1PLAA

High-resolution solution structure of reduced parsley plastocyanin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
AEVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPEYLNGAGETYEVTLTEKGTYKFYCEPHAGAGMKGEVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title High-resolution solution structure of reduced parsley plastocyanin.
pubmed doi rcsb
source organism Petroselinum crispum
molecule tags Electron transport protein
total genus 12
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plaA00
3GYRA 3T6ZA 2WO3B 4E9RA 1WA2X 1ZPUA 4WTQA 2PPDA 4YSCA 1AS6A 1ET8A 2ZOOA 1RKRA 1GSKA 2QDVA 1A8ZA 3N2JA 1PZCA 3T9WA 4YSQA 2CCWA 5I5JA 2I7SA 3ZIYA 3S8FB 1AS7A 1IC0A 1ID2A 1JVOA 1PNDA 1CUOA 3NJLA 3T6WA 4UAHA 4K9JA 5I6OA 1ZIBA 2GSMB 3FU9A 3CDZB 4E9XA 1NTDA 2UX6A 1BXAA 1JZIA 1RCYA 2VM3A 4YVUA 3SQRA 2DY2A 1AIZA 4E9TA 2BP0A 3EH5B 2YAMA 4E9WA 4HALA 2YAHA 3CZUB 1AZUA 1FA4A 2BZ7A 1NPJA 3QQXA 1GS8A 5B7EA 3ASOB 1X9UA 2HZHA 3H4FA 1RZQA 2VW6A 1PNCA 2HX9A 2GIMA 3FS9A 5PAZA 3X1EA 2QDWA 1J9SA 5B1JA 2AZAA 3ASNB 2FQDA 4DPBX 1AR1B 2I7OA 3D12B 3AY2A 4BXSV 4M3HA 2UXGA 2DYRB 2WSDA 3FYIB 6PCYA 2JFCA 3DIVA 1BQKA 1QHQA 3FPXA 4P5RA 2OV0A 4UANA 1NINA 5B1BB 1UATA 2VW7A 4HCIA 4YL4A 1SDDA 1ETJA 1AS8A 2QT6A 1KDIA 1SF5A 3NSYA 1OCZB 1PMYA 1GY1A 3H56A 5A7EA 3HEIB 4G7SB 2BP0B 2IAAC 1L9TA 1BEXA 2FT8A 1V10A 3PCYA 2Y69B 2XLLA 1JZFA 9PCYA 4YSUA 2IDTA 4BWTA 3FQYA 1CYWA 4W9ZA 7PAZA 2FJSA 4CSZA 2BW5A 2JXMA 2ZWNA 2TSAA 1KV7A 3QJSB 1FWXA 2IDQA 4GYBA 1M56B 3FQ1A 2MTAA 5D4JA 1AZRA 1HAUA 2PPAA 2IWEA 3QJVB 2FNWA 4GP4B 3BVDB 4DPCX 1JZJA 2BWIA 4E9VA 5I6KA 2JKWA 2YAOA 1J9RA 1ASOA 5F7BA 2W8CA 4G7QB 3NJIA 1GS6X 1SDDB 3CDZA 1E67A 1IBZA 2GI0A 2Y1AA 3AW5A 3QJQB 3UACA 2FQEA 3L45A 1NDTA 2E86A 2DV6A 1GYCA 3X1NA 4BWWA 4TXVB 2AVFA 2BZCA 3NJGA 1AZCA 3WG7B 3AG4B 4RH4A 1M57B 4A2DA 2YAFA 2J5WA 2PCYA 3QJRB 3U25A 1N68A 4GP5B 2UX7A 2XYBA 2PP8A 2R7EA 3WKQA 2BP8A 1ET7A 1R1CA 3NSFA 1A4CA 1BQRA 1J5DA 1NIAA 2VSKB 4E9YA 4FAAB 4CSPA 1A4AA 2XUWA 1M9WA 1GR7A 4ENZA 3AZUA 2IWKA 1IKOP 3EF4A 1KCBA 1L9QA 3RYMA 4DP6X 2IDFA 3GXUB 4E9QA 1JZGA 3HB3B 1J9QA 4YSRA 1TEFA 3CVDA 4HAKA 1ZDQA 5I6MA 3WI9A 2W88A 1PY0A 4N4YB 4G70B 5I28A 1ET5A 5I26A 4JHVA 3S3CB 2PP9A 1IBYA 3T6XA 1A65A 4GXFA 2N0MA 4DP2X 2XV3A 4MFHA 4YSDA 5D4HA 1AOZA 4DP1X 1ASPA 1I53A 1GS7A 3ABLB 2YAQA 1J5CA 2UXTA 3TU6A 3NJFA 4AKQA 2R7EB 2BP8B 2IWFA 2HRHA 3S8GB 3C75A 3AG1B 1L9SA 1WA0X 3FSWA 4G7RB 2EINB 3JT2A 5I5IA 3NYKA 4HCFA 2HX7A 1BQ5A 2TSBA 5EHFA 4X4KA 4YSOA 1OF0A 2H47C 1WAEA 3PXLA 4A2HA 2XWZA 1URIA 4W1TA 5B7MA 1TEGA 3TASA 2XV2A 2BHFA 1PZBA 5FC9A 3NSCA 2XX1A 4HHGA 1CYXA 3NP4A 1ILSA 1OCOB 3ABKB 1OOWA 4G72B 1SFHA 3TA4D 3FSAA 4M4RB 1ADWA 2EIJB 3ZX1A 8PAZA 2OJ1A 3BQVA 4KO5A 4GP8B 3AG3B 4ZK8A 2CJ3A 3WKPA 5AFAA 4F7KA 1B3IA 1JZEA 2AANA 3S3BB 2GC7C 1SF3A 1W6WA 5AZUA 3S3DB 4PAZA 2ZONA 3CG8A 4BDVA 2UXVA 1X9RA 2I85A 1PLAA 3OQRA 4NAJA 2YXVA 4HHWA 4KNTA 2PLTA 3OMNB 2FT6A 2DYSB 1MG3C 3OMIB 1NZRA 1W6LA 3PPSA 3SBRA 2CALA 4A2GA 4DP0X 4DP8X 1ILUA 2EIMB 1A4BA 1NICA 3ABMB 1GW0A 4YSAA 5LDUA 2HLEB 2VSMB 1E5ZA 1PLCA 3QPKA 5E9NA 3UABA 2Q9OA 1SHWA 2EILB 4KNSA 3PAVA 3NJKA 2PPEA 5D4IA 1DZ0A 4YSSA 2XU9A 3T71A 1JXDA 2BWDA 4FA7B 1PF3A 3UADA 4G71B 1CC3A 1E5YA 1DYZA 1ZDSA 5TK4A 1W8EA 2J57A 2HRGA 3IE9A 3MBWB 4HIPA 3FQ2A 1FFTB 2PPCA 4KOCA 4AZUA 4DP7X 4YVNA 4YSEA 1SNRA 1NIFA 2EIKB 1NPNA 2J55A 5I6NA 3QJUB 5B1KA 1E30A 4AKOA 1MZZA 5B1AB 4DP5X 2P80D 2IDUA 1AANA 1TU2A 3FU7B 4BDVB 3V9EA 1OE1A 1JXGA 1WA1X 1BXVA 3KW7A 4NERA 4L0PB 3UGEA 1KCWA 2GC4C 4AI7A 3IN2A 1ZV2A 4DPAX 2ZXWB 3X1FA 3EH4B 2FQFA 2GHZA 2GBAA 2J56A 3EH3B 4QLWA 3NSDA 2BW4A 3H4HA 2QPEB 3G5WA 1KYAA 1PCSA 4UF7C 5IY5B 1JZHA 3JTBA 3NP3A 1AZBA 2HXAA 3UAEA 2DWSA 1JOIA 1PZAA 1KBVA 2XXGA 1KBWA 1VLXA 2VW4A 1L9RA 1V54B 2Q5BA 3IBOA 4N8UA 1HAWA 2YARA 2XVBA 2RACA 4A66A 1PAZA 2FQGA 2VMJA 5AKRA 1ASQA 4BXVA 1NIEA 3FT0A 2AZUA 3UAAA 2XXFA 1OE2A 2GB2A 3OMAB 4P5SA 1SHXA 1YLBB 1XMEB 3N55A 2X88A 3FYEB 2YXWA 3FPYA 4PCYA 5TK2A 4KNUA 3ERXA 4KO9A 4AX3A 3ZBMA 4NB7A 3TBBA 1SJMA 4E9SA 1NWPA 4Q89A 3NJHA 3X2QB 3TBCA 1PLBA 2YAEA 1KGYE 4HCGA 2HX8A 1OE3A 1OCCB 4HZ1A 2A3TA 3GDCA 2H3XC 6PAZA 4A2EA 2YAPA 5I5MA 1AAJA 1T5KA 4QKTA 5B7FA 2FT7A 2PP7A 3PAUA 5B1JC 1WS7A 2IH9A 3CVCA 3SBQA 1F56A 2VM4A 3PAZA 3OD3A 1N70A 1MDAA 1V55B 2CUAA 1AZNA 3EHBB 3X1BA 1AG0A 3PLYA 1BYPA 1KDJA 1NWOA 4WKXA 4AKPA 4Q8BA 4BK5C 3WIAA 3T6VA 1A3ZA 1BYOA 2P80A 2AFNA 3NJJA 2FWLB 1OV8A 1QLEB 2PPFA 1MZYA 3X1GA 4A2FA 5B3SB 2BO0A 1XB3A 1NIDA 2XX0A 2B08A 3FU7A 4A67A 3FSVA 2UXFA 2VN3A 4JKNA 2FTAA 1AG6A 1NIBA 1RZPA 3WNJA 1XB6A 2LLNA 1JERA 1GY2A 1XB8A 7PCYA 1HFUA 1J9TA 4EF3A 4F2FA 1AQ8A 4JHUA 3FSZA 3AG2B 2B3IA 1OCRB 2H5UA 2QPDB 2DWTA 4GY4A 1QNIA 3CVBA 1BXUA 3QJTB 1MG2C 2YQBA 3ZDWA 2IDSA 3MX0B 1JXFA 1TKWA 3V9CA 5I6LA 1EHKB 3FU8A 3DTUB 4YSTA 4DP9X 5F7AA 1CURA 2CBPA 5PCYA 2XV0A 3SBPA 1WS8A 1IUZA 2CAKA 1EZLA 2IH8A 3DKHA 3WNIA 2WO2B 3NT0A 1JVLA 4KO7A 2MRYA 3NJMA 1L9PA 4BWUA 4DP4X 4KOBA 3ABGA 3IEAA 1L9OA 1ZIAA 1BAWA 5I6PA 2NRDA 1SFDA 3KW8A 3NJNA 3OM3B 4YSPA 1E65A 5ANHA 4KO6A 3IN0A 4F2EA 2X87A 1AACA 2PCFA 4A68A 2OCCB
chains in the Genus database with same CATH superfamily
1SYVA 3TJPA 5T3ZE 1NGYA 2A2QT 4E9RA 2X10A 2GK0A 3D39E 3VD5A 5I1LA 4YSCA 4Z77A 1S2EA 1TJHL 3RNKB 5C07D 5KVGH 3QI9B 4DAGL 1T89A 2G60H 3ZIYA 2FB4H 5DJ0B 4AQOA 5ES4B 5C09A 3P77A 1G43A 4FP8L 1CE6B 2A1WH 4WNJA 2VXSH 4Y1AB 3FBKA 3AMLA 4HJJL 3TYGL 4KFZC 4E5XA 4WHDA 1YY8A 5BS0B 4E9XA 1Z9MA 3FN0H 4JS7A 3T4YA 2NY0C 4JRWA 2VT0A 3TN0D 5CEXA 3HMXH 1DCEA 4FFWD 4S0SD 4Z3JA 3G3LA 2XNAB 3ZL4H 3CVHB 4M5YH 1PG7H 3UZQA 3CZUB 4RA3A 3ZTJG 4OV5A 5C7ZA 3KYNA 5KOVC 2TAAA 4K3EL 3QP3A 4LMQE 2Q10A 3H4FA 4JDZB 4JO5A 2AJSH 2WLNA 3MV01 5DVNA 4E41B 2K4AA 1LWHA 4HWNA 4QRSA 5JIIA 1U8LA 6FABH 2X38A 4CVXA 4BXSV 4HFWA 3H3BC 1K2DA 4MJHA 4GW4B 4DT2A 1RVFL 5A7BA 4X7TA 1QW8A 2JFCA 4LLVA 5CBAB 1HZLA 3QXAB 1JXKA 4QRAA 5L88L 1M05A 4QRPE 2ZP0T 4KHXL 3FQWA 4QMEA 1HZHL 2I24N 4B9GA 4TOYL 3BPNB 4LDOB 3SE9H 1ZHKB 2VMCA 3EFOA 5F2FA 1S7SB 3AXLA 3NSYA 4ANWA 3J27A 5A7EA 3NEOA 4JY5H 5JXAL 5GRUL 2A9BA 4Z3FA 1FG2A 2Z8VC 1MXGA 2FEJA 4K8RL 3S9DB 2EDJA 2NSMA 4HPYH 1B88A 3CX5K 3IRPX 3N85L 4OD3L 2CRIA 3ZKND 5IKCB 2Y69B 3OV6A 3ZK0A 4RFNC 1BM7A 4A6YH 2HJKB 1QUNA 3H8NA 4NM8L 2VZSA 4MYWB 3AGVA 3IJHA 3BVNB 5H94A 3BAKA 2A5UA 3REWB 2PWHA 1N4XL 1AIFA 2X89D 3NGBB 3EYVA 5DVLA 1RP9A 1MHEB 1WCBA 2ZICA 3FQ1A 4RLDA 5EOCH 3DI3B 5T1DH 3V2AR 1PZ3A 4MNQE 2IWEA 3PXJA 1XCWA 1FSKB 5IR1A 1G7HA 1HQ4B 4PJFF 5ALCH 5BRPA 4Q2ZA 2E3VA 5I6XB 2OYLA 4G7QB 4DOHB 4MWFA 2Q3XA 3P3RA 2IBZY 1DCLA 1H6FA 5DEGB 3U7YH 5JW4Q 4NWTL 1IGML 2YWYA 1WFIA 5IJCC 4RMVA 4AXWB 5B3JF 2BSTB 4EAEA 1MUJA 1OT4A 1MEXL 1JZ5A 3NVQA 1AMYA 4WU7B 1K85A 1YJDL 1ZA6A 2VMEA 4KQ3H 5I9QC 3UJJH 1CDJA 1FL6B 1ZA3B 2QQNH 3NJGA 5CKAA 1OLZA 1OP3H 5HY9B 2DQUH 3BLPX 2J5WA 3U25A 2ODHA 3SYOA 2PP8A 3MJGX 5GS3A 4QF1B 4WW2C 2FO8A 1N12A 3L54A 4EZLA 1MFEH 2H9GB 3MOBH 3T2LA 5IESL 5D2NE 2YKKA 5E8PB 5IV2A 3M07A 3FU5A 4Y5XC 1KTKE 4Y8AA 5E1GA 5A6LA 5ID1B 2CA3A 3D0VB 3MCYA 3MV7B 4QR7A 1EJ8A 4UDUA 3ILQC 1ZV5A 4WFFD 3M8OL 2B9BA 2LAAA 4EIBA 5GS0L 3K6NA 1FZJB 1RI8A 5HDBF 3TPUA 3ZKSD 4FQJH 4J8RB 4BH7A 4M3JA 3HCVB 2Y3NA 5HD8C 5EN2A 2YPKA 1GGCL 3MGTA 4MS8D 3QO1B 4HJGA 3SDXB 5K9QG 4LKXA 1J1PH 4Y4FA 1FYTA 3IETA 1CQKA 3D39B 4FI8A 2CDEB 3O6FB 1RIHL 4FE9A 2UY6B 2P5EA 4BRJA 5ITFB 4XHJD 3FT4A 1BBDL 4F33B 5DRXA 3C6SB 3B9VA 2OX5A 1GTNA 4DP2X 1PY4A 2EDMA 4MFHA 1LDSA 4YHNA 3MLZH 1K4DA 3B8YA 2OTUB 2XN1A 4OQTH 1T04A 5CILL 2BSEA 3MV9E 2HRHA 1BFOB 4M5ZH 1I9EA 1XO8A 1CF8L 1GGBL 1KN2H 4LP5A 4M61B 3VRIA 4PVBA 1EXGA 5CJ5A 4L4TA 4XR8C 4HUCA 3OJDA 4YMPA 3K71A 1XL4A 1IGTB 4R26H 2EDBA 1U93A 3MJ9A 2Z31A 1PLGH 3WLBA 3M17A 4QHNA 2Y6TE 1NKGA 4OZHE 3N9GL 4RRPM 4JPQA 3IXTB 4PGJA 1T0NB 2X4SA 2VO8A 4GW5A 4U31A 1LQBC 3PIQB 1QFUH 4JVUA 3KPNA 2EE0A 4W9LC 4ODSH 4Y7OC 5E00B 3UJIL 2VLRE 3HR5A 3WS3A 4H8WL 2R69H 4YGAB 3ZKMC 4PRHA 3UTTA 4Z7NF 3S88L 3L13A 1IGJB 3OWEA 1DQML 5EBLB 1QACA 2XWJA 4HHGA 4P2OD 3UZVB 3WN5C 5CD5D 4J3VA 3VGBA 4G3YL 1OOWA 4HV8A 2YFOA 3DLQR 1VPOH 1DQIA 4YLCA 4JG1L 4RAVA 3L4VA 4QRPB 3C6LD 5DQ9B 1G9NL 5FB8B 3OL2A 2MQ0A 2CJ3A 4KKAD 2ARWA 4LPWA 3L48A 4F7KA 3QR1A 4PJDE 2CDGB 5I0YA 1QLRB 2FX9L 1EEYB 4O02H 2OTWB 3HFML 4NUGH 3G5YA 4FQPA 12E8H 2WPGA 1NANI 3ULVD 2HFFB 3B5TA 3D69B 5GIRB 4YX2L 4WV1C 2PLTA 3PDGA 4F7PB 2NY6B 3UAJA 3OMNB 5D2LF 2D4FA 5HDWA 4XI5D 4X9FA 3L9RB 3DROA 3MUY1 5HPOA 2WJ5A 2ED9A 4OF6A 4N2DA 2XN9A 1S9YB 3EYQC 3EOBA 3QXDA 4ZOBA 4KMLB 1RAMA 4OLVH 1A4BA 4LEOA 5D8JL 3QCUH 5KSUA 1XAKA 4XMUA 5I1DA 2CZNA 2WQAA 3D7PA 4HXAL 4B5ZA 4MNQB 4I3SH 4OBRA 3GJFK 5CCKH 3A23A 4LE8A 4K7PY 4P06A 2OJEA 2AEIT 3JWNE 5DYOB 3T71A 3FOLB 4AG4H 1CFQB 3EOYG 4L1DA 1RSYA 5AW5B 1AKJA 1W2KT 5FM5M 1AI1H 5I1AB 1LDPH 1SYSA 5DDHB 3ZOAA 3HE6D 3MBWB 5IFAH 1CDCA 3FTZA 5DC0A 1TTGA 1OM9A 3B2XA 2EDTA 1BOGB 1CZ8L 1BD2A 2VDNB 4AEHH 2OSXA 2P80D 4TSAH 3UBGA 2OP4H 2AEWA 4N1HB 1MOEA 3B9KD 2CIKA 2Y2WA 5HVHB 3UGEA 3LV3B 2BFVH 2C4XA 3GSNA 3WEOA 4BV1A 4DPAX 1YY9D 4EVNB 4U0QB 4ZZFA 1LO0L 3QC6X 3BZ4B 1MXDA 5HVFB 2H32H 3ECBB 5F7NC 1UG9A 5D2NB 4WW1A 1IGYA 2F53A 3L7FA 3CMOH 2BHZA 3Q2WA 5KOMC 1KJMA 4EQ3A 4HX1A 3EKCA 1JD9A 3IDNB 4U3XA 1BQUA 3EYUH 3STBA 5DZLA 3E6HB 1MFDL 1JAEA 3ARDD 3O6KL 5EH1A 4MJ5B 4D9RE 3LZOA 4W4OA 1A3LL 5LG6A 1BFVH 5IGXH 2XFXB 1H9VA 2Z91A 5L8JB 2JLLA 3VQMA 4MXVF 3TWCL 4BE5A 4C56A 1R5VA 4L3FA 4KV5F 4NO0A 4F7MB 1CGSL 5DK2B 4X7SH 2J20A 5HXMA 4RIRA 1YYCA 3DV4A 1B90A 2AJUH 2VDKB 4AV4A 2FAUA 4UM9D 4ZSOE 4IOIA 4PCYA 5CXPA 2MNUA 4LOUC 2AV1B 2V9QA 4RAHA 4RDQG 3TTSA 3WFBH 1KLGA 1ZTXH 1ZT4B 2CLVB 3QVAA 4K9EL 5DQJB 3ZE0F 2X4TA 5HI4D 1XGTA 4AL8L 3MV9B 3STZA 3O0RH 4XBPA 1S7QA 2ICEB 4HCGA 5DJYA 5J89A 5C0GB 1NCBL 4Y1TA 5KVEL 1AAJA 1WWCA 2V17H 2DMHA 1F58L 1U91A 2VDLH 1UHVA 3QWQB 1IARB 3H9HB 2IH9A 4JFFD 4M62H 2YO3A 5F3HA 4AYSA 1IGCL 4E42A 1D9KB 5IUCA 4L8DB 4DZBA 4OZHB 3QZMA 1IIIA 4JGUA 4HUUA 2VLRB 5I1CH 2XFGB 5CIPA 3TBYB 1AP2B 2CLZA 3BFWA 3VSUA 1A66A 2CDFA 1XB3A 1OTSC 2BCKB 1RZKL 3L3DA 4JL2A 2Q76B 1UZ8B 3L2MA 2CRMA 3H6JA 1WP6A 1Z9SB 2VDML 5A2AA 1KB5B 1N8ZB 3H42H 5IOPB 3CCHA 2HLAA 1F1GA 1QSZA 2HVKA 2X41A 5MENE 4KRPB 4G6FB 3GEFA 1HHIB 1SEBB 4PJDB 3TO2B 2OMZA 5GGUB 3HC2A 1CXKA 1MFAH 4X5XB 3HG0A 3D8MA 4FNRA 4P59L 3V4VL 2X4RA 3ARYA 5IVOA 3WO3B 1CR9H 3ETBF 4N5UA 4PHZA 4JPWL 2C9PA 1AZVA 1I9IL 4ZNCD 1GOFA 4Q14A 1Z9NA 4YSTA 4HULB 3G5XA 1OM3L 3WIFB 3GGWA 4G6JH 4M48L 5DUML 3RWFB 2XV0A 3L3OA 1WS8A 3WNIA 1VB9A 2UVEA 3VE0B 4ORGB 4WCYH 5E4EB 1KELH 2YUVA 4YBLC 1KXQA 5CMAA 4MA1B 3IU3B 3WTYA 4JPKH 1MFNA 4FEIA 1DBBH 2NUPA 2K6ZA 2YRZA 3W56A 3HJEA 2WWMC 3C5ZC 5TFSH 3IGAA 2RFXA 2JJUA 4XMZA 3DJSA 2Q20A 2LVEA 4ZX3A 4POZD 3IPBA 5D70H 1I1AA 5DTFA 4F2EA 2X87A 1BP3B 5ALBL 4F8QA 4A68A 2BSSA 3P2DA 1WCQA 1SM3L 4TNVF 5SWSE 3T6ZA 4NN5B 2GT9A 3POHA 2WKOF 2X6AA 5DC2A 3FCSB 4PS4L 3SDCB 1BVKA 2V37A 3K3QA 4HD5A 1JN6B 4BE6A 3HKFA 4FADA 1FV1A 2CCWA 4JFDB 4Q0XH 2ZX5A 5TJWK 25C8H 4YXKH 4X8JB 4XPAL 2PW2A 4NT6B 4GEJA 3FZUD 4F9PC 2OPCA 3PWVB 1DBAL 4YHZH 4GRLC 4YUEL 2X28A 5IK3A 5JIQA 4GKNB 4N2NA 1XF1A 2BJMH 3GJFH 3OR7B 4LCUB 4N2MA 5AKSA 4KK8C 1BZ7B 1S7UA 3RPIA 2O1AA 1P1ZB 1D2PA 1KG0A 3NZHL 1DVZA 4P3DB 4B9KC 1TTAA 4PWKA 5CGBA 1NC2B 2IFFL 3Q44A 2YAMA 1A4KA 3RX7A 4JQXA 2IBBA 1XH3B 2F1AA 5LCVL 3UMNA 4KGJA 1ORSA 4XMKL 5BRZE 1OARL 4LKCA 5KYWB 1M3IA 1A1NB 2H1LM 2KERA 4UTAL 2YFNA 3ZVVA 1TQSA 5J13B 3QXUA 3KLDA 3FS9A 1O6TA 2X42A 5KSBA 2V7HA 4LPUA 4EI5B 3ES6B 2AAVA 4H20L 1SXZA 2CHZA 2ZJSH 5DD1L 1PW3A 4JCLA 3K8KA 2UXGA 1EJFA 3CFMA 4G80B 1JWUB 3G6JF 4TNEA 4ZSOB 3WUWA 5F7FA 1QWHA 1FFNA 5IUSA 1BQKA 1JSYA 3ILQD 4NZUH 1L7IH 3WHXB 3ZJAA 2WN3A 4GXVL 3RY5A 1F41A 1SDDA 5F89B 4KUZL 4WEBL 1QFWH 1KDIA 5EORH 1OP4A 4Y0GA 5BMFH 3DX6A 1XF4B 1CFVH 1PKQE 3HEIB 4AGLA 3QRBA 1L9TA 4M6NL 2BOBB 3LRHA 1LNUA 4NGHL 4Y4FD 3MFFA 5FYKD 3DTXA 3VI3F 2HFGH 3HZMB 1HHKB 2WGNB 2XLLA 2DQCH 3N0PB 3TBVA 3VWJD 3HZKB 2UZXA 5TGBB 2ISDA 1QP1A 4AYDC 2Y25A 4XOEA 3DV6B 5AOLA 4CSZA 3MNZB 2QGCA 2W59A 3SY0B 1JMZA 2J5LC 3P4OB 2XRAL 2C5DC 3IM1A 1CLVA 4HOMA 2MTAA 4OLYL 3BCDA 3QCTL 3HNVH 2BSED 1THAA 1UH4A 4KRNA 3SO3B 1XF5A 3EFFB 3BPCB 4IRZH 4G1EB 1YSOA 5E4AA 2AI0H 3G6DH 2VR6A 4L4TD 2ZTBA 5MENB 3ULVL 4NNXA 4P5KB 4GLRI 3DOSA 1UWXH 1IBZA 1YEHH 2YIHA 4FXKB 4XNYH 5E5MB 2EIDA 1YAIA 3VU2A 4TLTA 1B4LA 1AJ7L 3VNZA 4YEEA 3ZKMD 5I82A 4BZYA 4TVUA 4PJ5D 3I3EA 5EPMA 1TQVA 5CJBA 4N8VB 2IFGA 3MRMA 3PGFH 4ES9A 5C3IA 2EIZB 3UTTD 2KLTA 5EOQH 4N0YH 4AMKH 4P9HL 3FT2B 4EDXB 2XYBA 5AW7B 1DSWA 4WI2A 4M6ML 4HKBA 4NPKA 4HWBA 5EC2B 3F2LA 3SKMA 3ZTEA 3D52A 3BDBA 1INEL 2DF3A 3CC5B 5EIQA 3AZUA 5EUOA 2IWKA 1G9MC 2MMXA 3A6BL 3FQXA 3LKQA 4FD0A 1KCBA 2A73B 1YYMH 5DEFB 2HJFB 2FWOA 4M1DH 1B4JH 2FBJL 1JCVA 1JGDA 4AQZA 4BZ1L 2D7TL 1D3CA 3WI9A 2H2SC 1S78C 3F65A 5LGHH 5SWSB 5JR1H 2X4PA 1QBBA 1TJXA 5D7IA 3UAJD 5I8OH 3MLSL 1CD8A 4TUOA 4UAOC 4UUJB 3S3CB 2FLMA 2V6HA 4WEMB 5IFJA 4W9JC 1IVTA 3LZFH 3QUZB 1K72A 4XP9H 2YMTA 4IRSB 2R8SH 3WE1A 1X6NA 2XV3A 4IEFA 2ADFH 5D4HA 3MFGB 4AK2A 4JKKA 1RJYB 3P9MA 1XCQB 3PWPA 1OW0C 2YXMA 2XQYG 3QG7L 4HK0A 5INDA 4NENB 4PYHA 4F7TB 1XD0A 3DA0A 4FLRA 5J6HA 4GAYB 2APFA 5CCJA 2J72A 1HCVA 2XWEA 2FGWH 1VCBC 3VA6A 2ATPB 2P5PA 2R4SH 3CXDL 4MA3A 4Q58C 1HZKA 1FLRL 1AKJD 2AHIA 2EINB 2GCYA 4LGPB 2GJ6E 4LVNB 3EO1A 1NMCB 1U33A 4FCHA 4NFDA 3HUJE 4ZZKA 1Q9KA 1U8IA 4U3CA 4DF9A 5BRZB 1OPGH 2GAZB 2WJ7A 4KI5F 4Y5YA 4G9FA 4P04A 2VDOL 5BO1H 4M5SA 2NX5A 1E50A 3P4MB 4LVHB 1TEGA 2HKHH 2W9EL 1XF3B 4WGWB 3REVB 4P5TA 1OB0A 2DI8A 5E9DE 5C0RL 3HNSH 3LKSA 1ACZA 3UZEC 5EIIG 4P2RA 4Z7WA 1GAFL 3U30C 3RUGF 3ETBJ 3QT2A 1R5WB 2F53D 3MZTA 5IQ9B 3BQVA 1QBAA 2YZ8A 3VGAC 3FO9B 4KH9A 5CWSB 3AG3B 2CNZA 4OLUL 2CBOA 1MW0A 4UI2A 4CMMA 1WAAF 3LZQA 5AZEL 3F58L 2F19H 3EJYC 1PKQB 1HL8A 3H7LA 3Q8EA 4NQTA 3QAZB 1ONQB 1X9RA 3PHOB 1X5JA 4HUKB 1IQWL 3ZT5A 3OQRA 4K7PL 1PZ5B 5AVXB 1KYFA 4F7EA 3DMMA 2YRLA 3ISWA 4POUB 4LVEA 2QL1A 4LOUD 4YHOH 5DMGD 1EGJL 2HRPL 4ERSL 5GISH 4DWHA 2OL3A 5MEQB 3PJLA 1PGRB 4JG0H 4WJKB 5AUMA 1RHHA 2Z7UA 1WVZA 3SD5A 2YBRA 3GRWH 1T4KB 2FH8A 4KJPC 1RUKL 2EUVA 1E8ZA 4Y19E 1B0GA 4ECNA 2XWBA 5DD5L 3NCCB 2IALB 4KZCA 1BMZA 4KVNL 3WEBA 3VJ6A 1HCZA 1WGVA 3QZNA 4GO6B 5T1KA 3S34L 3PP4H 4UIMB 3RA7H 4HJTA 3H1ZA 4PQXA 5DD0H 3VG9B 3FULA 1U21A 1OQXA 1U58B 2CKBH 5MP6H 3KMDA 3NRQA 5C2BL 2X0VA 5ISZE 2WXKA 1NIFA 3MVSA 1MDTA 2WXGA 4JDVB 4BSWB 3TJEL 2VABB 3RTQB 4G8IA 5B1AB 4DP5X 5SWQA 5IMMB 5JPNC 2XWTB 3FU7B 2VUOA 4BDVB 1F00I 2I9TA 1OTSD 3KLLA 2B0SL 5HHVL 5CINH 4ZODA 5IBTL 4N2GA 3SPGA 3TEZA 1TCMA 4E0RB 3QQ4A 5LAXB 3BPLB 1U8OB 4LK4A 3WU1A 4KWUA 2DI9A 3MRIA 1JPST 1GZHA 2X1PA 4AI7A 4HEMA 2VMDA 2ORBL 2MQGA 2Y5QA 4PJ9A 4OB5L 2Y7MA 4ZUTB 3EH2A 1N2RB 2X5PA 3UP1A 3D4CA 3TL5A 1ZVHA 1NDGA 3IMVA 3RNQB 4EOWL 5F9JB 1IJNA 1MJ7L 3ARTA 4W68A 5E08H 2XG4B 1SLVA 4U1MB 1A3RL 1G7JB 2DWEA 2WK2A 1AZBA 5FHBH 3QEGL 1QSEE 3BSZH 3NCEB 1JOIA 4J4PC 4MXQC 1ECYA 1PZAA 4YBHA 5E5UB 4B3VA 3PUCA 3SBWC 2VSCA 2K6YA 2Q5BA 3IBOA 4LDLB 4HD9A 4LSRH 3JZ7A 3NN8A 3RWGA 2WB1A 2HT3D 4L37A 4ZMAT 4PREA 1O0VA 4TL4A 1PAZA 2PO6C 2R1XA 3L7EB 1ANUA 4Z3TA 5ICXB 1JF1B 3VFGL 1SDYA 1EFQA 1YA5A 1AD9A 3OKNA 4AEIH 3QUXC 4RFOL 4U6YA 1CB4A 3OKLA 4WENB 1MFBH 2BS9A 3FYEB 3FPYA 1QKZH 1SN0A 2WWMD 4V1DA 4ZOAA 2AXHA 4HGMA 3MUHL 2R0KH 1E4JA 1U3HB 3DK2A 1DBKH 3HAEB 3QIUA 3B1UA 3UIZA 5CCHE 4AJYV 5CP3A 3GDCA 2BIMA 2C1OB 5KEZA 1EUUA 2PR9A 4U1SB 5T1LB 1NCAH 3PAUA 5C08E 3CVCA 1IILE 2GJ6B 2OMTB 1AKPA 2VM4A 3M86A 5DRNA 1TPXB 2LABA 2WXMA 4BIKA 3TEYA 1BX2A 1DLFH 1Y6KR 1J05B 3OBAA 3B7UX 3NZSA 4RFEB 1A3QA 3B37A 4MD4A 4OJEH 3CZFA 5H4YA 5DJ2A 3KYKH 4GRLD 3UPAA 3FN0L 3T3MF 5K9QI 5D55A 5E9DB 5F7YC 4BYHA 2B08A 4UT6A 3P0GB 4G1MB 1D5ZB 3T6QC 1XGPB 5EBWB 1LM8V 5D1XE 3ZL4L 5EU7C 2G3XA 2DJSA 1YYLH 3RU8H 3LEXA 1XTLA 4U2YA 3DJZA 2FJFB 4G7VL 5C0FB 3MLYH 3BCFA 4MB5A 4W9DC 1NCWH 5HYSG 5FYKL 4IOFD 4P4KB 3DGGB 4LPTA 5EF2A 1CS6A 1OAUH 5LXVA 4TM9A 3FB7A 2W1NA 3FH5A 3EGXB 1NKOA 3MA7A 4BFFA 1S8DA 4Y16A 4NRZA 3V9CA 5EOTA 4PJCA 5LG1A 3GMPB 1D5BB 2WLKA 3IJ9A 5I76A 4DP9X 5KZCB 2QSCL 2HFTA 2P8PB 1UD5A 4GUQA 3S5ZA 5DUBB 5C07E 3VD4A 3HB3C 3ATDA 4NKOA 3HS0B 2WO2B 4BFEA 3FRUA 4PB0H 4YDMA 2F74A 1QBLH 4AC4A 1CTOA 4Y19B 4PGCB 3COOA 4JY5L 2VC2H 4NYLB 5DD3H 5FO7A 5TTRA 3IFOB 4NM4L 1I9RL 4K3JH 2EH7L 1A2YA 4HPYL 1KZQA 4B97A 1MH5B 3OM3B 3QUMB 2H6PB 4J3WA 5ICUA 1B4RA 3LTVA 5HI3C 2NY1D 2XIDA 1WV7T 1E27A 3G08B 4UQAA 3D4ZA 4OF7A 5ISZB 3GQFA 2OMXA 4JM2A 2MHAB 4N0FA 1RK1A 2VUKA 2W80C 2AXWA 4R0LB 1GCFA 2HSIA 1ET8A 3O2DH 3EDKA 3IT8D 2ED7A 5JW4N 3HG1A 1JDDA 4FG6C 5AG8A 1Q9LA 4L0YA 3PL6B 4QGTA 2MQCA 5EO1B 3NFSH 3MR9A 2QSVA 1T0MA 4I1NB 5INCB 4I85A 1FVEB 2DM4A 4NQSB 4JREB 1MCCA 2JCWA 3GO1L 3VFRB 3FHQA 4FTDA 4UNVA 1G1KA 1XD1A 3F7QA 2H6UA 4IU2B 3C08H 2VM3A 4CJ0A 1T5XA 4RGOH 4AOFA 2FSDA 1P1VA 4MJIA 3F7KA 2HN7A 1AQDB 4L4VA 4Y89A 5F6IB 1QBMH 2N56A 3RHWF 5JOFA 1P4BL 3CN3A 1YQVL 3UJJL 3VWKC 1ZKAA 1W80A 4OCXH 1U8JA 3CE1A 4QHKI 3DHUA 4E9LA 2ZX9A 4RWYH 1KYUA 4PRDB 3WEXA 1NLBH 5D96C 1U8HA 3BKYH 3O3DA 4KI5C 2G9KA 1V7MH 3X1EA 4UT9A 1ZRUA 3MLUL 1PKOA 1JFHA 4PCSA 2FBRA 3IAQA 5FKPB 3AY2A 2Q7NA 4JHBA 1JNHB 4LAJH 1UOVA 4X7FC 1LYQA 1NQBA 3F12A 4MCMA 1F2QA 3TIEA 2I5YH 3RY6A 4IIQC 4PUBH 2CBQA 3LOWA 5G4OA 3WL9A 3N1QC 2IV8A 3JUZA 4QTIH 2Q86B 3ILDA 1G5GA 4IDLA 1BMGA 1G6RB 4HIIA 1J1PL 4OZIE 1Z66A 3H56A 1E4XI 1ACYL 2H2SD 3KBFA 3NIGF 4NPYB 2NNCA 2UZIH 1UA3A 1DQTA 3PDOB 5AEAA 1HYRC 3SE3A 2IAAC 5C08B 3H2WA 1KMGA 3DTDA 4I18B 5FM5O 1FFOB 4F92B 2DKMA 3Q6FA 2OSWA 4JVPA 1KF9B 2IMMA 3GSVA 3MLZL 3O9WA 5HYEA 4AVIA 3RI5K 4FQIH 5IWLA 1BLNA 1ND0A 2F5AL 3UTSA 1KN2L 4L3EA 5EO0A 2TSAA 4M43H 4RQQB 5D1QC 1NBYB 4AIXA 1DE4A 2VITA 5D5ME 1NC4D 1B0WA 4I5BA 3AY4C 3QIWA 2XC8A 4W9GC 1CFSB 5D1XB 2HVJB 4R26L 4UDTB 2NW2A 2JJVA 4QHKJ 5MI0C 1T20A 3OKKB 4QJ5B 1M4KA 4NS0A 3K1DA 5E8NA 2P48B 1SN2A 1WF5A 2ZYSA 3NIFB 3DIFB 1A7NH 4WFFE 1RHFA 1QFUL 1OQOA 1P84J 4WO4C 4ODSL 3VM5A 5AVWB 3SPIA 1H8NA 5JLZA 3U1SH 2WXJA 2WBJB 4EUPH 5IIEB 3DC0A 3E3QE 3KPSE 2NX5D 5JNYB 4XN2A 4MJJA 3ARXA 2D3LA 1CG9B 4JQIA 4KPHH 4OIAA 2AQPA 1HHHA 4JGNA 4LRNL 1YN6B 2DJMA 2NYZA 3CHPA 3WKQA 3BAWA 3CIQA 3MNVB 1QFPA 5FOBB 5HI5C 1TNNA 5AYQA 4ELMB 1LEKA 3QQDA 4P2RD 4QUOA 4A38A 3QDHA 5A2JH 4NDMA 2X1OA 4AUJA 1HHJA 4WI0A 5BV7H 4HUMB 1D5MA 1UTDA 2N7AA 2OMUA 1XVSA 3DRTB 1KT2A 5J12B 3TN0B 4XPTH 4ZXBC 2OMNA 3IE4A 4O4YH 5ADPH 2BFGA 4I3RH 2APWA 2DIEA 2HKFL 3DETC 4PGZA 5CHNA 3TGXA 1BXXA 1XH1A 2ZOLA 3DXAD 2EDKA 1WUZA 3DMMD 4HG4K 4AVKA 1U8MB 2EUXA 3P69A 3PU7A 1MCWW 4KJPD 5I0XA 5AWNL 2O72A 1JK8A 3JYBA 4I3SL 4M4RA 5J1SC 1XIWA 4JFOB 3KM1A 5EZLA 5CD3B 5IEHA 3AMKA 3H2PA 4DHLA 2A4CA 2YAQA 3SDAC 1G7IA 3QG6B 3RDTC 4ZAKB 3NJFA 4PRPA 2F15A 1YNTF 4JMXA 2ZG3A 1QSFB 3SE8L 1DN0A 3DOIA 3TS8A 5EZOL 5T1KD 4I48B 4YO0A 4AJ0A 3BH8B 3CN1A 5L2JB 5GPRA 1J5OH 4G7RB 2N4IA 3HVDA 1QFHA 2ZCLL 4WI4A 2ESVE 4N1CA 1ZGLA 2TSBA 3OR6A 5ANMA 4CVWA 3TF4A 1HESA 3M1OA 4BFGA 3S3PA 5I16A 2X6VA 2GG1A 2AP2A 4S0TD 3TEWA 3FT1A 1ZT7B 4CA4A 5FFLA 1CD1A 1YEFL 2XWZA 3QIBB 5IEKA 2E7BA 4J39A 2O5YL 4DQAA 3A21A 1DQVA 4LAQH 1TVDA 3QNYA 3QFDB 4Y2OB 2NY2D 2KDYA 5LVEA 2DQGH 3M6DA 3EYUL 4PJ9D 5JHLH 3A22A 4AEFA 3QYCA 3GUTB 5KVDL 4PJBE 4EIUA 3H0TB 4PJEA 4DVRH 2YRPA 5ITBL 5J11C 3N06B 1WT5A 5IGXL 4GP8B 1PZUB 2ILLA 4HKXB 3K6OA 3T4AB 1OZTG 3GJEB 4GAJL 3ZHLA 1Z9PA 4OZIB 3G5ZB 4JZJB 1ITBB 4BELD 1UVQB 2RBLA 5K1VA 2DYPA 4X7SL 1KIUA 4NZFA 2FJHA 3QJHA 5CF3A 3MV8D 2UXVA 4PWEA 2AJUL 3DSFL 4JN1H 4QRUA 1RXLA 2F6AA 3LPGA 3N42B 4PWFA 1BJ1H 3DO7B 4GG8B 5GS1B 4PJ8A 1BQLL 1NJ9A 3CZGA 2C8NA 4GKOA 3DX7B 4GRWF 1YPZF 3D18A 1ZLUK 2P47B 3KJ6H 3IKKA 4ZFFA 3W11D 1DANT 1NICA 4DSYA 5E2VH 1MFVA 5D5MB 4FFYL 2EC8A 3MLRH 1U2HA 3UJTH 1F3DJ 4JHWL 3K5SA 3D85A 4N0CC 1OT1A 4Z7UF 4KNSA 1E5BA 1DZ0A 2F8VA 3QRGH 4QAMB 3UADA 4FULA 4PLKC 4ZUSA 5BW7C 4GT0A 4TMPA 5FDWA 4N2KA 1T1XA 2JIXA 3LPFA 3SE4C 3D3VD 2RCSL 1DFBH 4ZFFB 5I1EL 1FN4B 1E30A 1SOXA 2E46A 3SQBB 3P73A 5GRJL 2I60L 2VDPL 4FQ1L 3CLFL 3NZUA 4PPTA 2RALA 1N3NB 3G04B 4FN0A 5DURD 3KPSB 3UYRH 3UL4A 1F3JB 4FFZA 4ZD3H 2P26A 4HPHA 1K8DB 5B22A 4J3SA 3APNA 4CADA 2GC4C 3V0AC 3IN2A 1RMFH 3WS6C 3TVMC 2VLKA 1HL4A 4ZDHB 5I24A 2J6EL 2JJSC 3CFTA 1CD0A 1F4WL 3CFJB 5E0QA 4PY7B 4N2BA 3VX1A 2XQBH 1H15A 2AGJL 2FYYB 2WYZA 3JTSA 4JO1H 4ZS7H 4HJ0D 3VH8G 5BCAA 1CR9L 3IVKB 5C9KA 4IDJL 1QA9A 4JO4H 3AITA 4EZKA 3U2SB 2PCXA 2OSLA 4RISL 4ANUA 3TESA 1C5CH 2FJGA 4M1GH 1EXUA 5EUKB 3WY2A 1IGFL 4F24A 4JFFE 3LS5H 4KKQA 5LGYA 1XCTA 4WEEA 5JQ6L 3VYOA 4JM4H 3KS0J 4Q6IC 2BHYA 1MHPH 3QDGD 4UB0H 5C0AD 4BA0A 1DEEB 4OF5A 3FFCA 5MEOA 2FWSA 4AUUA 4P5SA 1YLBB 1P7KA 1GHFH 3ZR5A 4ABVA 3IS0X 5I74B 4HS3A 3CLEH 3T0AA 3MOQA 3NQIA 3L6FB 4EZJA 4QEGA 1E4WL 2EIEA 5EF3A 1D7CA 2A6IA 4HZLA 3B7YA 1YN7A 4OKVA 5HI3D 5IQLA 4LLDA 5EEVA 1U95B 1CGTA 2A3TA 1BIHA 3LXAA 4MMXA 4HC1A 4ZFOB 4MXWH 1A6AA 1DJHA 2C9VA 5SX4H 3TTYA 3HLAB 1INDL 4PTTB 3RGVA 1LK2B 3EZ8A 2CK0H 2QV2A 4JR9L 3TNNB 3VMPA 4OF0A 3NTCH 1BWMA 2ESVB 3U4EA 1UZGA 1UT9A 4OQ1A 5GGQH 4Q8BA 3EH1A 4D0CB 4DIXA 3MUGB 4UV4L 3B2DC 4YXKL 4NZDA 4W4NA 2AFNA 4KI1A 2V5YA 5JXEA 5EEZA 1G9ML 2F58H 1DP0A 3HG1D 1E40A 3ZDYF 4QYOA 3DUSB 1RIUL 2PPFA 2E27H 5L2KD 1TSRA 3BP5B 5IHHA 3PHAA 4I9XA 1E43A 1CDHA 2J1KA 3NCJH 3DUUB 4JPIB 1NCCL 1VJSA 3I6SA 4L8CB 4HQQL 2QQLH 4LSVH 4NP4H 4PJBB 4F8OA 3VWKD 4X6BA 1E5AA 2QZQA 3PG2A 4MJID 1UWEH 1XGQA 2HH0H 4L4VD 4NQXB 4FZEL 1RZGA 5IM7B 3Q43A 2BOCA 4MAUL 4KI5D 4K5MA 3CVBA 4XX1E 4KBPA 3OAZH 4IHBA 5EC1A 3UXFA 4BGDA 3SZ6A 2J8UF 3QXVA 4AQEB 4ZOEA 1MCKA 3HE6B 2D0HA 4P2CG 3HZYA 4PRID 4EZMA 4AIZB 4KMQA 4AJVA 2OLDA 4GSUA 1L7IL 2NZIA 3BGMB 1MCEA 1F6FB 3B2VL 4NNYA 1ZXKA 4I4WB 1FZMA 2O5ZH 1LJMA 1TF4A 4ZRGA 1F13A 1X5AA 3K4DA 5CN1A 4ZO8A 3SKNA 3X14B 3MQIA 4Z7QE 3SCMC 3C60A 4J27A 1N5AB 3B9KB 5EORL 3VXMA 1UGKA 5BMFL 1XGUA 1L9PA 2YA0A 2D7MA 3HMXA 5F70A 3BEVA 5L4JA 3C8HA 4EQ2A 4UNIA 1NEPA 2CHXA 2IBZX 3TA3C 1G7PB 3LRSB 4L9LC 3W0WA 1A7QH 4WSJA 4I89A 4KO6A 3VG0L 5FYLH 3VGHA 4L1LA 5ABZA 4ZPTA 2A74A 3K0YA 2AQQA 3E6FB 2DLEA 3EGSB 4KDTA 1WFTA 1WA2X 1UCBH 8FABB 2DM2A 1KXTB 3ARDB 3ESMA 5I15H 4QHUA 3DO3A 3U0PA 3GI8H 4FQCH 1AS6A 1AXSA 3O9WD 5D1QD 1A8ZA 4V2CB 2A9ML 2QVTA 1ZLUH 3WNKA 1CLYH 1L4IA 3UTSD 4L3ED 1NOFA 1QUPA 4AM0B 2DEWX 3V0VA 4LEEA 4R6UA 2W60A 1N6QL 3G6DL 2FSEB 4QHLB 1CL7H 3QIWD 3KGSA 1HSBA 1LK3H 5D9SA 1FL3A 4BA8A 1RU9L 5E1AB 4IK7A 1NTDA 2UX6A 4JN2A 2FZ3A 3N1MC 1JGVL 1W72L 3NRPA 4JL1A 3H55A 3EGDB 2XQYA 1UB5A 4HALA 2R0LH 4FLHA 1MQKH 1I8AA 3P1VA 4ZOCA 3A5VA 3QWRA 3PGFL 3BUBA 3R7QA 2HZHA 3L3KB 2WXRA 4PJ7A 5FA4A 3MMEA 2VW6A 4JFFB 4A6YA 2PCFB 3JUYA 1OEZW 2QDWA 1SYVB 1J9SA 5GSRA 2K3TA 3F6LA 4ELKA 1NGYB 1VFBA 5FYKE 1FYTE 4UQBA 2I7OA 2GK0B 4ZUWA 5C0IA 4O58H 3RG1C 3V5DA 5I1LB 4LFHD 4MQ7A 4Z77B 1QHPA 4ZO6A 1H6UA 5D7SH 1OGAA 3FPXA 2VLJA 2X9XA 3P77B 3V4UL 1FGNH 2J44A 2YN3A 1MCPL 4JCWA 2FGZA 1OSPH 1F1DA 4M6OH 2VZOA 4HIHA 4NN7B 4E5XB 1UOWA 4APXA 3UH8A 1YY8B 3BKML 4BJLA 5LGHL 3U0TA 3PJNA 1SF5A 5EIIA 4N86A 1NSNH 3T4YB 5E2UH 4HLJA 1HEZA 5CEXB 4HCRL 4L4TE 3CZEA 2XJLA 1KB9J 2DWXA 1KIPB 3RVUC 1J86A 1X5IA 4Z23A 1OB1A 5KVFH 3EJUA 4OF3A 2R8SL 2UYLA 4XNMA 4HWUA 4ANVA 3V10A 3IMBA 3KYNB 1LEGA 2F0CA 3OPZH 1A6WH 1U6AH 1RUPL 2ZKXA 3LZPA 3B2UC 4XN4A 2BNRA 3KWXA 1CYWA 1TZGH 3Q2VA 4YWGH 1FZOA 1VFAB 1G7LA 3BWAA 4JKLA 4PJ5E 4A7VA 4DQOL 4QRSB 2N1TE 2FGWL 4W93A 1U8LB 3V6BR 3QJSB 3OKDA 3UTTE 1T0OA 4CVXB 3NG5A 1R6VA 4HFWB 5JA8B 2WUBH 4PRPD 1JD7A 3QORA 2H1PH 1SDAB 3M88A 4X5PA 1AFVH 2JI1A 2AEPL 4X7TB 4LLVB 1MELA 3GBNL 1NFIA 1KCUL 1M05B 2WYHA 3FQWB 2V0AA 3TX4A 1R4XA 4KTDL 4FQLH 1UM6L 1MCJA 3ALXA 1TT6A 3EFOB 2GI0A 1I8UA 5BO1L 1S7WB 2HKHL 2ZYHA 4K94C 4HHAA 1HH6B 1A1OA 2P3YA 3D87B 3V6OC 4TXVB 1FG2B 3HNSL 4QJ4B 1E5CA 2VN5A 4OCSH 4KNQA 1QZ1A 1AZCA 1UZ6F 5J1AB 4F15B 1M57B 5FA3A 2VJ8A 4Q9QH 1FRGL 3VXNA 1N68A 4RMWA 3S37L 4A2LA 1QUNB 2C3WA 1X5ZA 1KTRL 1T4WA 4OQTA 3IJHB 2DMCA 3EFDH 4LIQL 5KAQG 2XN9E 1U2YA 1ETB1 3DX4A 5H94B 1KWGA 1W9XA 2ZXBA 4K7PX 3SDXF 4YDLB 1AIFB 3EYVB 3GXFA 1WCBB 2O6FA 5DA0B 1MRCH 3E1F1 3SN6N 4I88A 4EI6A 5H37H 1HNYA 5IR1B 4B9PA 1YEDB 1G7HB 4PVLA 5K33A 4E9QA 4Q2ZB 2DYPD 1E4HA 1TEFA 2YD2A 4N5ED 5DZJA 4MWFB 3VXRA 3I9AA 4UNTA 4JG0L 3MODL 5IB1B 4OD1L 4FXTA 4ZBJA 3GRWL 2R69A 4PJ8D 4PI2A 2PP9A 3T6XA 2AQ3A 3UBFA 4D94A 1BD2E 1ZA6B 1URZA 4PV8A 4MDJB 1OK8A 5EULV 2EYTA 4RGMB 3O2VL 5ESQA 4N0CD 3D51A 5GGTL 1I53A 4EJ1C 3HC3L 1OAKL 1R3IH 2JB6A 4FL4C 3CUPA 4AQ8C 1FE8H 1ZAGA 3SDDC 4PLKD 3D85D 1OOAA 4Z1PA 4HJ1A 1HXYA 1S9WB 1Y6MR 4DGIH 3X3GH 1KACB 1UD6A 2F53E 5IV2B 2GYSA 4O02A 4OLXH 1P4UA 1SXAA 4XN5A 4X98A 1MNNA 4JFEA 4UDUB 1X7QB 4PJXF 5I5IA 2A6DB 2J1ZA 3GM0A 1FAIL 2JCCA 2JIXD 2YD7A 4HCFA 4QO1A 3TPUB 2FLBT 4BH7B 4JGMA 2LU5A 1WAEA 5EN2B 2YPKB 3MGTB 4A7GF 3IDIA 4HJGB 3TVMD 4LKXB 3QPQC 5GSVA 4Y4FB 4C56E 2Z4TA 3GS4A 4HT1H 1FYTB 4TS6A 3BOVA 3IETB 1USZA 4PB9L 3VWJB 2QKIA 3FONA 3FT4B 1AYRA 5DRXB 4WO0A 2OX5B 1UKTA 1KCRH 2F7RA 2WVUA 3HKZA 3JV4A 4KXDA 1MLBA 3ZN6A 4RMTA 3U83A 4BFOA 4PJIA 4YHNB 4XWGL 1K4DB 2XBTA 3CX5J 3HPLA 4EUPG 4PG9A 3WKPA 1KUMA 1NGWB 4LSRL 4B9YA 2OW7A 1PL3A 4CC0A 5TE6L 3VRIB 3KEHA 3KM2A 4XZUA 4AEIL 4Y4KA 4L4TB 1UOLA 2ZONA 3OJDB 3K71B 3VTAA 2P7TA 5DLML 2DIBA 4NAJA 1MFBL 3T3PE 4ACTA 4JMNA 2F68X 1U93B 2G5UA 2X09A 3SGJC 5HYSA 1QKZL 2Z31B 1H3XA 2AV7B 2AW2A 3WLBB 3M17B 5LXGL 4QHNB 3FFCD 3KDMA 1W6LA 1DBKL 1NFKA 4GW5B 2V3DA 2X3AA 4X8XA 4PJ5B 3WN5B 2H32A 4HBQA 3TNMA 3HR5B 4GQQA 4Y4HC 3WS3B 4KKBC 1WC7B 1X5FA 3UTTB 1IAIL 1NAMH 4EIGB 2IPUK 2XWJB 3C5JA 3MZGB 5FLVA 1YQ2A 3SYPA 1F6AA 1S9KC 4HV8B 4YSSA 4P57A 2BWDA 1E6OH 3QI9C 1KGIA 2AKRA 4RAVB 4IGBA 5KN5A 1WLHA 1WIOA 2IDCA 2UWEA 4WNSA 1IBGH 4L5FL 4XP1L 2NPLX 1RFDH 2R56L 4ZO9A 1OAYL 2Y07L 3FQ2A 1NBCA 2IGTA 2PPCA 5IT2H 5LN4A 5FGBA 2J55A 1QPKA 4LSQH 4N0UA 5I0DA 3WKMH 5HJ3A 3G5YB 3MOAH 2G5BA 1KTCA 3KL3A 4DUWA 4LL1A 2QSTA 1K4CA 1E9PA 5KW9L 5JXED 1OE1A 4M5TA 1DFXA 1KFGA 3KPLA 5FAAA 3OGCB 4AC2A 2NY4D 5BUAA 2EIBA 3RU8L 3DROB 1E0OB 2IH1A 4S0HA 2O6DA 3BE1L 1JI2A 1TTUA 2XN9B 4YXHH 2G75A 4ZNEE 3EOBB 3BQUA 3DECA 4MLSA 3DHPA 4OFKA 3LRMA 3MRDB 4LEOB 4K5OA 1OAUL 3AM8A 4HMCA 5KSUB 1KEGL 2NY3B 4J3OF 3VDAA 4XAWH 5HDBE 1NPUA 4HSCX 5I1DB 3HG3A 2A6KA 3UAEA 4O00A 4B41A 2ZUXA 2OCJA 2UVFA 3L9EA 3WSQH 2OJEB 4ABQA 1VLXA 4N8UA 4P2YA 5ILTL 1IAOA 5BO0D 3SDYH 1AKJB 2XVBA 1T3FB 1SYSB 1FUNA 2E9WA 3Q9PA 1GVIA 3BPNC 1NGQH 2XZQH 4G6AC 5GJSL 2J6WA 1NM9A 3MLXL 1QBLL 2BWQA 5F44A 1BD2B 4CC4A 2EDQA 2DJUA 3JVFC 4HKJA 3NQKA 1TJIL 3IWVA 4NB7A 2EXTA 3TA3D 4NUMA 3GSNB 4TVSa 5EBMA 4XCYA 1G5AA 1EPFA 2R51A 4OZHF 1S7TA 4WK2B 5IHZB 1D5XA 1DVFC 4NO2B 3FTVA 4C57C 4WW1B 2F53B 5GGRB 3L7FB 4Y9FA 2EKSB 1T5KA 1EQWA 4HX1B 4OTXL 1TSHA 2CBTA 5L9DH 1WS7A 3UCQA 4NNPH 3LIUA 3NGBC 2MOVA 1N70A 1OSEA 2CUAA 4LLMA 4XMPH 2EZ0D 1IKNC 4ZFGL 3WIAA 4EIZC 1FSKC 4B95C 2W65A 4TULH 2ARJB 4Z7NE 3D0LA 4OVUA 4C56B 1R5VB 5I6XC 5KSBE 5G2NA 1QATA 3GSQA 1EZUA 5A40E 4PJDF 3O8XA 4RGOL 4H88H 4RIRB 4MBOA 3DV4B 4FABH 4NSKA 1HKLH 3FSVA 3ZHDA 2P46B 1E4XL 3HBZA 3C9NA 4UQ2A 1MWAB 5DHMC 5IJKA 2JQMA 3BHBA 3D2UA 3WNJA 2PKDA 1F4YL 3OB0H 5F7LB 5IJVA 4J5VA 1XB8A 1KLGB 1QFWI 2WVVA 2JKIS 2X4TB 3BKYL 1XGTB 1UT1A 2ZE0A 2Y5TB 1I7UA 3STZB 3FAWA 1S7QB 2V2WB 5AYTA 2QQQA 1BDYA 4A7TA 1ADQL 5DJAB 3K2KA 2DDQH 1U91B 1TKWA 2C9AA 3FQNB 5ICZB 4E42B 5F3HB 3T3PB 2VJXA 4NZRL 2JWYA 2I5YL 4DZBB 4NUPA 4X7EC 1P69B 2O6PA 5F1SA 5FWQA 2ZUWA 3V6FA 3FQRA 4HUUB 5JORA 1OGAD 1ZLWK 3GJFA 5C9JB 1ETA1 5CIPB 2VZTA 1G0XA 1NCTA 2R2EA 1ZHBA 1SVZA 2CLZB 5EZIH 3U0WL 3I75A 1U30A 2CDFB 3U7WL 3IEAA 3L3DB 1U8KA 3O6FC 4HPOH 3IAGC 4ABWA 1HYSD 2AQTA 3QJXA 4GO9A 5FGSA 2L7JA 2D3NA 2YMOA 1XAUA 4YDZA 5MHSD 2CO6A 2WAQA 2HLAB 3RWEB 2EVIA 2HVKB 4OSUH 1TTBA 4PW4A 2BPBA 5J8OA 3OC5A 1CI3M 5ADOH 4FQIL 1DDHA 2OMZB 4JANA 5AAMC 4XXCA 3JYCA 4NCC2 2X4RB 4M03A 4Z7VF 3UOAB 2BNRD 2WUCH 4RZKA 4ZS6D 3WIIH 2BRQA 3LMJH 2PXYA 4R97B 3UEQA 1FNSH 3G5XB 4CRPA 3GGWB 4G5ZL 2PWEA 5I6OA 2JI3A 3QORD 3FU9A 1CFNA 5I17B 4XMTA 1JZIA 4PJXA 3KXFA 3V5HA 2VERN 1PSKL 1IM3D 1RLBA 5HDBB 4PYGA 5EUOE 2V8LA 2O5NA 2RFXB 2WNWA 1PTZA 4X5WA 5CN2A 4MZIA 1JPSH 3FTGB 1QWUA 5IHWA 2QHRH 2C9UA 5B7EA 4XXDB 5DTFB 1OHZA 4JKWA 1QYGH 3L2LA 3L16A 3BDYL 2BSSB 2ARJQ 5DT1L 2GT9B 1SY6H 4XVUD 5D7IE 3L3JA 3W37A 1R24B 1EBAA 3HI5H 5KJ4A 2QELA 2DYRB 4BK5A 1BVKB 5GZOD 4ORZC 2JKXA 3K6FA 4HKZB 4LSTH 3UX9B 1FV1B 2AK1H 1BVZA 2OK0H 3MUJA 3EG9A 3ZQWA 3LKRB 4GRLB 1TVHA 4P2AA 5DJ8B 4B7IA 1TZOA 3PWPE 4XPTL 4IRZA 4JNXA 2VW7A 1GGIH 4OF8A 2NY6C 3O3AA 2ZG2A 3RKDC 5IK3B 3T08A 2Y7LA 3B9EA 3ZE1E 2Z4QA 3AS3A 3ULUH 4TNGA 2E4TA 5GZNA 1KXVC 1S7UB 1GMEA 4XO9A 1PMYA 2Q1EA 3PQYA 4N85A 4ODHL 1AGBA 1KB5H 1A4KB 3VXRD 1E4KC 3U82B 2NYYC 3QDJA 4XO4A 1A7OH 4QGYA 1WJ3A 3KBHE 2WBWB 5IVXF 1TTFA 3T2PA 4YFDB 1ORSB 5JZ7D 4LKCB 4BWTA 3PXHA 4OCYH 4JG9A 4Z7NB 1FNEA 3ZU8A 4OGXH 4LPXA 4UMGA 3S5LG 2CUHA 4G9FE 2OXHB 2V7HB 5EZJA 3INOA 4DGUA 2NX5E 3GMOA 5KSBB 2DWDA 2QFRA 1J8HA 5FS5A 2WLJA 4NQVA 3IRCA 4F9LC 5CZKA 1QTPA 2LW3A 2R2BA 2XWDA 4K0OA 1J5OL 4WWPA 4GP4B 3WUWB 2Z8SA 4P2RE 2AJYH 4Z7WE 5FDYA 2BWIA 3FBQA 3FW6A 5I6KA 2ZWYA 3GMNA 3F05A 4Y2NA 3TH3T 3LEYL 1OAZH 2XZAL 1ASOA 3PDDA 3R18A 3IYLW 3KNBB 3RWDA 2JELL 3OLDA 1YDPA 4JFED 1SDDB 1ESOA 5HVHC 4DCQB 3ENEA 2B14A 4XC3H 1QPXA 1I7ZA 4TSCH 1ZXQA 3EAKA 3W9EA 3NABH 5AVTB 3QPQD 5ESVA 5T5FH 3X1NA 4OZFH 1U3JA 2NY1B 5C0DA 3MBEA 4UM8A 4MNGA 1GC1C 3JWNH 3OPUA 2E7LC 3KCPB 3OZ9L 4LOFA 5JHLL 4RDBA 1RERA 1LNUB 3PE9A 2QR0A 3MFFB 1CVSC 3VA2C 2R1YA 2LU7A 3QHFL 4CILA 4DVRL 1NGPH 2VLLA 5T1MB 3ECUA 2J5LB 1EMTL 4FYTA 1IM9D 3BGFB 3THML 3V0DA 4J12A 4N6RA 5F1KC 4E9YA 3OKEA 4F3FA 1GR7A 3ZO9A 3PGDA 1J1OH 3QRFM 4RSVA 2P8MA 4J3OC 4C58B 1T7YA 4YHIA 4XVSL 2FUTA 4WHCA 1AGFA 4CGTA 4FFVC 3MRCA 4JN1L 1OPOA 3O0LA 3S0PA 4OJFH 1RZ8A 4F5CA 2PO6A 3MRBA 4Y4KD 4AEEA 3HFFA 1AMXA 2V5SA 4NNXB 2XHNA 4LCCA 3V0WL 2W88A 5A6IA 3VH8A 1MHCA 3VGGA 5CR8A 2GJPA 4GMTL 2GW5A 2NTFA 4DK5A 1WFJA 2ICEC 4KKBD 4LARL 1OY3B 1OP5K 1Q1PA 3MLRL 1JBJA 2IMNA 1DVUA 5EPMB 1P6FA 4LEXH 1ZLWH 3UPRA 3MRMB 4M7ZB 2EYRB 4BQ6A 3O45A 3QRGL 1L0QA 4LSSH 3JBG7 4A04A 1D9KC 2AQRA 2Q8BH 1KBGL 4HEME 3BYTA 3S8GB 4HKBB 3K6IA 3PABB 1P7QA 1VEOA 3SKMB 1T7WA 4IGBD 1CICA 5EUOB 1EAQA 1T1WA 1XGRA 2A4EA 2WXHA 3FQXB 2YJLA 3GXNA 3L95A 5I2IA 1WG3A 4PR5A 2YGVA 2D2CC 3KR3L 4ZD3L 2ZD0A 1DBML 1O6VA 2FWOB 3FCUB 5HDOA 3TZVA 2H47C 1NFAA 3BO8A 4X4YA 1JGDB 1MCQA 5IW1A 4KZDH 1JRHH 2MCAA 4W1TA 1KTLA 2KYIA 1QI3A 4AV5A 4DN3H 2X4PB 1NUDA 1MCFA 5IB3A 4KRPC 5D7IB 2KQMA 1ZVSA 3GRWA 4A2MA 4TUOB 1INQA 3BD3A 5IFJB 4JO1L 4W9EC 4IEFB 1ADWA 3BQUD 4V1DE 4ONGL 4MBRA 3P9MB 3PWPB 4W6XB 1C5CL 4HK0B 5INDB 1JNLL 5J6HB 2APVA 1EO7A 1ROWA 5HJGA 3ZE1B 4LHQB 4WUKH 2CKBA 5FO8B 3EUUA 3S96A 4H26A 4TF4A 4FKKA 4G6MH 4MA3B 4R96B 3EO0A 5HHXH 2ZX8A 4XP6L 2I85A 2DQJL 4LCIH 2GCYB 4MA1C 3QJOA 1NMBL 1BVLA 2QLVB 3OLEA 4TPRL 1CFMA 4LHJB 5E6YA 5IG7A 5JOPD 3EO1B 1G6VK 5DVPA 3UBXG 5C0EA 3T0EA 1P5VA 5BZZA 4GIPD 1Q9KB 2AJVL 1U8IB 3LNGA 2CHDA 4WY7H 1NZRA 2WLHA 4FHBD 3LX9A 4Y5YB 4G9FB 4MX7B 5H37G 2NX5B 3L2NA 4ATTA 1UT2A 2ZKHH 4J2XA 5LDUA 4P5TB 1KGCD 1DVFD 5EU7E 2Y6SD 4NN5C 2OTPA 5C6PB 4ADGA 5DRZA 2EILB 4P2RB 5DHVH 4Z7WB 5TQ0L 3F00A 5D4IA 3SDCC 3VI4A 4JZOA 4JQVA 3BSZA 1OT2A 2YA1A 1ML0A 4PD4K 1E5YA 4YHMH 1ZDSA 2K1MA 4MMYA 4OAWA 4MJ4A 1SJHA 1L6ZA 5AZ2L 4CMMB 1B2WH 4R7NA 4HFUH 1S46A 1D5IL 4OGYL 4DTGL 4C4KO 3KBEA 1NFDA 4K71B 4U49A 3HI6L 4NZJA 4LSUH 4PJCE 2W0PA 5LAPA 3D09A 5D7LA 1N59A 4F7EB 3DMMB 5HPMA 4NERA 3AQXA 4L0PB 1RPQA 3O81A 1OALA 4M7KL 5FYJH 1QAWA 3EH4B 4FG2A 1MCNA 1UWEL 1XFPA 1NLDH 2Z35A 5AUMB 1RHHB 4X99A 3D08A 4M56A 2YBRB 4MD5A 1VRSA 5J13C 2DQDL 5T3XH 3NJVA 1B0GB 4EI5C 3VFOA 2FIKB 4WGVB 5DJDA 2W95A 3CSGA 2V9UA 4EBQH 4NJ9H 5IROC 3G6AA 2CMRH 4FJYA 1KJ2H 3VJ6B 3KLAA 3MLPA 5T1KB 3WV0A 4NI6A 5E2WH 3LPWA 1LO2L 1EJ6A 3QULA 3CSPA 4NC1E 1HVXA 3OAYK 2YGOA 2QQKL 2FUQA 3NH7H 1M1XA 5F9OH 3FT3A 4G8IB 3Q01A 2AJXL 4GSXA 3L5XH 2NSXA 2MNWA 1E7UA 5T3ZD 2BVPB 4FKHA 4DW2H 2I9TB 3HG1E 5IVNA 2WCSA 3D39D 4KXZH 4N8CH 3QQ4B 2WZAA 2L8AA 3MRIB 4HEPA 4S1SL 2PYFA 4K94L 2NY2B 1I8IA 4BH8A 1FO0H 3ROOA 4PJ9B 4FI6A 2F8OA 4Z5RA 2BIPA 5KANG 1ZANL 4AW7A 2LLGA 4H25A 1XSIA 1NDGB 2JJTC 1E9OA 3CDCA 4OFIA 4XN8A 3ZY7A 5B7FA 3GI8L 5I15L 4FQCL 2PP7A 4MJIE 2DWEB 2XBZA 2QGDA 3ORJA 4L4VE 4Z95L 1XQ4A 2YC1A 5E8OA 1QRNA 4KY1L 3EHBB 1MDAA 3X1BA 1AGCA 1XR8A 1JGUH 3UG5A 5IB2B 3SO3C 1OP5H 3NN8B 3RWGB 4L5FE 1CL7L 2W9DH 4GEIA 4L37B 4PREB 1LK3L 3CSTA 5DHDA 4UTBL 1QLEB 2YPVL 3X1GA 3OKNB 1AD9B 4PVNA 2FL5A 2IANA 4U6YB 1MSPA 3SGKA 3OKLB 2OR7A 4ACPA 4HS8H 2VN3A 1C08A 2DB8A 1A6TA 3R0MA 4V1DB 4X5LA 1WAAE 3KXFD 2ZOKA 3MGAA 1HFUA 3KPRA 4F2FA 4ONFH 1AZZC 2MCG1 5A16A 1MJUL 1OP9A 2JI2A 3I85A 1UD3A 1DO6A 1EFXA 3A6CH 1F86A 5I19L 4O58L 1QO3A 4KKRA 3O2DA 5CJQL 1BBJA 1J48A 3MRFA 2GBVA 5D7SL 5DRNB 3DTUB 4XOCA 3BGAA 2ADJA 1DDTA 4FP8H 3RE0A 1BX2B 4HJJH 3TYGH 2F8IA 2DQFA 2CPUA 3FO2A 2Z8WC 2CCVA 4QOKA 2KLRA 3Q1EA 1WHPA 2CAKA 2ZXCA 2IH8A 4I77H 4MD4B 5DURB 3SE6A 5DJ2B 4PP2A 4CNIB 3UTSE 4L3EE 4I7ZC 5G4NA 4ZT1A 2BDNL 3NJMA 2ZWKA 2V9TA 2Q7AA 1L3WA 3VRJA 4ZXBA 3EJTA 2UY7A 3ARBA 4AWJC 2YLKA 4B9ZA 3QWOB 4G83A 4Q9RL 4UQEA 5GZND 3QZPA 4K3EH 3QUZC 3US1A 2DKSA 4IRSC 4NRXB 3VD7A 4OVVA 3VFNA 3DDFA 3AS2A 1Q0YH 1CWVA 3FB7B 1RVFH 3MA7B 4DN4L 3GLAA 1S8DB 4JLRA 4HA1A 4D8OA 4Y16B 4NRZB 4YSQA 3LHAA 5EOTB 5L88H 4PJCB 3IGLA 1H3UA 3L5JA 3CFBA 3CZLA 4KHXH 2V5TA 1HZHH 5I76B 4P9ML 4IKLA 4TOYH 2ITDA 4F58L 1J8HD 4P0DA 1FIEA 4AGPA 4LVNC 1NMCC 5BVJA 1IGIL 3M7FB 1QASA 4HOWA 2ZXGA 1YEIL 1QOKA 4NKOB 1IBHA 3FRUB 5E5LA 3SQRA 1RCYA 5JXAH 2DY2A 1THCA 2VRKA 3JVGC 2F74B 4EE2A 2Q2LA 4OLWL 1U2CA 3EH5B 5K9KB 3LQZA 4HISA 4LVHC 4IBUA 4IBWA 5FO7B 3S36L 3N85H 1DVQA 1EJOH 1ZSDA 4OCSL 2VR4A 4IBLT 4OD3H 1A2YB 2EDDA 5AW2B 1GJUA 1JMXA 2AK4A 4NM8H 2OZ4L 4Q9QL 1RK7A 2CH8A 3DVFA 3R4RA 2Q87A 1LD9A 5I8KL 3VXTA 2WCGA 4XMXA 2NDGA 3EFDL 2AZAA 5IHUH 4DPBX 1N4XH 1JG9A 2OMXB 5TH2A 4N0FB 3HI1A 1DVTA 1TQTA 2L7QA 5JHAA 2BXYA 4UT7L 1E28A 2WYIA 1PVHA 3FYIB 1YECL 3HG1B 1MRCL 1Q9LB 3WYRA 1W0VB 4XGZA 3QAZC 2P42B 3TIDA 3MR9B 4TVPE 1T0MB 1QNZL 1QFOA 2C9RA 4FFVD 4NJAL 2EDWA 1UATA 1DQKA 3MUUA 4URTB 2ZCZA 4NWTH 1IGMH 1R3LA 4K23L 3QEUA 4PRPE 4ZPVB 2VO5A 4BKLA 4CW1A 4TUKL 3ZE2E 1MEXH 2RH0A 1FDLL 2H6OA 5DJCA 2R23A 1T5XB 1YJDH 4JRYA 3T65A 4XXWA 3UYPA 3VGFA 3CVHL 4MJIB 2HN7B 5JOFB 4L4VB 4EUPA 2PTUA 3C5SA 1B0RA 1D7DA 2ZXEB 3OAYH 5FIEA 5IW3A 1U8JB 4A39A 2YOAA 2B59A 3MC0A 2HP4A 2OJZL 4C83A 4CVZA 4DEWA 1FE8L 5IESH 2P45B 2FJSA 2EYSA 4D9LL 4EXPX 1OTTD 4AH2A 2Y36L 1WE5A 3NIFF 2SEBA 3VG9C 5F3BA 4EN3A 3BESR 2GEEA 4OI9A 4OLXL 3WTTA 3US0A 5GS0H 3ZW3A 3RTQC 1PD1A 3F12B 1BHGA 3TIEB 3GF8A 3H9YA 2C3XA 5CJXC 2HT2C 3L81A 3QS2A 4PJEE 3WL9B 4OGAC 1GGCH 3Q6GH 3WELA 1CICD 3WTSA 3CDZA 3BPLC 5FUOL 2WLLA 3T1FB 1SMOA 1RIHH 4HIIB 5FKAA 1GYCA 5F1NA 5IJBC 4ELMF 4FTVA 4KRPD 2YXFA 2IPUG 1R75A 4QAWA 4X50A 2AVFA 2H3NB 1IL1A 5SWZA 3E1ZA 4XP5H 2VDRB 3FH7A 3L5WA 3KHQA 3B43A 5GRWA 3O4LA 3Q6FB 4NIKB 1WHOA 1BF2A 5CILH 1Q9WA 3GSVB 1EERB 5A43C 2HG0A 3LH2L 3O9WB 4U1JB 1CF8H 1GGBH 3F7YA 4UZGA 4X9IA 5LBVA 1H6EA 2GVYA 1BLNB 1TITA 4JE4B 1ND0B 4PH8A 3UTSB 1D7BA 4L3EB 1LO3L 2XUWA 5EO0B 3LIZH 5CGYC 2BIQA 4X6DA 4XVOA 1DE4B 2VITB 4LLUA 4Y2DA 3HHRB 3MCLL 5D4QA 4I5BB 3QIWB 4L48A 3CH8A 1H19A 4BSVA 3B2MA 2J25A 2NR6C 3CFDA 1JGLL 4S1DC 2COVD 3N9GH 3P0VH 1AGEA 2QADB 3A0OA 4JUTA 2JKTM 1WISA 4AZ8A 5HYJA 5E8NB 1I31A 1SGKA 3UJIH 2K45A 4G70B 4H8WH 4N4YB 4Z3IA 3KLKA 3S88H 2ZKMX 2KL6A 1DQMH 2NXZB 3T0ED 4XO3A 3QYNA 2XPZA 1IBYA 5JLZB 3FCTA 4G3YH 4PJHA 1VCAA 3LVEA 4HWEL 5EEXA 1G9NH 3S6CA 3V95A 1J5HA 1HHHB 1QHOA 1ZSHA 2BH0A 4AK1A 1E2ZA 1TPXC 4OCWL 3AAZA 5KS9A 2VLKE 1RFDL 2AJZA 1LEKB 2FX9H 3QQDB 4JFDD 4V2BA 3W3BA 4D0DA 5IT2L 5FYJU 2QVMA 2OULB 1H5BA 4TRPL 2EDYA 4NDMB 2O5XL 1KTBA 5F97E 4YHLL 3O6LH 2OZNA 5JUEL 4YX2H 4BHUI 2HUHA 1SVBA 4WI0B 1HH9A 1M6UA 2GHWB 4H0HB 1OHQA 2GSIA 3IF1A 2MNJB 1Q4NX 2OMUB 5I8EA 1KT2B 2GUOA 4KAQL 3TURA 1ZLDA 2EE2A 3UBHA 2DJ4A 4X4KA 3JWOH 4N1EA 5T3ZL 1YHPA 4JGJA 4GPVA 4XCCH 3KWWA 5AW9B 4Y5VA 1GGUA 5CHNB 4D9RD 2ZOLB 4OZ4A 4HUWA 2GI7A 5D7LD 2XV2A 1DUZA 5FC9A 1AD0A 4LLYA 3NSCA 2XX1A 3FFCE 4OZIF 4HXAH 4LL9A 1PAMA 4P4KC 3V9FA 3ABKB 3TA4D 1JK8B 4EI5D 4M4RB 1TQUA 1EHAA 2FO1A 5IEHB 3U46A 4S1QL 4OZFG 4H2CA 1CU4L 1G7IB 3N42F 4XNXH 4YPGA 3SDYL 3JWNG 4N8PA 4PRPB 3JWDC 3FNKA 3NIGE 3ZE2B 5SX4I 2BY3A 4Z7IA 3KZ8A 1PDKB 1DN0B 1CZ8H 1NGQL 4YBQC 2XZQL 3NCFB 3HS0C 4ILDA 3D34A 4YO0B 5LUMA 2X2HA 5JPMA 5EZPA 5D5MF 3RIAF 4MAYD 1B6DA 2DYSB 1ZGLB 4J1UA 3OR6B 4GKZA 2BK8A 5DHEA 2WZPD 3SCMA 3ALPA 3ZUNC 5I16B 5LBSL 3EZJB 4GXUN 1R3JA 1TOXA 3LN4A 4FA8A 4DP8X 5IEKB 1T66D 4R7LA 2WKLA 3JV0A 2AF2A 1FFPA 4R83A 3VXUA 3QO0A 4YSAA 4BZ2L 5D1ZI 3UFIA 4LSDA 5B39B 4X0KA 1MFDH 1U8CB 2YOCA 4NI3A 4R0LC 3O6KH 5EU5A 4NNPL 3NJKA 2P49B 4WEUD 4PJEB 1TETL 4U6VH 5JHMA 4BHUA 3PL6C 3TWCH 2JVUA 4TULL 5KJRH 1CXLA 4KOCA 4DP7X 4YSEA 4YVNA 3ELQA 1CGSH 4JREC 1Q94B 4U1NA 5AYUL 5JO5B 5I1GL 2DYPB 3MJ6A 1KIUB 4H88L 3QJHB 2C3GA 4M9OA 3VYNA 4F7CA 2EQDA 4FABL 1I8MA 4QRUB 3RL2A 5KVGE 3TCTA 2OMVA 3BVWA 4K9EH 2QMKA 5F6IC 2FECI 5TPWL 4PJ8B 2IAND 4O2CA 4AL8H 1FNGA 5HVWA 1NJ9B 4KX9A 3PV6A 4FHKA 2B5IB 2WTRB 3D18B 5BUPA 3GKZA 5C0JA 1QZNA 1NCBH 1PX8A 3CSFA 3GKWH 3CFCL 3I6LE 4BFKA 5E1QA 4ENED 5KVEH 4ODVL 3BVXA 1F58H 1X9QA 1PEWA 3KPRD 2LTQB 4D7BA 4GSRA 5BXFA 3D85B 2DWSA 3GSOA 4WSKA 1DJIA 1KBVA 5HHQB 4QRFA 3W0WE 1EFXD 4H0GA 1HAWA 3VXQA 5D6DA 4MKMA 2YARA 4A66A 2VXVL 3CHOA 1WBYA 5K69A 5FDWB 4KC3B 5DHYA 4UZSA 1T1XB 2OKMA 1NIEA 3MKKA 1X4XA 4Y7MA 2JIXB 1TDQA 4RZCB 2VDNL 2XXFA 3UAAA 43C9B 3JWOC 5EZIL 3P73B 3A4DA 1B0IA 4QOKD 2VDMH 1XMEB 5SWSD 2X3CA 4KO9A 3VSTA 3LZNA 4CADB 4GOSA 5H8DA 4ONHA 4XWOD 2V5MA 5C71A 2VLKB 4I18C 5EBGA 3ARBD 4IRSD 3HRZC 5D1ZC 1GC1L 5F71A 3TM6A 1OE3A 4P59H 3V4VH 4HZ1A 5ADOL 4M6AA 2XPYA 3QEQA 4QKTA 1H15B 4JPWH 4YJZL 1I9IH 2KUTA 2R29L 4KKPA 5EO9A 3ULSA 4MCNA 1F56A 1QA9B 4WFGD 3VO0A 1BPLB 1OO2A 2TRHA 3IFPA 1AG0A 1T22A 1KDJA 1FNSL 2OSLB 3KL0A 4M48H 5CP7A 3BP4A 4XPFL 4KVCL 3Q8AA 1BYOA 1EXUB 4PJGF 2M83A 4Y9EA 5D1XC 1XX9C 1F11A 4PJBF 1H9DA 1M53A 1XCTB 3X12A 1KGJA 3P02A 5BRZD 3S4SG 5EEYA 4OM0L 1R19A 3FFCB 2VDKL 2VNCA 1P7KB 1EANA 4FOMA 2UXFA 1GJIA 3DGCR 1P7HL 4GUCA 5JDSA 4HS3B 1OGAE 3NUKA 4WTXA 3S5LA 2WBJC 3WFEL 3NPSB 2CGYA 3GMMA 4XH2B 1JPSL 2B1AL 1GY2A 1J9TA 1MRDH 2BVEA 3MLWL 4I0KA 1SM3H 2A6IB 4HZLB 1QYGL 3NIGB 1YN7B 4WHYH 3OHXA 1YG9A 4OKVB 4LLDB 2LU3A 4F57L 2J12B 4XPBL 4QRRA 4PS4H 4MMXB 2WLIA 3D4GA 1SY6L 2AK4D 5MHSE 1A6AB 1I3UA 1FNHA 1U4EA 1UM4L 3UC0H 5TDPA 2WO4A 3ILPA 4UWQB 3PHQA 3U4EB 4XPAH 4NHUA 3ZUCA 3PHSA 1P2CB 1DBAH 4V11A 4YUEH 3T77A 3QB7C 3RVTD 2BNRE 4HP5A 3TN0C 3P3TA 1YO4A 5M94B 4F1ZA 1UYWH 3NZHH 4FFWC 1T1ZA 2NY4B 1J8KA 4OJDH 4Z7UE 2IFFH 2MRYA 2DPKA 2EO7A 3K2IA 2NUTA 2ZIDA 4RAUA 1KB5L 3AWGA 3D4YA 5LCVH 1WZ1L 2M26A 1EEZA 4YHYC 3C5XA 3NJNA 1A7OL 1JDCA 1OARH 4XMKH 5T5NF 1XXFC 2VMFA 4UTAH 1KZYA 4JRYD 2K7QA 4IMKC 4X6BB 4FQQB 4HGKC 2ZG1A 5I71B 2QSQA 2WWNA 4OCYL 3N41B 3GYRA 3HN8A 2FATL 2BOCB 4UQCA 5DD1H 4ZAKC 5JYMA 1GMIA 3D9AL 3WJJC 2PPDA 1I8LA 5EC1B 1S5IH 2WOYA 1GSKA 3HC4H 3CU7A 2IVFC 2G2NA 2X53A 2CIIA 3WIHA 4YHKL 4QCIB 3VFVA 3HZYB 4HWZA 4KY2A 3V7AG 4UILL 4OKDA 3N6YA 2E56A 3RTQD 5CEZD 3L3HA 4GXVH 2ALWA 2EUWA 5KSAA 3UBXI 4WEBH 2R2HA 3ZYIA 1I3VA 4WUUA 3BRFA 4HYTB 1YEEL 3ARGA 1ZGLM 4PGDA 2IPKA 2IQAA 3ZRFC 2E75C 3AUWB 1HIMH 3QIBC 3TA3B 1RURH 3VXMB 4E9TA 1XGUB 2BIOA 2WXNA 2YGPA 4AIEA 4NGHH 2RA1A 3ZKNC 3BEVB 2ITEA 3UP6A 2V2XA 3WJLC 4BQCA 1Z1WA 3W0WB 2B3RA 1B6UA 4FTVD 4YN3A 1X9UA 2YWZA 1YMMA 1S7VA 3W39A 4OCNC 4ZPTB 2A74B 2GIYA 3VXRE 1HNFA 1PX3A 2NY7H 3ZMNA 1KY6A 4U7SA 5C86A 3Q48A 5J3HC 1F45A 2R1WA 4JM0A 2XRAH 3GLZA 3CJJA 2IAMA 3O4LD 2X0WA 3U0PB 3L4ZA 1AXSB 3QCTH 4JZJC 5IHLB 1WFUA 2ADYA 1JGEB 3BAIA 4L2YA 2Q8AL 3DIVA 4I2XA 3K6SA 4P5RA 1NKRA 1I7RA 3ULVH 1HI6A 4OJFL 4UANA 2PW1A 3V0VB 2NR6D 2W60B 1SQMA 4WJ5A 4HCIA 2B16A 4N2IA 4YL4A 3JV5A 3T2QA 5GS1C 1HSBB 1S3KL 1FL3B 5E7BA 5JMRA 3TO4C 1AYOA 1SXBA 3VFWA 4A37A 1AJ7H 1WH0A 2FZ3B 3EYOB 1IFRA 4JN2B 5DQDH 1Y7VA 2X4OA 4LLQA 4OUUA 5LNGA 1QEXA 5AD0B 5HYJD 3SPHA 3BIBX 1UB5B 4JFEE 4APQA 5HTSA 2NT0A 1EK3A 3OQ3B 2JCCE 4BFIA 4H0LC 4LEXL 4PS7A 3ZMRA 4NO5A 2IDTA 4R2GD 5T1LD 3ZDYE 1K6QL 4W9ZA 3QQ3A 4M6MH 4PJ7B 5FA4B 3MMEB 2HWZL 2Q8BL 4MD0B 1AQKL 4A6YB 2F8XC 1EA9C 5KBDA 5FV1L 4X8GA 5GSRB 4ELKB 1INEH 5HHMD 5L6YL 4HJIA 2CJUL 4W9IC 4ZUWB 1KB3A 3OLIA 4K3HA 3UBXA 2BSDA 5I66B 3LDBB 1M56B 3RNKA 3V5DB 5BOZG 5L4MA 4MQ7B 2NLJA 3OHMB 4LDEB 5E56A 2MWCA 5DS8A 1T5WB 4DPCX 2C9XA 1OGAB 3VB8A 4MNHA 1CE6A 5D71L 2PCPA 4MS8C 4Y1AA 3GM8A 5H37A 5J06A 3E3QC 4PJIE 4BZ1H 4DKFL 3N91A 2C1PA 3EJRA 2KPWA 2VL4A 2R83A 4XNUL 4KZDL 4HIHB 2G3ZA 5BS0A 3MRGA 1BEYL 5C3TA 4APXB 1I1YA 1NDTA 1TO4A 2J8UE 3S2CA 5EIIB 3MLSH 5T33L 1UM5H 4M8VA 1HEZB 3UCRA 4BD4A 1I3RA 1GXEA 4UIKL 5DVOA 5KANI 2EAEA 4LSPL 4P4KD 4OI8A 1OB1B 1PY9A 4NIYE 1NDMA 2UYLB 3QG7H 1BZEA 4XNMB 4RH4A 3QBTB 1LEGB 3SPVA 3GBEA 2Q0ZX 1BQHB 4GG6A 5DF0A 2BNRB 2I9LA 4OJAA 3K2MC 3BWAB 1G7LB 1R17A 1PCXA 1A4AA 3KLHC 2ZUVA 2EE9A 4N26A 3DBXA 4Z7UB 1FLRH 3OKDB 4FNLL 4J23A 1EIBA 2M1KA 3ZPDA 1G9EA 2WBXA 1IEAB 3EF4A 4WI6A 3SQOL 3QORB 1P0SE 3OZLA 4YNYB 4JBSA 1NFIB 5I74C 3TV3L 4AJWA 2OFQA 1CGUA 4XNBA 1IM3B 2UWEE 2VR9A 3ATAA 3CVDA 5DZPA 4GIAA