1PLAA

High-resolution solution structure of reduced parsley plastocyanin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
AEVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPEYLNGAGETYEVTLTEKGTYKFYCEPHAGAGMKGEVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title High-resolution solution structure of reduced parsley plastocyanin.
pubmed doi rcsb
source organism Petroselinum crispum
molecule tags Electron transport protein
total genus 12
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plaA00
2IDUA 1GY2A 2I85A 2VSMB 2OV0A 1BXVA 4G70B 1CURA 2HRGA 1OF0A 1XB8A 4GP4B 4A2FA 2PP7A 1DYZA 4KNSA 3FS9A 3BVDB 2J55A 1L9RA 2GC7C 1OCRB 3FQYA 4YSDA 2HX9A 2VW6A 3NP3A 3T6XA 4Q8BA 3IEAA 3NSFA 5EHFA 4YSUA 4YSEA 4DP1X 1AS8A 4FAAB 1M9WA 2GIMA 3T6ZA 3X1GA 1ID2A 5I6KA 3TA4D 4E9WA 3QJQB 4DP2X 2W88A 2LLNA 1AZBA 1KCWA 3HEIB 1NPJA 3NJIA 3FU7B 3ZBMA 5I5IA 1ZDSA 1IBYA 1SNRA 1SDDB 2XXFA 1WA1X 2HXAA 1XMEB 3CZUB 2UX6A 1JZEA 1CUOA 4KO6A 1J5DA 2VM4A 3SQRA 1W6WA 4M4RB 4QKTA 2GI0A 5I6OA 4YSAA 1JZJA 4BDVA 3IN2A 2BWDA 2H3XC 1L9SA 4DP8X 2I7OA 4WTQA 4DP4X 1ET8A 2JXMA 1W6LA 4ZK8A 1JZFA 2XXGA 2E86A 3NJMA 3PXLA 3SBPA 1RCYA 1KCBA 1VLXA 3NT0A 4A2DA 1BXUA 2YXVA 4F7KA 2YAMA 5B7FA 1AACA 5B1BB 4ENZA 2IDTA 3X2QB 2GB2A 4F2EA 3PCYA 1NIFA 4NERA 3SBRA 1TEFA 3AZUA 1ASPA 2JKWA 2DWSA 2FQGA 2XVBA 4GP8B 1J5CA 1PMYA 3NJJA 4G7QB 3WNIA 1A8ZA 3UAAA 5B7EA 3PAZA 1N68A 1DZ0A 3TU6A 2FQDA 3NJKA 1AS7A 3ABLB 5PCYA 4PCYA 4YSSA 1B3IA 1OCZB 7PCYA 1ZIAA 1MZZA 1ASQA 1JZHA 2TSBA 3U25A 3FU7A 2QDWA 1A4AA 3S8GB 1AS6A 4K9JA 1JXFA 3X1EA 2IDSA 1BYOA 2WO3B 1L9TA 1ZDQA 1SDDA 6PAZA 3NSCA 5I6NA 5TK2A 2CCWA 2EIKB 2YAQA 3FYEB 4HZ1A 2QPDB 4A2HA 1ET7A 4YSOA 3UAEA 1M56B 2X88A 2CBPA 8PAZA 5AFAA 2HX7A 1NTDA 3UGEA 4AKPA 3KW7A 5ANHA 4GP5B 3ZDWA 4A2GA 2MTAA 3WG7B 1OOWA 2UXVA 1ILSA 1A65A 1M57B 5B1JA 1SHXA 2EILB 4G71B 1OCOB 3FT0A 4L0PB 1GW0A 4CSZA 4FA7B 1MZYA 1OE3A 2ZWNA 4DP9X 2YAHA 2DV6A 3FSAA 3NYKA 2YARA 2XWZA 3S8FB 2QT6A 1F56A 4UF7C 2CAKA 2WSDA 1BYPA 2BZ7A 4YSPA 2PP9A 1TU2A 2CALA 1IBZA 3CVBA 1GS7A 1FA4A 2J5WA 5LDUA 2PCFA 3H4HA 5FC9A 2ZXWB 4DP5X 4HHGA 2ZONA 4HAKA 1PF3A 5D4JA 1PLBA 4BWTA 1AQ8A 1E65A 1URIA 2DYSB 3NJNA 4X4KA 2HZHA 3T6VA 4KO7A 2W8CA 4GXFA 4AI7A 5I28A 4W1TA 1AZRA 4KNTA 1AIZA 1AZUA 3DKHA 5AKRA 4KO5A 3IN0A 3N55A 1PZBA 4GY4A 1L9QA 1GYCA 2XUWA 4UAHA 2XV3A 3HB3B 4DPAX 3ABKB 1J9TA 1SF5A 2GBAA 2QPEB 3TASA 3NP4A 2J57A 4YSQA 2DWTA 1FFTB 1HAWA 2FTAA 2PPAA 1MG2C 1JZIA 4E9QA 1E5YA 3OQRA 2XV0A 1NIAA 1W8EA 1J9RA 1WAEA 2BP0B 2FQFA 2UXTA 3OM3B 2IH9A 5F7AA 2XYBA 1AG6A 3D12B 3EH3B 1JXDA 2P80D 3N2JA 1ZPUA 3S3BB 1BAWA 1BQ5A 3DTUB 1J9QA 1JERA 4YSCA 4M3HA 3OMAB 2H47C 4BXSV 3IE9A 3OMNB 4KO9A 1FWXA 4DPBX 2FQEA 4HCGA 2BW5A 2FJSA 2Q5BA 2VMJA 3BQVA 2AZUA 4RH4A 1WS7A 3JT2A 4NAJA 2VSKB 2DYRB 3AW5A 2YAPA 4YSRA 4AKQA 2BO0A 4F2FA 4A2EA 2GSMB 5I5JA 4A66A 2XX1A 4DPCX 3EHBB 3AY2A 3WIAA 1BEXA 2UX7A 4A67A 4Q89A 2BW4A 3QPKA 5I26A 4YL4A 3FPYA 1JVLA 3ZX1A 2YXWA 4DP0X 1E5ZA 4G7SB 1NIBA 1KYAA 3T71A 1MG3C 2HLEB 5E9NA 4E9TA 3FU9A 1JVOA 3SBQA 1WA2X 3QJRB 4KOBA 4P5RA 1BQKA 3CDZB 3WNJA 4DP7X 2BWIA 3QQXA 2FT8A 2QDVA 1OE1A 2J56A 2PLTA 4YSTA 3ASOB 3KW8A 2HRHA 2BP8B 3PAVA 4E9XA 1QHQA 2YAFA 1NWPA 3FU8A 3T6WA 2BP0A 1QNIA 1EZLA 4AKOA 2CJ3A 3WKPA 3JTBA 1SHWA 1TEGA 3X1BA 2B3IA 2XX0A 3EH4B 3MX0B 5D4IA 4YVUA 1NWOA 3AG3B 1PNCA 3QJUB 1SF3A 5I6LA 3FSZA 3X1FA 4N4YB 4PAZA 3UABA 1NICA 3GXUB 5B1JC 4JKNA 3WKQA 2PPEA 6PCYA 2UXFA 4AX3A 2XV2A 1JZGA 1GS8A 2AANA 4E9SA 1A4BA 1PAZA 1RZQA 2VW7A 1ADWA 5D4HA 3FYIB 2EIJB 3S3DB 1N70A 2MRYA 5TK4A 2NRDA 3FSVA 1OV8A 2Q9OA 3ZIYA 4BWWA 1J9SA 2VN3A 3CVCA 1HAUA 3TBCA 4W9ZA 5I5MA 2PCYA 5F7BA 1IKOP 4E9YA 3CDZA 2GC4C 4N8UA 4G7RB 4JHUA 3DIVA 1E30A 2BP8A 2YAEA 3OD3A 3AG4B 1AR1B 1GY1A 1EHKB 3WI9A 3IBOA 2OJ1A 3QJTB 4MFHA 3PPSA 1NPNA 1PCSA 3V9CA 3PAUA 4YVNA 1I53A 4EF3A 3FQ1A 4BK5C 1AG0A 3ABMB 3RYMA 1AZCA 2H5UA 2R7EB 4BXVA 1KBVA 3T9WA 5I6PA 1PZAA 3EF4A 1ZIBA 2XU9A 3V9EA 1PLCA 5IY5B 1SFHA 2WO2B 3GDCA 3L45A 2TSAA 1TKWA 2IWEA 2I7SA 3NJGA 4HHWA 3FPXA 1NIEA 5AZUA 1NINA 1A3ZA 2Y1AA 3QJVB 1AANA 1YLBB 3OMIB 2OCCB 1OCCB 2IAAC 3CG8A 4A68A 2CUAA 2EIMB 1UATA 4KOCA 4HCFA 1CC3A 2YAOA 1KDIA 2YQBA 5B7MA 2EINB 3QJSB 1V10A 1ASOA 4HIPA 3FQ2A 2GHZA 2X87A 5B1AB 2FWLB 1RZPA 3ASNB 2Y69B 3H56A 1PY0A 4E9RA 1L9PA 4E9VA 2A3TA 2IWKA 2AZAA 3ABGA 3NSDA 1AOZA 2B08A 4DP6X 1HFUA 1NIDA 1BXAA 1L9OA 1QLEB 2VM3A 3NJLA 2BHFA 2FNWA 5B1KA 3G5WA 3C75A 3X1NA 2XLLA 2IDQA 1A4CA 1CYXA 2N0MA 2UXGA 1KGYE 5B3SB 1AAJA 3AG1B 4JHVA 3S3CB 2PPFA 3H4FA 3PLYA 2BZCA 3ERXA 3NJFA 4CSPA 1KDJA 1RKRA 1KV7A 1IUZA 1X9RA 2IWFA 1OE2A 2AFNA 2R7EA 4GYBA 3TBBA 1PZCA 3FSWA 1BQRA 3NSYA 1ETJA 1ET5A 5PAZA 3AG2B 1GS6X 3EH5B 1R1CA 1XB3A 2ZOOA 5I6MA 1ZV2A 3CVDA 2PPCA 4AZUA 2FT6A 3UADA 1E67A 7PAZA 1JXGA 1ILUA 4TXVB 1SFDA 4HCIA 1SJMA 1NZRA 2DY2A 1WA0X 1PNDA 2IDFA 1MDAA 2AVFA 4KNUA 1V55B 2P80A 4BWUA 1GSKA 1PLAA 2JFCA 3UACA 5A7EA 4HALA 2IH8A 1T5KA 4WKXA 1JOIA 3MBWB 3NJHA 3GYRA 1CYWA 1V54B 4NB7A 2PPDA 2PP8A 2FT7A 2VW4A 1XB6A 4G72B 1IC0A 2RACA 4UANA 1GR7A 1AZNA 4P5SA 1NDTA 1KBWA 1X9UA 4BDVB 1WS8A 9PCYA 2HX8A 4QLWA
chains in the Genus database with same CATH superfamily
4BK4A 4FQ1H 3WO3B 2M2DA 1HHHA 1KTKE 5C0EB 3QUKA 3T1FA 1CE6A 1JI2A 5E4EC 3F58H 3IFNL 4ODTL 3VFVB 2HAZA 5IFAL 3P4OA 2BSBA 3VXRB 1WVZA 2XG4B 5EUOF 2HT4D 3HC0A 3MAWA 4J3BA 4UQ3B 1YEDA 5E2VH 5GGVL 1CU4L 2DBLH 4K71C 4A2FA 2APSA 3HFFA 3RPKA 1DCEA 3HBZA 2JCCE 4HJUA 4XMXA 4BSWA 4QXWA 1DL7L 3K91A 5HYJE 5F1IB 5FV1L 4EI6B 4LKCB 1UA3A 2P52A 3L4UA 1BSIA 4HOMA 3D3VE 4U7SA 2OR7A 1M71A 4OCNC 2ESVE 1CGXA 4KDVA 1I31A 4U0RB 1K8DA 1NGYA 4XHJC 3RVVD 4ANVA 4LGRB 3L3DA 1QP1A 2G0LA 3KWVA 3NJIA 4XC3H 3BHBB 1IGJA 4R83A 3A21A 4XMKL 4P23C 4MLIA 5I5IA 3QUXB 1ZLUK 3ZT6A 4MA8H 4JR9H 3DETD 2IC2A 3O6FC 3EO0B 4OM1L 4P3DA 1X5ZA 2HFEA 5IMKB 1WA1X 1XMEB 2AXGA 2X28A 2M8XA 1RURH 3LPPA 1PKOA 4MD0B 4KKAD 4Z7UB 3QZOA 4M7KL 4YSAA 5KUMA 3ZW3A 5E1IA 1UG9A 2XPZA 4OQTH 3HR5B 5CJXA 5KVDL 4B9GA 4LSTL 3HG4A 4F8OA 2J88L 2PWGA 3WFCH 1SMAA 4UIMA 1N64L 1MVFA 3GJFA 3PPEA 3QG7H 2QVTA 1AFVL 3UTSE 4LBEA 5KVEE 2YXVA 3LXAA 1QFPA 1OEZW 5FA4B 4I8DA 2GIYA 5DQJB 1V3LA 5B7FA 1AACA 3NFSH 3HG2A 5HP5A 4B3VA 2WYTA 1FFQA 3CFKA 3TJPA 1G6RH 1NCWL 4PJDF 2ITCB 3AZUA 5CIPA 3HLKA 4N9OB 3BAYA 2KLRA 5BS0E 1BZDA 1YEEH 2UZIL 4X98A 5FO7A 3WMQA 5B4MC 3UAAA 2PCFB 4AL8H 1ZRUA 3US0A 4JZOA 3NJKA 2FGWL 3O3DA 3BVWA 4RDBA 3OAYH 3ABLB 5EU7E 4YSSA 3BSZL 1PFOA 1IKFL 4FFVD 3U25A 3RVXD 3FU7A 4XAWH 1U8JB 4H13C 5LWYH 1A4AA 1FFRA 1MI5E 3C5JA 2RFXB 3S8GB 4PJ5E 5AOIA 1FC1A 2X4OA 2AABH 4JY4A 3EGDA 4PRAB 4NP4H 1MCEA 2BNUB 4Z18A 3T4YB 1G0XA 2EIKB 2YAQA 1YUKB 1WZLA 3HI5H 4H8HA 3MNZA 1NMBL 4YSOA 3AQZA 2DH2A 3KPOA 3FT2A 3C09C 1A3QA 3DGCR 5HXMA 1N8ZA 4BKLB 4QUOA 3EH2A 4FD0A 1GGIH 4XNUH 2AMUA 2R27A 3KL5A 5F9WB 3CX5J 4KUZL 2JKTM 4Z3HA 2DWDB 2EZ0C 1DVFD 1QLEL 3FFDB 3WE1A 2VDQB 3GDBA 3LRKA 4PJEB 3IJYA 4GT0A 1L3NA 4HPOH 1SHXA 3GGWB 4X6CE 2HN7B 4XBMA 3WV0A 1Y1DA 2X4TB 1OLLA 4NC1E 4XZUB 3FQXA 1COBA 3P1VA 2YEQA 3TYGL 5EUOB 1XXFC 1F11A 3EBAA 1NGZA 1Z9SB 3ZZQA 5JZ7C 3H9SB 4PGBB 2BNQE 1VAHA 3HG0A 1M2VB 4ANWA 1G5GA 2L4OA 3MRJB 2EH7H 3E6HA 4OH2A 3AWEA 3WBDA 5BMFL 3BT0A 4IBVA 4I3SH 2NY0C 3NJNA 3HE7A 3PQYA 1ORSA 3GMNA 2FSEA 3OKLB 4HEPA 2DZEA 2N7SA 4QJ4B 5I1JH 5FYJD 2GABA 2ETWA 1WITA 4R7VA 3D9AL 5AKRA 4DGIH 1GGYA 2QSVA 3BAXA 2IOOA 4FLSA 1G4MA 2IAMC 1CD0A 4UAHA 4M3KB 4P2RB 1F4WL 3HHRB 3RDJA 4UNVA 4EI0A 2E59A 1LO4H 4ELDA 4R4BB 3S5LA 2AK4B 3SDDD 4DHLA 1W72B 1H0DA 4QTFA 4ZXBB 4DGYH 2CRZA 2X1WL 4NPJA 5AW0B 2VN4A 1A2YB 2WZAA 2CLRB 2XZCL 4BUGA 2HT2C 2XFXB 3D0VA 5DUPL 1T6BX 3ZE1E 2F9BT 5C0CD 3MCG1 1NFDA 3JYCA 1HT6A 3CZJA 1D7CA 2VXVH 2G2RA 1JXDA 2A73B 1ZPUA 1L0XA 1ONQA 2EH8H 1FFPB 1WZ1H 3HAEB 3I9GL 3MRNA 3P3UA 5DJYA 1CLVA 1T22A 2F19L 3WENA 3IE9A 4HG4J 4CDHA 2CDGB 3FDWA 2IBBA 4RH4A 3ILQC 4JRLA 5I16B 4ATTA 3BPOB 5DHYB 3C2SA 4PRPB 2NY3D 4ZFZB 3CC5B 4F2FA 2E6QA 2DDQL 3GMQB 3K2IA 3C8HA 1AKPA 4A66A 3ULVE 2H3KA 1YMHA 2MWCA 3AT0A 2WVVA 5AAMC 3L6FA 3BQUA 5DURB 4DGWC 2WXOA 4LQ1A 4PRHE 4G9FD 4PJDB 5E0FA 2B0SL 1DVQA 3QQNA 3RDTC 3DO3A 3ZDXF 1JWMB 1F45A 3MRPB 5A2JH 4YBHA 4LLAA 1XGPA 2Y36L 1T5XA 1LTXA 4WU7B 3FU9A 2GT9B 1Q0YL 2A38A 4QRPE 5J4MA 4Q52A 3HI1B 3DMMA 4Y5VB 5EBWB 3KYMB 4F2ME 1QEXA 1EQWA 2ZIDA 5EUKA 5E1AA 1GYUA 1I1RA 2DTML 2JJVA 3Q2VA 2P5EB 1G7PB 4ONGH 2ZTBA 2R23A 2BSEA 2EO7A 3FUMA 5AUMB 3B2UD 5LGHH 5F3BB 4I1RA 2B3IA 2ZXAA 3L3OA 3TO2A 4N8CL 5CP3A 3WEXA 2HH0L 3CFUA 2L0DA 1EHLH 4OJEH 1BBDL 3GBML 4X4MA 1NICA 4MDRA 3S5LB 1OVZA 3LEVH 4Y1AB 4LOVA 4IBYA 5F0LB 1CFMA 43CAB 4P59H 1BBJB 2OL3A 3U82B 4RGOL 3O6FB 5DD5L 5BV7H 2VW7A 1Q9OB 3O3BB 1TF4A 4PJFF 3D39B 1FO0H 1IIIA 3GTNA 1JZ4A 2E46A 4BWWA 3ZKNC 4B6ZA 3DUSA 1AZZC 5F96H 2F53D 1DJIA 5HGAA 4PUBH 4APXB 3HPLA 4FG4A 1OGAA 4OCYH 5DK2A 1N6QH 2VC2B 4KVPA 4YHPA 2EAEA 1VERA 5J9PB 3CDZA 3BGMA 3QFJA 1FL5B 1G9NL 3GC3A 1GGUA 1V3KA 4MMXC 5HYJD 4QT5B 3QYMA 5E5RB 2YAEA 5I23A 3AG4B 5GRVK 3RHWF 2CHXA 2VR8A 3VGAC 4D9QD 3BD4A 2BNRD 3MJ8A 5JHLA 3GPEA 1KFAL 1S7XB 5IVNA 4AIXA 3QJTB 4XWOD 1YNTF 4MFHA 3NA4A 3IDJB 5CEZH 1GMEA 3D09A 1B0RB 2G2NA 2PXYC 3SKMA 1AGDA 3MRQA 1W2KT 4BXVA 4JCMA 2KI6A 1W0WB 4LCVA 3QZNA 5DFVC 3TBYB 5I66A 4XMVA 1ZGLA 3REVB 2O5XL 4IOIB 3GPSA 2D4FA 2V3DA 1KB5L 4NNYB 3FPXA 2VDOB 4GRLD 1N0LB 4ERSL 1FORL 1IAOA 2JQMA 1KGIA 4HK3N 3WSQH 5HDWA 4P57B 4RQQB 1YLBB 1EVUA 1RZKH 3HE6C 3MJGX 2AKRB 5AQ0A 3OLGA 3C9NA 3QO1A 2J43A 3V0WH 3W9DB 4B41A 2ZG3A 4MCYA 1WFOA 5HHMB 1X5GA 3C09B 2LE9A 2GHZA 5B1AB 3P4LA 2CKBB 2OXHB 5C6TH 1W0YT 4Y19D 2DLEA 3DGGA 1TOXA 1IGFL 3V4VL 1AOZA 3IXTA 1HFUA 4XCFL 1YUHA 1HQRB 4J28A 3F7YA 4Q6YA 3ZDXB 2ZWSA 2D9QB 3VTAA 1CVRA 4O2FA 3V5HA 2FHCA 4JPKH 3RIFF 3V4PA 3K8MA 4W6YB 2H1LM 5ADOH 4MB4A 3OG6B 1G84A 3U6XS 1UFGA 1WIUA 3IPBA 2LR4A 4M5TA 5H35B 1IM9B 4JDVB 1AXTL 4OD1L 1FNLA 3SJVB 2VLLA 4AYBA 1X9RA 1UA6L 3OKEB 3RZCA 25C8H 2MKLC 2D3NA 5I15H 4IKIA 4L4VA 1HQ4A 3GBDA 5DC2A 1HXMB 1CQYA 4IOFC 3N40P 1OP3H 2CJUH 3B9KC 4GFXA 1KNOA 4TLUA 4LL1A 2X9ZA 2IQ9L 2R51A 4WHTA 2BRRH 4ZMOA 1P9MC 3CLFH 3TOPA 2D7TH 4PVMA 3RIAF 1BX2B 2A9ML 4GAJL 4GBXB 1CL7L 2HFFA 3BO8B 3MA9L 3QH3B 3UJTL 3UO1L 4P06A 2RD0A 4OM0H 4RAVA 2JLLA 4GEIA 3EBIA 1EV2E 4JDTH 1MNUL 3RY4A 4YFLI 4BH8B 5AW7B 5C71A 1DO5A 1T5WA 5DQ9A 3NIDE 5HHOA 1S9WA 2JFCA 3UYRH 3CX5K 3S48A 5H37G 4FHJA 4PS4L 2GCYB 1IVTA 2WKOA 3QDMB 5D7LA 2NT1A 5JMRA 3DVGB 5INCB 3FRUB 4PJFB 3VACA 4M56A 1CDYA 1G4RA 5IKCA 3KWXA 1GYAA 3CMGA 4IHBA 3UTPD 1A0QH 2CM6A 1RJLA 2YKLH 2J20A 2FD6H 3DIFA 1GY2A 4P0DA 1OGSA 4IU2A 1OO2A 4OR1A 4O02L 2EEDA 4H20H 3ECQA 1OK8A 3OKMA 4FXGA 4KK6C 2HG0A 5CXPA 4ZBJA 4ANUA 4XPBL 3C6LA 4R84A 1OB1B 2DQDL 2X40A 3LZFH 2PP7A 4ZS7L 3RDTD 1JPEA 1KLGB 4IRJB 2BCKA 1U8LA 5JOPE 1KG0A 1NM4A 3BVXA 4Q8BA 4JKWA 1HOCB 1YEHH 4AM0A 1JDCA 4P99A 2OJEB 3DOSB 4KAQL 4CGTA 1S3KH 4QJ3B 1NC2B 2B7DT 4ONFH 1ID2A 5AALA 5C9JA 5CJQL 2B14A 5KJRL 1AZBA 1VADA 3QWNA 1JPFA 4J8RA 5CAYB 4U3HA 4Z7VA 4CMMB 3EOAA 1V27A 5MP6L 2WNXA 1KB9J 1WFIA 1MCCA 2X7LB 2BY1A 3VA2C 3DHMA 2ICWA 2Z1KA 2ZP9A 3CIAA 2Z93B 4TTGA 3O4LA 3BCFA 5C86A 5LB1A 4KY2A 1KTDA 4HG4K 2F18A 3KWWB 2WKGA 2B2XH 2FBJH 3ZGHA 4OJFH 4U31A 2VDPL 3A22A 3D87B 1AVAA 1T6WA 5C0EA 3GXIA 2E27H 1OHQA 4J23A 3CFJB 1FCGA 3VFVA 1KCBA 4WUUD 3VXRA 2XG4A 1BQUA 1KXQE 4I0KA 4UQ3A 2O5YL 4HMDA 1W80A 4ZO8A 5I5RA 3RILA 1UYWH 5T8IA 5IJBC 3BAJA 2X53A 1CCZA 3T3ME 15C8H 3HUJB 1MSPA 1OAXH 5F1IA 4MS6A 4EI6A 1NIFA 4LKCA 2XKNB 5FYJL 5J11C 3QRGH 4F7CB 4Q9QH 3Q13A 1WE5A 4RFOL 3OJ2C 1XXDC 5AKVA 4UINL 2DAVA 4J3TA 3UOAB 4WUKL 3NJJA 3DJ9A 1A8ZA 2EIDA 3ZKQD 4UQ9A 5B7EA 5GGUB 5BZDB 1FVCB 1UWXH 2FQDA 4XN5A 1D7FA 3CVHB 1E4KC 2WP3T 4YXKH 3VDCA 2VL4A 3BVNB 4BZYA 3SE8H 2O5ZL 3T0VA 4JM4L 4U2ZA 2NY6B 3BHBA 5I71B 1CB4A 3LIZA 4WGVB 1M3IA 1NQBA 3V10A 3QUXA 3X1EA 5DRWB 4X4YB 3P4MB 4C54A 4OV5B 5LBSH 3EO0A 1F90L 4NGHH 2NZ9C 3TT1H 3ARDD 1T0MB 1XAKA 2O4EA 5IMKA 3MLUH 5GRJL 4R6UA 3I6GB 4HD5A 4ZSOB 3WIHA 1CVSC 5DFVD 1DQDL 4DW2H 3L1OH 4MD0A 4Z7UA 4JO4L 3RUGE 5MENE 3PWPD 3QC5X 4CU7A 2PXYB 3KPSB 5TE7L 1IGMH 5AYQA 2AAAA 2YR3A 3HR5A 1A3RL 3QW9A 4BGLA 3MV9D 4AKPA 3KW7A 2ODHA 2F8OA 5FYKD 3D33A 2ZKHL 4KI5D 4TPRH 3GEFA 4HS6B 4Z76B 2Q6WB 4MS8C 1EHXA 4IKJA 4ACTA 1TJHH 3FFCE 5FA4A 5DQJA 3Q8BA 1G6VK 1ROCA 4YX2L 2H32H 2KQMA 4M5ZH 5EEZA 3T2OA 1JZ7A 5JA9A 1K4CB 2DV6A 3HE6B 4LASL 5F8RC 3CAFA 1ZLWH 1BYPA 2ITCA 3DSFH 2X1QA 4JUSA 4M9OA 2PCFA 1ERNA 4L23A 3IJHB 3HN3A 1PF3A 2OXGB 1XF4B 1DLHB 1IILE 3R8QA 1D6VL 1HNYA 4MJIB 5EU6D 3QUYC 2BWQA 1AQ8A 4GXUN 4WJG3 1AMYA 4ZQKB 1RU9L 1U8JA 4PSRA 1T83C 2VR7A 3ZKMC 3K71B 4KVCH 5ISZB 1ZTXH 2RFXA 1LMIA 5ADPH 4PRAA 1Q0XH 2BNUA 3T4YA 1PZBA 3UTZB 2XUWA 3ZO9A 2E75C 3SE9L 4KKBC 4MNGE 1D3CA 2J5LC 4JHWH 2QPEB 1KJ2L 3LYRA 5FX3A 1HAWA 3RLSA 4BKLA 1IBDA 2AQ2A 1W8EA 4Y7OC 3KWTA 2FATL 5F7MC 2Y2WA 3B9KB 2DWDA 1WC7B 1EAJA 3FFDA 5I1EH 5AVZB 1DBJH 2ATKB 2CXGA 5T3ZH 5HDQH 4PJEA 4UZUA 2MCPH 4PRIB 3GGWA 5GRUH 2LU7A 2HN7A 1BQ5A 5FO9B 2X4TA 3SN6N 1NGXB 4R2GC 4O2EB 4XZUA 3X3FL 4OJYA 4RNRB 5DHVB 3MCKB 4M1DH 4EKJA 4M1CC 2DQUH 2BW5A 2Q5BA 1O7DE 2VMJA 3QORA 5EUOA 4OLWL 4F58L 4DKDC 2IANE 1Z9SA 5SWQB 4OCRL 3JT2A 2DRUA 3D6GA 1XGTB 3B5HA 3H9SA 2DYRB 4PGBA 5J1SC 1O9ZA 2I24N 1M2VA 2EDKA 4FEMA 4XAKE 3WDHA 1EMTL 4XPTL 3MRJA 4HH9B 4XXCC 1JN6B 2OMVB 4ES9A 4D7PA 2GEQA 4Y16D 1U30A 5DQDH 3L17A 3AVEA 2YGQA 4AK1A 2VDRL 3OKLA 2HT3D 1E5ZA 3BMWA 1UJ3B 4JFPB 5EBLB 3D52A 4KROC 1QUNB 1X7TA 2CGRH 3SKJH 3R06B 3KPNB 1BMZA 3VFGH 4P2RA 4DUXA 1W9XA 4LVOB 4N0CC 5I76B 2FT8A 4MYPA 4R4BA 1T1WB 3ULUD 3LHPL 2WBXA 4AQ1C 1WDAA 2ZE0A 3RZWA 2AK4A 1W72A 4WWPA 2YAFA 3FQNB 3FU8A 3F7KA 2BOLA 4ZXBA 3T0BA 3UG5A 5T1KD 1I9RH 4DQAA 4IEFB 3C60C 1PFCA 3AACA 3VXUD 1A2YA 3F00A 2CLRA 4LSPH 4XRCB 2XFXA 3WKPA 1JZ8A 2Q3XA 1D9KD 4LPUA 2XN2A 5AOJA 3E38A 4KK9D 5FAAA 4KTDH 2Z7YA 1HXYB 4LESA 1OWWA 2A73A 1GPOH 3MLZL 3NK4A 2B1AL 4NQVB 4X9HA 5SWSE 3WO4C 3LQAL 1FFPA 2OSYA 3HAEA 5DS2A 5BQ7B 4PJ7B 1CJYA 3FSZA 5L88H 1JF1B 5EN2B 1G1YA 1KPVB 2X6BA 3TO4D 2CDGA 4ZMYA 1I8MB 5KOMC 1CGUA 5C0GB 3U9WA 5I16A 1EFQA 5DHYA 3K5RA 3QI9C 4PRPA 5JHMA 1QSFB 4ZFZA 3CC5A 4UV7H 3WD5H 3GMQA 4QNPF 4F57H 4KZDH 1S9VB 1KCSL 5DO2C 1OAUH 1IE4A 4PJDA 4G6JL 1TSRA 2JH2A 3QARA 3US9A 2Y0SA 1E2ZA 2MRYA 5J8OA 4PRNB 1JWMA 3FJTA 2WZ5A 3MRPA 3SDCD 4U3CA 1DJHA 1IFHL 2K0RA 2X42A 3UPAA 3ZR6A 1OAYL 1OY3B 3B37A 4WU7A 3V0JA 2GT9A 3MJ9H 4XXWC 4X9GA 4UTBA 1TQUA 1AYRA 3E8UL 2AEPH 2GC4C 3B8SA 3L9RB 2MIZA 3HI1A 1CPUA 2Y6SC 3QUMH 3AQYA 3KYMA 4X7CC 3AMKA 4Y5VA 5EBWA 5BOZG 2AJUH 4JY6B 1KGCD 2FJGB 1YRKA 2P5EA 12E8L 1G7PA 1CFVL 3IETA 3NDZE 1K3ZA 1KCKA 2MNWA 3NVQA 4Y9BA 5TF1H 4NBXB 3RNKB 5DJ6B 5AUMA 4EF3A 2NX5E 5IT2H 4BK5C 1AG0A 5F3BA 1U3JA 3T3PF 2EO9A 5EZPA 5FM5M 3T9WA 2R0ZL 1AQHA 2XU9A 4JQVC 3V0AC 1JNLH 4WWNA 2YPLD 1KB9K 2NZ9D 4HK0B 2EEBA 1TEYA 1I1CA 1RULL 1YY9D 1GKEA 3FB6B 3CBRA 4IDJL 4RA3A 4Y1AA 5AZUA 1TQCC 43CAA 3ZTJG 1EAQA 1MF2H 1BBJA 2Y06H 3BKMH 5GS3A 3O6FA 2DI9A 4RRPM 3TFKC 1QNZL 1JGUH 3ZE0E 3ZDZB 1Q9OA 3O3BA 4P3CH 2CUAA 2LTQB 2GITB 4KOCA 5DMJB 2ZWKA 3D39A 1HH6B 1UXWB 1MHPL 2IF7A 2XWTB 4G80B 5C0BB 1GTNA 2ZYHA 4APXA 1BFVH 2DD8L 3PP4H 1YEGH 4JFDB 3QIWC 1ZTXE 2K3TA 1J0ZA 3AMLA 1GAFL 4XNDA 6FABL 5J9PA 3NOIA 2M26A 1FL5A 4Y4HC 3NCMA 1MHEB 4NKMB 1TIUA 4QT5A 3ZE2E 5IVXB 1HJBC 1XGYL 4UV4H 4HIEB 3LPFA 4P5TD 1CYXA 2N0MA 1ZA3B 1T1YB 4ODVL 1S7XA 4FHKA 3HMWL 4OZIB 3FUJA 3IDJA 3C08L 3AGWA 4FQIL 4BZ1A 1B0RA 1HI6B 3C2AL 4XX1G 1E3FA 2WXJA 4LU5L 1ZLVK 3CFCH 1IKNC 2QPUA 4TL4A 1ZTMA 1VEMA 1W0WA 3R7QA 4BZ2L 3RX9A 3TBYA 3MDJA 3GWJA 3APCA 1TPXC 3REVA 2XN9E 1JWUB 5IQOA 4IOIA 3NPZB 4OGYL 1QFWI 1LD9B 2RBLA 4NWTH 3VFWB 4LHUD 4NNYA 4OT1L 3V6ZB 3CMOL 3MGTB 3Q01A 2BXYA 1N0LA 2WUCL 4E41B 5JPMC 5JTWA 2HVJB 1HEZB 3SOBH 1B9KA 1C12B 1I1AD 1QD0A 2VGLM 4PVBA 4PV8B 3B1TA 3HNTL 4QYAA 1E9OB 4P57A 4RQQA 4CAGA 1SVCP 4N1CA 3QWOB 2YK1L 2AKRA 4LE8A 3QDGE 1U9KA 1A6VH 3U48A 1FLRL 1DSFH 3W9DA 1D5BB 2J5LB 1HE7A 2FX7H 4NIKB 2X70B 5KAQF 2YEVB 4Y2DC 4U6YB 2CKBA 4R2GD 2OXHA 3S0PA 1GR7A 4JS7A 3QWQB 1QRKA 1N0XL 3LPWA 2VAAB 3RWHB 4DGVH 1HQRA 2VXSH 5K39B 4JFFD 5GZNA 2WQ8A 3OXSB 2WIIB 2DEYX 1RERA 1X4XA 2CK2A 3T4AC 2R8SH 2FK9A 1F18A 2F8VA 4N0UB 2WWNA 1ZLSL 5H35A 5BJTB 1IM9A 4JDVA 3SJVA 1QFOA 1QTYT 4FG2A 5L4JA 4MKMA 4PQXA 4U1GB 1FPTH 1KYOJ 4WI3A 3JTTB 2EDLA 1E4XH 1JGLH 1HZHH 3OKEA 1Y6NR 4R90L 1QPPA 4JPWH 1HXMA 4ISVB 4L3FA 2Y6TE 5HHXH 5HDOA 3RX5A 1VGKB 3O81A 3CZSA 1E4XI 2R1WB 2P5WE 4LSQH 3U0PB 1WJ3A 1XF2B 2I60H 2NXZC 1PIGA 1X5AA 3T3PB 8CGTA 2R0KH 1BX2A 4GBXA 3MRLB 3ZYOA 3BWUF 2DQTL 3BO8A 3KHOA 3QH3A 2WANA 4KROB 4L18A 3BH9B 5DZNA 3L3KB 4LCWE 1IBFA 1RFDH 5CHNB 4NO2B 4AEHL 3KVQA 3PGDB 5TE4H 3V0DA 3C60D 3RE0A 2J8OA 5FYKL 1VRSA 1IX2A 5I1IL 1GJWA 4J3SA 1CLCA 2GCYA 4HMEA 5K9QG 1WCBB 3WS3B 1DQLH 3QDMA 3SIKA 4WCYL 1Q1PA 1VZIA 3DVGA 3PL6D 2BVUA 5INCA 5KYYB 3FRUA 1MOEA 5FDYA 1EJOH 1FDLL 3B9VA 4PJFA 3U2SB 5J3HD 4WWID 4AQZA 1FNFA 1JZJA 5T5NF 4FNTA 4YIQB 4DP4X 3I3EA 2CO2A 4YH6A 3OWRA 5MERB 1WSST 3WKNA 2B39A 5GRWA 1ACCA 3KM2A 1F1GA 3II2A 1RCYA 4DSYA 1PG7H 1KV3A 1OB1A 2QEJA 3ATAA 4HXBL 2CGYA 2EACA 4X7TB 4ICXA 3B9EA 1FZMB 4RWYL 2COVD 1GHFL 3IFNH 4L3EB 1KLGA 4OJCA 5JIKA 5CLWA 5IFAH 4IRJA 3V7MA 4Y4KB 2D7PA 3H54A 2QQNL 2ZCHL 5GGVH 1CU4H 1QWHA 2H3NB 4MAYC 3IMBA 4M5YH 1ANUA 1HOCA 2AJYL 2OJEA 3DOSA 4Q4IA 1NC2A 1C7TA 1CDGA 3OMZA 1HWWA 4YLBA 1JDAA 1FNHA 3CFBB 4KRPD 1KELL 4CMMA 2C34A 2WLYA 1G0DA 1RVFH 4GOSA 3ML9A 2Y5TB 1L7IL 4N0RA 1KZYA 3VMPA 2QL1A 2ZG2A 1IU1A 2HWZL 5E9AA 2X7LA 1TYJA 2LV4A 1RZJH 5CFAA 2GQHA 3L4VA 3WTUA 4IIQB 1DVXA 1FG9C 2Z93A 1HXKA 4Z7QF 2NUTB 3KPRE 2FRGP 4G8AC 3ORJA 4Z7NB 4CW1B 3LS4H 1T2QL 2J6EL 4JFUA 4KFZC 1FYTE 3JBG7 3LN9A 2OZ4L 3KWWA 3P30L 2GEEA 4GSUA 4HSAC 1PZUB 1KWGA 2WO4A 3BVTA 4DKFH 4M7KH 5ANHA 2VN6A 1BIHA 3TFKD 4HSQA 3CFJA 3PP3K 4LP8A 4U6XB 3JWOL 2UXVA 5BO0D 3FO0L 1BVKB 4QOKB 4F8NA 1U4EA 4HCRL 1A47A 4JQXC 4NOFA 4LSTH 3FZUC 3VVVA 1TQCB 1INQB 1SBBA 2VSDA 3MODL 4FJ6A 3O0RL 1N64H 2KS0A 4FZEL 4MKTA 3S88L 1ITBB 3BUTA 2ATAA 4DP9X 3O9WC 2X41A 3HUJA 1AFVH 1MXDA 1WIOA 4LSVH 2MH4A 1PEWA 2QT6A 2XKNA 3D85B 1F56A 5DGQA 4F7CA 4I87A 2BIQA 4NCC2 1ZV5A 4M6AA 4JANB 3FHEA 4HU8A 2PTVA 5GGUA 3T0AA 5BZDA 1FVCA 2ZXWB 1B2YA 3UC2A 3CVHA 4PJAE 5FUZL 3ULUL 4WFGD 2VWEC 1U3ZA 3TL5A 3BVNA 2MCG1 1KJVB 2WY3B 4APQD 5A3ID 2X3AA 2G5RA 3GUTB 4URKA 1FH5L 4OFKA 3QQ9D 5DRWA 4X4YA 3P4MA 4OV5A 1AZUA 5EZOL 2AI0L 1URLA 2DWXA 4RBPH 5CGYC 1T0MA 5H4YA 3I6GA 4OLXL 4ZSOA 1GYCA 1M7UA 2DJ4A 3HHSB 1YQVL 5F97E 4JO2H 1J5IA 5JHDB 2GBAA 2O61B 1PQZB 1K72A 2PXYA 3NP4A 3ROLB 3KPSA 3DRTB 4NKQB 3DXAB 3IDNB 1IGIL 5E00B 4J3XA 1NMBH 3NIFF 4LSDA 1TPXB 4N2CA 1QFHA 4EZLA 5JR1H 5D4QA 4HS6A 3Q8AA 4Z76A 2Q6WA 4OLUL 4LAQH 4FQPA 2PMZA 5JPMB 4BBWA 1K2DB 4P9MH 4KUZH 4WSJA 1QLEH 3HW7A 1K4CA 5E2WH 2R2CA 4M6OH 3HE6A 2ZX8A 1GIGL 4YHIB 5LVEA 1XIWC 5BUGA 4LCCC 1H6TA 4K9EL 1X5HA 3NESA 4D0CB 3N1QC 4MWFB 4QI3A 5F0JB 1G7QB 3IJHA 4JMXA 2OXGA 1XF4A 1DLHA 1WYJA 3EHBB 1J8SA 3S8WA 2UX7A 4Y2DB 1DQKA 4MJIA 5B3JF 4NO3B 4ZQKA 3SGJC 5FW6A 1CD9B 1EANA 1DJSA 1PPIA 3FH5A 5ISZA 1ROWA 3ZTCC 2YXWA 4ZD3H 4DP0X 1BD2D 2Q20A 3KJ4C 1AHMA 2AITA 4L8SC 5T33H 2QVKA 3UTZA 1R19A 1A7BA 1N5AB 4O2CB 3OX8B 1JVKA 2QV2A 2BWIA 5IBTH 2ZUXA 4I89A 1ZXQA 1JMZA 3FOMB 3ME0B 2CQVA 2PLTA 2C4FU 4ELMF 4ORGB 4PR5B 3WFZA 4H8PA 3U4BL 1XSKA 2PO6D 4Z7QB 2ZAIA 4UNTA 2WBJD 3B9KA 3D48R 2EKSB 1WC7A 1QRND 4H1LG 2ATKA 4JZNB 1Q94B 2NXZB 3AITA 4FTVD 1CTMA 2XX0A 4PRIA 5D4IA 1E6JL 5GIRB 5CJ5A 5F7DB 5FO9A 1XCWA 4P4KD 3CD4A 4MCZB 3T0EB 1NGXA 2XZCH 1GA2A 2VH5L 4O2EA 3WTWA 4PHXA 2VN7A 3PQYE 4HAFA 4RNRA 5DHVA 4Z7IA 3MCKA 1I8UA 1TKWB 2XQ0A 2MCAA 4KHTH 4HUKB 2Y3AA 5SWQA 3WFEH 5B1JC 1XGTA 3L95B 3MV11 2F19H 3NRPA 1SM3H 4MRCA 2QZQA 4HH9A 3TONA 4E9SA 3GRBA 1JN6A 2OMVA 3Q06A 4U7KA 3FYIB 4F5CE 1XD0A 1A9EB 4ENED 1RIHL 2DDQH 3ZIYA 3TVMC 4JL1A 3P77B 3FT9A 1UJ3A 5T1LD 4JFPA 1NGWB 1JGVH 5EBLA 3WCYA 1QUNA 3MLVL 3KBEA 1KYOK 2B0SH 3R06A 2JB5L 3KPNA 5T1MB 4NJAH 1NFDE 1MEXH 4PJ9C 1I8IB 2OMYB 5I76A 4YL9A 5LG1A 3V2AR 3L5HA 1T1WA 1WK0A 2OMTB 2Y36H 2DH3A 1P6AB 4M8QB 2I07B 4W9IC 1F58H 3BKCH 2DQ6A 2CO7B 3FQNA 4N6RB 5D1XC 5IVZB 4IEFA 4KDTC 1VPOL 3I6LD 2IPKB 3G7TA 4JFZL 4XRCA 3RQ3A 1IEHA 4F3FB 2Z8SA 4IBLT 2FX9L 1UD8A 3TCTA 2CDEB 1AZCA 1HXYA 2R4SH 2YS4A 2H5UA 2QFRA 4NQVA 2R9HD 5T3XH 1I9IH 4ZYKB 3DO7B 3EF4A 5BQ7A 3J2PA 4PJ7A 1CR9L 4DJMA 1IEAB 1JF1A 5EN2A 3CBJB 1KPVA 1KEML 3NJGA 1I8MA 4C47A 4HHWA 1OLZA 2WWMC 5C0GA 1TJMA 1FC2D 3K2MC 4FQLL 2Y1AA 1QSFA 2HH0H 3DTDA 5BNXD 2P48B 2E7DA 2WQVA 1MFUA 4FGMA 2VLRD 4GSQA 4X6DB 4UOJA 4DAGL 4PJGF 3GBMH 2EKJA 1WFJA 3FH7A 3NN8B 1S9VA 1R75A 2IAAC 3CG8A 1P4LB 3EOYG 4RZKA 1E8ZA 2GPZA 1H6EA 5I8KL 1HN1A 3TWCH 2FWUA 1S7UB 5DD5H 1UWFA 4PRNA 3QJSB 1LK3L 3LEYL 4C56D 5EIIG 4L0ZA 1ZVYA 4UZSA 3GXPA 4KJWD 1I8KB 1A7OL 4UYQA 4JFXB 4N5EC 4N8VG 3MRKB 1VGEL 2DKMA 1R4XA 5E24E 3L9RA 1L9OA 2VM3A 5CGMA 3L16A 3M1OA 1A4JB 4KJYB 1BWWA 4JY6A 3O9WB 4X4ME 2FJGA 2J4WL 1VSCA 2OYMA 4H8QA 1FAKT 4UCFA 5F1SA 3PLYA 3S3CB 3UTTE 3GSNB 3HB3C 1J12A 2ZP0T 4O02B 5D96C 1BZOA 5IOPB 3W0WB 5JQIB 3RNKA 4RDQG 5DJ6A 3U2IA 1EJ8A 2I5YH 3GB7B 4CBZA 3LH2L 1S78D 2VR9A 5D70L 1S5IL 2PF6A 5H37A 1A21A 4XOAA 2ZCLH 1IV8A 1ET5A 1SOQA 4I0CC 4JN1H 1E4KA 1SJHB 5PAZA 4HK0A 43C9B 3Q5OA 4F7TB 3E9UA 3AXIA 4ZMPA 3HC2A 3FB6A 5BO1L 1C7SA 4PJ8D 4X2UA 2ZZUT 4FKEA 2ICWI 4BFOA 1JXGA 4RMBA 4JFTA 2V6HA 4HX1B 3QFJE 4AE1A 1KB5H 5EU5B 1CDIA 3G5XB 2CO4A 4ERSH 3A3YB 2KYIA 4PJBF 2GITA 1A64A 1E5BA 4PGZA 4NBYB 1HH6A 4L37B 4P8QA 1UXWA 1H3UA 2XWTA 4G80A 4KXZI 4RMUA 4TOYL 2IPUK 5C0BA 1JYNA 2AK1L 2L8AA 3MSPA 1V54B 2OSLB 3RRQA 4HWUA 5ANMB 1YSOA 3CDCA 1F00I 4JFDA 1V8HA 2QPSA 3MRCB 2JWYA 2RACA 3ELQA 3X11B 2YIHA 4HFWB 5E8NB 1MHEA 2NXYC 5EU7C 4NKMA 5IVXA 5C0DB 4M7LT 4HFUL 4HIEA 2I25N 2AXWA 1CE1L 1ZA3A 4IBTA 3V4VH 2OW7A 2VDPB 4OV6F 4XCFH 1T1YA 4XE0A 4AJVA 4OZIA 4UI2A 4NXSA 1XIWB 2CR0A 1HI6A 1XB8A 3VXSD 1NCAL 3IDXL 5E03A 2NY5H 3ARBD 1UVQB 2HTLC 3LIZH 4W70A 3ULAB 2ZT9C 3E0GA 3HS0C 1AXTH 4OD1H 4XP1L 1OSEA 1ADQL 1JWUA 1UA6H 2W0FB 4Z78B 2JKNA 1TT6A 1LD9A 3WIHH 1FSKC 3VFWA 3WMPA 3V6ZA 5EC1B 3MGTA 4E41A 2PWDA 1T83A 2HVJA 1HEZA 5MI0C 1C12A 2Y1ZA 4Z7OF 5TE6H 2FO1A 4PV8A 4OI9A 3KJ4B 1E9OA 5T5FH 1ZSHA 2IQ9H 3QWOA 4EXPX 2IDCA 3WNLA 1DJGA 2K8QA 3SDDB 1TNMA 2A9MH 1EAOA 3L9BA 1TZOA 4GAJH 4NC1C 1D5BA 2NYYC 5EC2B 4Y2OB 4JPVL 3UJTH 3US1A 5D5MF 3JV4B 2X70A 2E0PA 3VFPB 1MNUH 4PJGB 1TNNA 4FQCH 2MJWA 2XXFA 4FNLL 4MHHG 3ILPB 2FL5B 4J27A 1MVUB 4KVNH 4OF0A 4U6YA 4XB8A 2HJFB 4X6EB 2C5DC 1H8SA 4UU9B 5DEZA 3RWHA 2VAAA 5D1QD 2ADIB 5IBLD 3O2DL 5K39A 3OXSA 2WIIA 3T0XA 1FNSL 3NSJA 1PY9A 3HS9A 4OCSL 1C5BH 4N0UA 5HYQB 4TUKL 1YAZA 1FYHB 3QA3B 1N7ML 1M42A 5BJTA 2FB4L 3N6YA 3P3YA 4FNUA 4NZRH 4F7KA 1WUZA 3JTTA 1NMCC 4KHXL 1OWRM 4G9FB 1KXVC 2YMOA 2X89D 4ZW5A 4ISVA 5F0PB 2GB2A 2X0WA 1R3KB 1KCVL 5G4NA 2DQDH 3QIBC 3NQKA 2EADA 4JGJA 4J2QA 4PVLA 1VGKA 3ILDA 5T3XE 4I13B 3U0PA 2R1WA 1QR4A 3C5ZC 1XF2A 2W65B 3O11B 2IGTA 1KCRL 2P7TB 5FUOL 3DTXB 4OJAA 3IRCA 3MLWL 2SEBB 3MRLA 1A7RL 1BHGA 4I77L 4CSSA 3FCTB 4RA0C 3BH9A 3L3KA 4E9LA 1BV8A 1NCIA 5C6WH 5CHNA 4NO2A 1ASQA 3PGDA 4PJ9B 3WNOA 3UO8B 1JWSB 1NH6A 3RFZC 3TEWA 5CJQH 2VXTH 3X17A 2R69H 4G8GD 3UAJC 2IVFC 2DQEL 1T4KB 1WCBA 5LQBH 3WS3A 4S0TD 2CCWA 4NLHA 4QRSB 4QRRD 4XE5B 5AVXB 7FABL 4GMSL 5KYYA 3SB3A 4MQXD 5MP6H 2HVKB 3U2SA 1YG9A 4HUWB 4OZHF 1ET7A 5JW3L 2OI9C 1JFQL 2C9AA 1KJ2B 3LKNB 2A99A 2H1XA 4JPIB 4YIQA 5ACZB 1K5WA 3VSQA 4C4BA 5MERA 1Y6KR 1KPRB 5JQ6L 2JKIS 2ZYSA 4GP5B 1NANI 4PH8A 3RKDC 3VMNA 3ATDA 2H2PD 2QQLL 4X7TA 4FNQA 4L0PB 1UXSB 2ZQKA 1FZMA 3CE1A 4MJ2A 4OB5L 4L3EA 4AYFB 3CQQA 1MRDL 2V2WB 3FRPG 4OLVL 4Y4KA 4Z7VE 2V4LA 2YAHA 1RUQH 2O5YH 3D3VD 3GSQB 4PB0L 2F53B 2H3NA 3LZQA 1HL8A 3I74A 2ZKWA 2ESVD 4JBSA 3GRGA 4XPAH 2XBZA 1D5IH 1BVZA 3H4HA 3UL4A 4HWBL 3O4LE 3GXTA 1PZ5B 4N0FB 1PLBA 3ES6B 3F2LA 1TVHB 3UC0H 3FU3A 1F3JB 1FNEB 4FFYL 4WUKH 4LLQB 1XF1A 1A14H 3CFBA 4WVRA 2XZAL 1ML0A 2W92A 4H1LB 4XO5A 4JHAL 4Z7OB 2Y5TA 5DJZB 5C0JB 3VXRE 2KERA 2O5ZH 2YO3A 3BUBA 2WZPD 4IIQA 3VFUB 5LDSA 1SDAB 1L0QA 4MBRA 1T7WA 3O2WL 3HB3B 2NUTA 2ZG1A 3MCYA 3QCTH 1RL1A 3EUDA 3EW3B 4UQCA 1F90H 1KC5L 3QUZD 3MROB 4CW1A 5D5MB 1I3RB 3QCUL 2YLKA 4LBAA 3TASA 5AEAA 3UP1A 4BK5A 4YSQA 1FFTB 2IGFL 4G7YL 3IJEB 3ZQXA 3N85H 2WVUA 3O41B 3GI9L 5DHEA 5EPMB 3SQOL 3UJIH 1CXEA 3IDUA 3UTSD 1NGPH 1KPUB 4U6XA 3SDAD 3L4TA 1TO4A 1BVKA 5HDBB 4MSWB 5TE7H 1VFBB 2BLFA 4QOKA 4G59C 1CLZL 1TZHB 2V9RA 1EWHA 1WIPA 1INQA 1YPZB 3S97C 2P80D 4FC3E 4ETQB 3QRFM 1LO0L 2ZKHH 1JERA 4KJPD 4P4RB 2JKRM 3OMAB 4J3OD 4N22A 5BS0D 4CL7A 4Y5XB 3D85A 3OMNB 1Q38A 1SMOA 2EJ1A 3Q6FB 3BQVA 4WK0B 4BCXA 4YX2H 1SEQH 4JFEB 4ZTPH 4H25B 4JANA 3ARGD 1JS4A 4Y19B 5CEXB 4LASH 5HGGS 1LO2H 1R46A 4PV9B 4Z7UE 4WEEA 5IQ7L 2F2HA 3QEUB 3EJCA 1EDHA 3P73B 1KJVA 1MI5D 5CU9A 4ZRGA 4PJ5D 1QYGH 4YL4A 3GUTA 2NXYB 3EFDL 2DJSA 1TQBC 3COOA 2FEEI 3GSXB 5LG6A 1D6VH 1JTTA 2GIXA 5E9NA 4AW4A 5F1OB 2OPCA 1RU9H 2G3ZA 2X4RB 4G43B 1JVOA 4ZX4A 3HHSA 2CRMA 4E5XG 4YHZL 4NRXB 3S35L 5JHDA 4UDTB 1YZZA 3CN1A 2O61A 1PQZA 3ROLA 1HC1A 3DRTA 3DXAA 4F8PA 4NZ8A 2VJXA 1IKNA 3IDNA 5D7IF 5E00A 2EXTA 1CZ8H 1L3WA 1MFEL 2ID5A 5LXGL 4P07A 4HF5H 2W1NA 4QHKJ 5DI8B 1FSKB 4ZMNA 1QTSA 5EDSA 3DHPA 1PVHA 5JPMA 5D2LE 4GPVA 4LSSL 1H3GA 4PIBA 1YEKH 3QHFL 1K2DA 5MI0B 1NL0L 2FATH 2B3RA 3WNNA 4K3DL 5DUML 2YGVA 1F13A 2VO5A 3EYQC 3DJTA 4M9PA 3BE1L 4KKLD 4HOZA 5EIIB 4HP5A 4NT6B 4ZS6D 4B0MB 3Q05A 4HUUB 2WWKT 4Q6IB 4YHIA 5IBUG 1ZK9A 2BNQD 5AVVB 4W68A 4N8VB 4KZ0A 1IC7L 4D0CA 3X3FH 4MWFA 2UUDH 1G7QA 4Q0XH 4KI5F 4R0LC 2W07B 2NYZA 1N4XL 2BSRB 3P54A 2RALA 4OLWH 1OW0A 5D4HA 3RX7A 4Z77B 4Y2DA 1D6EB 1NGQH 4WTZG 3H1ZA 4NO3A 3IM1A 3RWCB 3U1QA 35C8L 3RBGA 1EMTH 2Q8BH 1QACA 4XPTH 2VN3A 3CVCA 4A2MA 4S1SL 5E94B 2PWHA 4BZ1H 2HLFC 2WQWA 3BGFB 5DLLA 1N2RB 4NUGL 3IPFA 1EBPA 2PWFA 2YPVA 2VDRH 3GMLB 4OLEA 4PJEE 5LKNA 1N5AA 4O2CA 3OX8A 3GRWL 1QSEB 4N8UA 3FOMA 3ME0A 5DHXB 2QHRH 4J39A 4ORGA 4PR5A 5GJSL 4QGTA 3FNKA 4ZW3A 4ZAKD 3IT8D 4HV8B 1F41A 3PHAA 4OUUB 3IBOA 2OJ1A 3G6DL 3H9SE 3QIBB 3LHPH 1GGBH 3L7EB 2EKSA 3C5ZB 3PAUA 1F3DJ 4JZNA 2W9DH 3DJRA 4L5FH 3KPPB 2YZ1A 3W57A 1Q94A 4FI7A 4YQXH 5GIRA 4NUPA 3OAYK 5F7DA 1TJIL 1U36A 1ZA6B 5BVJB 4MCZA 3T0EA 4LCUB 2JCWA 2WSKA 1IJNA 2LLGA 3L45A 4YHML 3LKOB 1QOKA 1TKWA 3BJLA 3R1GH 3MLZH 2B1AH 2OJZH 2M83A 3LQAH 2DBJA 3TH4T 1NINA 4KPHH 4UIKH 3L95A 1T21B 2QQKL 4LHUG 3ULVD 2NY1C 2AJXH 3UMTA 3VD4A 3MC0A 4PRHD 4LPYA 4EN3C 3L1FA 4P2RE 2HA1A 3GTTA 3WY4A 4CSTA 4XP6H 2HRPH 4M29A 1WZMA 3IAQA 2CA4A 3WXVL 1UATA 1A9EA 3DX7B 4EZKA 4HCFA 1BJ1H 4BKTC 1KDIA 4UQAA 3BIAX 1ASOA 5CCJA 3P77A 4WUUB 1J0IA 2YGOA 1NGWA 1A7NL 1WGOA 3BXNB 3HFML 4H26B 3H56A 2MOGA 1M2OA 1ZOXA 2RCSL 2OK0H 2XWEA 2DF3A 1WWCA 5T1MA 2IWKA 4YMPA 4N2OA 3NSDA 1JZ3A 1I8IA 1ZANH 2OMYA 2VXQH 4DP6X 1SJXA 2OMTA 1I85C 1F3RB 4M8QA 3WN5C 2I07A 5B1KA 4BEIA 5MEOB 1UKTA 4GUPB 2CO7A 4XN4A 3E8UH 1AAJA 2WOYA 4N6RA 4FKHA 5IVZA 1E40A 2CR3A 4PRPE 2IPKA 4EOWL 4F3FA 3BLPX 2EVFA 1IUZA 1QI5A 1D5XB 4IRSC 5DT1L 2CDEA 5I8EB 2AFNA 3RWDB 1X9LA 3DO7A 4YXLH 4ZYKA 3O4OC 4QXGL 4DKEL 5CS7A 4N2FA 3ULUF 2XKUA 1QBAA 3ARPA 2ZOOA 3UG3A 1IEAA 3X12B 4Z1PA 1AH1A 2Y2TA 4JO3L 3LB6D 4DWHA 4WW2F 2O6CA 3IDGB 1EZVX 5IB1B 1Q8MA 2AEQL 4X0KB 5IW6B 2X2IA 4L4TD 3UG4A 3PWPB 4X6DA 3O6ML 3WKMH 2Y7OA 4WI6A 4YJZL 4GG6F 1RULH 4IDJH 4XOCA 3NN8A 5C07B 4X8XA 1P4LA 2IH1B 1I75A 1NUNB 2WJ7A 3M1CA 3D8MA 2QSQA 1NCBL 4GIPD 3U30B 3MV9B 3KBHE 1DVZA 5EULV 1S7UA 4AQ8C 3B83A 2X9WA 1U8HB 3SGKC 5K59E 3U9PH 4U1IB 4JJ5B 4JQIH 3DX9B 4LQFH 2VE6B 4AQOA 4G72B 3BKYL 2A9NL 1RAMA 1I8KA 2WLIB 3GO1L 2CJTA 4JFXA 3MRKA 1D7DA 4PP2B 2ROYA 2E9JA 4ZPTB 1A4JA 3HI6L 2NOYA 6FABH 4HT1L 4KJYA 2GJ6D 2G30A 1JTPA 4N26A 3O9WA 3V5KB 4YUEH 4OI7A 2CO3A 2Z6FA 2KH2B 3GSNA 4O02A 3U7YL 2ZKXA 5IOPA 3W0WA 4JG0H 1KENL 4JCWA 2BY3A 3K72B 4MYWB 3GB7A 4MVBD 1FAIL 3SDXF 4P49A 1CGWA 3IXAB 3N42F 1R5IB 3HMWH 5TQ0L 5F93C 3BESR 2EVJA 2I69A 3C08H 1L9RA 1SJHA 3D39E 1EJ6A 5KG9B 2VW6A 43C9A 4MA1C 2YZ8A 4F7TA 4X9FA 3LRLA 3LKQB 4YE4L 2A1WL 1IRAY 4F1ZA 1TLMA 4JK0D 1DVSA 4G6MH 2VRQA 1QZNA 4YSEA 2H0EA 1TQBB 5CKAA 4OGYH 1AE6L 2IOMA 4HX1A 4TNFA 3BRGC 5EU5A 1FJ1B 1S7SB 1FH2A 5L4FA 3G5XA 5IGXL 4K23H 2DS4A 4R5XA 5ESAB 1QFWM 3PU7A 4BFFA 3FOLB 2CCVA 4L37A 3HNTH 5AW9B 4AQAB 3D2UB 5AAWC 4ZOEA 2OSLA 4NN6B 2XTJC 3MKGA 5ANMA 4OF5A 1IL1B 4Z7WB 1FLRH 2JTDA 3MOAL 1DLFL 2GKIA 4NO0D 3UIYA 3MRCA 2EE6A 2O30A 3FRPB 4BINA 1HZKA 3X11A 4HFWA 1Y7VA 4YHNB 3MJ7B 4WV1C 5E8NA 5DD6B 4F80A 3O3EB 3FB8B 5C0DA 3V6OA 1AD0B 4PBXA 4UILH 3IFLH 3H55A 4U3SB 1G5AA 1TFHA 1UC6A 2NLJB 1XIWA 4ODUB 3QAQA 1EUUA 3NIGB 4Y16B 3RGVD 1UVQA 4GW1B 4JO8A 4L5FE 3T2NL 4PGCB 2IDTA 1EHAA 1ZLSH 4R0LB 2YD9A 5ILTL 1M7DB 5HHME 2W0FA 2HKFL 4Z78A 4GAYB 1TU2B 5EC1A 1A5FL 3LZOA 3INUL 4YGVB 1MIMH 1A7PL 1BGXH 1Q9WB 4M7JH 1EK3A 3I9PA 1JD9A 1BM3H 1QBML 4KV5F 3SDDA 3EKCA 2NQ3A 4NQTA 2DQTH 2R2BB 3AXLB 5EC2A 4Y2OA 5KVEL 5DCCA 1JXFA 5TTRA 2ADJB 2IDSA 3JV4A 1O7DC 3CGTA 3VFPA 1TR7A 1ZDQA 4PJGA 5GQBA 3FQRB 1E3XA 3ILPA 2FL5A 1MVUA 4KZEH 5CGBA 1FZJB 2HJFA 4HJJH 4L1SA 4X6EA 1FQ9C 4PWEA 5FYKH 5I1IH 4UU9A 3CFEB 2ADIA 2XHNA 3GZKA 2VDMB 1PSKH 4D7BA 3LVEA 5A43C 5IOKA 2P4AB 1P4BL 4RSVA 2AERT 4GO8A 2KDYA 4AT6B 4AV0A 4IBZA 2ZKYA 4LT7A 5DRZB 4XPGL 4P5MB 2OM5A 3P0YL 2ZOTA 5HYQA 4XNYL 2DLFL 3QA3A 1YECL 1EH9A 1I9JL 4GI9A 1MJ8L 2NCMA 4AGMA 5B1JA 2GSGB 5JOPD 3CK0H 3NAAL 4G9FA 2NY1B 2A0LC 1AC6A 1HS6A 4EN3B 3K2UL 5F7NC 1R3KA 4L2YA 5BRZE 1U6AL 4LEXL 4LLVB 2ZX6A 3SDCB 1FHNA 1WGVA 5JA8B 2W65A 3O11A 2P7TA 4PMFA 5CSGA 4E5XB 2A77L 3DTXA 5DZOA 2WXNA 3D18B 3WKYA 2J5WA 2SEBA 2ZCHH 4TL5A 1MAMH 2NW2B 2V8LA 3FCTA 3HBPA 5C0IB 4B9IA 1J11A 1K8IB 2AJYH 3NZHH 2MQ3A 4RGND 4PJ9A 1JWSA 4LP5A 2ZP8A 4NLAA 3VE0B 2C9XA 4K94C 4CILA 5IUCA 5KS9E 1OAJA 1OT4A 1WUNT 4HD9A 2OR9L 1T4KA 4XN9A 3NMEA 4FXKC 4QRSA 4NQCB 4ZX6A 2BJML 1LWJA 4LLMB 1G0YR 1P4IH 1L7IH 2HVKA 4HUWA 4FYRA 4QRQB 4KK8D 2HWZH 1TYEB 2XETA 2WQUA 5IBUB 2YPLB 1KJ2A 3LKNA 5AKSA 4CDGC 3SPGA 4JPIA 1DFBL 4Y2LA 5ACZA 1E5CA 4QY8B 1OP3K 2D7NA 2R15A 1KPRA 3SE6A 1J9RA 2RIKA 1CGTA 3R4DA 4PS8A 4PLKC 3X14B 4RSYA 2FSDA 3QYCA 3OM3B 3P30H 5KOVC 1UUNA 3QP3A 4V2CB 5CEZD 4D9RE 3N2JA 1UXSA 3FCUB 4W9GC 4AYFA 4G5AA 3C6SB 3KDPB 4U6HB 5AB9A 2V2WA 4HCRH 3U7WL 1T20B 3GSQA 5EOTB 2F53A 3VI3B 3WLWD 1JD7A 3AABA 4HCGA 4LOUC 3O0RH 4FZEH 1MW2A 3S88H 3LXCA 1O6SB 1OP5H 5ACLA 4R96B 3OVUB 5HBBA 4JM2C 4WTXA 2R0WL 3VG0L 1PZ5A 4N0FA 2HMID 2ZXQA 1UOWA 3B3BA 3ES6A 4W9JC 3AY2A 1TVHA 2W0LA 5IQLA 4S0SD 1FL3B 1F3JA 1FNEA 5FGSA 4P5TB 4X83A 4A67A 4LLQA 3IWUA 5E0QA 4FQ1L 3FPYA 1JVLA 5FUZH 2F8IA 4H1LA 3ZX1A 3CFDB 1SXBA 1KYAA 3T71A 2NQDA 5DJZA 5C0JA 2Y4SA 4TSCL 2DIEA 5MEND 1RI8A 3VFUA 5CR8A 4RGMB 3SBQA 2VM9A 3EH1A 3UBFA 1M3JA 3EJZD 4C83B 3MROA 1WFMA 1QO3B 1I3RA 1TO5A 2D0GA 2DQCH 3HUJE 3QZMA 4M8UA 4Y9GA 5D5MA 2F8XC 3N9GH 3IJEA 4L29B 4LHUB 3O41A 2K7PA 2JJTA 5EPMA 3Q44A 4XCNB 3ULVL 5JXEC 1KPUA 1WAPA 3T77B 5C7XH 2CJ3A 3FFCD 5ICYB 4MSWA 5JLZB 1VFBA 4FP8H 2K9UA 1TZHA 1UENA 4MMYB 5SV3A 4KH2A 3HIZA 1YPZA 2FHBA 3FO1B 3S2CA 1ZEAL 4ETQA 2E7LC 1WZAA 3N40F 4OZGF 3IVKB 1TVBB 5SX4H 4P4RA 4BFEA 5A2FA 4OLUH 1HWGB 1YJDL 5IHUL 1VZGA 3QJHB 2ENQA 4Y5XA 2YBRB 5DJDA 2YUWA 4MA8L 4JR9L 3SCMD 3Q6FA 2Z0BA 2XN0A 4JFEA 2D8KA 3L4WA 4H25A 5SX4I 3BD5A 5GPRA 1MRCL 3KPLB 4X0NA 4Y19A 5CEXA 4ZSOE 5D1ZC 4AYSA 3VNYA 2YD7A 3QPQD 2XTJB 3MLTB 4PV9A 3UBXG 5ECGA 4ZMWA 3QEUA 1P5UC 3S3JA 3P73A 2H26B 3KPSE 4UT7L 5DGRA 4UOW0 4WV1B 3DBXB 4RFEB 3WFCL 4W9EC 3T0DA 3L4CA 3UBHA 3QIUC 3GSXA 3QG7L 1HYRC 3U6XA 1GGTA 3SY6A 4XVSH 1FCCA 1GZHC 2X4RA 4G43A 1AGCB 1HCZA 1J1XL 3SYCA 1BA9A 3ZPDA 5F7WC 4U1MB 4NRXA 4WENB 4UDTA 5E8PB 3ZLQC 1CQKA 4Z5RB 1B2WH 4L8CB 3U0TB 4TYUA 3MLSH 2Y7NA 3LAFA 1HU8A 4NXKA 3FB7B 4XVUD 1YEEL 3L3GB 3HC3L 1KTBA 2VDNH 4S1QL 5IEKB 4AL8L 3WJLC 5DI8A 3B9DA 4CVWA 1BDYA 1NPNA 2EVHA 2WLZA 4ZFFB 3G5YB 1UWXK 3U4BH 5D7JC 3SYOA 2LU3A 1I3VA 2LGNA 1PZAA 2E47A 4HGWB 4MJIE 5JIHA 3VWJD 3G5VB 1PLCA 4HJ0D 5IY5B 4J12A 1ZGLM 1KEGL 2GK2A 4YDNA 3OHXB 5EIIA 2IAND 3RTLA 4NT6A 3UEZA 5ISZE 4HUUA 2AABL 2QPFA 4Q6IA 4EIGB 1E6JH 4YZWA 4NP4L 4JRYB 3UTOA 4AG4H 4PWKA 4N8VA 4XAKD 5LN4A 3H3PL 2QJDA 4I0PC 3W5NA 3QAZC 2ADYA 4WO4C 1NC4D 4MZIA 3S34L 3RU8H 1DTUA 2W07A 1TETL 2BSRA 4Z77A 1D6EA 3BCDA 1WCQA 4XCCH 3K6SB 3GLEA 3RWCA 5B7MA 2BK8A 1IMHC 3CN0A 1HHJB 1O7SA 3SY0B 2LABA 2JI3A 4DFHA 5E94A 1OP4A 2J1KA 3WTTA 1BF8A 3ARZA 3F7PC 5EOCH 1N2RA 2GYSA 2VDKB 4XMWA 4EIZC 1RIHH 1ACXA 3OR6B 5KVFH 4W9DC 2F08A 3GMLA 4WI2A 1UM6L 4FLRA 3LNDA 1LLAA 1QSEA 2F54E 1NCDH 3MLVH 3Q9PA 1FG2B 2A4CA 2LOEA 2CJSA 2JB5H 3C75A 1H9VA 5KYWB 1CFNB 4HV8A 3TV3H 1JNNH 4OUUA 1ZLWK 3RHWK 4AH2B 1RSFA 1EEUA 3V0HA 3C5XA 4MGXA 3QIBA 3L7EA 2FYVA 4K2UH 3FQUB 3C5ZA 5SWSD 3KPPA 4MZRA 2AQPA 4TTDD 5DJXB 4I3SL 3UCQA 4PTTB 1ZA6A 2PR9A 4P46C 1P7BA 2C3HA 5BVJA 3NSYA 4JFZH 4LCUA 3F8UB 5CZVL 4RX4D 3LKOA 4CN4A 3OZKA 1ZGLP 1Z0MA 2JIXB 5I1JL 4F1SA 1OK0A 3HN8A 3APMA 3O6KH 4AXWA 4DGIL 1MCIA 4CN6A 1T21A 4OZGB 3W56A 3UAJA 3UEQA 4TVPE 2CBMA 4LARL 1LO4L 1SLUA 4PY7B 5KSAC 2WUBH 3W39B 5EEUA 2WLNA 2KPWA 4FXKB 4N2IA 2WIMA 5MEQB 4S1DC 3UBGA 5I6XC 3DX7A 4PLKD 1BVLB 1GSKA 3PNRB 3PWNB 4PM1A 3UGXA 3UACA 4DAGH 2P44B 4DGYL 4P2OD 4WNSA 1JCVA 4LVEA 4WUUA 3BXNA 4K5LA 1Q9LB 5HI3C 4FFZL 4H26A 5I82A 3TA3D 3ECBB 3CHQA 2AQSA 4NRZB 2VXVL 1MLCB 4FS0A 3OLDA 3BZ4B 3N41F 3ZYZA 2DICA 4P5SA 3T8MA 1WZ1L 1JK9B 5L8KB 5HHVL 4PJ7E 5D7KD 1IZJA 3FCSB 3WS6A 5MEOA 2AGJL 3KPTA 4GUPA 2QSTA 3TNNB 5CP7B 4D94A 1VGEH 3RIFK 4P9HC 4F8TA 1JPSH 2V9UA 2NX5D 2IPUG 1QSFE 1U2YA 5F71A 1O9VA 3AT9A 5FO8B 5I19H 1ZE3C 4BQ8A 1D5XA 1M05B 5I8EA 1AYOA 5L9DH 4M8RA 1IO4C 2BERA 3RWDA 4APQB 2J55A 3GHEH 4AEEA 2CSPA 3LKPB 3X12A 1XD1A 3T6XA 3RL2B 2AXJA 2EE2A 3QISA 1TTRA 1P84J 3IDGA 4PVNA 5IB1A 3W11D 4CVZB 5E6ID 2W95A 4X0KA 1S7WB 3L48A 5IW6A 2OSXA 1UD3A 3PWPA 3X1GA 1H9DA 1ZAGA 4A37A 3NCEB 1BFOB 3TXAA 4M48H 1Z9LA 4KQ3H 5C07A 5BO1H 4GS7B 2IH1A 2DQMA 2V9QA 1MW3A 3EDJA 3MV9A 2PWEA 3ECWA 1TTUA 3MBEC 4LEEA 2C3XA 4ONGL 1U8HA 3BX7C 3R4RA 5CLXA 1J5HA 4MAUL 2X05A 3MTXA 4U1IA 5A40E 2NY2C 4JJ5A 3DX9A 5LCVA 2VE6A 2UX6A 1CUOA 2WLIA 4CC0A 4TOYH 1DBAH 2WLHA 2Z35B 2AP2A 4IRZA 4PP2A 1UT1A 4MZ3A 2Z31C 5LXVA 3K3QA 1EHLL 4ZPTA 3VXTB 5JW4R 5CJXC 3V5KA 2KZBA 1F8TH 4K5NA 2PYED 1I9EA 1O9WA 4J4PD 5HHNB 4N2LA 3SBPA 1WAAF 3K72A 5GGTL 1BXUA 4MCMA 5GSVB 1CE1H 3IXAA 1R5IA 5EEWA 4AJWA 2BVEA 3ZDZE 2XNAB 2XN9D 5D1ZB 1WPCA 2ZKMX 1NCOA 4UTAA 3RA7H 5KG9A 1NCAH 2A6KB 1P5UB 3D4ZA 3IDXH 3FTUA 5F96L 4PUBL 4YR6B 3RJQB 1HTYA 1ASPA 3LKQA 5DMIH 1J5CA 4K55A 1N6QL 5ABAA 2N7BA 1Q1JL 4JFDE 3WNIA 1PJ9A 2VRAA 4XP1H 5IVOA 3BMVA 5LHDA 2CIKB 3QDGD 3UJJH 5PCYA 1QLFB 1FJ1A 1S7SA 4LGSB 5D6CB 3OB0K 4HIJB 5IVXE 1MZZA 5ESAA 3LHAA 1JZHA 5E7BA 3FOLA 1Z9OA 3V79C 4AQAA 4LPCA 3D2UA 1SY6A 3M17B 4TF4A 3OGCB 3JUYA 3AU1B 3MV7E 4YS4A 4OZIE 4BA0A 1LQBC 2CRYA 2H6PB 4Z7WA 2H45A 1IL1A 4HC1A 3TWYA 3RVUC 4YGAB 2AJZB 5TK2A 3ZMEA 3FRPA 4FTVB 5D7HA 5GJTL 4JPVH 3FCBA 1BAGA 4P4KB 2AAVA 3NCFB 4YHNA 3MJ7A 5KVFE 4HZLB 5DD6A 5CLTA 2HRLA 4FNLH 3O3EA 2J6EA 3F12B 3FB8A 1AD0A 3K5SA 3AM8A 1MJ7H 2R1YB 3ZKSD 1MIEH 5DVLA 4ZNEA 4U3SA 2D31B 1OQOA 4A2GA 4MB1A 3RGHA 3ZDWA 4P2QD 2XWCA 4H44C 4I18C 3MI6A 2NLJA 3WSQL 1FNSH 4ODUA 1MCJA 1XSJA 4OF8A 4G8FB 4HKBB 1RZKL 4I1PA 2EILB 4I0PB 4Y16A 2AV7B 1SHSA 2F7RA 4GW1A 4L9LB 4TUKH 4WO4B 5EBMB 2V33A 3V0WL 2LQRA 4PGCA 4FDWA 4R0LA 1WTGT 2P5WD 4B97A 2FB4H 3AY4A 4S1RL 2APWA 1JV5B 2XWZA 1A02N 1M7DA 1X5KA 2CAKA 2WSDA 3F85A 4GAYA 4KHXH 4FG6D 1TQWA 2ZYIA 3F6JA 1GYWA 1TU2A 4W4NA 1IBZA 2VISB 3EAKA 4YGVA 1Q9WA 4Y8DC 5C6TL 5LDUA 2ODIA 2J73A 4LCWD 4DP5X 3KYKH 3LS5H 4BWTA 1KCRH 5EDXA 2ZUSA 1Y6MR 4ZW7A 1MQ8A 1SOSA 5FUOH 5G2NA 4JPKL 3QJXA 2VOTA 4TUUA 4GO6B 2R2BA 3AXLA 4I77H 2LW3A 5G55A 1AZRA 2ADJA 3O8XC 4N0UE 3LN4B 4FFTA 3WLBB 2BP5M 1L0YA 5GISH 3NZ8B 3FQRA 4P46D 5F6IC 1FZJA 3CLEH 4CMHC 4ZZKA 3GNML 3S96B 2DQEH 4DF9A 3CFEA 4K3GA 2NDFA 4GKNB 1BVNP 4IW4C 2J57A 3RWIB 2CJUL 7FABH 2V7HB 5HD8D 4GMSH 1J8HE 4AC2A 4Z3EA 4N6QA 4AT6A 3ZSTA 3H7LA 1T66C 5DRZA 3ZTDC 4P5MA 3TTYA 2B8OT 4LIQH 3UBXB 3KH3A 5JW3H 2D7TL 4G6FB 3VD9A 4YK4C 4GMTH 5DJ0B 3T3PE 2WGXA 2VLRB 3GKZA 5FR3A 4ODWB 1AG6A 1LE5B 4POUB 2GSGA 4JDTL 2VLME 5GZOC 3M1BB 4EN3A 5KSAB 5E4OA 1A7QL 5HI3D 4LLVA 3SDCA 4HIXL 4C56B 2FQEA 2YPVH 3QWRD 4HWNA 2AZUA 3TEZA 4XXDB 3DNKA 1MRDH 5AVRB 4E5XA 1CO1A 3D18A 4OSUH 4TV3A 1PKQB 3BI9X 5EEYA 2GSMB 2K7QA 3GMOB 3JWNH 2ZNWA 2NW2A 5C0IA 1K8IA 4NZDA 1P6WA 4ATWA 3B34A 1A0QL 4YPGB 4DUVA 2YKLL 2FD6L 3DHJA 3QXAB 3VE0A 1EIBA 3A4FA 3IGAB 3SDYH 5JW4N 1KTLB 3VW3H 4G7SB 3KPRD 2XZAH 4ONHB 4NQCA 2V8MA 4LLMA 4OIAA 5CILL 1FYTD 4QRQA 2X4PB 5FYLH 4L3EE 4TRPL 1JYWA 3LKRB 2YPLA 4WFHE 3HG1E 1W15A 1WG3A 1LEGB 1XL6A 2K45A 4ZFQA 4BQ6A 1CDHA 4QY8A 3O2WH 1YEHL 1E28B 4PJ8B 4HEMA 1KC5H 4YBQC 1FGNL 3E3QC 3QCUH 4Q14A 3X14A 1DQQB 1GL4B 1NCHA 2BX5A 2NNFA 3FL7A 1CFSB 4NS0A 4ONFL 4WTZA 5DC9B 4LRIC 2B1HH 3OJMB 1SHWA 2YSTA 4M5SA 1KJ3H 1HHGB 3LD8B 3NCJH 3C6SA 4U6HA 2G3NA 1EERB 2WXPA 4R7LA 5KTEL 1JK8B 3OLIA 1T20A 1CLZH 5EOTA 5E51A 3VI3A 2OW6A 4IOSA 2K6ZA 5KVGH 1LO0H 3P9LB 4WZ9A 1O6SA 2X12A 3PJNA 5FV2A 4R96A 5TFSL 2H1PL 4BFJA 3MBEB 4NCC1 1O7VA 2Y7SA 4PIRF 1CN4A 4LMQI 4LP4A 1GS8A 4WJKB 3S7GA 1A4BA 2JCCF 4V1DB 2FLMA 4GKSB 5A2AA 2QKSA 3LH9A 4Z7NE 1FL3A 1CDJA 2YSSB 4MQ7B 4P5TA 2FBJL 3GJEB 3CQPA 2DQFB 4C57C 2H9GB 1BYNA 5F1KC 2Z31B 1TLKA 2E27L 3CFDA 3DX2A 3RJDA 5IJVB 2ATPB 3VTTA 3MXVL 1YC7A 3VXSB 4G6AD 1MREH 1JV2B 5JUEL 4XMZA 4KKQA 3EFDH 2QFPA 3B1UA 5HI5D 2RA1A 4LAJH 3IMUA 4C83A 4D0BB 1OAXL 4G7RB 1VACB 1QO3A 4PLOB 3ELAT 2WCSA 2IQAB 3QRGL 4L29A 5IV2B 4Q9QL 2C7FA 4LHUA 1P84K 4YHZH 1JYXA 4XCNA 3S35H 3T77A 1UD2A 3LX9A 4WU5B 1B4JH 5HGBB 5ICYA 5JLZA 5C1MB 4WI7A 4MMYA 4YXKL 3FO1A 2ENSA 1NSNH 1WT5A 3RGBA 3HZKB 3TH2T 3IVKA 4BQ9A 1TVBA 2Q0ZX 5TDPB 4G1MB 2EIBA 3L4ZA 3Q8FA 3QJHA 2YBRA 5LBSL 4NGHL 3QHFH 5I0XA 3TT1L 4HOXA 3QUHA 4K3DH 5DUMH 3MLUL 3KPLA 4I2XB 4ZO9A 3BE1H 1EDYA 5AAWA 3F6LA 4DW2L 3FF8A 4HSCX 3PABB 4XNBA 3N44F 5GS0C 3MLTA 1IB5A 2JB6B 4OF6A 3WJMB 3OMIB 1U91B 1HNFA 1IGML 3QK0A 1IC7H 1XZWA 2H26A 4G5ZL 4YFDB 1OTTD 2QKIB 1MDTA 3BT2L 4WV1A 4A1RA 2CLZB 3DBXA 4RFEA 1N4XH 4J3OF 4JGMA 2WKLA 1RZPA 3NABL 4NQDB 4YFEA 3ZMNA 1Y1UA 3K4DA 4S0HA 2R29A 1TJHL 1AGCA 2A3TA 4I18B 4S1SH 3N06B 4U1MA 1YHPA 5DVKA 5JIDA 3FMGH 5E8PA 3ZUCA 1H3VA 1U3HD 2XYCA 3SPJA 2FNWA 3U0TA 3G5WA 4EAEA 4L8CA 5K9QI 2NTSP 5DLMH 1SVBA 3FB7A 3TZVC 3L3GA 5HVHC 1DBKL 5IEKA 3PHOB 3EGSB 4Y8AA 3L5IA 2XXMB 3G5YA 5CJBA 4EIBA 4LIQE 1CXKA 4POYA 4ZFFA 3HE7D 3RZCC 2QVMA 4HGWA 2J1YA 3G5VA 4YC2B 1GTFA 1JHKL 3RVWC 3OHXA 1ZTXL 5BXFB 4G8GB 2F5AL 5ADPL 5IR1B 3N1MC 2QADD 4JRYA 1Q0XL 1TJIH 3B8YA 1GVIA 5IQMA 4ZNCD 2Q87A 3U79A 5IF0B 3MPCA 3O8XB 1KXHA 4PWFA 1SFDA 1P4UA 4UBDC 4JHWL 5JZ7D 3GSUB 3TFBA 5LBGA 3Q8CA 4CMHB 4AK2A 2QQKH 1EFXB 4BWUA 3K6SA 1HHJA 5C0AE 3SY0A 2ADFL 1CFBA 2MQCA 5CLZA 2YJQA 4LCIL 1PD1A 4MMZC 5I1EL 1DBJL 3WXVH 5C0NC 1XB6A 3OR6A 4QWWD 2MCPL 1TJXA 3FT3B 5GRUL 2V5TA 5HYJB 5F6HI 1RIVH 4BHUA 2GJJA 3DROB 5C08B 1A7NH 4MXQC 5GGVY 4M02A 1U92B 1FG2A 1C08B 1REIA 4HQQH 2RCSH 3TP4A 5FYLE 2DQUL 1J48A 2OYKA 1AO7E 1CFNA 2N59A 2KQNA 2DWYA 4HH8A 5KYWA 3RTQB 4AH2A 2J2ZB 1TTCA 3G6JB 4HW6A 4IU3B 4FXGC 4BUHA 1V05A 3FQUA 4AC4A 2HRGA 3BQUD 1OF0A 1JDDA 3VM5A 3AREC 3CFNA 3LN5B 4TSBL 1XBDA 1KGWA 3FN0L 4MD4B 5DJXA 4PLJC 4PTTA 2A4EA 3LNGA 3O2VH 3TEYA 4EOWH 2PETA 1TITA 3BSHA 1ADQA 2JIXA 3V8CA 3ZHNA 4LLWB 4XX1E 4M6MH 2CGRL 3SKJL 4NQEB 3DIDA 5K9KB 1ZS8B 5DZVA 4QXGH 3ZE1F 2Q7NA 2VLKE 4DKEH 3PHSA 3V0FA 3OF6A 4GRWH 3OKOB 4LMQE 4OZGA 5KVGE 4A7UA 4PY7A 1HEHC 1IM3B 1H3PH 3DMMD 2NR6C 3W39A 1AI1H 4FXKA 5MEQA 1TTGA 1AHKA 1BVLA 2E7CA 3PWNA 2D73A 1D2OA 2BSED 5JIIA 4HPYH 3SDAB 2VERN 3N44B 2B77A 1Q9LA 5J06A 1OTSD 2UWEB 3UH8A 3ECBA 3EJTA 3I02B 2HUHA 4NRZA 3SQRA 1MLCA 3ULVF 1GPOL 3BZ4A 4Y1SA 1RUMH 4XHQA 2VZ1A 3UGUA 1JK9A 4TNEA 4MNHB 3UZQB 3K81A 3O2DA 5L88L 3FCSA 1XL4A 3BKYH 1NBQA 4W4OC 3UTTD 5JDJA 1VKXB 1XV8A 3TNNA 3A24A 5CP7A 4LB8A 5D72H 3ARGB 4LF3B 4EDXB 2E86A 5JYMA 1E50A 4UV7L 3WD5L 4JFQB 3D51A 4WRLA 3O0LA 5FO8A 3AS3A 1SRDA 4X6DE 4F57L 4KZDL 1TZ8A 2QTVA 1M05A 3TCXA 2YAMA 1AR1C 1OAUL 3CXFA 5FLUA 2ALWA 3TCLB 4APQA 4L05A 5E95B 1XF5B 1KENH 1ULVA 4H8UA 4AVKA 4F20A 4NERA 2VZUA 2J8UB 3LKPA 3SBRA 3RL2A 3QXTA 4DFIA 5KVMC 2JELL 5TQ0H 5BZXA 2XVBA 1XFPA 3TJHC 4CVZA 5DS8B 3QGVA 1UWEL 1S7WA 4YZFE 4U6TA 1RHFA 3FU6A 3TU6A 3W37A 2AEPL 4KY1L 1BFOA 1HHIB 4YE4H 3Q2LA 4IKLA 2KZKA 3B7RL 1Z3RA 2AJUL 1OCWL 1PGRB 4J2XA 2VABB 4WI9A 2F1EA 3QUXC 3MRRB 5DVNA 1FVEB 2DJUA 1RZIB 3W0WE 4N20A 3TS8A 4UB0L 4M43L 4ZFOL 5JXEA 3M45A 2Z35A 4A2HA 2QPDB 5KSBE 2GJPA 5D2NB 1DN0B 1JNLL 3MOAH 1M56B 2VWEE 3VXTA 2NT0A 8PAZA 2E7LA 3QEQB 2BNQB 2DQGL 4EE2A 2WXKA 5HHNA 3TBWB 2Y06L 1B4TA 3RG1C 3QS3A 3BKML 1ZS2A 2GAZB 2QR0B 2DM2A 1JGUL 5GSVA 1RK1B 4RFNC 3J07A 5AVYB 4KGJA 1MZYA 4P3CL 1JUFB 2XNAA 3BDBA 5D1ZA 3NG5A 4AYDC 2QZ5A 4QRAA 5CCGE 5GS2H 5ESQB 3FSAA 2LLLA 3M6DA 4ZI8A 4DKTA 2A6KA 3S8FB 1L9MA 1P5UA 2VR4A 3LZPA 3V6BR 3M8OH 2XSKA 4YR6A 3VFRB 4EUPH 3GHPA 3T2NH 4JY5H 5K33A 4PBWD 5EZIH 2CIKA 2YWZA 1QKZL 4HWBA 1QLFA 1XF3B 3II1A 4NFBA 5BOPA 2NNCA 5D6CA 4HIJA 5IFHH 4FFYA 1RJCA 2GTZB 4ZAKB 4PREB 4PJIB 2W8CA 1ES0B 3M17A 4ZX3A 2KC0A 3OGCA 3AU1A 3AS1A 2WXHA 2H6PA 2X1XR 4PGDB 3WY3A