHA 4GL2A 2HU5A 4N0QA 4IJ6A 3ZH9B 2G7ZA 3WDMA 1NW9B 2HLDD 2PSDA 3L1KA 4BCBA 3G0OA 2GJSA 1U0JA 4B6OA 1F38A 1D2HA 2GK6A 4I6EA 2R6FA 3PNVA 4JVNA 4H1TA 2QUJA 4C6RA 3HA2A 2O8VA 2HK9A 5CCBA 3ORQA 3QWFA 2AN3A 3L06A 4J0IA 4B3FX 5AVSA 3PVZA 1XDGA 4Q01A 2WF8A 2Y9MB 3VKFA 1PJZA 1T4DA 4OUDA 5H81A 5B6PA 1C9JA 4JT4A 4M8KA 3N58A 5A3SA 3DOJA 4MO9A 4UVDA 3GFBA 3GLIA 5LMNB 5D01A 3SFTA 1DDOA 1UKAA 1Q19A 3AR2A 3GL9A 2D7DA 1NQOA 1WDMA 2EBWA 1V5FA 3BGOS 1W75A 2JLBA 3CZMA 4L8GA 2NM0A 2WD8A 4E94A 3BEOA 3CSDA 4B4DA 1AA6A 2GN0A 4Q1VA 3ZY5A 2WA2A 3JALA 5HEKA 1D4AA 5HILA 5J4KA 4N0MA 4CXMA 4U1RA 3IAHA 5GONA 3A9SA 1SNYA 1U9ZA 2PZBA 2X5NA 4ZO6A 1XB2A 5KTMA 4WT7A 5FV4A 2JAUA 2AB0A 3I58A 3PQ8A 3R3HA 1G7CA 1Z0JA 2NT4A 3K2BA 2ICAA 2PGOA 2QTTA 2BISA 2XGGA 3AR5A 4FZJA 2IBMA 3FTNA 1AE1A 4HMQA 4HWSA 1NC1A 1IPHA 3BE5A 3JQQA 3L6RA 3QUAA 5KNBD 4LDQA 4LTNA 1WX1A 2B21A 1GITA 2ZBQA 1LVGA 4HPXB 1VLJA 2E4WA 4NDAA 3M4YA 3DHYA 2IE0A 3DKPA 4OH7A 4QVGA 4A6DA 5FNVA 2BIFA 4PFSA 5HW0A 4DLKA 3K4HA 2EVWX 4PAWA 3K30A 3OQHA 1PJAA 3VU9B 3M5DA 2GD2A 4BAZA 1K8ZB 2NUTB 3X2FA 3UWOA 4BVGA 3DNMA 3GGCA 1QE3A 1PX0A 1JZSA 3EVGA 3ZK8A 2ZZNA 5T6MA 3ETLA 1CEYA 1HDIA 4AJPA 2HXYA 4EPWA 4D45A 4CKCB 3CZPA 2WIFA 2CV0A