1PLAA

High-resolution solution structure of reduced parsley plastocyanin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
b'AEVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPEYLNGAGETYEVTLTEKGTYKFYCEPHAGAGMKGEVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
molecule tags Electron transport protein
source organism Petroselinum crispum
publication title High-resolution solution structure of reduced parsley plastocyanin.
pubmed doi rcsb
total genus 12
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plaA00
3NJHA 4YSAA 2FTAA 2CALA 4N4YB 2CCWA 2DWTA 3QPKA 2UXGA 4DP8X 2XYBA 1AZNA 2BWDA 5E9NA 1PMYA 3UAEA 1YLBB 2H3XC 4BDVA 1BEXA 3HEIB 1E5YA 1KGYE 3ABGA 4NB7A 3PLYA 2XX1A 5AKRA 5I6KA 1GY2A 3QJTB 4GP8B 2YAPA 4YSQA 4ENZA 3FPYA 3WKPA 1EZLA 4DP5X 5I6LA 1J5DA 4DP4X 4EF3A 2IWKA 1JVOA 2PP7A 2GC7C 2YAQA 4ZK8A 4KO5A 2QDVA 1HAWA 3NP3A 3CVCA 1PAZA 1ZDSA 4G72B 1KDJA 3S3CB 4AZUA 1JXFA 1OE2A 1T5KA 2VSMB 4JHVA 4E9QA 3JTBA 3SBQA 3C75A 4BDVB 4KNUA 3EH5B 3NJIA 2PP8A 3G5WA 3QJUB 3RYMA 1PF3A 3NJFA 4DP6X 1JZHA 1E65A 3CZUB 4G71B 1JVLA 3NYKA 2IWEA 3TU6A 3ZX1A 4KO9A 5AZUA 4DPAX 3WG7B 3IN2A 1J9SA 2JXMA 1OV8A 1ETJA 5I6NA 3NT0A 1JZFA 2PLTA 5EHFA 1WS7A 2W88A 2OCCB 4L0PB 4JKNA 4HCIA 3NSFA 4RH4A 3OQRA 2HX8A 1IBYA 5I5MA 2H5UA 5B1JC 2WSDA 5TK2A 3KW7A 2FT6A 3FQYA 3PCYA 4M4RB 3DKHA 2XV0A 4W9ZA 1XB6A 3QJSB 2VW7A 4X4KA 4K9JA 1ZV2A 1MZZA 3UGEA 1PZBA 2W8CA 5A7EA 2IDFA 1JZJA 1SF3A 2UXTA 4HCGA 3BVDB 3WKQA 4CSPA 3ABMB 1RZQA 2UXFA 4YSPA 4QKTA 5PCYA 2FNWA 5D4JA 2AANA 2QPEB 3HB3B 1PLAA 2GIMA 1ZDQA 4YSTA 3S3DB 3V9CA 4YVNA 3AG4B 2J5WA 4E9WA 4QLWA 2IWFA 3PXLA 3ABLB 3OMIB 1QHQA 2HXAA 1A4BA 1A3ZA 1E5ZA 3KW8A 4PCYA 5FC9A 3X1EA 1CYWA 2XXGA 2GC4C 1BQKA 1URIA 2RACA 2P80A 1NIEA 1SNRA 5F7BA 3X1GA 2HX9A 5B1JA 1CYXA 3V9EA 1A4CA 2J55A 3FSWA 2YXWA 3CDZB 1V54B 5I6MA 1NICA 4YSOA 2BO0A 2GBAA 5B1KA 2HX7A 1WA0X 3SBPA 1NTDA 1A4AA 1SFHA 1JERA 1RKRA 1ILUA 2J56A 1JXDA 2CAKA 2BW4A 3ZBMA 5B7MA 3GDCA 6PCYA 2XV2A 4A66A 2JKWA 4M3HA 3N55A 4KOBA 4YSUA 2XU9A 1FWXA 1GW0A 1PY0A 1AIZA 4GY4A 2Y1AA 1JZEA 1SJMA 3ASNB 3CVBA 4E9YA 1BXUA 2CUAA 1NINA 3UAAA 1A65A 3FU8A 1GSKA 1VLXA 4W1TA 5D4IA 1NPNA 5I26A 4DP7X 2VMJA 2N0MA 1KBWA 1V55B 3FU9A 1J9RA 3NJJA 4BWTA 1OCOB 1PNDA 2PP9A 4Q89A 1IUZA 2HRHA 1M57B 5I5JA 4BXVA 1RCYA 1KCBA 3WIAA 3NJKA 3AZUA 1R1CA 3NJGA 4AKOA 2AZUA 1OF0A 1E67A 1QLEB 1CC3A 1ADWA 4GYBA 2YAFA 3QJRB 5TK4A 2GI0A 3IBOA 1JZIA 1BQ5A 2VM4A 3ERXA 2ZWNA 4YVUA 2QPDB 3FS9A 1CURA 4AKPA 1NWOA 1ID2A 1N70A 1GY1A 2YAHA 3X1FA 1F56A 2X88A 3NJLA 2OV0A 2DY2A 3CG8A 1NIDA 4F2FA 3S8GB 2TSBA 2YAEA 1GR7A 2IAAC 1L9OA 4YSEA 2ZONA 2VW4A 3PAUA 5B1AB 4UAHA 2EIMB 4HZ1A 1L9SA 4G70B 1MDAA 1L9RA 2BW5A 3UADA 1BYPA 2EILB 2R7EB 2UXVA 4GP5B 4MFHA 1AG6A 2BP0B 3NSYA 4E9RA 1W6WA 1AZCA 1OCZB 4E9SA 1ASPA 1DZ0A 1WAEA 3TA4D 3WNIA 2PPAA 2E86A 1UATA 2DV6A 1JXGA 1WA1X 4YSRA 3T6VA 1FA4A 2XWZA 3FSZA 3T6ZA 1OE3A 2PCYA 2UX6A 5I6OA 4GP4B 3CDZA 1PLBA 1BYOA 3FYIB 4DPBX 2I7SA 1JOIA 1OCRB 1GS8A 4G7RB 4HALA 4A2EA 1TEGA 3FQ2A 4YSCA 1TKWA 2EIKB 3OM3B 1AACA 3EH4B 1FFTB 1BAWA 5B1BB 3T71A 1BQRA 3PPSA 4CSZA 3QJVB 3FU7B 1MZYA 1EHKB 4KO7A 3H4HA 3T9WA 3U25A 2AVFA 2PCFA 1X9UA 1BXAA 1IKOP 3GYRA 1B3IA 1JZGA 1NIFA 2NRDA 3SQRA 3NP4A 3X1BA 1CUOA 2ZOOA 3AG3B 3BQVA 3ASOB 3NSDA 2LLNA 3N2JA 4Q8BA 4DP1X 2DYSB 3WNJA 1GS7A 4G7QB 1W6LA 2IDSA 1NZRA 3FU7A 2Y69B 1ILSA 4HCFA 4DP9X 1SF5A 4E9TA 1AS7A 1ASOA 1ZIBA 2AZAA 3JT2A 3GXUB 2PPFA 2CBPA 1KYAA 2B3IA 3H4FA 4A2FA 1XB8A 2QT6A 1PLCA 2FJSA 1AG0A 3FQ1A 1KBVA 3T6WA 5F7AA 5I28A 4A67A 1N68A 3AG1B 5B3SB 1TEFA 3EHBB 3IN0A 1L9PA 5I5IA 1AZBA 5IY5B 3UABA 1I53A 1XMEB 7PAZA 4P5RA 5LDUA 2BP8A 1NPJA 1OE1A 2Q5BA 3DIVA 4AX3A 1ET5A 1A8ZA 3FYEB 4WTQA 1M56B 4BK5C 1IBZA 2VM3A 2YAOA 3OD3A 4HHWA 1MG3C 4F7KA 4DP0X 1DYZA 1AS6A 1GYCA 2FQGA 4E9VA 1XB3A 2BZCA 1AR1B 3EF4A 3OMNB 4KNSA 8PAZA 4HAKA 1PCSA 1OCCB 1AS8A 2UX7A 2ZXWB 2R7EA 2YARA 3D12B 4BXSV 3AG2B 4KOCA 3T6XA 2P80D 2BP0A 3PAVA 2VN3A 2BP8B 2GB2A 2GSMB 4A2HA 3QQXA 3DTUB 2CJ3A 2XXFA 5D4HA 2IH9A 1PZAA 3IE9A 4NAJA 2BZ7A 3H56A 3TASA 4G7SB 4A2DA 3AW5A 3NJNA 3FSAA 4HHGA 1BXVA 4AI7A 3AY2A 2BWIA 1ASQA 2EIJB 6PAZA 2YQBA 3PAZA 4A2GA 3NSCA 1QNIA 1IC0A 2J57A 2OJ1A 2Q9OA 1AOZA 2VSKB 3ZIYA 2X87A 3CVDA 4NERA 2IDUA 1SDDA 2EINB 2AFNA 2WO2B 3FSVA 4HIPA 4UF7C 4YL4A 3NJMA 4KO6A 5AFAA 1PZCA 4DPCX 2YXVA 3L45A 3S8FB 1AAJA 4PAZA 5PAZA 1NDTA 1OOWA 3TBCA 4N8UA 1GS6X 2XLLA 3UACA 4E9XA 2JFCA 3X1NA 4BWUA 1PNCA 2XX0A 1SFDA 2XVBA 1AZUA 2GHZA 1V10A 2MTAA 2WO3B 2XV3A 1KV7A 1TU2A 1SDDB 5B7EA 2DWSA 2FQDA 2FQFA 1HFUA 1NIAA 1ET8A 2H47C 3MX0B 4DP2X 1W8EA 1SHWA 3IEAA 3QJQB 4YSSA 3OMAB 3TBBA 4AKQA 1WS8A 4YSDA 1WA2X 2YAMA 2DYRB 3MBWB 5ANHA 3S3BB 1HAUA 2TSAA 1AANA 1KDIA 4GXFA 3WI9A 2HRGA 1J9TA 4KNTA 2B08A 1AQ8A 2IDQA 2HZHA 2XUWA 3SBRA 4BWWA 2MRYA 3EH3B 2PPDA 4WKXA 4FA7B 2FT7A 2I85A 1ZIAA 3FT0A 2QDWA 2I7OA 1X9RA 3X2QB 1SHXA 9PCYA 1ZPUA 4TXVB 1L9QA 2FQEA 2FT8A 4FAAB 1J9QA 4P5SA 5I6PA 2A3TA 1KCWA 4F2EA 1M9WA 2VW6A 3FPXA 4JHUA 1NIBA 1NWPA 4A68A 4UANA 1MG2C 3ZDWA 2PPEA 2HLEB 2BHFA 1J5CA 2PPCA 2FWLB 1ET7A 1E30A 3ABKB 2IH8A 7PCYA 1L9TA 1RZPA 1AZRA 5B7FA 2IDTA
chains in the Genus database with same CATH superfamily
1OAKH 4MQXC 1D6VL 3BRGC 2V9QA 1I8LA 4HUWA 4PEEA 3W11D 3HE7A 2P5EA 4LOEA 5CD5C 4K71B 3FAWA 3VFSB 4FFYL 1BJ1H 3IJHB 3GS4A 5J9PB 2Y7MA 1KGUA 1PYWA 1QFPA 1XZ0B 2JKLA 1HXKA 3O0RH 3CX5J 3QEQA 4KK9C 4Z76B 4M3JA 3NCCB 3P69A 1IC7H 2Y36L 3OXSB 4IYKA 3PWPD 2B4CH 3KM1A 3KGSA 2NCMA 1C5BH 1BFOA 1OL0A 4LESA 3W2DL 5KJ4A 5A2FA 3L4YA 4A04A 2BNQE 5HI5D 3LJ3A 4DEUA 4G6FB 5AVTB 4RRPG 2MIZA 3US0A 3LD8C 4MJ6A 1ZLUK 4HC1H 4HUWB 4YE0A 5EEWA 4WUKL 1I1AA 3LV3A 4Y9EA 3LKPA 1HAWA 1YQVL 4JHVA 3FH7A 5D6DA 1C5CL 4JDVB 4EBQH 3P3YA 2EH7H 2EDFA 1KJ3L 5SWZD 2PP8A 2NW3A 3UJIH 3W5MA 3JYCA 3K6FA 3PV6A 2LU3A 2A4EA 5D8JH 6FABH 1E27A 3V7AG 4PJ7F 3VI4F 2J1WA 5DMGD 1R24A 1OV8A 4Y16A 2ARJA 1JZFA 3QFGA 1KULA 1ZVSB 2WVUA 1HOCB 1G7IA 3FMGL 3UZQA 4FLOA 5BV7L 4XCYA 2BVQB 2DQHL 3KHQA 3BHBB 3QCVL 4QRFA 4OLYL 1E6JH 3B2VH 4IIQC 1ZLSH 2BWQA 3K0YA 2YKLL 2QGBA 3T77A 3QJSB 4FP8L 1Y6KR 5KVDL 2LLGA 2DLFL 3Q6FA 1PZBA 4NKMA 4APXA 2B1AH 3V5HA 3DBXB 3GLAA 2IDFA 2JELH 3CCHA 3HC3H 4G9FD 4KQ3L 4OF6A 4D8PB 5JZ7C 4PQXA 3QRGL 4MAYD 4X5RA 4ZXBC 4CDGC 4EIUA 5LGKA 5EBMB 4WEBH 2UXFA 3TJHC 3CZSA 4NNYB 1RUKH 2WHVA 2XJLA 3LQAH 3O9WB 1HOCA 4PJDA 3EJSA 5G4NA 4AG4H 1NFIB 1ZDQA 2P7TA 4YVNA 2H32B 1UKQA 4QLWA 1ZV5A 4IKJA 3ABLB 3HI6L 3NMEA 5JOFA 1A3ZA 2CK0H 3V0EA 1JK8B 1GGUA 3L8QA 1OAYL 3C08H 4K3JH 1O0VA 4NKMB 4NQSA 3VTAA 3I6GA 4YHKL 3KPTA 1QP1A 1RJYB 2IV8A 1A4CA 5TQ0H 4O2FB 1BV8A 2NUTA 4M5ZL 1AMYA 3DVGB 3EGXB 4KRMB 3CDZB 2XKNA 2PYFA 1FLTX 3ULSA 1A3QA 2BO0A 2IALA 3V4UL 1P4LA 3QWNA 3GZKA 2G3XA 3PHQB 4GXUM 1NTDA 3VJ6B 4LVNB 2OSYA 1VIWA 1V5JA 3QFJE 2AV1A 4ZYKA 1H0DA 1F6LL 1RZJL 4JB9H 5DD0L 3TBSB 3O8XA 3WFEL 4EXKA 2V2WB 1YEKH 2JKWA 3EFFB 3COOA 3E3QE 4LOFA 1UZ8B 2IG2H 3WFBL 1PY0A 2B0SL 4GUPA 5LXGH 1U91A 3N0AA 2VERN 1JD7A 5FHAH 3ZL4H 3ZUNC 1GGCH 1S7UA 3EGXA 3BUYB 3UAAA 2WNGA 3K8MA 3EJUA 3U7WH 5JW4M 2CUHA 1BG1A 1ZT1B 2D7QA 3HS9A 1V55B 3SE4A 3R06A 4QJ5B 5JLZB 1PJWA 4OCMC 1FL6A 5BUPA 1RZFH 5D7LE 1BGXL 1BWWA 3AB0B 3P30L 1G84A 1DVFB 1I7ZA 4RNRA 1IGML 1NEZA 1OTSD 3B2MA 3L7FB 4C4KO 2UZYB 1NM4A 4L8SB 4R84A 4J7RA 2DM2A 1U8MA 2B9BA 4LSTL 4HWBL 1UCBH 3CFCL 5GGVL 1UD4A 4RAVA 5DC4B 4ZRGA 2GI0A 4BYHA 2Y06L 1FCGA 4GEIA 4NPKA 3B9AA 3VAEA 2Q2EB 4XXCA 5FR3A 4OW6A 1AXTL 1H6FA 3HVNA 4G8AC 2DWXA 1EHXA 5E1IA 3EYFB 1ROCA 2P46B 4PY8I 2IPKA 3C5XA 4ZPVB 2GW5A 1JV2A 1A3RH 5LNEA 4IMKA 3W9EA 2OYLA 1K6QH 3NJLA 4L4VA 3RI5F 1CICB 2AK4B 3SBWC 3FONA 4L8SA 1XGUB 3JWNC 4XCCL 4WNJA 2ZXEB 2WYZA 2AERT 3ZT5A 4YHIA 4W6WB 3DECA 3CXDL 4PB9L 5KJ7E 1YNTF 1A6UL 3KBFA 4TUUA 2EIMB 4X5XA 4IKNA 1B2WL 2IQ9H 2NPLX 2FL5B 4GFTB 4JG1H 5E1HB 1ZA6B 3UTSD 1XCXA 4Z5RB 1YYLH 1BYPA 4LSRL 1GPOH 2P8PA 4QOKA 2PXYB 5DVOA 3AU0A 1NL0L 4GRLC 1XSKA 1OALA 3GB7B 1SJHA 1HILB 5C0DB 2Y36H 4ZTEA 3PP4L 5HHXH 4NFCA 3MUUA 4XPFH 3RJOA 2ZYRA 1NGPL 5G5DA 2X4QA 3M17B 3BUTA 3V95A 3VGEA 2R2EB 4AIXA 1A7NH 1FNLA 4G8EB 4OSUL 5B8CA 2AV7B 4EQ2A 4BHUA 1F3JB 5DYOA 4CNIA 5K1JA 1YMHB 4RGNE 4HC1L 35C8H 3E3QC 4WUKH 3S0PA 2FL5A 5I24A 4P23C 1JGEA 2WXOA 3DX0A 4PJ9C 5E9DB 3FCBA 3UC0L 1OCRB 1UT9A 2PXYA 3US9A 3CMGA 3SYAA 3FQ2A 2Z7ZA 3RWCA 1MQ8A 3NZSA 4OCYL 5JUEL 4WDIB 1ITCA 1KIQB 3TO2B 4DNLA 4AL8H 3PUUA 4JPSA 3WS6A 1J8HB 2HG0A 1X5XA 3EXJA 3OKOB 1M1SA 4Y4KA 4X7SL 2YD0A 3LKQB 3QULB 3TFKC 2AVFA 4NQDE 1T03H 1F3JA 2XTJE 1P7QD 1T0MA 1ZXKA 2BOBA 3ARGB 3UXFA 1SJEB 4BHUI 3DTDA 3MLZL 1QLEH 4IBZA 4PJAA 3LKSA 4UDUB 5E9DA 3UOAB 3DYMA 1UZGA 1NBVL 5D7SH 4OLYH 3NSDA 4KTYA 3MC0A 4N1CA 5FB8A 1QI3A 4DUVA 1F8TL 2NYZA 3MTXA 5GS1A 4IM8A 4GRWF 3SQBB 4E9TA 4KZCA 1ASOA 2QR0B 3QWRA 4LLWB 5F9OH 4Q9BA 4LZKA 4LSPH 4OJYA 1Z3RA 4QRPB 4NUQA 4PR5A 1SYSB 4YXHH 3BCFA 1BPLB 3I84A 5D1QD 3S34L 3EDDA 2IGLA 3C5ZC 1ONQB 4XVSL 4YWGL 4X0NA 1M6UA 1EEQA 3BWUC 1L9PA 4KVCH 2F18A 4HJGA 4FA8A 5HDWA 3BWUF 4LVEA 4HKJB 4HWEH 3GMQA 5B21A 5LDUA 1KB5L 1E4HA 3LKRA 2ITCB 1A8ZA 5JXEA 3BKMH 1M56B 3DV6B 4D0CA 3WLBA 1K8DA 5T5NG 1DLHB 1JRHL 1EEYA 1RZ7H 2Y5TA 3CXHJ 4L4TA 1AC0A 1AS6A 3ZE1E 4Y2LA 4EDWH 3HRZA 4XN7A 4I1RA 8PAZA 3QUXB 3QDJE 3DOHA 5C71A 5DZNA 5HHVL 4RGNC 5GIRB 5EA0L 5GJSL 4MJ5B 2YUWA 3NH7L 3TYFB 4V1DA 4XBGB 2BP0A 3GIZH 4QRUA 4ABUA 3UO1L 1ZSDB 4AC2A 2B0SH 5LXGL 3DV6A 4PBVC 4N2EA 5FHAL 3MRPB 1GGCL 3CU1A 1B88A 5I1GL 3FB5B 3GC3A 2Y1VA 4NAJA 4UV7L 4WFED 2Y6TE 2YHGA 3FCUB 3AW5A 3WHXB 1Q0XL 3IFLL 4NKDA 4G8FA 4UU9A 1A0QL 2P52A 4AH2A 5MEOA 4PB0L 5FO2A 3BGMA 1OCWL 3EO9L 3F04A 2FD6L 5ES4B 3ZT6A 2QMJA 1BGXH 2Q9OA 3SDXB 5DA0B 2UWEF 3JWNE 3MRCA 5TDNA 3MVSA 2RBLA 5GZOA 1RJZB 2X87A 3KYKL 3CN2A 1SDDA 4BH8B 4LSUL 2I26N 1PEWA 3K6OA 5T1DH 1XWVA 1QBAA 2EICA 4X99A 3KYNB 1KBBA 1BMWA 1OKEA 3IFOB 4JZNA 3WAJA 3RBSA 3OWEA 1OT2A 2AXGB 4G8FB 2Y06H 3TBCA 5PAZA 1KN2H 4WNQA 2NY0D 4N8UA 4ADIA 2IXQB 3HUJF 4D3CL 2VJ0A 4Q9CA 5IR1A 4ETYA 4O4YL 4H0IA 2QQKL 5ALCH 4UT9H 1TZHB 1RIVH 1X5ZA 2Z31D 4KJYA 2Y7LA 3O9WD 2GHZA 1Z6JT 2MTAA 3RNQB 1XMWA 1NGXA 3D87B 1AKJD 2DWSA 1JZ5A 4JJ5B 4KVNH 5E5MA 2E9WA 3I3DA 2FO8A 3B7TA 3GRWH 2CHZA 3MLYH 4P3CL 3CDCA 4N0UB 1NGYB 4EOWH 2Z7UA 3ATAA 3ES6B 3IM1A 4G82A 2DF3A 4TNWK 3NGBC 4U0QB 3RWIB 4ZX6A 2YAMA 1UWGH 5IR1B 3DMMD 1UT1A 1V8HA 4I9WE 3EYVB 3MHZA 5ADPL 5D7LD 1WBYB 5KANG 3MCKB 4KKQA 3VFOA 4CGTA 5JIDA 1LE9A 1JF1A 3HUJE 1OGAA 3WENA 4ZAKB 4Z7AA 4JDEB 4JM2F 4BFIB 3U4AA 1MQKL 4J4PD 2MRYA 3N44F 3NSJA 1WRFA 4JFUA 35C8L 3F7LA 1HDMA 3QUKB 1SBBA 4YXLL 1Y6NR 5KSAB 2UZXA 1KFGA 5DTFA 1INEL 1DR9A 1SOKA 3O6FD 2BK8A 4QHLB 4OCWH 1BVNT 2H7WA 3MCKA 3ZRCC 5KAQF 1JG9A 1T0NB 5AW0B 4G9DA 4QXGH 1OGAB 4XO9A 3ZQWA 3IRCA 2GK0A 3MLSL 2GTQA 5EBWB 4PP2A 2ZG1A 3TURA 4IHOA 4MA8H 3RPKA 5CLZA 1NFAA 2X1PA 3LZNA 4TUKL 4TTDD 2X7LA 3PWPB 2G30A 3SJVA 2P24A 2C9QA 3GTVA 4FHBD 4PJ5D 4B3VA 3QDME 4X2UA 1NBVH 5D7SL 1G7LA 4TLKA 5EIIG 4FTVA 1MAJA 3PDOB 3DROA 4ZUTA 2R0WH 4B27A 2NX5B 3OAUL 1BZ7A 4KXAA 3F5WA 4U0RB 4PJCF 5BRZD 3O6ML 1AMXA 2DWTA 3QPKA 1M7XA 5L2KD 3QGVA 4B0MB 4B5EA 3QJOA 3ZDZF 1YUKB 3FCTA 5FO9B 2H3XC 3RUGE 4DHLA 3ZL1A 3E7JA 1E4XL 2OR9L 3TO4A 5T33L 3GEFA 3OKMA 5AAMC 1R5WA 3MLWL 4HULB 2H6PA 2ENSA 1HZHH 4N86A 4F57H 1G6RH 1EZLA 4YAQA 4H20L 4F1SA 4HWEL 4DP4X 3OAZH 4ZW8A 4B9GA 1A3LH 4EF3A 1FYHB 4Z78B 5L6YL 4ZK8A 3HN5A 4JKKA 4JL1A 2A9ML 3S2CA 2WXRA 4NO2A 3K80A 1H6UA 1EBAA 2NR6D 3ZDXB 5I6XC 1Z7JA 4GQPH 3OPZH 2XPYA 2X1XR 4R4FH 4R2GC 1RFDL 5DO2D 2ITDA 4YHZH 3RTQB 3POHA 5BVJB 1E65A 3KLHD 4N9GA 3HOGA 4M1CC 5AZUA 3BH8A 3SPCA 3IN2A 4K23H 3KPNB 2E0PA 1MJ8H 4U1SB 4IRZL 5FW8A 5EHFA 3C60C 2Q20A 2W88A 3EFDH 5GGVY 2ZICA 4HV8B 5D7IA 4HKZA 1SEQL 3E8UL 3SODB 3ZTJG 2FR4A 4NO2B 1KCRL 1MH5B 2MKLC 1P5UA 1KEGH 2VW7A 1L0YA 3ARDB 1E4KC 2EC9T 3JZ7A 4R8WH 4DK3A 4IDJL 4RQQB 1KCVH 4LEXH 3VQLA 3WJMA 4L4TE 3GSRB 5LAPA 4K94L 4OI7A 2DBJA 3LH2L 4XPHH 1X5MA 2ZXDA 3KVDD 1GC1C 1DVSA 2YWZA 5AEAA 4YSPA 1DUZA 2E27H 3QDJA 5PCYA 4NENB 5D4JA 4K3EH 2JI1A 4J3SA 4DZ8A 2J5WA 4LCIL 2WBJD 3N9GH 1UM5H 1X4XA 1CB4A 4OV6F 5EPMB 4NUPA 3ARFB 3HPJA 4ZUVA 5SV4A 2BINA 5F6IB 1MNUL 5C70A 5C0EB 4GG6F 3LH9A 4C47A 3ARDA 2O5XL 1NAMA 5L9DL 4L3ED 1FV1A 1K9TA 4JJOA 1LQBC 1DBJL 5E00B 4A37A 3KH4A 5AAWA 3S36L 4C54A 1RQ5A 1SNRA 4FLSA 5E2TH 1ACZA 2Q86A 4LPVA 3CDFA 3MUHL 4W93A 2QLVB 3ZQ9A 4EIGB 2DQDL 1OAXH 1QRNB 3VXUA 2W59A 3FFDA 5DUML 4KI1A 4U05A 5DJDB 1KB5B 2IGTA 4ZSOA 4EXPX 3RP1A 3GBNL 5TGBA 5A2KH 5DRNB 4P5KA 2FNBA 4H26A 2VDLB 4CMMB 5KSBA 5FGCB 1ILUA 4WSJA 2BW4A 1RP9A 4PVMA 5FOJA 3PWPE 1QNZH 4YFLF 5FGCE 5DEGB 5E00A 2WBXA 1SHSA 3G08B 3PGFL 3RGVD 4DN3H 1QSFE 5I0DA 2XZCL 2QEJA 3JQOB 1YAZA 3MOAH 3CPLA 3ASNB 4N0YL 4B9IA 1NOAA 4E9YA 3NIFB 1U8KB 3P0YL 1QRNA 3IE4A 4N8VG 3LDBB 5BO0D 4UQCA 5IG7B 5JHLL 1VESA 4POZC 1HJBC 4DP7X 1DVQA 4OFQA 4MZ2A 2F53E 2A6DB 4JFED 1CG9A 1AKJB 1F02I 1KPRA 4BKTC 1OK8A 3L3HA 2O1AA 3QSKB 4HXAH 3MNZB 5CFHA 5J13C 4IMLA 5FYJE 2GUOB 4LU5H 4M7LT 2FJGA 1WZ1L 1HNGA 3NJKA 1MCOL 1CE6B 3NJGA 3ETBJ 4B97A 4KPHH 1U8KA 1ZHNB 5F96L 3DGGB 3CFMA 4LSQH 1F5WA 2EEDA 5DFWH 3D18B 4AUYA 3LXAA 2X38A 3IF1A 4UQAA 3ECQA 4F9LC 3G6AB 5F9JA 5DT1H 4NLAA 2PO6B 3LZPA 1A7OH 1ZLEA 2JLPA 5F8RC 4PG9B 2FECL 1A7PL 1XCTA 5A2CA 4KKZA 3OG4B 5CU5A 3CG8A 4ZMPA 4BFGA 4KROD 2P5ED 3MROB 3UMNA 2WXMA 1KNOB 3U1SH 2YAEA 4GKNA 4J3UA 4YHNA 1P4BL 4DAGH 2GITA 2XC8A 1Q0YH 2VLMD 4JRXE 2X9ZA 4LLUA 4N5EC 4FXLA 5F9AC 3K72B 3VXSE 4LBAA 1VAHA 2FEDC 1XF4A 3NPSB 3IF1B 4RGMC 1PZ2A 5IB3A 3LQZB 4M1GL 4WW2C 3QUZD 3GBEA 1FFOB 2PO6A 5CR8A 3DV4A 5EMYA 5DS8A 1QRKA 2J6EH 4RWYH 1HZLA 1AO7B 2H4EA 4I2XB 1VERA 5E1AB 1ASPA 2OCFD 4I3SL 4FQ1L 3WNIA 4OIFA 1N5AA 2VABA 2DAVA 1A3LL 3FSZA 3PWNB 4M8QB 3IDXH 3DX4A 4WUUA 1DHKA 1L7TH 5J1AA 1FZKA 1HHGB 2VDLL 1WFOA 2WYTA 4NZTL 4W4OC 1IO4C 3FO2A 2NNFA 4E0RA 4F9PA 1BAWA 4NO5A 1ICTA 3US1A 3TVMA 1LO3H 3VFPA 1L9NA 2HJLB 2F53B 3NCJH 2VZUA 4PU2A 3IGAA 2GBVA 1MZYA 1EHKB 4I18C 4DVRH 1N59B 2AJXL 3Q2CA 3Q9QA 4P46A 3VB9A 4KZEL 1SMDA 1ZHLA 1GW6A 1OSZB 1Q9KB 4G7YH 5KBKA 5L4IA 2KDGA 3L3DB 3MUY1 3QT2A 5E2WL 1RZ8A 4ANVA 4U3SA 3O3DA 3T0EC 3E8UH 4TNVK 4AM0Q 2NQCA 3GXNA 3WY2A 2BIQA 5DVPA 5CP7A 4OD1H 4TPRL 4J8RA 3M45A 3PL6A 3QNZA 5BOZG 2OXHA 4P4KD 2D7PA 4AIEA 5D7IF 5HHQA 2IBZX 2EKSB 5D9SB 5DUBA 4UTAA 4LRIA 5SWZA 4MMYB 4X8XA 4X6FB 5IHWA 3QQ9D 3PDGA 3WS3A 2NY7L 3BVNB 1CTMA 1IGIH 5EULV 1A2YB 2XFXA 3PHAA 2K9UA 4PRAA 3FQ1A 4TNFA 3OLEA 2XVGA 2X6MA 4Y2DD 3RGHA 3OB0H 1JXKA 3CAFA 1YMME 15C8H 1EO8L 4LVHC 3W39A 3WXWL 2E7LA 1ZANL 5B3SB 1TEFA 1QQDA 1UB5B 2K0RA 4JFPB 1OT4A 4YX2H 3KPRE 4N8PA 1HEJC 4IGBB 1IARB 7PAZA 1E3FA 3GHBH 1TZAA 3MJGX 1S9XA 4OUUA 1IEAB 1J8HD 1RIHH 1N6VA 4FD0A 5ADOL 3EFOB 3CX2A 1XH0A 1VGEL 4QRRB 3QBTB 4TQIA 1CIDA 4ODUB 4YHYC 3BUBA 1E4WL 1MKFA 2XDHA 1GH7A 1A2YA 5AW4B 3WMSA 4OCLC 1IFRA 1N8ZA 1ZLDA 2VZOA 3DETD 3TT1H 3EF4A 3OMNB 4I5BB 3UTSE 2ZIDA 3JWDC 4HAKA 4HH8A 4PJDE 5DHVB 3DK0A 1KYOJ 2DH3A 4K8RD 4LEBA 5JORA 4EI5A 4Y1AD 4JFPA 1SM3L 2AQQA 4KKCC 4I4WB 1IEAA 1O9ZA 4NAQA 5T5FA 1ZJBA 1IBBA 3A21A 3ZJAA 4N6RA 5IKCB 3N1FC 3QQXA 4U3HA 3HE6A 1YUHB 3FTVA 1QEXA 1B3JA 2DJMA 1EFXD 5HVWA 4D9LL 2AJSH 3M1OA 4YGVB 3RHWK 4CU6A 5J0BA 3HG1A 2R83A 2ZUQB 2FWOA 4QUOA 5FM8A 4HUCA 3IAGC 5BQ7A 4X8JB 4KTEL 2P5EB 4JFTA 4QR7A 5C0CA 5LCVH 3D85D 2VSKB 4HD5A 5F88B 5BV7B 4PJGF 4R2GB 5KYUB 4IK6A 4XZ4A 2PCFB 4ELKB 4YDIL 1LLAA 4HHAB 4XNXH 1PZCA 4Y2OB 2HPTA 4H1LG 1QSFA 2X9WA 3V0WL 2IAMA 3EDEA 5GRJH 2Y3AA 4LF3A 2JK5A 3BW9A 4JMNA 3PFUA 3OHXB 2J4WH 2OS7A 3QUZA 4MJ6B 1XAUA 4YHPA 4JREB 5DHMC 4I0PA 3ECWA 4TQEH 3MRGA 4ZFGH 2YA2A 3BI9X 4D9QE 5F88A 1CBJA 1A7RH 3TJPA 2OK0L 3QQ4A 1OHQA 2H3KA 3NN8B 4PG2A 4DAGL 4ZTPH 5GGRB 1HFUA 5LG1A 2X09A 3S35X 3TNMA 4NM8H 5C0NC 3QORD 5FEBA 5T3XD 1SUHA 4KMQA 1AQHA 1IBFA 4OJDH 2WXJA 3MRHB 5ESVB 5IQLA 2EYTA 3SGDI 5IW6A 5LQBH 1YY8A 2CKBB 5KSVB 2HLAB 3MPCA 5D1ZC 4O2EB 2B8OT 2ZKYA 1FSKB 4ZD3L 1S3KL 3UIZA 2ZNWA 2J6EL 5HY9A 4JHZA 1ZVSA 5HHNB 3UZQB 4Y4HB 2H41A 3RGVB 3C6LA 4Z9KB 2BVQA 5IQ9A 2DEWX 3KS0J 5CCKH 2EVIA 3BKCL 5IB2A 4I48A 3NZ8B 4R97B 4Z0BH 5CILH 1AQ8A 2IGFL 5E94B 2WWOA 4I0PC 4WKXA 1QASA 3O2DL 1I85A 5C07D 3MGAA 3QHZH 4LPCA 4DQOH 1QSED 1X9RA 2ZYIA 3C87A 4BKLB 3Q1EA 3WJLC 2VXVL 2BPBA 5T1LD 2IAMC 3RVVD 4EVNB 4ZUUA 5DJYA 1U8JB 3N50A 2F19L 2LQRA 3MSPA 4XP1H 1DQVA 1TUPA 3V6OA 4LBEB 4CW1A 4OH2A 1S6NA 1URZA 1VPOH 3QI9B 4PTUA 4CMHB 1MCEA 5D1QC 4F2EA 2P5EE 1EAPB 1P1ZB 1UB6B 2DTMH 3JV0A 1U58A 3HLAB 3VFVB 4K7PY 3GPSA 2B20A 1TTFA 4X6DF 5AW9B 4S1RH 3STBA 1J5CA 4NQSB 4IKLA 5JOEA 3RUGB 5EU7C 4OIIH 1S78C 4EZKA 5DS1A 5JW4N 3C6LD 5IF0B 4AEIH 3IGKA 1F11B 4TNEA 1I3RB 4MAYB 3TCTA 1ZCRA 3GM8A 5BCAA 3OKYA 4Y9BA 4N28A 4IJ3B 4UV4L 5JIMA 2ZF8A 4QDGA 2XKNB 3NJHA 5D7KD 3ZHLA 4DW2H 1I85C 5I19L 2EIBA 1KT2B 1QRNE 1GZQB 4U7MA 1C5CH 5FCUH 4LHUD 5IROA 2PO6C 1YEGL 1XGQB 2Q8AH 1EEZB 3APFA 4FG6D 4XRCB 1YEHL 4HWUA 3U79A 1E8XA 3INUL 1OM3H 1E3XA 4PRHD 4OV5B 3PLYA 1I9JL 1BLIA 1LO0L 4WUUE 3EJQA 2B5IB 5ALBL 3MRIB 5F1NB 3CZEA 2XVKA 2EVHA 3WKPA 2A99A 5CWSA 3F58H 1WFMA 3GHBL 4GAYA 2TAAA 1RIHL 2CK2A 2IWKA 1KCSL 3MFGB 2BCKA 3MODH 3SN6N 1CI5A 2YAQA 2ZUSA 3B1UA 4FNPA 3JWOL 3DTXB 3S4SG 4LLAA 1XT5A 3ALXA 1MRCL 3VDCA 4D94A 3BH9A 3L7EA 5JPNA 1AHMA 1MHCA 2D4FA 2R1YB 1IGJA 1HI6A 3MV11 4J6RH 1NEZB 3FO9B 3HC4L 4MZIA 4N2BA 5HYIA 1VFBA 1PL3A 4P4RA 5TF1H 5ANME 3ZX1A 1YC8A 3B7SA 4YZFE 5CGYC 3SCMA 1N26A 1Z5HA 3OHXC 1EHLH 2J88H 3QO1B 4LRNL 4KJWD 5I6NA 3R0NA 3NT0A 3EBGA 1QHPA 4MB1A 2WY3B 4OCXL 4JO2H 5C08A 2OCCB 4EO5A 3DO7A 2BX5A 5I75B 5KBMA 4LAQL 3ZE0F 3GFUA 2NY3B 3FQYA 4NM4H 3WO4B 2P4AB 2YBRB 5HGDA 1BBDL 5FECA 3EHBD 3ZOAA 2R23A 4OZFA 1NH6A 4Z3TA 4EDXB 4S10A 2XNAA 3HA0A 4KRPC 1G1OA 3BP7A 3OMZA 3L1GA 3BT2H 4JFOB 4ONGL 3QISA 1NEUA 4UM9D 1KEML 2A74A 4ODBD 3ZE1B 4DVBA 5KVMC 1KIUA 2WUCL 1KY6A 3UBXA 1L0QA 3FT4B 3STZB 1MEXL 3SDDA 2E9BA 1RZJH 3ROOB 2G0KA 1SY6A 2PR4H 2BMKB 4H0LC 3ZXAC 4ACTA 4OFYD 2R23B 4OZFB 3J7HA 1E5ZA 4JO1H 4LEEA 2XG4A 5AZEL 4NNXA 4PJGA 1URIA 3GZQA 3FO1A 4C4KT 3U7WL 4LSSH 4B6ZA 4APQD 1G7MA 4MZRA 4PD4K 1SN0A 3QWRD 4PGJA 2I5YL 4HJUA 2OX5B 1I3GL 2Z7WA 4P59L 4YSOA 2IANB 4PJ8A 5ITFA 2JLLA 5K9JH 2NW2B 4W70A 5B1KA 3H3PL 5E8EA 4PGBB 1OP9A 3GI8H 1JK9B 1T1YA 3QIWA 2EDEA 4JN2B 4YBQD 5C0CE 1CDIA 3VH8G 3ZSSA 3ZKQD 4OZGE 1EAJA 3FQUA 2HJFA 4K3HA 4YSUA 2NTFB 2FX9L 3SKJH 4KJQD 1CGSL 4DGYL 2GJZA 1FZJB 4ZD3H 5GSRB 1G7MB 4QHNA 1T7XA 1Q94A 4M43H 5H4ZA 3ZE2B 2NXYC 1MFBH 5ICYB 1FE8H 1BZQK 3LKSB 4UDUA 5E4EC 5AVQB 2G60H 3LV3B 3LKPB 3IDJA 3QXAA 1TJGL 3AT0A 4OQTL 2DMKA 1J8HE 5IMKB 4JFQB 2K8QA 4XOEA 3LRSB 4LKXA 5HI4D 1I7RA 2H2SD 3O2DH 4K2UH 3S5ZA 5IMOA 1CL7I 3UPCA 1HE7A 1QBBA 1SOXA 3DA0A 4NHUA 5F7HA 3L4TA 1CT8A 1A6UH 1JL8A 3QIBB 3T0VA 2H1XA 2H32H 2IQ9L 3B56A 4JG1L 4QRPA 4V2BA 3WUWG 5K9KB 5LCVA 5EORL 1KZQA 4PYGA 4ODVH 2OXGB 3NFNA 1QR1A 1LVEA 5H37H 4A2LA 5DMKA 3Q0HA 5TK4A 1OSYA 5IOPA 1S9WA 4GUCA 3EJYD 5TPWL 3CFDA 3IJYB 4HIIB 2M26A 3RWHA 4HJGB 3WKMH 4HZAA 1CURA 2V17L 5IMKA 4XXDB 1LE5A 3UAJD 3N91A 2A0LC 3B3IB 1ORQB 3W0WB 4J2XA 2QKSA 4OJEH 4F2FA 3IETB 1K8DB 3LPFA 4FDWA 3V5HB 1I1YB 3FQXA 2A1WL 4D8PA 1NUGA 2FX8L 4XNQB 2BNQD 3KEHA 3H42H 1D5MA 3RVXD 5EBMA 4X4XB 4HZ1A 1E8WA 1L3WA 5F1SA 5KYYB 1CGYA 3RDTD 3UADA 4XOAA 4HWZA 3RIAK 3T2PA 4KHXH 4AZ8B 4F92B 4RAUA 3BN3B 5J1TC 2A6IB 2WAHA 2DEYX 1MXDA 1E4JA 2VL5A 3IFPA 4PJ7A 3FFCB 3VI4A 1PEZA 3B3IA 3H9HA 4YXKH 4XP9L 1VJSA 3DJSA 5EZLA 5JOFB 1AZCA 1KGCD 5C9JA 4G6KL 3JUZA 4JRYE 5F72S 5DK2B 2DI7A 3FUJA 1M7UA 4RDBA 4TF4A 5JR1L 2OJZH 1WAEA 1BM3H 1JV5B 2X44D 1FPTH 2OTWA 1RSFA 3NA9H 3CDGB 3N42F 4NSKB 4NQDA 4DJMA 3KYAA 1KCSH 3VD9A 4JVPA 3CDZA 4IBUA 3O2WL 3QR2A 1PLBA 3TN0C 3FYIB 3V6FB 1NUNB 4RAUB 5JXEC 2FVNA 4G7RB 1CF8H 1XL4A 3EH4B 2APTA 1KMGA 2R56H 1N5YL 2GJPA 2WLKA 4MQTB 2X1OA 4GAAA 5EZLB 3THML 4YQXL 2LHAA 1S7QA 2A9BA 4YUEL 1FRGL 4I9XA 2BHZA 3O4LE 3U25A 3S2AA 2J1ZA 2UY7B 3PUCA 1YEDB 1G87A 3UH8A 1E40A 3PABA 1U91B 1BZ9B 4QWWC 3CDGA 1I1AC 1M7DB 3EW3B 4H88L 4NSKA 3SQRA 5D2NC 5I66B 1KB3A 2P49B 2IFFL 1DVTA 1CUOA 1U93A 4TSCH 1JZ3A 5HYQA 3AG3B 5C0AB 4P2OB 3M8OH 1KJ2A 4MD5A 2GQHA 4HJ0D 4R7VA 4RCAA 4WCYL 3RNQA 3UP1A 3QQ3A 4MX7A 2JVUA 1GJUA 4HUKB 1AD9A 4BFKA 2Q10A 3RDTA 2CDEA 2HTKC 3LQMA 3MU3A 1I8IA 2CBPA 4PS3A 3PABB 3V6BR 4WW1A 2WQ8A 4MS6A 4PRNA 4KMTL 4MRCA 5I8EA 5ACMA 5JHMA 1NANI 1NCAH 5A7BA 5EZIL 1A6WH 3TEUA 5F7AA 2YD4A 2VDQH 2UUDK 2XZAL 4W68A 4AEHL 4ADJA 3LDBC 1EH9A 4A67A 4ZTOL 5MEND 3DPBB 4HIXL 2BVUA 4OM0L 2HMIC 2QTEA 2D3NA 2GYSA 3UAJA 3L5JA 4RMBA 2APXA 3EYFA 4GBXC 4M6OH 4UM8B 1AD9B 5D2LA 4OKVA 2BNRD 1I9EA 4Q58C 3DHPA 4A7GA 4B7IA 4XMTA 1XGUA 4F7KA 1FN4A 3C09B 5IQNA 2RQEA 4BZ2L 1GYCA 5CMAA 4E9VA 1TYRA 2WBJA 3VXRA 4L5FH 4AGMA 5FWRA 1FFQA 5D2NA 3H3PH 4B9KC 4B9CA 2YPVL 3DPBA 3QDJD 3HHSA 1PCSA 4GKLA 4P05A 4TQ8A 2Q76A 3K71B 1EX0A 3D12B 5JHDA 3TONA 5F3FA 5IFJB 3AG2B 2HG5B 4OLVH 1WBZB 1I8AA 2BP8B 4ALAL 3VG9B 3NQKA 4DGIH 1AE6L 1RURL 2CIKB 2W95A 2X2IA 5C7XH 2BRQA 3QXTA 4A7VA 3B2UC 2C4FU 4PP2B 4DGYH 1J7VR 1PKQA 3DTUB 4EI6A 4AV0A 1RJLB 3T0EB 2OMNA 1KXTA 4OZGB 1OTUC 1IE5A 3D09A 4P46C 4PP1C 4AQEA 4GMSH 1KC5H 4H25B 5ALCL 1H8SA 1PTZA 1UXMA 5EBLB 2AJVL 1RIVL 3AS0A 4H13C 3HHSB 3PWLA 4HIJA 5L8JB 4OD2B 1KWGA 3HAEG 1DQIA 3L2NA 5ACLA 4KROC 3DSFL 2ZP8A 1WBZA 4K2UL 1NLDL 5E9DE 1IX2A 5HGGS 1IV8A 1U3ZA 2ZUTA 2ESVA 1FFNA 3LRLA 4O51A 3DUSA 3CFNA 3CVDA 3QUMH 2Z6FA 3OKOA 1F4AA 4JUSA 3MKKA 4KXZH 5FDWA 3LKQA 4EOWL 2BH0A 4RDQG 3U4EB 2ADGB 3FUKA 4OZGA 3WDHA 2DQIL 3DX8B 1IJNA 4P2QE 4OTXL 1NGZB 1JF5A 5D5MF 1J8SA 1IL1A 3WSQH 3OKMB 1SJEA 4RRPA 4E36A 4RLDA 5TPWH 4HIQA 3CHSA 5G2NA 2W0LA 4KTGA 1RULL 5HHOB 2EDBA 5BZWB 4NS0A 4ZMQA 1MI5B 3FT2A 3GZOA 1KTDB 4FQXB 4S2SA 1UTDA 1PNCA 2B2XL 3WOVA 2L04A 5HHMD 4EEEA 2XX0A 4UYQA 2JJUA 4XO4A 1IAII 3KPMB 2PWGA 4UOW1 4RSVA 3ULVD 3SQBA 4P4KA 3VW3L 1XVSA 1X5IA 1WPCA 4HS8H 2VIRB 1QABA 5JW3L 1ET8A 1HHJB 5D5ME 1FYTA 1ODAA 3R7RA 4M1DL 5IGXH 4I87A 1TVHA 4CJ1A 4KGJA 1UUSA 5DR5L 1AO7D 1FAKT 3IJ9A 4GRMB 4GBXB 3V10A 4HX1B 1W72A 3L4CA 3MRFB 4P2OC 5E23A 3LVTA 1Y07A 3U0PB 3LKNA 3L3GA 4ZNEA 2DQJH 5ID1B 5T3ZL 3CSYA 1YN6B 4H8WH 3MV7D 4PS7A 2WXIA 2PMZA 1CE1H 4TUKH 2H9GB 2ZUXA 5FYKL 3TVMD 3KPLB 3VI3F 5HI5C 2FR4B 1CLYH 3VSTA 1IE4A 1LP9E 4LFHG 5FW7A 3QPXH 4PPTA 1MY7A 4ZMXA 3EOTL 1SXAA 1FL3A 1HH6B 1ZIAA 2QADB 3ARBB 1SHXA 3DC0A 3S9DB 1UFUA 2FB4L 1V3JA 5H37A 3MRFA 4NQTA 2OQJB 5DC2A 3IPBA 3SKOA 3FHQA 2FQEA 1QBLH 1MHEA 3EBIA 5IQMA 1J9QA 4E68A 3MLUH 4WHTA 1G5AA 3H8NA 5IHZB 4HIHA 3CD4A 3KPLA 2J5LC 2BERA 2VW6A 5E99H 2O5ZH 3TT3H 1D9KC 3ARFA 3HPJB 5IBUB 1UYWL 2Q87A 3UTZA 3DVIA 1NIBA 1WWCA 1XGYH 1NMAL 3QIBC 1UH2A 2EDJA 2HTLC 4U4IA 1T2JA 4DO6A 1G7QA 2FEEI 1MJJA 4QXTA 4XNDA 4TVPH 1I8UA 4NO3A 2OQJA 1XD0A 2J8UB 5CP3A 3BGMB 5LWYL 1ZT4B 1QOKA 4NJ9L 2A9MH 4N4YB 3FFDB 3VFNA 2CCWA 1L6PA 2C1PB 4NRYB 5A3IC 5JYLA 3LZRA 5LAXA 1XF2A 5J13B 3DETC 5CO1A 2VZSA 5MEQB 4KMTH 3C2AL 4HK0B 4NX0A 1JZDC 1YLBB 3MO1B 5GS2D 4PRPE 2OJEA 5B3JF 4JMXA 4NP4H 3IFOA 3HI5H 2ZXQA 2YGVA 4X5WB 1TZIB 4FNUA 2WBWB 3VYPA 5EDSA 5AD0A 2ZSWB 3FFOA 2VH5H 4NRZB 1EIBA 3GIVA 1QO3A 2WV3A 4M6OL 5A40E 5I6LA 4P2CG 1JVOA 1Q9WA 2FGZA 1O7DE 2NXZC 4F7TB 1HHHB 3ASWA 4MMXA 2DKSA 1CFQA 1KJ3H 3STLB 3ETBF 5TDPA 3I2CL 3L4XA 5IJKA 2VSMB 3H85A 5DWUH 4PI0A 1KCVL 1BDYA 3BSZL 2BVYA 3KLKA 2CHXA 3QA3B 3UPAA 3G5YA 4LSVL 4PJHB 3JXAA 5DU7A 2YPVH 3GXFA 3N41B 3NTCH 4BKSC 4FNTA 1U8QB 3WE6B 5A1AA 4G6FD 3NPSC 2Q3AA 1SMOA 1DJHA 3L9EA 4YLBA 2YRBA 4HCRL 2V7NB 1KJ2H 1YEFL 2JCCE 5EO0A 5FLUA 4HG4K 3Q2NA 4JKNA 3VXQA 4WFFE 2VLKD 1MCHA 1LM8V 4O58L 3V6ZA 2XQ0A 2WSDA 5C86A 4PJXB 4NCDA 2XRAL 1YMMD 3LZFH 4RISH 5F6IC 4MQXD 3IWUA 2Q7YB 2VRKA 2W8CA 3W11C 2NY5C 4QTHB 2XXCB 2DQDH 5FDYA 2OMXA 3GHEL 4KJPC 4JFXA 4YFEA 3FQ4A 3FFCD 3PGDB 1E5AA 2VR7A 3QXDB 4IOFD 5GGTA 3TXAA 1NLDH 1LHZA 1MFMA 3R1GH 3VO0A 3VACA 4QKTA 2NLJA 5C0GA 5C0ND 3SOTA 5I1JL 4NN7C 4YSTA 3HI6H 2CH8A 3V9CA 2IJ0C 3DUUA 2EE0A 1X4YA 2VDOH 5EBWA 2DQGL 5K1NA 2ICWI 5E2UL 5E1QA 3WSQL 3WHE0 4K7FA 4XAKE 2JJTC 4XC1L 4MXVF 3Q2WA 1L4IA 1ETZA 4L9LA 4JFXB 5CZVL 1VZGA 3QXDA 3V9EA 3ZTEA 4RMVA 2C3VB 2H45A 3PWNA 5KSAC 1E9PA 5EU5B 4Y7MA 1JGVH 4OZFH 1A14H 3PRZA 3CFQA 4ZQTA 4NT6A 3UG4A 3UTPD 4GFXA 3VW3H 4AE0A 3MA7B 4X6BA 3RTQC 1A4AA 3L16A 5AL0A 4YIQA 2AS5M 4WW2F 2VDQB 1NCHA 4LU5L 4M03A 3QFJA 3QCUL 3LIZL 2F53A 4KQ4L 4M6ML 3TIDB 5B7MA 1MCOH 1S7XA 4LDLB 4IW4C 2HT4C 2PWDA 3CQQA 4NPYB 3GSUB 4XTRC 3VFGL 2XU9A 2YZ1A 2R39A 1L5GB 5F93C 2BCMA 2FH8A 3SIKA 3KYMA 3CVBA 1NMBL 2BDNL 1GA2A 4RFEA 2XTJB 3NZHL 4HZLA 2PW1B 2CUAA 1C12B 2QZQA 4OIBA 3V7MA 2HLFC 4R7XA 5DC0A 1AKPA 1RZ8B 3HJEA 1A7OL 1ZS2A 3C5ZB 3FTXA 4FHKA 4EIZC 1Q4NX 5EU4A 4X6BB 3MRNA 3G7TA 3NJJA 3ARUA 1RZIB 3QPXL 4JRXD 1MRFL 2RTTA 1OCOB 3O8XC 4GO9A 5L7XL 4BA8A 5HHQB 1EGJA 3K6IA 4Q89A 4GW1A 1EV2E 1QPXA 3BKJL 5F1IB 1U6AL 1A5FL 3DSNA 1JD9A 3RTQA 4G2AA 4PJ5E 3AZUA 5FFGA 2AJ3A 2CGRL 3GJFH 5K59E 2L7QA 3QAZC 4LASH 2IAND 4BK5A 2LU4A 4YDKH 3KR3L 4U1GB 4M5YH 5I0XA 4HKZB 1GGYA 3A5VA 4H8QA 4L1TA 1B6DA 4UTBH 1LK2B 3U1QA 1ID2A 1JHLL 4M7KL 1OAJA 2OULB 3MBEB 1DQDH 3U36B 4XXWC 3X1FA 4S1QH 5ILTL 2N4IA 2CJSA 3S8GB 4AYSA 4TVPL 4HYTB 1XAKA 2PCPB 4FLRA 4JFHE 4NWTL 2P8MB 2NNAB 2VLKB 4WI0B 1A6TB 2VMFA 2X4NB 2VW4A 2ZONA 4R0LB 4GKSB 3VD1A 1XV8A 4NZTH 3AUVA 4JCWA 4FL4C 1F4XH 3UTSA 3AADB 2W0KA 4LRIC 3GNMH 3KBPA 4PRBA 3VRJA 3U4BH 3NFPB 3C2AH 1LK2A 4HP5A 2A9NH 4Z7QB 1I75A 2NX5E 1P7KB 1GZPA 3CZKA 4Z77A 1NAMB 3SBWA 1F6AA 3U2IA 5FYLH 3I9PA 3WJJA 2W65B 2MCAA 1YUHA 2APFA 3MGTB 3P1VA 3L2LA 4IIZA 4FQ2H 1U2HA 2NY3D 4HJJH 4GKSA 3VFUA 5ELIA 3OKLA 5I6OA 1DJZA 2Z93A 2KC0A 4N2HA 5EOQH 3E6HB 3KLSA 4MJIA 2V4LA 1JMXA 1LD9A 3MUGB 3R7QA 3EUDA 5IESL 2QTVA 2FATL 3HZMB 3SD2A 4CBZA 5DEZA 1WT5A 2XY2A 4MAYC 1QTPA 2X12A 3KJ4B 2C7UA 4OZGF 1PZ5B 4Z77B 2NY0B 2GHWB 4FXKB 4MCYA 5DXWA 3T9WA 3HI1A 3MGTA 4W4NA 1T1ZB 1X9UA 3LKOA 5EUOB 1N8OE 3MLZH 1FAIL 5INDA 4NO0D 1QSEA 4JY4A 4XVUC 5KVGL 3REVB 3LHPL 1EO5A 1N6UA 2Z93B 4PM1A 1J5HA 2VC2L 3X1BA 4LF3B 1PG7X 4MMZA 2O61A 3K4AA 4Q7DA 1R3IL 3MRGB 3V52L 4AM0B 3P3UA 4DP1X 4ATTA 3MNZA 1E4WH 3UYPB 1NZRA 3H53A 1ZIBA 3GMPA 4GIOA 3T0AA 3QYMA 1P9MA 5INDB 4LPYA 1LP9A 2W9EH 4HLZH 1XB8A 3REVA 2QT6A 2QSQA 2Z91B 3V79C 1R5VA 2J12B 1K5NB 2V2XA 3BFOA 3L3JB 2X89D 3AROA 3BXNA 4JO3L 4KVCL 4U6XB 4OB5H 4XP6L 3V9FA 3ATEA 4HLZG 5I28A 4BV1A 3E38A 4FFVD 5DQJB 4U1GC 5F9JB 1NGQH 2AK1L 4O2CA 5IUSA 4KC3B 1XMEB 1CD8A 4HISA 5INCA 1PKOA 5DYFA 3QAQA 4HKBB 4I48B 3E9UA 4KKLD 4P23D 1KJVA 2DJ4A 4QHKJ 4Y4KC 4EDWL 4ZW3A 4Z3FA 1JP5A 2XIDA 4MNGB 2OSWA 4N8VB 4WI9A 1CXKA 1R3LA 1A14L 4NZUL 4U6XA 5HI4C 5ESQA 2X4SA 4FQLH 2FEEL 5JQHC 1JHKL 5TE6L 3ZK0A 1J18A 1CTOA 4OVUA 5IB3B 4KAQH 4JGJA 1V3LA 3B6SB 3TF7C 1C08A 2W9DL 3ZHDA 2E47A 5AAWC 3T6XA 2F1AA 1XHHA 1BJ8A 5E6UB 3P9LA 4DFIA 3QI9A 5HYJE 2Q3ZA 1Y18B 1EQWA 2DJUA 4NZRH 4PN6A 3BVVA 1BQUA 3SY0B 3KL3A 3EOYG 4B9JA 4JQVC 3UCQA 5KBPA 3EH1A 4PB0H 3X11A 2N7SA 2DWEA 2DQTL 4AGOA 3RJQB 1PD0A 3GD1C 5CD3B 1R3LB 1EFXA 1VEMA 3TLRA 3O3AA 3WFDH 2X4SB 1Q72L 1MVUB 5IF0A 1S46A 1MPAH 3FCGA 1CFBA 4F20A 4M61B 2FAUA 3HE6D 2C9RA 2IQAB 1TNMA 5CIPH 2YPLB 4XWGL 4MDRA 1IFHH 3NSCA 32C2A 3IKCB 4F7MB 5CBEB 3HE7C 3DDFA 1UM6H 2F74A 4FFWD 2OCJA 2EYRB 3K7UA 3QORB 2VUOA 1NAKL 1V7NL 4PJ9B 4R4BA 3DUHA 4JQXA 4P46B 4RMRA 5IUCA 1K2DB 4AV4A 4DPCX 4IGBC 3QNFA 1MVUA 3A6BH 3C8KB 4PAZA 3KR3H 1HX0A 3ISYA 5CJXA 4GXVH 5EV7A 2IQAA 1QBML 2GTWA 2R59A 4PWGA 4Y1TA 5CWSB 4HOWA 5CCKL 3A4DA 5CBEA 2X6VA 1GAFH 4JPVH 3CFJA 5LKNA 4PWHA 3BOVA 1I9IL 5ILTH 2Y1ZA 1I31A 3TTSA 3OR7B 3UX9B 4MMYA 2CBOA 4Y16C 4NWTH 3HFML 2BXYA 2VXVH 1BEYH 5FKAB 1HI6B 4NC0B 1SHWA 1ZSHA 3S88L 1U8PA 1T04A 2SODB 5HGBB 5J6HB 5DK0A 3RX5A 3UPRB 4NHCL 1UKSA 4P2RB 3SPJA 3MBWB 1HAUA 4XCEA 4FMKA 3SKUD 3B7RL 2A9NL 3HS0B 3P0VL 2FIKB 2HN7A 4OLZL 2ZKWA 1DLFL 2L3BA 4LDOB 1FVEB 4LK4A 3BP6A 4IGBA 4JPKH 1P7BA 4BFRA 4S1RL 3DX3A 1D7BA 3TBYB 1FGVH 3NSXA 5E03A 5T5NF 5F9WC 4GH7B 4RAHA 3BZ4A 2PWEA 4EMZA 4HAGA 5HGDB 1QLFA 1LXMA 1Q9LB 1OP4A 3APNA 4ODTH 3L48A 5D7KE 2FYYA 4ACPA 4MXWL 4AQ1A 5I17B 4QRRE 4X7CC 4LLQA 3MUJA 4PBWD 4EDXA 3JWNG 1XR8A 4MKMA 4HJ0C 2QDWA 25C8L 4MDJA 5K9OA 1S7TB 1GZHC 4OCWL 5H37G 4TSAL 5FCUL 3UBXI 4H5SA 1OTTD 2WO4A 2WIIB 2FT8A 4QJ3B 1L0XA 5DJCA 2WLIB 3VGBA 3VWJB 4P5TA 3CFIC 1G7PB 4P5SA 4U4BA 3PF2A 4JRFA 4NEHB 4NUJB 4FG4A 1ADQA 3GO1L 4N6RB 4ZG1A 4JKLA 1NFKA 4Q9RH 3T5WA 1X7SA 4FQXD 1F13A 4QOKD 4AENB 5I9QC 4UANA 4JQIL 4K0OA 1TNNA 1E30A 1M71B 3CFEB 4XMUA 3DX9B 1A25A 2BY2A 1AQKH 2GSGB 2YEZA 3HG1B 2EUZA 4UB0H 4TNGA 5T5FH 3FQTA 3Q3GB 3IYLW 3ZE2E 3CN3A 3FUEA 5I74B 3WIFA 3B83A 3K81A 3M6DA 5CLXA 4M5SA 4LVNC 5IFAH 3H2PA 5DHXB 4PJGE 4NCC2 2W9EL 2E6PA 3C8DA 3DURA 1FQ9C 4RGND 2ZYHA 3CFEA 4WI4A 5E2VH 3QPQC 3G04A 5J3HD 3BEVA 2GSGA 4I3GA 3PV6B 1MDTA 3ME0B 4YSQA 4KDWA 2ENYA 4JG0L 4Y16B 2H6OA 3D2UB 3TWCH 4PJFF 3HE7B 4OKDA 2IV9A 2FUQA 2PP7A 3AGWA 3WKYA 3EXLA 1KDJA 1XH3B 3S3CB 1RFDH 3WYRA 1E2VA 1T5KA 5JW4Q 3QQ4B 4DKAA 5GGRA 5IMOB 3L5HA 5JPNC 4NGHL 3EH5B 3NJIA 4GW4A 3ZZQA 1AGEA 2TRHA 3QDGB 4FQLL 2DM4A 2VLRB 3G04B 4PTTB 1JHKH 4QRQB 1AQDB 5F1KC 1YY8B 4L0ZA 3CZUB 1UWYA 4QRPE 3NYKA 2OMVB 1MF2L 4DPAX 3EFDL 4O2EA 4Z1PA 2KLTA 1AJ7H 1SEQH 4DWHA 2DI9A 4X7TA 5CAYB 4FXGC 5DMKB 3CUPB 1WS7A 2ZF9A 2CO4A 2CA4A 4CC1A 4JRWA 3RGVA 5BPPA 1HYSD 3QEUB 5CJ8A 5IB2B 2CHNA 5HGHB 3NDZE 2ZG2A 3QEGL 3SGKC 4R9HA 2J8UF 4PJCA 3OZKA 2FWUA 3LZOA 5BJTA 5I15H 2N7AA 1BF2A 1Z5LA 3O9WC 5D71L 1NC4B 1P4IH 3NA4A 1DJSA 1G6RB 4AUJA 3QO0B 4X7TB 4KZDH 4ZFOB 1OT1A 2LT9A 4LAJH 5F89A 3WJJC 5AVWB 4UT7H 3OJDA 3HZVA 3NG5A 4OCRH 1BQHA 4MJIE 5HBBA 2A6IA 1N9PA 5A2BA 2ADIB 1O6SA 4R7NB 1FFPA 4RMTA 1U58B 3VFVA 1ZHBA 1H0DB 2YMXH 1J0KA 2WOYA 1T5WB 2L8AA 3A6BL 4R5TA 4Q4EA 3DBXA 3HCVB 5T1MB 1NLBL 1WV7T 1MCJA 1G9ML 4CADB 4X4YA 1NC4A 4NQDD 2OBGA 2J55A 3HPLB 3FSWA 2YXWA 4J3XA 2NR6C 5IIEB 2CCVA 3P02A 3ZTJH 4BJLA 3NK3A 1KIRB 4JPWH 2VDKL 3QNYA 3IRZA 1DL7L 4MJID 1MLCB 1S9VB 1CXHA 2FEDD 3PREA 1H3PH 3TIEB 2CSPA 4AGQA 5KN5B 1YEDA 4N22A 3VA2C 4FQPA 2Z0BA 2ZTBA 3HNVH 3PJSA 1G43A 3T0XA 1PD1A 1M7DA 1OW0C 4YDNA 4NKOA 4G8GA 5JHLH 1V3KA 3WTWA 3JV5A 5E6IA 2PTTB 3ELQA 2YUZA 4W1TA 1YRKA 5D4IA 4Y5YA 5K69A 1CLZH 3BEWA 3SE3C 4EUPA 3IAPA 1A66A 3QUGA 2OL3B 1LO5A 4OD3L 1ZLWK 4M7ZB 4UZUA 1IBGL 3ZZSA 4YFDB 5A2JH 4FFZA 1U8CB 1MFDH 1XF3A 1IGJB 3CMOH 2DL2A 2GSIA 1URLA 4PGCB 1X7QB 1NBQA 2AZUA 2W0PA 1WWAX 4NBYB 5E08H 2QVIA 4AVIA 1RU9H 1E5UI 3IK2A 3AS2A 4LKCA 5FPIA 3EJZD 8FABA 2X28A 3DO7B 3VDAA 3ERXA 3GT6A 1A7PH 1FHGA 4WFHE 2WZPD 3ZZ1A 4H40A 4WK2B 2MPAL 3AS3A 3QG6B 5HDBF 4HK3J 5D2LB 5C2UB 5G5DB 1KV3A 1OD7A 4LCWA 2OV0A 4ANWA 4HA1A 1AQKL 2Y4SA 2TSBA 3QCVH 1UACL 4JAMB 2VJ8A 3F2LA 2YGNA 2WAQA 1ZLSL 5D1ZI 1TG8A 3FH5A 3O4OC 2HT2C 2IAAC 2BIPA 1M7IA 4PJ6A 3WGUB 1O7SA 3KWUA 4BFEA 2HH0H 1OAUL 4L1DA 2H0FA 5E24E 1JTPA 3KLQA 2UXVA 4NRXB 1XIWC 3PY9A 4Y5YC 2ZX8A 5DEFA 4WHYG 2KL6A 3L9YA 4N9OB 4WEBL 1UWXH 2V8LA 3GLEA 3KLHC 1FI8C 1QZNA 4POUB 3WNLA 2FLBT 4X6CB 4FQ1H 1YPZA 3ML8A 4ELMA 1I7TA 2YK1L 2FZ3B 1QVOB 4H88H 4EI6B 1LEGB 3RX7A 3TA4D 3OJVC 3KBEA 3FN3A 4LARL 5EUOE 3X14B 1T21A 4APQA 1OAKL 3C08L 4K3JL 3TWCL 4EN3A 1K8IB 3SDAA 3T6ZA 2HKFH 2XG5B 5E6SB 2IANA 1MCIA 2X0UA 2NDGA 2DTSA 3A67H 2VXTH 4TYUA 2WLHA 4P07A 2FSEA 4JDTH 1MCFA 1IC7L 5FO8B 3IRPX 3DUSB 1YPZB 3QJVB 4U1JA 2O72A 5IJDC 1DEDA 3ROLA 4LLWA 4NZFA 2V7HA 1MCBA 4C4UA 4LPTA 1IVLA 2WZPA 4LCUB 3HAEB 4KKCD 4CNIB 5GSRA 4UM9A 3EF7A 3G5ZB 1P84K 3JT0A 3MRJB 5EU3A 3TPUB 2I9TA 4BK4A 2YQ2A 5DLMH 3ZL4L 3FNKA 4AYEC 1CK0L 1Z1WA 2AF2A 5CJQH 2EEXA 1AC6A 2IF7A 4N5ED 4NQUA 1JPTL 4FL4B 4AYFB 4ZZKA 4NHUB 1JN6B 4XOBA 1CT8B 3T2NH 6FABL 2V7HB 2VLME 3HNTL 2F0CA 4JY6B 4WWKD 3WLBB 3EGSA 5FYJU 5K9KA 1HHJA 3TA3D 4UM9B 3QI9D 3SDYL 5EU3B 1WLHA 3TPUA 2XETA 3AQDA 3MREB 3LS4L 3D50A 5MEPB 4YX2L 3HTLX 3H0TB 3CFDB 4LIQE 5C7XL 3EHBB 1CDJA 3IN0A 3BJLA 1PG7L 1FH2A 4ZJ9A 2VN7A 1AZBA 2D0HA 4XXDA 1LE5B 2FX7H 3QIUC 4KGLA 4V1DB 1OQXA 1N67A 4XBGA 1QATA 1N64H 4GI9A 2HLFD 3WN5B 3D2TA 3KPSB 4N2NA 1X44A 3ZKSD 1NCTA 2Y07H 3CPUA 4HHWA 1BW8A 2OMWB 3L3KB 2BJML 5ICUA 4IRJA 3GLDA 1DYZA 3DX1A 1OGAD 1XB3A 2PTVA 4UU9B 1AR1B 1IBDA 2W1NA 4PV8B 4XCCH 2EUWA 1G4RA 5HP5A 4P9ML 4JR9L 1AS8A 2DLTA 3A4AA 1XSOA 5HJ3A 2D9CA 2ZJSH 1IAOA 3FFCA 4HKJA 5HSFA 2K6WA 3H9HB 4LHQB 4Z7UE 1M2OA 1DCEA 3KGTA 3T1FB 1IAIM 2ITCA 3WS6C 2GSMB 4A2HA 2MWCA 4XCNB 3UTZB 1F58L 1ML0A 2DQUH 4HU2A 3RVUC 3PP4H 4X99B 4IRJB 1JV5A 5KBLA 1U8LA 2MH4A 3QUHA 1RAMA 3MRBA 3LXCA 1HS6A 1PIGA 3GJFB 2KKQA 4C56A 2X9YA 3AY2A 1RIUH 1ASQA 1QI5A 2YC1A 3QQ9C 5GGUB 2C34A 5L8LB 2A7BA 1S9YB 3NACL 4BQBA 4XNXL 1GRWA 1LO4L 1OARL 4LQFH 4W9FC 4GI6A 5MI0B 2IAMD 5MEQA 2C1OA 3S35L 1WK0A 4KO6A 3MRPA 3O4LB 4XPGL 4ESKA 2OZ4L 2WOBA 1YVLA 1I8KB 3LEXB 3MRBB 3ES6A 4CC4A 2XA3A 4K9EL 5HPMA 2OL3L 1KFAH 1Z9SA 2QHLA 1D9KA 1S5IL 3P9WB 3I50L 4E9XA 1C1EH 2JIXD 1MI5E 2DW5A 1HE8A 3V4PB 3QWQB 3IGFA 3P30H 3QQ3B 4YMPA 1JZ2A 3QRFM 1TU2A 4HEMA 2VLJD 2XICA 3BIBX 4K07A 2F54B 2CDEB 4PRPB 5EO9B 3QARA 1QEWA 3CVHL 3QC6X 3KXFD 4JZNB 4FABL 1KXQE 1IQWH 5CEYA 4CVZB 5D1XC 1E5BA 2R29L 3EJTA 5IEHB 2XXMB 1U8QA 4KFMA 1AXTH 1D9KB 1HL5A 1JGDB 3GWJA 4GINA 3S5LA 2WXQA 2CU9A 4WGKA 5EF3A 3QQNA 3BKCH 1B0GA 4QHLA 2VZ1A 4Z0BL 3T8MA 2IGFH 5CM1A 2ZAIA 1T0NA 1QYGL 3MYJB 3K74B 3RAJH 4RFOH 4UT6L 3MV8A 3V6ZB 3RL2B 4X8GA 4DZBA 3QJFB 4M4RA 5IQ7L 3KHOA 3JVGC 2OW6A 2OSLA 4PB9H 3F84A 4G8IB 1KB5H 1XGRB 1NGYA 1FN4B 2HKFL 4K5PA 2Z8VC 4Z3EA 4QTHA 2L7UA 1ZKAA 3Q9PA 5IWLA 4H8HA 1QUNB 1WAAE 4CC4C 3IVKA 3SE8L 2WN3A 5JHDB 5IFJA 3HRPA 1CDHA 5HHXL 1DTUA 4FTVE 2KDYA 3CC5B 5H94B 1BVZA 3MYJA 1GGBH 2ZOLA 4LCCC 3N3EA 5ITBL 4ZAKA 5T3XL 2B5IC 1YY9C 2GY5A 1PKQB 3DO3A 1RJLA 5C92A 1TEYA 2EECA 2P48B 3BKYL 3TN0A 3ZHNA 1YSOA 2D7NA 3Q6GH 4JHBA 4XI5C 1OM9A 2CPUA 2YD7A 3HB3D 4L9LB 5DLML 1L9TA 3GDBA 3TL5A 2BVTA 1ZTMA 5I1GH 4KKLC 2BFVL 3HHMA 1MY5A 2IDTA 3UP6A 1IVTA 1ZE3C 2ATAA 2XQYA 5DWUL 4NZJA 2ESVD 1T5XA 3VSVA 2NZIA 1JZ4A 3MNDA 5FDWB 1SBSH 5IVZA 4RIRA 4KH2A 3UAEA 1S7XB 3IPEA 3ULUH 5KSBF 5ALBH 1P69B 2P24B 4BQ6A 3HG1E 4GSRA 5AW7B 1QTSA 2ITDB 1VACA 4MNQE 5DZAA 1GY2A 5BV7C 2CKNA 1H15B 4XAWL 1AVAA 2PW1A 4EIBA 1E9QA 5C0FA 3GKWH 4WJ5B 4HUXB 1N64L 4Y1AA 2CJUH 3NBNA 1MRCH 2EDQA 2LAAA 3CVCA 4OZFG 3ARGD 3MRNB 1A7QL 4GT7A 4J6RL 4BD4A 2KHAA 3ZR6A 1DJIA 5EEXA 3GHEH 5BRQA 4ABWA 3TF4A 1MW0A 3QJUB 2WXNA 3NCBB 3KMDA 1UD3A 4XP4H 1BAFH 2G2RB 3IJ7A 4WGVB 3AY4C 1R5WB 4L8DB 3B2XA 3HIZA 5CJOH 4GRMA 2AJ3B 4P49A 2BS71 3E8VA 4JO2L 3QYNA 2QV2A 3WG7B 2IPUG 2D03H 3U0PA 3W5NA 1S7WA 1ETJA 1GHFL 4TSBL 4OAWA 4Z78A 5ID1A 2BSTA 1I8MB 2VXQH 2QLYA 4N1HB 1F58H 2DQUL 3QE5A 4IGBD 1KLFA 2HVJB 4PV9B 2FT6A 2XV0A 1QWHA 1TETH 2Y25A 4N25A 4F8OA 4OLWL 4JKMA 4CBPA 1G1CA 4JFVA 2X9XA 4K9JA 1ZV2A 4OGXL 3HC0A 9CGTA 2WVVA 5CD5D 1WGVA 3V5KA 4DKEH 2PCPA 3Q8CA 2PO6D 3LN5A 2WGXA 1ECYA 3BVDB 5HHVH 4BCZA 5EA0H 3E1F1 5C09D 3ABMB 3L5WA 4NBXB 3EDJA 4BSJA 3UTSB 4OAWB 3G5XB 2BSTB 2FNWA 5KS9E 4AQZA 2GIMA 1HIML 4HIHB 3N6YA 1FL5A 3C60B 5EUKA 1EDYA 4BFNA 2OMZA 5DJ0B 5EEZA 1F2XK 3FT3A 1A4BA 2CQVA 2FBRA 3OR6B 1CICD 2AK4D 1F6AB 1QKZH 1PLGH 2I32A 4K9EH 1BVLB 4IU2B 5DD1L 2I5YH 1CYXA 3CPLB 3QZPA 4BZYA 1NA8A 5I6MA 1HWWA 2XN9E 3TESA 1JDCA 1IGCL 4E2OA 3FTWA 3V4VL 4DCQB 2ZYSA 4RWHA 1MW2A 4QXUH 5SWSD 4WUUD 3B9KA 3D06A 1RI8A 4P23A 5GS3A 1IGFH 3MO1A 1PZ5A 1U42A 1YCSA 5E56A 2QQNH 3UERA 2I9LA 2CM6A 3ZKXB 3HI1B 5IBTL 2HFFB 2BNQB 2FJGB 3SEPA 3MOBL 1VZIA 1JZEA 1SJMA 4I88A 2QGCA 1J87A 4LL9A 1C7TA 3CZFB 3HKFA 4U7KA 3EHBC 1M05A 3CLFH 2ZOTA 1S2EA 5GJTH 3HKZA 2HT3C 2I07A 2XQYK 1USZA 1DQDL 5AVYB 4MMXB 4OCSH 4DCQA 4HPYH 4YL9A 3CLEH 1ZK9A 4KVNL 3C5JB 3FU9A 5JZ7D 5DJ6B 3GRWL 3ILPA 4P3CH 1HEHC 1YEJH 3SGJA 4ONFH 5IOKA 3QUYA 5TDOB 3QZLA 3TJHD 5ICZB 1OOAA 2WUBH 3PHOA 4QMEA 3WFHA 1VADA 4Y5VA 1BCIA 5F7UA 2ADJA 4CU7A 1MWAL 3ARPA 4XHQA 1NCGA 1DUYB 4UQ2A 4XB8A 1GGBL 2V7NA 3MJ9L 5EO0B 2F5BH 3BP4A 5JDJA 2Y23A 3FS9A 2D3JA 1BYNA 5FYLL 4AKPA 3QIWC 1F18A 5INCB 1NSNH 5CCGE 2GUOA 4L37A 2XWBA 1ZWIB 2BVPB 4P9HH 4JM2C 1L9OA 1T7ZA 1UZ6F 2VDPL 3AUWB 1ZHNA 1DBBH 2ZQKA 4KHXL 4XE0A 1IKNC 4LGRB 3V4PL 2UWEE 1SPDA 5GZNA 3CZGA 2V2TA 2WQXA 2LV4A 3BAJA 4F3FB 3G6AA 4IBVA 1OANA 3JWNH 1BZEA 3CK0L 3DUUB 3S3JA 2NZ9C 3KPOB 1U3HA 2VNCA 4LOVA 3VE0A 5JR1H 1BIIA 1XCTB 5BOPA 5E6IC 1BM3L 3NGBB 2DWDA 3QUYC 4NO0B 3FW6A 4W9IC 1YNKH 5EN2B 4ECNA 3TA3A 1JGLH 1HYSC 2E86A 3BSZA 4LCYB 5E6ID 1BD2B 5L9DH 3IU3B 5AKVA 2CLVA 3UMTA 5EIIA 2O6DA 1KSRA 4MCZB 2B3RA 3S36H 1A9VA 2CJTA 5DI8A 3PNRB 4DPBX 4TULL 3RWGA 1LWRA 4L3EA 4ZQKB 2RMNA 1CZ8H 2NY4B 2NT0A 3MA7A 3M46A 4OLUL 1TKWA 1AACA 1FFTB 1Y7VA 2I60H 5AW6B 3NZUA 3SPHA 1RUKL 4AG4L 4NQVB 1AD0A 1BIIB 5DJ8B 5DGQA 5DUMH 4XP4L 4DIXA 1E28B 1UUNA 3AXLB 3FZUC 4NPYA 4UQDA 4N1EA 4K5OA 2WZ5A 1WUZA 5SWZB 2QVFB 1R47A 5DUJA 4XE5B 4XBPB 3UAJC 2NRDA 2OMTA 2C7FA 4HZLB 1T80A 1QFUH 4W9GC 3B2DC 2WP3O 5IMMA 4YHKH 3RFZA 4L3EB 4HBQA 1AYRA 3U2JA 4N0YH 4U1IA 3BD4A 2AGJH 3EJRA 3PWVA 1WISA 1HHIB 1KF9B 3T3PE 3RA7H 4E41B 5HYEA 1YZZA 2AJYH 4S1SH 3T8XB 3TNNB 3CV5A 3MV7E 4BZ1L 1B4TA 2DLHA 1LNUB 1RH8A 3FDWA 3TEYA 2EDHA 4HWNA 4Z6AT 1R0AL 2Z0UA 5D6CA 4HXAL 1KYAA 1D2PA 4ABVA 5LGYA 4Y4FA 3AM8C 3S5LG 1N8ZB 1BZ8A 3U0WH 3WTVA 5FO7A 4U3SB 3MZGB 2G0LA 1QFHA 5AW8B 3I75A 1HHIA 1KCRH 3MR9A 3QNZB 1J1XL 1RUAL 1C7SA 3ESOA 2CUIA 5FX3A 1VEOA 1ZLVH 1D5ZB 1PLGL 2M2DA 4NZ8A 4ZFZA 4XNYH 3SKNA 1MFVA 5J1SC 2KZBA 3BO8B 3D69A 4WTQA 2CO7A 1IM9B 1NCIA 5BZDA 3WFDL 1HC1A 4JFFE 1Q72H 1X5LA 4Y2NA 1HINH 4X4MA 2NQDA 1JIBA 2V9UA 4FLQA 4CGUB 2BSRA 4RMUA 2E27L 4PRAB 4MDJB 4N2FA 4HDIB 3VXRE 3U1SL 1IGCH 2EZ0C 2X6AA 4NQEA 2JIXA 3PWUB 1UKTA 3QAZB 4DGIL 3D07A 1AGFA 3P9MB 3MR9B 3AQYA 3CBRA 1K4DB 1WVZA 3QG7H 4P5TB 5CN1A 4LHUB 4OFKA 1U3JA 3O6LL 3IBEA 3MZTA 3MOBH 1AO7E 2XXFA 4G83A 5DEJA 4FFZL 3TASA 5DVMA 4MS8C 1CD1B 4GLRH 4WSGA 1V3MA 2W9LA 4NQEB 1GAFL 4X4ZA 1IQDB 3S5YA 4LEOA 4N20A 3GBNH 3CXDH 2DMCA 2VERA 1C16A 2EYSB 3L4WA 3BWAB 5J6GA 3IS0X 4ONFL 1MELA 4I0PB 1X5KA 4L05A 3V0FA 1TVBA 3L4UA 5IB1B 4IIQA 4BBWA 4KQ0A 3BAYA 3S96A 5AYUL 4AOFA 3S88H 2Z35A 4ZPTA 1PYWB 4Z76A 1TENA 2QHRL 2O93L 4L0YA 4XPFL 5F7DA 1NGPH 1QSEB 3BD5A 3P0YH 2R0KH 4JY4B 5EU6E 4R90L 1BFOB 1CD1A 3KVQA 3BEVB 2QGDA 1UXWB 2HAZA 3FTUA 3MLXH 4PJ5B 2CKBA 5F7WC 2WLLB 1CO1A 2XWEA 4LEOB 4XODA 5I1KL 4X9HA 3NDYE 5J6GB 4MMZB 2O61B 3QEHB 4QT5B 4ZW6A 3RFRA 5HY9B 1MVFA 2HTLD 4MNQD 1KYOK 2JJVA 5IVXE 2WO3B 4YR6B 2YN3A 3FOMB 4AUUA 2I69A 3FTYA 2BY3A 3S96B 5ID0A 4FYTA 4TPRH 1EEUA 4XVTL 1PX4A 3DRQA 4HS6A 5IGXL 5DQDH 1WYJA 2V3FA 2WXPA 2EXSA 2GTZA 4EBQL 4PTTA 2J1KA 4TSAH 4DO5A 4QRQA 2FBJL 1MXGA 4Z7VB 1TPXB 3OWRA 2QADC 2X4OA 4P2QD 1IGIL 1TQTA 3ZYZA 4EVNA 3CK0H 5I8KL 1YMMA 2HKHH 3CH1B 3CUPA 1UM4H 5I71B 3ESVF 2KLSA 1G7IB 2GJ6D 3OTTA 4GXFA 2W38A 2CDFA 5AB9A 2DQ6A 2VWEE 1DQTA 4TUOB 3KJ6H 2C3XA 1T7VA 4OQ1A 4PJ7E 3VI4E 1P4BH 2FJFB 3EH3B 1Q0YL 1WCBA 5ADOH 2FT7A 5ANMA 5F7YC 1TF4A 4J8QA 3P2DA 3JWDL 4N8VA 2VUKA 5A16A 9PCYA 2X10A 4HF5H 1RXLA 5FYLD 4HOMA 4ZFOA 4R2GD 3ARTA 5HD8C 4PJDB 1MJ7L 3O9WA 4Y4HA 4JL2A 2F7RA 3RB5A 4FJZA 1UVQB 5SWSE 1Y18A 1O6SB 3QH3A 3BPLC 4ZI8A 5DZVA 4XRCA 2C8NA 4Q14A 2WXFA 1ZHBB 1NDMB 2N3JA 1HQ4B 3PYCA 4OI9A 2XBTA 3I6GB 3VXSD 1R46A 3OV6A 2J71A 2K1MA 3NVQA 1RJYA 1JWUB 2AGJL 2X70A 5AENA 1OGTA 4ZS7H 2AAAA 5JHDE 2NUTB 4O2FA 4R3SB 3DJ9A 5B7FA 5BW7C 5DJZA 2FTAA 3L95B 4NQQA 1KGCE 5B1CA 1JRHI 4FI8A 1P7QB 4ICXA 4MNHB 3MRDA 3QNYB 4DFHA 2B1HL 5HDLA 3SGEI 4KTEH 5E9NA 4UINH 1H6EA 3I85A 5JPNB 3O81A 2DBLH 5DD0H 2Y5EA 3FO9A 4MMZC 2MTPA 4J3OD 1JF6A 1J10A 3HMWL 4HPHA 2YUXA 4FZ8L 4K7PX 4QRRD 4TLSA 3SCMB 1BM7A 5DJZB 3I3EA 1IAKA 2ADFL 2ICWB 2R0ZL 4DP5X 4HLEA 3SY6A 4XNYL 3OVUB 4ZMWA 4FS0A 1EJOL 3FT1A 1XEDA 2QDVA 1XGQA 5AOKA 1PAZA 2JTDA 2R69A 1JXFA 5I73C 3O6FC 1T1XB 3FB6B 1DSFH 5T1KA 3U30C 4E9QA 1N4XH 4JM0A 5D2LE 3ATFA 3L81A 3REWB 5JMOC 2KUTA 1T04B 4DP6X 1V7MH 4YDZA 3A47A 4X50A 4PGCA 1ZY9A 3EZ8A 4URTB 4HCRH 4MNGE 2NY6B 5J6SA 1J1OL 5I1EH 4R97C 1QWNA 3PP3H 3UBXB 4KX7A 5T3ZE 3FT4A 4XB3A 1EAQA 2QKIC 5C0BD 4D3CH 4QRTA 4H0HB 4QLRA 4F27A 1VGEH 5HVGB 1S3KH 4NCC1 2H5UA 3FUHA 2O6CA 3PCYA 4N6QA 3WO3B 4F7EB 2A6KA 4JFZL 2EC8A 5A2LH 4OM1L 5LGHH 1C5DA 5E5RB 4AIZB 4LCWB 3GTNA 5D70H 4U1LA 3QFDA 1A3RL 3G6JE 1PBYA 4GG8B 3BMVA 4LB8A 4KUZH 1S7RA 4HETA 4MGXA 1E8ZA 5EO1A 3TH4T 1ZS8B 2EH8L 1G7PA 2QPEB 5LO7A 4PWFA 1KG0B 2DQGH 1FH5L 2WTPA 3U46B 4KUCF 4NUJA 4PJIB 1HILA 5C0DA 4JN2A 1QFWM 5E0QA 3EOAA 1WG3A 5ADPH 5FECB 2GT9A 2AMGA 1VPOL 3AXHA 3ZTDC 1DVFD 1I7TB 1F4WL 5FS5A 2XQYG 1NIEA 2GPZA 5ENWB 4AQOA 1S7RB 2RCSL 4KKPA 2XA8H 4O00A 4NC2B 1A7NL 4ZXBA 5AKSA 3L2MA 3MNWA 4EN3B 1Q94B 1DBKL 1ZPLA 1AH1A 4XH2B 2EIZA 2DKUA 4XN2A 1V54B 5KOMC 1TJIL 1E3ZA 3WIFB 2BVEA 2HX7A 1JPGB 3U46A 3U7YH 2XI9A 2BMKA 3MCLH 1CLVA 3OZ9H 2VWEC 1RKRA 3VFGH 5IVXB 2IH3A 4F33A 4A39A 3O3BB 5FKPB 1MJUH 5JUEH 2D73A 4Y4KB 4QXGL 4Y8DC 4CVXB 4PJGB 4BFOA 3FKUS 3MLSH 1A1NA 1TTBA 3VX1A 1X5YA 4FNLL 1VCAA 1EZSA 1OM3L 2ODHA 2DIBA 2GIXA 3MNWB 5EF1A 1QR1B 1A65A 4P2RE 3RGBA 2MPAH 4PJ8B 4X6CF 2V37A 5I26A 1U8IB 1T1WB 4XI5D 1U8HA 2L4OA 2WPGA 1JK9A 1T1YB 3QIWB 2OK0H 4K7PH 1UOWA 1IT9L 3ZDYF 5FKPA 5GS1B 3X3GL 2X41A 4GSQA 3JWDH 3FULA 3RHWF 5EOTA 1F8TH 2F54E 2VLRA 4JY6A 2DLIA 2GKIA 3F62A 1ECZA 3MXWL 4XNQA 4HT1H 1E4XH 4GS7C 3HC4H 2YAFA 5E8NB 4ABQA 3U9WA 4OZ4B 1A22B 3IBOA 2ENPA 2VAAA 1JHLH 4HWZB 4Z7OE 5MENE 2ZWNA 4KKNA 4O02A 4WV1C 4YWGH 4QHKI 2QPDB 4JGNA 3WIHA 1A4KB 1FNEB 2WB1A 1WZKA