1PLAA

High-resolution solution structure of reduced parsley plastocyanin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
AEVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPEYLNGAGETYEVTLTEKGTYKFYCEPHAGAGMKGEVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution solution structure of reduced parsley plastocyanin.
pubmed doi rcsb
source organism Petroselinum crispum
molecule tags Electron transport protein
molecule keywords PLASTOCYANIN
total genus 12
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plaA00
4KO9A 2Q5BA 2UXGA 2PLTA 1NIFA 2PPCA 2IH9A 3NJNA 3FQYA 1EZLA 2YAQA 3AG2B 4NAJA 3NJKA 9PCYA 3IBOA 4HCFA 1AS6A 1GR7A 1JERA 3ASOB 2YAFA 5B1JC 2J56A 4BXVA 5B1KA 4NB7A 4E9SA 1NTDA 1W6LA 1NICA 2A3TA 2GC7C 1AS7A 2VW4A 1V54B 5I6MA 1ZDQA 3ERXA 1JOIA 1OCOB 2DWTA 2PPAA 5AZUA 2IDTA 1BQKA 2EIJB 1E67A 2IDFA 4QKTA 2AZAA 1J9TA 2BP0B 3FPXA 3HEIB 1BEXA 2PPEA 4DPAX 1A65A 1NWOA 4UF7C 3T6VA 2OV0A 3X1BA 1L9SA 2BW4A 2WSDA 3RYMA 4A2GA 1JXDA 2H5UA 2YXVA 1ZDSA 2DV6A 3QQXA 1ASOA 2PCYA 3ABKB 4BXSV 1RZQA 2UXVA 2BWDA 3HB3B 3PAZA 1AZRA 4Q89A 3FU7A 3IN0A 4DP9X 3PPSA 2W8CA 4F2FA 3FU7B 4BWWA 1OF0A 2TSBA 2FQEA 3FT0A 2BO0A 4G72B 5I28A 3T6WA 2X88A 5D4JA 4BWUA 1ETJA 2DY2A 1A4AA 2YAPA 1W8EA 5TK4A 1V55B 1XB6A 3X2QB 4ENZA 4QLWA 3ABGA 2BP8B 1AZCA 1IC0A 3UGEA 3V9CA 3CZUB 3G5WA 3KW7A 1ZIBA 2CAKA 2NRDA 5I6NA 3AY2A 1FFTB 2JKWA 1L9OA 2CCWA 1PZCA 2CBPA 3SBPA 2XV0A 3CDZB 1MDAA 2UX6A 4YSCA 1SDDA 3PAVA 1ZV2A 5AKRA 1L9PA 3PAUA 3FSVA 4G7RB 1AS8A 1CUOA 2AVFA 3FQ2A 3H4FA 3CVCA 2FQDA 4E9VA 4JKNA 2IDQA 3EF4A 2IWFA 4A2DA 1DYZA 2EINB 3OMAB 3DTUB 4HZ1A 1AACA 1MZYA 1IBYA 3WNIA 2I7OA 3BQVA 3NSDA 4HCIA 3X1NA 3SBRA 1WA0X 4A2EA 4M4RB 2JXMA 4FA7B 4AKQA 1KDJA 3AG4B 2FT7A 1ASPA 2GB2A 3PXLA 1HAUA 6PAZA 1WS7A 2IAAC 1TU2A 5B7EA 3SBQA 3ZBMA 5LDUA 4EF3A 3UABA 3FU8A 2IWKA 1OCRB 1AZBA 1ET7A 2BP0A 3IN2A 1XB8A 2DYRB 2ZWNA 1HAWA 4CSZA 1AG6A 2WO2B 2YXWA 1AAJA 3NJMA 4UANA 3ZDWA 1PLBA 4BWTA 5I6OA 1JZJA 1KCWA 3OMNB 4M3HA 5B1BB 1BQRA 2AANA 2XLLA 3NSYA 4AZUA 1J9RA 4P5RA 4YSAA 4DP1X 4A2FA 2FT8A 4K9JA 4KO7A 1GW0A 3EH3B 1NIDA 1PZAA 4GP8B 1SNRA 5FC9A 3S3DB 1BYOA 1DZ0A 4HAKA 2EILB 1JZGA 2OCCB 1KYAA 4YSTA 4DP6X 8PAZA 1ET8A 1J5CA 2B3IA 3FYIB 4G70B 4YVNA 1YLBB 5F7BA 1M9WA 3AZUA 4BDVA 3NJIA 1ADWA 2H3XC 4AKPA 1A4CA 1TKWA 2VM4A 2ZONA 3NJGA 1NIEA 3WNJA 4HHGA 3AW5A 3FS9A 4KO6A 1NIAA 5E9NA 1WA1X 2HX9A 3FU9A 4DP0X 1PNDA 1WAEA 1AZNA 3JTBA 4N8UA 1PNCA 3IE9A 1GS6X 4HALA 1OE1A 5AFAA 3EHBB 1GS7A 1L9RA 4DPBX 2PPDA 3DKHA 2QPEB 1CYXA 2GIMA 4YSOA 1IBZA 1ILUA 2FQGA 3S8FB 1BYPA 4AI7A 2XX0A 3TA4D 3ABLB 2N0MA 3ASNB 4Q8BA 3T9WA 1FWXA 3CG8A 4DP4X 1NDTA 1ILSA 4A67A 1AZUA 1JXFA 4E9QA 4YSPA 3UADA 2VSKB 4E9TA 2YQBA 3FQ1A 3T6XA 1EHKB 1ASQA 3NP3A 3NT0A 3UAAA 4A66A 5PAZA 1KBVA 4YSQA 4A2HA 3QJUB 3WKQA 1AANA 4YL4A 1MG3C 5F7AA 2BWIA 1A3ZA 3PLYA 1NIBA 2PCFA 1JXGA 1PMYA 2ZOOA 4E9XA 3NP4A 4GP5B 4AKOA 3OMIB 2Y69B 1JZHA 4PAZA 3T71A 2VM3A 5IY5B 3GXUB 3EH4B 5A7EA 1JVLA 2QDWA 3NSFA 1N68A 4DP5X 3N55A 3S3BB 1SDDB 2WO3B 3TASA 4G71B 2P80A 1SFDA 3BVDB 4E9YA 1KGYE 3AG3B 2H47C 1CYWA 3X1GA 5EHFA 5I5MA 4W9ZA 1RCYA 3NJFA 3ZX1A 2HXAA 2FTAA 2UXTA 2W88A 3U25A 2GHZA 2UX7A 5B7FA 1CURA 1OCZB 1NPNA 2J5WA 1E5YA 2X87A 1NPJA 1SFHA 1RKRA 4JHUA 3QJSB 1ID2A 1OOWA 2PP9A 5I5JA 3MX0B 1JZIA 1PY0A 5I5IA 1KDIA 1QLEB 2IH8A 3WIAA 1SJMA 1TEFA 4GY4A 1V10A 4E9WA 1X9RA 2GC4C 1SF5A 3NSCA 1E5ZA 3JT2A 4NERA 1AR1B 5B7MA 1BXUA 4YVUA 2XVBA 1M56B 3H4HA 2XX1A 1F56A 3QJQB 2JFCA 1ET5A 1B3IA 2IWEA 4AX3A 4KNSA 2P80D 2YAOA 1GYCA 1OE2A 2FJSA 1PLCA 2XUWA 1AG0A 2J55A 4F2EA 1AQ8A 2EIMB 3QPKA 2HZHA 4GXFA 7PCYA 1PLAA 3AG1B 3SQRA 2CUAA 3S3CB 4KOBA 4BK5C 2BW5A 1QNIA 5PCYA 6PCYA 2YARA 3CVBA 3EH5B 1R1CA 1QHQA 2QDVA 3ABMB 2XXFA 3OD3A 1KCBA 1BAWA 2XV3A 1OV8A 2YAEA 3S8GB 3FYEB 4MFHA 5ANHA 5TK2A 2YAMA 1JVOA 5B1AB 1FA4A 3OQRA 1BXVA 1E30A 5B3SB 1SHWA 2FT6A 1X9UA 4YSDA 3QJTB 2BZ7A 3KW8A 2I7SA 2Q9OA 3FSZA 1MG2C 2HX8A 3UACA 2ZXWB 1SF3A 2HLEB 4HIPA 2J57A 1AIZA 3NYKA 2XYBA 2DWSA 4F7KA 4DP8X 2QPDB 1OE3A 1BXAA 2QT6A 1A8ZA 1KBWA 3NJJA 1I53A 3PCYA 3QJVB 2GBAA 1CC3A 3N2JA 4HHWA 3C75A 2PP7A 3WG7B 5D4HA 2RACA 1JZEA 2MRYA 3CDZA 3WKPA 3UAEA 2R7EB 2BHFA 2VN3A 1BQ5A 2IDSA 4CSPA 4ZK8A 2FQFA 1GSKA 4JHVA 4A68A 4X4KA 1L9TA 4GP4B 2XXGA 1OCCB 1M57B 4YSRA 5B1JA 1XMEB 4P5SA 2CALA 3TBBA 2EIKB 1JZFA 4GYBA 1ZPUA 1E65A 2E86A 4DP2X 4KOCA 1T5KA 1J9QA 1UATA 1WA2X 1XB3A 4TXVB 4W1TA 1TEGA 3ZIYA 3GDCA 4N4YB 2UXFA 2DYSB 2I85A 4BDVB 1KV7A 1GS8A 2AZUA 3CVDA 2PP8A 3X1FA 4KO5A 2VSMB 1IKOP 2AFNA 5D4IA 2GSMB 2MTAA 2XU9A 2VW7A 4E9RA 1PZBA 1PAZA 1J9SA 1GY1A 7PAZA 2HRGA 3TU6A 4DPCX 1RZPA 4UAHA 3NJHA 2HX7A 1NINA 3L45A 1MZZA 1URIA 3V9EA 3NJLA 2Y1AA 4RH4A 1AOZA 4WTQA 2IDUA 1SHXA 2FWLB 2LLNA 2FNWA 3GYRA 1HFUA 3FPYA 5I6LA 1L9QA 2GI0A 1ZIAA 2HRHA 2VMJA 2CJ3A 3H56A 1PCSA 2VW6A 3QJRB 5I6KA 4HCGA 3OM3B 3T6ZA 3TBCA 1WS8A 2XV2A 3WI9A 2BP8A 1A4BA 3FSWA 4KNUA 4WKXA 2B08A 1NWPA 4YSEA 5I26A 3FSAA 4KNTA 2BZCA 1N70A 1W6WA 4PCYA 2XWZA 4G7QB 1NZRA 3MBWB 4YSSA 2R7EA 4G7SB 3D12B 2TSAA 1IUZA 3DIVA 2YAHA 2PPFA 4YSUA 1PF3A 2OJ1A 4L0PB 3IEAA 5I6PA 4DP7X 1J5DA 4FAAB 3X1EA 1VLXA 1GY2A
chains in the Genus database with same CATH superfamily
3PGCB 4KO9A 3HHRB 4XNZB 1IC5H 1MHCA 1R3LA 3ZQXA 2NY5C 4NWUL 4U1HA 3STZA 4YXLL 4KVNL 5I1LB 2VQ1A 3A5VA 3L3OA 5KYNA 3K2KA 4P2CG 4FFWD 3BGMA 2NY5H 5ISZD 2DWDB 3K5SA 3IBOA 4NP9A 4XNXL 1GR7A 3WDJA 1DQQB 3L9EA 5B1JC 3WJMA 3L54A 4A63A 2IGLA 3F7LA 3TJEH 3QPXH 5AB0A 5J1TC 5AVTB 3MSPA 3P11L 4BM7A 4V2CB 4DT2A 1X7QA 2BVTA 1X5GA 3O6LH 2J8UB 1HHJB 1IAOA 1CGYA 3UGXA 2P48B 2BS9A 1LK3L 3FUHA 1EXUA 2FJGB 1MFDL 4WUKH 3SDDC 5I75B 1LQBC 2ZP0T 1S7TB 2NLJB 4KJQD 4C56A 4YZFF 1D7CA 4S1DD 5BO0D 3GTTA 4QYAA 5CGBA 3CSTA 1J9TA 2VOTA 3V7MA 4M7JL 3DLQR 3ARDB 3P9MB 5DZJA 1RH8A 1FAKT 2XZCL 2AQTA 4TVPH 1MRDL 4FLQA 1IGIL 1AQKL 1JXDA 2V4LA 1DJSA 3L81A 2O30A 5J12C 3SJVB 3HS9A 3AM8C 2ZTBA 2FD6L 4OIIH 1RSYA 5GRZA 1BBJB 1DBJH 1WZ1H 3IN0A 4TLSA 2AVGA 4HIQA 1P4IH 1MNNA 3MLWH 3REVB 1OF0A 3C5SA 3DNKA 3WN6A 5B3JF 4TSCL 2J44A 3HG1B 3NRQA 4XMWA 2ZNXA 5I28A 4WNQA 2ADIA 1S3RA 2G3ZA 3A4FA 1G9EA 2Z0UA 2IALB 3LHAA 4JM2C 4MBRA 4BZ2H 5D8JH 3BP7A 1GIGL 3Q3GB 1FGNL 1UOVA 2JKSA 2CCVA 3J27A 3EZJB 1W8EA 1JV5B 2VXUH 2XRAL 1E8WA 3I3BA 4JAMB 4UI2A 5TK4A 4QLWA 4YFLI 3UGEA 3OJ2C 1CG9B 3MGOA 2GUYA 2P49B 2E9WA 4LHQB 3HR6A 1LWRA 4ZX3A 4GFTB 4MMXC 5DHVA 3QUYC 4NQCB 4JFUA 1FLRL 1LEGA 1LD9B 4XNBA 3CDZB 5EZPA 1YNLH 4I0PB 5HVFB 5BV7H 5I66A 1EDHA 2ITCA 2O5YH 4Q9BA 1DCLA 4L9DA 1QZ1A 3FCUB 1J8HE 5SWQA 5KUMA 1IAII 2FHFA 3DX9A 4MTMA 2EO7A 3C2AH 4JDVA 4ZMOA 2VQUA 1LTXA 1EJ6A 5JLZB 1NC2D 3E7JA 1NBZA 3U79A 2OTWB 3PNWA 3BQVA 4S1RH 4OV5A 2OMUA 4J3SA 3LQMA 3QEUB 4PP2A 5L2KB 1BFOB 5LNGA 3RVXC 1PG7L 1ASPA 4IKLA 4P9HH 3V4PB 3DMMC 3RWCB 4U6TA 3RILA 1JVKA 3KWWB 4K3JH 2AI0L 3P2DA 2EDTA 5LQBL 2IAAC 1BFVH 5CZVH 2IBZX 3T0XA 3QI9C 1K2DA 3CSPA 1NEZA 2CNYA 1BZ7B 3UTSA 3CN1A 2NY1D 4QPEA 1NC2A 1HAWA 3QRBA 4GIPD 1CJYA 3CXHK 4K94L 5DEFA 5DS1A 5DWUL 5DJCA 4RMRA 3TFKC 2NY6D 1QTSA 5KS9E 1HHJA 4M3HA 4PRIE 5M94B 3HN8A 4ZFOA 1HYRC 5HDLA 3O6FB 4MNQD 4WV1B 2JI2A 2IFGA 1KPUA 4B60A 5L2KE 1J9RA 4WK0B 1QKZL 4D2NA 2YFNA 2ODIA 1TO4A 3HFFA 1LJMA 3SKOA 5IMLB 1T04B 3VCLA 1MW0A 4HAGA 2B1HH 3FB6B 3WLWC 4KKCD 3ZTCC 1DZ0A 4HAKA 5HHOE 4Z78B 4G80B 4N22A 4WY7H 3GPSA 2XBTA 2OCCB 1ET8A 4JY5H 5DUPH 3LQAC 1RK1A 3GMOA 1CD1B 3LRSB 1RJLA 3P9WB 4IKJA 4G6FD 4AT6B 1CLYH 3ZUNC 2V2WA 3L7EB 4AQOA 1OGSA 2TRHA 4MAYC 3H2WA 5F88B 5HVHB 3EO9H 4L1BA 4LPYA 1IIKA 2D7MA 1QFWI 3PFUA 5GRJH 4JGNA 2C7UA 3MV8A 4XNAA 5DHDA 3P02A 1I1FB 4X4YA 2WWOA 3G5XA 3PS6A 1OARH 4FDWA 3ARQA 1UENA 4XPAL 1UZ8A 4ZFFB 5FM4A 5CCKL 1PD1A 3O45B 3FU9A 3QEHA 3MLXH 5AG9A 2GPZA 3F7VA 3B4NA 1F2XK 1AZNA 1F4WL 4N8UA 4YDIH 5FO2A 3RDTA 5CD5C 1F90H 4NT6A 2XIDA 4HALA 4QHNB 2GY5A 4EZKA 4KTDL 1JAEA 4PJ9D 3VH8A 5I1AB 3TA4D 3KWTA 5DK0A 1FV1B 2HKFH 5E6IC 5IW6A 4A67A 1A14L 1YAZA 3KLAB 4KMTL 3O6MH 1GAFH 1NJ9B 4KQ3L 2Y3NA 4P57B 4RIRA 3FTGB 5IESL 3IFPB 3NT0A 1ZTXH 1A2YB 3NABL 4LLUB 4TNGA 1AMYA 3UAJD 3PLYA 3FQTA 1BW8A 1MWAH 3LQZB 3BH9B 2WNXA 4OZFB 2OKMA 1PMYA 4M7KL 2W65B 4AV4A 2CXKA 3EGSA 4AIEA 5L2JA 4HIIA 2TRYA 3L3JB 3KR3H 1SLUA 4J12A 2WYIA 2J8HA 2XWEA 4XP5H 1VFMA 3CN3A 1XCTA 5L4FA 4UM8B 5T3ZH 3O2WH 3QP3A 2WO3B 4P04A 2NY0D 3WFCH 2I9LA 4U1IA 4G9FA 4OUOA 2YOCA 3WXVL 2AV7A 4HFUH 2K6WA 3QA3A 3S88L 1J5OH 4JG0H 4W9ZA 2MWCA 3ZX1A 1CFBA 3MRBB 4PTUB 5E9DB 2NY1C 3EJTA 3S35X 2CXGA 4J7RA 1T5XB 2VJ8A 4R97B 1J1XH 4P23A 3V5KB 5C0FA 3QJSB 3ULSB 3VWKC 2FZ3A 4UM9B 1WFTA 5J9PB 5CBAA 2HG5B 1Y1DA 2XNAB 1IEAA 4N8PA 5D4QA 4NBYB 1LP9A 2K8QA 3F65A 3L1FA 4OQTL 1KLFA 2CCLA 1U93B 2NX5E 1NCNA 1F1GA 4X6DA 3Q8FA 2EDYA 4A7VA 3QCVL 2HUEA 2DYPB 4HV8B 3WJLC 4J1UB 1D9KD 1RULL 2OMZB 1G7JA 1S5HB 1GYCA 1L3WA 1YMME 3WFDL 5CIPA 4P59H 2FIKB 1OGTB 5K9QG 1V3KA 1TR7A 1F4YL 4H13C 2WPGA 1RIHH 1B6DA 5E1HB 5CBEB 1PL3A 2MKLC 4XC1L 3CVBA 5GGUA 1YEFH 1W80A 5F7YC 1H3UA 3ZDZE 2XXFA 1DL7H 2QFPA 3OD3A 1Z9OA 4QWWD 1GTNA 2Z93A 3L95A 1KCBA 1SBSL 2Y1YA 1A6PA 5K1NA 3UCQA 3FO9B 3ILPB 4WI5A 5BJTB 4R2GB 2J4WL 5CWSA 4ZW5A 4M4RA 1XSOA 1ZA6A 3HNTH 4LLYA 3QJTB 4A7QA 2FX8H 4Q9QH 1OQOA 4N1EA 1X9QA 2P5WD 2ZF9A 4JJOA 2HX8A 4ETQA 2CHXA 4HU8A 4F8LA 5IROD 1LEKB 2PN5A 4YHYC 4XPFH 1CLZL 12E8H 4KY1L 5I2IA 2X9XA 5JW4Q 3T04D 5J4MA 1CDUA 1X9LA 2VDNH 2XQ0A 1KIRB 4JANB 4LDEB 5JIHA 2V2TA 1KB5A 4HC1H 4MD4B 3TPUB 1RUPH 4FP8H 2IAND 3NZ8A 4LCWE 3UO1H 2A7BA 3P54A 4RGNB 2VN3A 3ZHKA 4BQ8A 3HZ3A 4N2FA 1BQ5A 2FATL 5I82A 1ZHBB 1Q72L 4KTEL 1TSHA 4N3UA 4X7TA 4TSAL 5INCA 4B3EA 5HBBA 3H42L 3FQWB 4GRLD 1GZHA 4JHVA 1TU2B 5DRWB 1UASA 1QLEH 4E41A 3P77A 3TN0B 1M42A 3E80A 3G6AB 3HPLB 3VI4B 1JPTH 4TN9A 5LAXB 1K5NB 3PWLA 3ILEA 2WNKA 2DIAA 3FRPB 1KPRA 2CALA 3IDXL 1X5HA 2ZX9A 3PPEA 1DDHA 2BSSA 3ZMEA 1UATA 3HAEG 5IG7A 4AYGA 3OG6B 4OZIA 2GJZB 5I0WA 1RK0A 2WQ8A 3P3TA 2OMYA 1PLGL 4GG8B 3EYVA 1HE7A 3MJ9H 3NZSA 4WJ5B 3QDGB 3AT9A 4ZFZA 4C54A 4PJ7F 3T0VA 4JKMA 3GJEA 5I1KL 5IOKA 1XF5B 1HCZA 2VCOA 3QUMH 1Q38A 1WAAE 1XEDA 3M1OA 1LP9B 4X6CA 4NN6B 3G04A 1FFPB 1MOEA 4PJFE 3SKNB 1FGVH 4YE4L 1DLHB 1N64L 2FDBP 3GSVA 4NQXB 3MA7B 4NWTH 4QMEA 4GSDL 4ZUTB 4H2AA 2QELA 4FQXB 5FYKH 5TJWK 1WIUA 4Y0GA 4RNRB 3O2DA 4U4IA 1KJ3H 4PJAB 4XMKL 2PXYD 1SDAB 4ONOA 3K2MC 4PBDA 4RH4A 1HXYB 1L7TH 1CGVA 1S5HA 1AOZA 2GSIB 4LL9A 2YOAA 3MI6A 4IIQC 4OLZH 5DXWA 1PKQA 1MIMH 2DQEL 3MFFA 4RFOH 1BVNP 4TTDD 4BSJA 5TE7H 4GKSA 3ARBA 2VLKE 2A4CA 2V5YA 3CC1A 1MPAL 4OF5A 1ZIAA 1F6AB 4G42B 3BUYB 3QYCA 2IGFL 5DD3L 4AM0Q 3GSWB 3T4AA 1T4KB 3NH7H 2OLDA 5KVMC 1A4BA 4V1DB 3FSWA 4K2UH 2B08A 4IGBB 1ROCA 4GI8A 4Y2NA 1HHHA 4CBPA 3D85A 3H54A 4KNTA 3WIFA 3SKMB 5EU6D 2V5SA 2HG0A 4A6YH 4U7KA 1LO0H 3UGUA 4ZUSB 2ZUTA 1FDLH 3V52L 2KYIA 2KLSA 1INEH 3O6FD 4DP7X 1FL3B 1QBMH 1RZGA 1AHMA 4D9LL 1AGBA 4XP4L 4D8PB 3B56A 1IVLA 3CD4A 1PYWA 1TQCC 3LZFH 4P2QE 5AVZB 3TO4A 5J13C 5JPNB 2EDKA 1NBYB 3AFLA 43C9A 5EZOL 1HNGA 1Z9SA 2NPLX 2X3BA 1CFMA 1YPZE 2V2TB 1CTNA 4B96A 4CKVX 2YA1A 1ADQA 2MPVA 2P5EA 2YUVA 3UZVB 3D0VB 1ZANL 2XOTA 5JOFB 2BIIA 4X2UA 4XTRC 3NRPA 3UXFA 2NY0B 3N1PC 1V05A 4M1DH 4UINH 4GBXB 4XOCA 3C60C 4HCFA 2WXGA 4M62H 1A4KA 3UTQA 3H3KA 5FW6A 4BXVA 3Q0HA 5B1CA 4HS6A 3VI4E 3KMDA 2WUCL 3HLAB 3RWGB 4N28A 3MUZ1 4QRQB 2ESVE 4M6AA 4L9LC 2IVFC 5ERWB 2MOGA 3GMOB 3BP4A 4FEMA 4N1CA 4U1JA 4OZIB 3UPAA 1BQKA 1NUFA 3ASWA 3ZE2F 1WC7B 2CUMA 4QKTA 3ECVA 5C0CE 4JPKH 4AIZB 2IPTL 3D4ZA 4EI5A 1MI5A 1N10A 2PPEA 4H8HA 4X0KB 1MH5A 5EB9A 3WO4B 4BCXA 1L9SA 2R29L 4GW4B 5IVXA 2GBTA 5CEYB 1RJYA 3RKPA 1ZGLA 4E68A 2H5UA 4F2MB 1ZGLP 1ZDSA 2KL6A 4YL9A 5IK3B 5IB1A 3TZVC 4JO1H 5DK2B 1CTMA 3U36A 3DHJA 4F37F 3UG3A 1YN6A 3TBSA 4KH9A 1ZTXE 1J8SA 2ZXQA 2FSEA 1U8IA 4X9IA 5HDOA 1JWMB 2A83A 4XOEA 3PP3H 3G6JB 2CDEA 3HG5A 1IQWL 4EXKA 2WO4A 2DLHA 4RDBA 1F02I 4XO3A 4PJBE 5DMGD 1JV5A 2WIIB 2D3LA 2FJFB 3U4EB 4JN1H 4ENZA 1P4BH 1SZNA 3QISA 2OSYA 1C5DA 3NA9L 5D96C 1U3HA 3BSZL 4YK4B 2ESVD 2Y7QB 3L9BA 5F1KC 3SDXB 3IRPX 5I6NA 4TVSa 3P0VL 3KXFB 1QFUH 4K5OA 3N44F 2XV0A 3EJRA 4NQDD 2YMXL 3CMOL 5EZLB 3FCGA 5SWQB 1IAKA 2F54D 1PSKH 2E9BA 3GO1L 4YSCA 1SJEA 3VWKD 3FFCE 5MEQA 1E6JH 3FSVA 2P7TB 1KXQE 1MIEL 5J6GB 1AD9B 1T22B 1EFXA 5T5NF 3D33A 2E7LC 4XPTH 4ALAL 2UY7B 2CO3A 1FZJB 2BSBA 4TNVK 3VWKA 2VQ1B 3L3OB 5E2VH 2Q10A 4GRWB 2GB2A 3CAFA 2HSIA 1FSKC 5DT1H 4NQTA 4ZNEA 1HH9B 4WK2B 1B4TA 4A2MA 3HN5A 5ID1B 5HHQB 4NQVA 4PV9A 3LKRB 2V7NB 3IETA 3PWVB 1T0NB 5B4MC 4EIZC 3EGDB 1YVLA 1MCRA 1NFDE 4BH8B 2XJKA 2R29A 2BVQB 3ZO9A 2BY2A 4CSZA 3VNZA 2C9RA 3U46B 1T0OA 4NQSA 1JZJA 1HL4A 3D7PA 3OMNB 3BIBX 1YEHL 3DVNB 4PJ8B 5FO7A 5ETUA 3OHXB 2D7TL 1XCQB 3QT2A 5DD5L 1LMIA 1E3FA 4QXGH 1N0LA 4ELME 1ZV5A 2E3VA 1BZ9B 5HY9B 2I27N 4A2FA 3VXSA 2ZXCA 2AV1A 1XGTA 1WC7A 4NSKA 1UM5H 2OL3H 3KLQA 2QZ5A 1SNRA 5FC9A 5FYKE 2C3VB 1URZA 4CJ0A 3MC0A 4G9DA 4HX1B 1SOXA 2AXJA 5EFIB 2XACC 2W1NA 4QRRE 1OAQH 1OSZA 3MCG1 5K9KA 2NXYC 1P2CA 5J0BA 4O4YH 7CGTA 2WVVB 1TTCA 4QRSB 4Y5YC 1JDAA 3SQOH 1M9WA 1RHFA 3VM5A 4BDVA 2FSDA 3HZVA 1OAXH 4Y4HB 3FQXB 1YYLL 4TRPH 5FV1L 4UMSA 4N0UB 1YEKH 4OZHB 4W6YB 4X98A 1HINH 3RKDD 4NN7B 3U1PA 3O45A 4JMNA 2AJVH 1TITA 1GTFA 1ACYH 1B4JL 3SE4A 4ZS7L 4D7BA 1ID5I 2WXMA 3BP7B 1PNDA 3ALPA 2ATPA 4O2CA 4PWJA 1BZ8A 3JTBA 5A7BA 2DTMH 4PJBB 3BKYL 5JIDA 4YDKH 2AP2A 4OM0L 5ESVA 1BAGA 4ISVA 5HHME 1F6LL 2EUWA 3F7PC 5CKGA 1UWYA 1R3JB 1BYPA 4PJAF 5ANMA 3F62A 3APNA 1VGEH 3CZFA 4XWOD 5KVGE 2CPCA 1Z7JA 4YXKH 2NUTA 1F58H 2R15A 4FQ1L 4OCSL 3S8WA 1A4JA 1CXFA 4KROC 5EZLA 4APQC 3UIZA 1BVKB 4FGMA 1XAUA 3ATDA 2OTUA 4CN4A 2BJML 4PY8J 5CJ5A 4FLHA 4ZMZA 4BKLA 3DGGA 1HNFA 3GSOA 3LZQA 4YHZL 5DMJB 4UMGA 1AR2A 2DIEA 2NNFA 4WW2C 3QC5X 1KGCE 4IJTA 1JXGA 2H3KA 3DVFA 4RSYA 1F5WA 5GPRA 3QEUA 4MB3A 4PP2B 4BFFA 5IVXF 3QG6B 2FECI 4MHHG 2F7IA 1JZHA 4DN3L 2QJDA 3CK0H 2VM3A 3FT2B 4LSVH 1BVNT 2G60H 2VJ0A 1C7TA 3GMNB 4ICWA 1JVLA 1MVYA 3ROLB 4DP5X 3M45A 5HGDB 2R2EB 3GJFK 3QFGA 2I9LB 4U1IB 5CS7A 1LDPL 1QZNA 1RAMA 1KLUA 5ISZB 4NOFA 5K1VA 5FF6B 2QGBA 3RVWD 1SFDA 4G5AA 4FULA 3SE8L 4YDVB 2GFBA 3HE6C 5HJBA 4KU1A 1DFBH 4CGUB 3L3HA 1Z9LA 2FR4B 3QZNA 5BOJA 3KJ6L 3PHOA 5DC9B 1TVDA 2A6IA 5E08H 1XWVA 4QRBA 1FHNA 4O58L 1ZVYA 3V5KA 2HFFA 1MCOH 4NCC1 5BUGA 3LRKA 2CJUH 2J6WA 1ZJBA 4IEFB 3US0A 5EU4A 1KIPA 3TC9A 2C4FT 4F93B 1S7VA 1N0LB 3RIFK 3VFNA 4M7LT 1DJYA 2NTFB 4E41B 2LTQC 5FOBB 2IH8A 1CL7I 3L3GB 4IRSD 5E6ZA 1SJMA 5BS0A 3HE7D 4W9LC 1S9XA 5J13B 5A2AA 5KJ4A 5J6SA 3NSCA 3I6KA 4XP9L 4F58L 2ZCLH 2CD0A 3G5YA 1TENA 3PJSB 3L9YA 1LO4L 5DD6B 1G7IB 3HUJE 1KWGA 1KTBA 4JFFB 3GIVA 2P52A 3MNWB 2XVLA 2IWEA 4PRIA 2HFEA 2DH3A 1OE2A 1A1NA 3IDYB 4TULH 2EIMB 5DYFA 5GRWA 1ZA3A 5CMAB 2F53A 1DBAL 4Q6KA 4CSSA 3AS1A 4WHYH 2CLZA 5DHVH 4IRSA 2EXYC 5T3XE 2IXQB 1CXEA 3KPQB 2ZXEB 2F7PA 5ICXA 1M7IB 2R0ZH 2VDNB 1VADB 3BKJL 1IE4A 4UNTA 1KXVA 3NG5A 2AEIT 3WJJA 2QDVA 3CXFA 3TZVB 1A1OB 5JDSB 2GAZA 1II4E 2P9RA 5G5DB 1EJOL 1A6VH 1AGBB 1AXSB 3MOAH 4PRID 5BZWB 2K45A 2VR5A 1Z5HA 4PHXA 4LPXA 2ADFH 4JJ5A 3TCLA 3VRJA 2E7HA 2VH5L 2VLJB 3VXMD 3N1GC 4X7SL 2XICA 1DUYB 3RB7A 1X9UA 3K6SB 5D1QA 2ETWA 5CINH 4E5XB 3IJ8A 3QEGL 4I48A 4K8RL 4YHPB 1SF3A 3WN5B 2P8MA 1E9OB 1BVKA 1QA9A 1UCBH 2DQFA 1ZXKA 3A4AA 1G7MB 2QPDB 1JGEB 5CD3B 4LSRH 1MVUB 1DFXA 1UT9A 1I53A 5DVOA 4MJ2A 4OZGB 5T5NG 1B4RA 2EH8H 4PRPA 5DGRA 5DQ9B 2YLKA 5E23A 3QXDA 3SDDA 2P5WE 4KUCF 4NN5B 4X50A 3HC3H 3E1F1 1GOGA 4KI5D 4U1GB 1NOAA 1EH9A 3QPQD 4XGZB 4AG4L 1T2QL 3HMXL 3M8OH 2N59A 2AGJL 4MDJB 5JPMB 3PWPB 4ZDHB 4BUGA 1X4YA 1JP5A 2DQDH 3SQBB 3OKKA 1XAKA 3JBG7 1UHVA 2VZ1A 4LXFA 3ARTA 2B4CC 5GSVB 2YD9A 2WLLA 4OGXH 3MV9B 4PJXA 4MJIB 2VLMD 3AGWA 3IMUA 1TCRA 1FF5A 3LEYL 2ITFA 1QSFB 2B2XH 4RDQG 4PIBA 5LGJA 1FH2A 5L8LB 3BP5B 2CJTA 4I85A 4FXKB 3WUWG 2FYYA 2PP8A 4NZFA 1HL9A 1IMHC 1AXTL 2AFNA 5IB5A 5D4IA 3ZYJA 4G9FE 4AYEC 5DC4B 1TPXC 1JGLL 3ARGB 3QQNA 2LV4A 3H9ZA 4FFZL 5EULV 5D2NE 3OHXC 1PZBA 3VE0A 1G9MH 2VITA 4HJGB 1UZ6F 2P8LB 3LOWA 3TU6A 4J8RB 4WJG3 4N20A 1JF1B 1YMMB 1QFPA 2HX7A 4JFFE 5C6WH 1AGEB 1JPFA 1LO3L 5D2LA 5FGCB 5B38B 5I17B 1EK3A 1OTTD 2L7JA 4PVNA 5I23A 2Y1AA 3EG9B 2OW7A 3NK3A 4G6JL 4U4BA 3WUWB 5CLTA 3FTVA 3M07A 4KVCL 4M7ZB 1WFMA 4ADIA 3KJ4C 1NFIB 2RB8A 4JZOA 4ONHA 1CFQA 4LEBA 4EUPB 1D7FA 3INOA 2GI0A 2OXHA 5DHYA 3RWHA 2NX5A 4Z5RA 3TA3D 1CCZA 3RWIB 3ZSTA 3IF1A 5EPMB 2VW6A 1E28B 4WRLA 2JJWA 4XNYH 1A7OL 2X6VA 2Y7SA 3L4ZA 1L7IL 3INUH 2E6JA 4ZOAA 5TDOB 5DJ6B 5EORH 2YQ2A 1NAMA 2UYLA 2ZXDA 1FC1A 4UNUA 2QVFB 4MMXB 4F20A 1IO4C 4GT7A 1VKXA 3H9YA 3IU4L 4JCMA 3PWJA 2NZ1A 4PJIB 2GJ6E 1SHMA 5IB4A 4KITB 1KG0B 1S9VA 4WK4B 3H7LA 1NOFA 4LSUL 1QSVA 1R3IL 3DSFL 2ENYA 1GY2A 3LS4H 1IC1A 1KCLA 3EJPA 4Y4HC 2YPKB 4HMDA 3JWDC 2H3NB 3FL7A 2D7OA 2MH4A 3LH9A 4RMBA 4DK6A 3RFZA 1NMCB 1ORSB 3VG0H 1GMEA 5IMKB 2PCXA 4C56E 5JOFA 3FQYA 2Y1ZA 3I2CL 4BUHA 1OAUH 4PJCF 3ZE2B 4X7CC 4E9LA 3DX8B 3V4VH 2MCPH 3VGAC 4Z76A 3A67H 1DEDA 2YAFA 2X4RA 2XWDA 5JPMA 1KPRB 3HC4H 4HWZB 4Y19A 1JGDA 3TBYB 1NCCL 1UA6H 4LKCB 1AC0A 3IFOB 2F1AA 5I76A 5KS9A 1RZKC 4UZGA 3CVIL 4EQ2A 2DQGH 2HCZX 2XPGB 3RWFB 1RU9L 1K8DA 4JRYA 2WBKA 3DXAD 3CSYA 5KYUB 2Z9TA 3MZGB 3K4DA 4HBQA 3QDMB 2IDTA 3KWUA 4EIUA 5D1ZB 1OGAD 2OQJB 4ILDA 5K1JA 2F9BT 4KRPD 3FHEA 2YEQA 5EF2A 4X0KA 1X7TA 2ZCKL 2K0RA 4MJ6B 4PJ9C 4MCNA 5MEND 3IJEB 3RX9A 3IGLA 2ATPB 1NCWL 1A66A 2XPZA 5CGTA 5ADOL 4B95C 4HVBA 2JKJA 4HJEA 3ELQA 5E8DL 4PJHF 2C3HA 5ADPH 1BM3H 3CXHJ 4D0BA 4NUGH 5D93C 1CXKA 3W0WE 5AZ2L 1PQZA 1NGWA 3FF7A 3ULVC 1NGQL 1WGVA 4C57C 4PGEB 3MZTA 1WWAX 2F0CA 3LKOB 4PGZA 1U3YA 1D5ZB 1J8HA 2QR0A 1GGIH 4OF6A 5GISH 2VUKA 5JHDE 5I1JL 3DPBA 3F12B 1Q0XL 5DMKB 3W38A 4ICXA 1P9MA 3ZW3A 1A4AA 4CN6A 1E5BA 4MVBC 2DJMA 4HSAC 2C9SA 3QUGA 2BP8B 4XCFH 5KVEL 5DVNA 5CP7A 3SDXA 3N40F 3FQXA 4RQQA 5DJDB 3UZEC 2VXSH 3PDOA 4CKQA 1M7UA 4PEEA 1N8OE 2JKWA 3NA4A 4PCSA 2XN9E 1M1XB 1HEZA 1FN4B 1TZOA 1MDAA 1N5AB 3CHXA 2UX6A 3AAZB 2VDMB 4JQIH 3O41A 2GBVA 4JLRA 1D5RA 5B21A 5BQ7A 2W0FA 1FNEB 3I50L 4KJPC 5B22A 1Q1JH 2IDQA 3JYBA 4TUOB 1F4XH 3BD4A 5CEXB 4G82A 2C7FA 3T0EA 3S0PA 3VM7A 3KPTA 4GSUA 1AACA 3GT6A 2JB5H 4NM8H 4OR1A 5T33H 4OI9A 3V55A 2AJUL 2Y06H 3L9RB 3E0GA 2FX9L 4IBVA 1AD0B 2NY1B 2VABA 5F7DB 4YLBA 5I0ZA 2B1AL 1R3KA 2NZ9D 2IANB 3RLSA 2E7LA 1HAUA 3MXVL 3M1CA 3T6QC 1J0YA 3FH7A 2BM3A 2J7LA 3QDMD 4FFYH 2RJMA 2I9TA 4JDTH 1D9KC 1NSNL 3FBKA 4BH8A 5E8OB 5I15H 2D0FA 5AVSB 3QUXB 1I31A 1Q9KA 3MLZL 3WXWH 5HVWA 2EIZA 1N3NB 3ULUF 3UBGA 1J9CT 2NW3B 3QJXA 3PQYE 3CFBA 1YUHA 4F5CE 3LX9A 1PLBA 2WUBL 3LPWA 1YEWA 3WEAA 5EEWA 1E3ZA 2D4FA 3MNZB 5HY9A 3K1DA 2AANA 5MP6H 2Z35B 3WY1A 3IDUA 4NQDE 3MLYL 1SXBA 3R7RA 1IX2A 3SY0A 2UY6B 4KXAA 4PQXA 5E00A 2NY3D 1NIDA 4XAWH 4AMWA 3EJZD 4FNPA 4P9ML 4RMVA 2AXHA 4QOKB 2IOIA 3STBA 3EF7A 4FA8A 1W0VA 2A4EA 2AMUA 3ESUF 4PWKA 2B14A 1NLDH 1GGYA 4NRZB 1B0GA 2WVVA 3UP1A 4TL5A 4G6MH 1CFVL 4ZUWB 4FQXD 4U1GC 1UM6H 4G70B 4AIOA 4FG6C 4Y16C 3GSNA 4H8UA 5ITFA 1YLBB 1E4JA 1QTYT 4UDTB 3RVUD 3RIKA 1OLLA 2EXSA 3H85A 3NJGA 1KJ2A 3WSQL 1OGTA 1MCWW 4GEIA 3E2HB 2XFGB 5GGVL 1I7ZB 4FQCH 3PRZA 2OMVA 3QEQD 4DP0X 3AS0A 1QLRB 1C12B 3MACH 3QJFB 5HDQL 5GGTH 3EFFB 3I02B 4ZPVA 4N0FA 5T1MA 4MKMA 1GS6X 3X13B 5AB9A 2H4EA 3B7RL 4DPBX 1Q94B 2XFXB 3U1SH 3ZZ1A 2A77H 4OZGA 5AW7B 3REVA 4GEJA 1DBKL 4NENB 4IS6B 1FIGH 2KZ1B 3IVKA 3L2MA 3MRJA 3VFMB 5E24E 1CPUA 4J3BA 4C55A 1MRCH 4ZAKD 3Q9PA 2GJJA 4PJEE 1FN4A 1KIQB 1QNZH 4Y9BA 1BD2B 5EU3A 4PGJA 3W9DA 2BIQA 4WTZA 1F13A 1ODUA 3EAKA 2ZUXA 4LLVA 1W91A 3FKUS 5FYLL 3QQ3A 1OANA 4ODXA 3UPCA 5I9QC 3BC9A 4JFPA 4F92B 3U7YH 4M4PA 4AKOA 4G3YL 4JQIA 4OZIE 3QUYB 4U1LA 4AYBA 1WQVT 2YIHA 4ODVL 5DD0H 3T71A 1KEGL 3QJOA 4PTTB 5A7EA 1WICA 2DKUA 3ZN6A 2QDWA 3S3BB 3K91A 5ICUA 1ZD6A 1R19A 3GSNH 5T1DL 5HGHA 3V7AE 4MNGE 4WI8A 4YO0B 3T2PA 2WKOA 4WI2A 2YJQA 4YHOL 4G80A 4PU2A 1A7QL 2R39A 3ELAT 3GEFA 4F37K 3RURA 4PJIF 2ATKA 2XSKA 4UT9L 1KELH 2XTJD 3DUHA 4ODHH 2VZUA 5C2BH 4ZW8A 2CIIA 3DETC 4B53A 4CC0A 1SEBB 1IBGH 3L5XL 5F88A 4NNPH 1BD2E 1XGZA 2OAAA 1FBIH 3CCHA 3ESVF 4ODTL 4XCYA 3LKNA 4JL1A 1CO1A 4GKNA 4LPVA 4YDZA 4O02L 5AL0A 1TEFA 3RB5A 3HFML 4NERA 4IIQA 2YSSA 1BXUA 2XXCB 2MQ3A 4FJZA 3OC5A 2APWA 3BT2H 3GS7A 2EYTB 4NAMA 5I8EA 4F7TA 1IGJA 1UVQB 3PGFH 1HZKA 2D7NA 4OZHE 1UXWA 3BVNB 5HGAA 4GSRA 1U8LA 2J1XA 5H35A 2CUAA 3CJJA 1NAMB 2BNRA 2UYLB 3DJSA 3BWZA 4MNGB 4OBRA 5FECB 3WMQA 5E6UB 2W9DL 2WK2A 3I84A 4DUVA 2EZ0C 1WPCA 3LIZL 3QFJD 3MRLB 3L7FA 2I25N 3LNDA 3M7OA 4TNVF 2KBGA 4A1RA 4OD3L 1NA8A 1JPSL 3I9GH 2ICCA 2WD0A 2ZE0A 3QQ4B 5JYMA 1HSBB 1W72A 2HVKB 3IDGA 1YG9A 2NW2A 3LQAH 4LIQL 4GT0A 3X3FH 3PQYD 4I0PA 2F5BH 1C1EL 3NPZB 3Q7JA 4LHJB 1SHWA 3EJUA 4P46D 1FL6A 3OAZH 3DUUB 4N25A 2A9NH 3K1KC 4I48B 1RUKH 4B50A 1MG2C 1RZIB 2NY0C 4LCVA 3FUNA 4DVBB 5C92A 2PTTA 4PJ7A 3VSUA 5E2WH 1F8TH 2YBRB 3N1MC 4NIKB 4Y9CA 1KB5H 1B6UA 5DEZA 2NUPA 1OE3A 2VR3A 4KKAC 2E7MA 1KCUH 2VDMH 3W82A 1CE6B 3NJJA 1OB1A 1PYWB 2OR8A 4BJLA 1J87A 2XWXA 5BOZG 3QJHA 5IW6B 4JVWA 2D9CA 3WKPA 1A3QA 1RPUA 4LVHC 1AP2B 4AJYV 1QSFD 1NGYB 1ZOXA 5JW4R 1QVOA 5CSGA 4WU7A 4OKVA 4HT1H 3MRIB 3VYNA 4L1SA 4GP4B 1WZKA 4GBXA 5ILTH 1M57B 3VSQA 2LW3A 4AEHH 2ZCZA 2APFA 3RUGB 4KX8A 4NRYA 2E76C 1JZFA 1KEGH 5FFOA 4ESKA 5GZOD 2E86A 2G9HA 4A7SA 3S98A 4RZCB 2HH0H 5AW4B 5H4YA 1DSYA 2KS0A 1DN0A 2ICWI 4LOUD 2L4OA 2OMZA 5D55A 1UH2A 1M7DA 2RH0A 3IMVA 4G6AC 3U1QA 2WTOA 4WSJA 2YN3A 4LL1A 4R90L 1J05A 1OSPH 2AAAA 4XBPB 2VLKA 1DBKH 1RZFH 3SY6A 4LDOB 3KPLA 4NQEA 5GGUB 2JLPA 1UD5A 2P8LA 3DTXB 4HHAB 3WDIA 1T6WA 2HLAA 2PW2A 7PAZA 1RVFL 1XF4B 2EE6A 3SSGA 4PJ5A 4P2OA 5TH2B 5FDYA 3TFKD 4HWEL 4JGMA 4UAHA 1H3VA 5I1IH 1Y1UA 3ISYA 1BQLL 3LN5B 4G7YH 4LCWB 4H26A 3AROA 4PRNA 4XWOC 1CIDA 4K73A 2OQJA 1SRDA 3GRWL 2VQ4A 2A5UA 4C8XA 4R4BA 3HPJB 4LQFH 4AJ0A 3BEVA 4JZOB 4ONHB 1C16B 3QC6X 4KKBD 4M8UA 1ZLWH 4XCEB 1WZLA 3NIGB 1I1CA 1CICD 1FZMB 4ZSOE 4P46B 4OZ4A 2VMJA 3LZNA 4L5FL 2W0FB 3P40A 3C6LA 2WQRA 3B9VA 3FT1A 4MNQA 5LCVA 1CDBA 1FL5B 1UM6L 5FAAA 1H15B 1WS8A 3CQFA 3DPDA 1MHHA 2XTLA 4HUXB 3SCMA 3D39A 5FB8B 2NCMA 2BZCA 5IF0A 2WB7A 3MBWB 1IT9L 1H5BC 2H9GA 4Q0XH 4DGUA 5BW7A 3WFBL 2WLZA 2FEDD 4M43H 2C8NA 4QNPE 3LD8B 2EO1A 1IBHA 1WUZA 4PCKA 3TT1H 3WYRA 3BH4A 3X1EA 3ESOA 3TXAA 1FG2A 5C0RL 2X41A 2RTTA 2WBJA 1HU8A 3TT3L 4M5ZH 3IXTB 5I8KL 4WI9A 1FYHB 3BDXA 3JV5A 3S9DB 5TF1H 4AEIL 4FQQB 4HDIB 5IG7B 3KLHD 4JG1H 4KUZH 4MA7H 1RK0B 1SLVA 2X4PA 3MLZH 1JNLH 5A6IA 3PF2A 3KWWA 4GKZA 3JVGC 5GGQL 3WU1A 3ZE1B 3ZHDA 3DX8A 4ZUSA 4AV0A 3MGAA 3OXRA 3BEWA 2VQTA 4MLSA 4R7XA 5IJKC 4ETQB 2V9RA 1TQBC 4YHYB 3R1GL 2ZICA 2VM9A 1P6FA 1XX9C 2J56A 2YGVA 2DQUH 3K46A 2GC7C 4OFQA 1AGDA 4QRRA 2VWEE 1P6WA 4HK3J 1N59A 5LBSA 1V7NL 4X99A 1OD7A 2PPAA 3TVMA 4FG0A 4FYQA 1GA2A 1R3HB 1ZJAA 5DJAA 3EADA 1UXSA 2IDFA 1HKLL 3RWDA 2G2RB 4KI1A 1XGTB 1NWOA 3FRPA 3KPSE 4JHWL 3SGKC 2D3VA 2B0SL 2CH8A 3MRDB 4YWGL 1G43A 2J8UF 4N1HB 1XFPA 4XN4A 4H44C 1G7JB 2O6FA 4XCFL 1YMHB 2UXVA 1KT2A 3G6DH 3HB3B 1HIML 1FO0B 1ZE3C 3HR5A 4P5MA 2NXYB 2WW8A 3L4XA 1I9EA 4Y5YB 2K78A 4FQJH 3TEXA 4D0CB 4Z7QE 5JW3L 2V8LA 2Z4TA 5C7XL 25C8L 2B4CL 1U21A 4XCCH 4LOFA 1C16A 4LNVA 3RDTB 3AB0B 2CBOA 4GRWH 4BWUA 3T0DA 1ETJA 5HYFA 1NDMB 4GB9A 5ADPL 2EIEA 1YZZA 4NHUA 4DUWA 5E8DH 4S2SB 5KYYB 4IU3A 1JI1A 4MLIA 3CZUB 3MBEB 3STLB 5KBMA 5TDOA 3UDWC 1F86A 1HI6A 2ZUYA 1H9VA 2EO9A 5JXAL 4ZBJA 2VKXA 2ZCKH 4HUUB 3SKUD 1CBVH 4U0RC 2BSEA 5B8CA 3Q6GL 4LASH 3F58H 2Z31D 2CO6B 3OR6A 2ENPA 2H6PA 3PAVA 5TGBA 2HRPL 3QIUA 2V7HB 3QXUA 1IKFL 3E6HA 4NFDA 3VX0A 5C08A 4IHOB 3EF4A 3QUZA 1JWSA 3V6OE 4GLRH 1JF6A 2A74C 4JB9L 4L8SC 4R4ND 5LBSL 2BNUB 1JZDC 1NLBL 4OLXH 1U9KA 1DBBH 3CC5A 3T3PF 1WA0X 1R3KB 4KHTL 1CICA 2BHYA 5I9QB 5SWSA 4GKLA 3HRZB 4OUUA 3BWUF 3LKPA 4U1HB 3QIWA 15C8H 1JDCA 3A67L 3GI8H 4N9GA 3VXSE 3P77B 1GZPA 5D2NC 2IWKA 2VDRH 1AQDB 4XCYB 2ZNWA 2DYRB 2RMNA 4IRZA 4D8PA 4AZ8B 1O7DE 4U6YA 3K72A 5AW5B 4WJKB 2EABA 2XQBL 3KG5A 5GIRA 4H20H 3WKML 4BELD 1R9FA 3QUYA 1MQKH 4N2GA 1R3IH 1M3JA 1I7RA 3S35H 3U2JA 5IB3B 1QG3A 2KKQA 1P1ZB 2Y1VA 4AENA 4YS4A 1PDKA 2FUTA 3G9VA 1JGVH 3NAAH 3S3JA 3ULUC 4AWJC 1CBVL 5L6YH 1YY8A 2O6EA 2OXGA 2Q7AA 2NXZB 3U82B 4I1PA 1NBVH 3W0WD 5LGKA 2E75C 3QFDA 4XHQA 4X6CB 3ZHNA 2ZWZA 3IJSB 1BYOA 1TTAA 2H2SD 5F7EH 2EILB 3UJIH 1L7IH 3INUL 4XTRD 4B7LA 5ERWA 1EHLH 4L2YA 5D7JD 3FYIB 2WP3T 4WF7A 1JG9A 4RSVA 5GS1A 2NQ3A 3L1GA 4HUKB 4D0BB 3ZTJG 2EACA 3E9TA 3OHMB 1RLWA 5C7XH 2PYEB 3AZUA 4N2AA 4E41D 4LEXH 5F9AC 3NJIA 1ADWA 5H94A 4TUKH 5GS2D 1A7BA 3REWA 5H4ZA 1BBJA 2ZONA 5F9JA 3VXSB 1ADQL 4HC1A 4UUJB 2ZWYA 3NFPA 5D1QE 1YDPB 4F33A 2EYRB 1ERNA 1A6TA 5H37H 1F45A 2MJWA 4N0YH 5HYJE 1VCAA 4DGWC 3GZPA 4YWGH 3WHE0 3SE6A 1DQTA 4LPUA 2AHIA 1CFNB 1UVQA 2FLMA 3KLKA 1QQDB 3F7YB 4O2EA 4CBZA 3FUIA 3LXCA 1G9ML 3KYNB 3DECA 4S1SL 4HLZH 3TBWB 5JOPD 4FFZH 4KFMA 2W92A 3ASNB 3D25B 1S78C 5DHVB 1AZUA 1QFWH 5DS2A 2YQBA 4J3OH 5EV7A 2DQ6A 2NNCA 1MLCA 1ML0A 1NBVL 2AMGA 2VISA 3BKCH 1IM9A 2G3XA 3L5WA 1LE5A 1S7UB 4ODXB 4AC2A 2B2XL 1RZ7L 5IVZA 3KM1A 5D7JC 1E9OA 1NIBA 4GFXA 2E27H 1W15A 2EIDA 1NAKL 4ZXBA 5L7XH 1MQKL 3IJ7A 4GP5B 3SDXE 3MKGA 2P26A 4FXTA 4PJXE 1C5BH 1MNUH 1CS6A 1XZ0B 1Z9MA 1L5GB 3PNWB 1WAPA 1IAIH 4HGWB 3RPIB 1OAZH 3HI1A 3D0VA 5DMYA 2XZAH 3GM8A 3QO1B 3AY4A 3QXDB 2YMTA 1JNLL 4AITA 4KUZL 4MA7L 4OGZA 4ANXA 3GS4A 1GRWA 5C07E 3ZVVA 2VMEA 4DUXA 4I9WE 5I8KH 1K4DB 4HUMB 2JTDA 1F1DA 1KGYE 4LVHB 3C5XA 5A6MA 4KHTH 5F72S 4RX4D 1RCYA 5HSFA 2X2HA 3VFPA 3GLZA 5G4OA 5LBSH 3U25A 3VQMA 3SYAA 1L4IA 1MCWM 3HI5L 2WXIA 3MNZA 1SFHA 1RKRA 4TQPA 1X5JA 3QIUD 4KI5E 2P4AB 1UCBL 3WIHA 1RHHB 3PE9A 2VDKH 5LG1A 4GXVH 1HYSC 4FCAA 5CINL 2Q6WA 4OKVB 3DRTA 5I5IA 1LEIB 2OCFD 1CN4A 3BO8A 3HG1A 4W9KC 4KRLB 1ZLUH 1NFDA 4JCWA 5JXAH 2A6KA 2CBTA 1E5ZA 3DRQA 2DM3A 3JT2A 2WBJC 4EO5A 4TTDC 1F56A 1OK8A 4M29A 3V0IA 4C47A 2AXGB 2JFCA 4RISL 2ZAHA 3MMEA 3DSNA 3DVGA 4HXAH 2X2JA 1CG9A 3MGOB 4JNXA 2YRLA 5EOQH 3FRUB 1FFNB 4G8GE 4J3VA 3BKJH 3B9DA 3D39B 3VFVB 3GRWH 5JORB 3SQRA 1I7ZA 1SXSA 3K74B 1BQLH 2OMVB 1QYGL 3ARED 3ARDA 3CMGA 2UWEE 4KGLA 3ROOA 1MRFL 2ICWB 3KH3A 2E47A 4BFJA 6PCYA 2X7LA 3I6KB 1FNGB 2GJ6A 4Z7WE 2CKBA 4TULL 3S5ZA 3RWHB 1ZGLM 1FFQA 4E42B 5LN4A 5F0PB 3HS0C 5T3XD 1GPOH 4F57H 4XOBA 2FVNA 4F3FB 4GBXD 5F70A 3LXBA 1QPXA 3L13A 2Q76A 2WXKA 2XZZA 3GJFB 3CHRA 3RA7L 4DEPB 3ZHFA 4PY7A 1Y07A 43CAA 3OXRB 2BZDA 4JFQA 3UACA 1CLCA 4PD4J 4OD2A 1U8QA 1JYXA 5C0GA 1XDTT 3NIDB 1NCBH 3TO4C 1HX0A 2QV2A 5IOPA 3QHFL 4XMTA 2NR6A 5E08L 2PWEA 3NVQA 5BVPH 4GNKB 5ANME 2YPKA 2EVIA 4WO4B 1JZEA 5AENA 1R3HA 3FT3A 1CTOA 4J6IA 5DJAB 2BHFA 4FNQA 3QO1A 4N2LA 4PV9B 5BMFH 5A16B 3ZRCC 5IM7B 4LF3B 1O75A 3ZMRA 3ARYA 1BVLB 3GSOB 4FQIL 2VDML 4HULB 1MKFA 3FK3A 4YGVA 2K9FB 2WINB 1MREL 3O3AB 1MW3A 1F8TL 1IGCH 3QHZH 2R9HC 3CE1A 1HHKA 5EBMB 1T5KA 1ZWIB 2AQRA 4TXVB 2ALAA 2VC2H 2YPVA 3N42B 3VI3F 4JFFA 2VLJE 3OSVA 1RJLB 5JIKA 4GUQA 1F3JA 3KAAA 1Y7VA 3X3FL 1XR9A 3UAJC 5KVDE 1UGKA 4KO5A 4Q0XL 5AVWB 5T3XL 5HHPB 1BPVA 1F58L 3D39D 4FQ1H 3KPRA 1X7QB 3NPSB 1KGJA 5CEYA 1VGEL 3IGFA 4LP8A 5K33A 4X5XA 4Z7VB 3GEWB 2E9IA 3HAEH 3LIZH 1GY1A 2E7DA 3NIFF 3BUQA 5C09B 4MJIA 5LGYA 1OT2A 2QPUA 3TVMD 3UBHA 4NM4H 2NZIA 2VDQB 3CXDL 2H0PA 3KYKH 4L18A 4PGCB 2F58H 1WWCA 2WN3A 4L5FH 5FO8B 3SGJA 3JTTA 2LE9A 2VZOA 3ECUA 4QLRA 5GZNC 1ACYL 2OULB 3VFOA 1KB3A 4NO2B 2YQ3A 4MX7B 5D1QD 3FPYA 4KTGA 1YEKL 2R1XA 3SPJA 2A0LD 2OZNA 3BUDA 4P23D 1LVEA 2HA1A 3B5HA 4JHAL 4G7YL 5JO5A 4G6KH 2XXMB 1D3CA 1TQWA 4FQHA 4GLRI 2EDFA 3VTAA 4M1CC 3KXFA 4GBXC 4X8JB 2NOYA 2BERA 1GZHC 1FL6B 1EXGA 5SWZD 1A5FL 3G5XB 4IBLT 1NZRA 3OJDB 3GDBA 5JA8B 4NZ8A 2BC4A 2D2OA 2R56L 3C2SA 1KELL 3VXRE 1Q9OA 3U9UA 1ZRUA 4X80H 1NGXA 3PWPA 4K3DL 5F1NB 1ED3A 4U1KB 2FLBT 2FX7H 3HC2A 3H0TB 4MJ4A 5FYKD 3VFWB 5C0IA 4Q9RH 2DBLH 4JL2A 1YNTA 4G8EB 1XXDC 5FGCE 2EICA 3LNIA 4P5TD 3NGBB 2WLLB 1HI6B 2ZXGA 1NIFA 2DLIA 3WMPA 5DJ6A 1X44A 1J8HD 4FHBD 4QRPB 5IJVA 3I9IA 4CMMB 2ZYHA 4HT1L 2DKMA 5AVQB 3AG2B 5J9PA 1BPLB 1NANH 3DDFA 4O02B 1DQQA 1SOSA 5GQBA 1AS6A 3JWNC 1I4FB 5GJTL 2DBLL 2PWDA 5CGYD 2VMCA 1BJ8A 2F8IA 3BH9A 3I9AA 2NTSP 5B1KA 2FX7L 2MPAH 1OW0C 4WEBH 1DCEA 4X6DB 5KS9B 5D2NB 1KGCD 3IDNA 1QNZL 1KCUL 1JOIA 2P46B 2R56H 3N04A 5KBPA 3LRSA 4OI8A 3P4MA 2DEWX 4UQBA 3GKWH 2FGZA 4MMYA 1FRGH 1NAML 1A5FH 4XN8A 2ODHA 4L3AA 3MRNA 4OY9A 3WD5L 3NQIA 2KZBA 1ONQA 4K9EC 1PJ9A 1XQ4A 1PSKL 5EMYA 5BOPA 3B37A 2UY6A 5CHNB 3ZHLA 5DRNA 3CMOH 4AXWB 4EJ1C 3MRDA 3SE4C 5HI5C 2CO7B 3T6VA 3TA3C 4LIQH 4JHAH 4H8WC 2IBGA 3PGDA 2JB6A 2LFGA 5IW3A 4RRPG 1ASOA 3L95B 3MRGA 4FQCL 4Z6AT 4KZ0A 4ZUWA 4L4VB 4J39A 3TJHD 4OZGE 5GRYA 2RQEA 1PZDA 3KYNA 5CKAA 2DD8H 3BEVB 4OU3A 2VR4A 1HTYA 2FRGP 2RD0A 4GUCA 2W9DH 4LNRB 3V4PL 1YUKB 4BZ1H 4UV4H 4DGIH 1VACA 3KYKL 3FT0A 4WDIA 1PKQB 2K3TA 3T6WA 5E7FA 1O6TA 4BD4A 3RIFF 1R6VA 5I6XC 1VKXB 3CWGA 2VE6A 4PS8A 1JMXA 2ZXAA 1IQDB 2DY2A 1V27A 3S5LG 1V55B 3FZUD 2VRAA 3NESA 1JF1A 1WCBA 4KJWC 2D2CC 4JK0D 3TYGH 1Q4NX 3V8OA 1TKWB 3RL1A 5FA3B 2CCWA 1PZCA 2HMID 3MLYH 3N41F 1PZ5B 3N5AA 3D09A 5HHOD 4A7GF 4WWKA 1DJIA 2MEJB 3NZ8B 3OG4B 4JUTA 2IPTH 1IM3B 3IVKB 4MWFB 3EOBA 2NX5B 4Z5RB 5AKRA 3IBEA 1IBGL 2X3CA 2WLIB 3L5XH 4QJ3B 5AVUB 4F15C 4HYTB 4AGQA 3O9WC 3BFQG 3F04A 3T0ED 3UTTE 4FLRA 4MNQE 5HDBE 3SDAC 4JM2B 4XNZC 3PQYA 2MFNA 4W9IC 2E4TA 2VR6A 3MRRA 4FTVA 4TKWA 4XT1C 3T4YB 5GGRB 3WNIA 3M7FB 3OAUH 3RFRA 4NZDA 3MRQA 4OUUB 2WQUA 3RWCA 1ZA6B 3B9KC 4X9FA 3T8MA 3OKDB 3P3SA 4RIRB 4QRPE 5CSBA 4DCQA 6PAZA 4MDJA 3V6OC 3QS2A 1MJJA 3MO1B 4HIHB 4UINL 2ZAGA 2B77A 1BAFL 1KPVB 4R83A 1Z32X 3GMRA 2BDNH 1UJ3C 3BESR 3UYPA 1E0OB 3CPLB 3QS3A 4H2CA 4JVUA 1FJ1B 2A2QT 1ND0B 3TJPA 4Z7UF 3I50H 5L2JB 3ZDWA 1YEDB 4UTBL 4BWTA 1HS6A 4PS3A 3TVMB 4HGWA 3TBVB 3QRFM 2W91A 4J4PD 4ZW6A 1ACZA 3OLDA 1X5AA 4R9HA 1NANI 3AU1A 5B1BB 3RA7H 4IKKA 4UU9B 5C9JB 2VLRA 3HTLX 1Z5YD 2Y5TB 4PRDA 3V52H 4BHUI 4YSAA 3GPEA 2VXSL 4Z76B 1NC4B 2WSKA 2WCPA 3F7KA 1O9ZA 2OCJA 1FIGL 2EEDA 3MJ6A 4XN2A 4Y19D 3J7HA 3VYPA 1XCWA 1YUHB 1PVHA 2F68X 3UZQA 1Q0XH 3KHQA 4KKNA 2ISDA 4G5ZL 4PLKC 1TJXA 4GRLB 2HFGL 1H3PL 3WTTA 3PDGA 4RFNB 2J72A 1GKEA 3SGDH 2MNWA 4ZFOL 1EFXD 5HDQH 2X6BA 2Z65C 2XNAA 2O6DA 5C0CD 3KPQA 1G7QA 4HHGA 5HGAB 2Z34A 3MODH 3AW5A 3RX8A 3X12A 2DQEH 4KO6A 1MCEA 1NIAA 4RFOL 4FERA 2BOCB 3TO2B 3FQNA 3T77A 3C09B 3GSRA 1PNCA 4YMPA 4PJ8D 4WFGE 3UTZA 2VL4A 4UYQA 4NI6A 3U4KA 1HN1A 5HGGS 5I1HH 4UOQA 1ZLVH 5JIIA 3TCLB 3SYPA 3H53A 3S8FB 1ILUA 3JSSA 4GXVL 2F8VA 3ABLB 4J6RH 3MCKA 2WP3O 3TH2T 3O4LD 4X7DC 1ITBB 4EKJA 4XAWL 3ROOB 5HYIA 5I1KH 4JO4H 4YNYA 1IARB 2WTRB 1HHGB 2RHEA 3FW6A 3QUZD 3KCWA 3KEDA 1A4KB 3UTQB 3G6AA 1IEBA 5EIIA 5CP7B 5I1GL 2GTWA 1B0RB 3NP4A 2XC8A 4EZMA 2IMMA 3DIFB 2MCPL 4D8OA 5T1LB 1TETL 1SY6H 2IDCA 3RZWA 4PYGA 4FXLA 5FEBA 2Y7OA 5FDWB 2AQ3A 1N68A 3QDHA 4NQQA 5J11B 4ZOBA 5E6IB 1BREA 1SDDB 3VG0L 1DUZB 1QBBA 2FATH 4KZCA 2M1KA 5ID1A 1T1WB 2BSTB 2E27L 2H47C 3KH4A 3S34H 1YHPA 1BOGB 1A6AA 3BZEA 4F8TA 1M2OA 1JRHI 5AAMC 1W0VB 4DEUA 1FO0L 2UXTA 4JKPL 1A1MB 1RPKA 4WV1C 5E9AA 3GBML 4NEHB 4ZO9A 4OFDA 4F2MA 1XGRB 4LKXB 3CDYA 2A1WL 1J88A 2N3JA 4UT7H 1OM3L 1DVFD 1VZHA 5EORL 4C56B 1I9JL 3CLEL 1M05B 3WBDA 4U1MA 5F1SA 3K8MA 1ICTA 1M4KA 2FX8L 1JXJA 2P8PA 1EHXA 1A47A 4ZSOA 2WZPA 5D71H 3D0LA 3TBTA 2VLKB 2OSLA 4WEUD 5AOZA 3IDMA 4P05A 4MGXA 4NC2B 4N0YL 3NN8B 1DR9A 2N56A 3I02A 4F5CA 3UZQB 4I0CC 4JG5A 4X6DF 3OTTA 5CNHA 4P2AA 1OTUC 2BY3A 2FIKA 4AX3A 1R24B 3KPRD 1HVXA 4BQBA 3QFJE 4CU7A 5KSVA 4GAYB 4PR5A 2GIXA 2JVUA 1C8QA 1N6UA 4X9BA 1FFPA 4P5TB 3K6OA 3AS2A 5AZ2H 1EHLL 3EH5B 5JQHC 4ZW7A 1JGIA 2X89A 3IF1B 4FFWC 3OMZA 1B0GB 4GG6F 1BHGA 2ZZUT 1RQ5A 4PD4K 4HGKC 4TMPA 1RULH 2YAEA 3IAGC 3OKMB 3KE0A 1G4RA 3LVTA 5CJXC 2J6EA 2YZ1A 1TFHA 4CDGC 2R8SH 5JPMC 5D7LB 2AS5M 3O3EA 1HEZB 5J1SC 1BMZA 4M5SA 4NO2A 1T2JA 1S7UA 1JMZA 1U8JA 1QWNA 3S35L 4LHUD 2ZXWB 2XQBH 4HIPA 3C5ZB 3WKMH 2PCFB 3QYMA 4OF0A 3A21A 3MRFA 3T0BA 2AJ3B 4P2RB 1J1XL 3LZPA 5AYUH 2J21A 2QT6A 3RFZB 2VWEC 4HWNA 1VJSA 5DZ9A 4P4KC 3KPSD 5DJYA 3WG7B 3M8OL 2ZF8A 5D4HA 4FRWA 2GHWB 3DOHA 1YO4A 2IBZY 1IKNA 3ZKMD 3TNMB 3POHA 4PS4L 4CSPA 4CADA 1MXGA 5EZJB 5C0JB 1DBBL 3K8KA 3HW7A 3C8DA 1W0YT 4N5UA 4YOKA 3I2CH 2MQ0A 1OCCB 4LKCA 4YSRA 4FQLL 3W5MA 1O7VA 1PY9A 2EIKB 4UQEA 5IJKA 3B7SA 2IBBA 4H8QA 3QUMB 3DSFH 2HRPH 4JRWA 4M7KH 1TJMA 3V0JA 3GSXB 4LPWA 2C1OB 3JV0A 1DJZA 1UB6B 2HKAA 1DJHA 1R17A 2DYSB 4WTZG 4WW2F 4XO5A 3FN0L 4X7SH 2CNZA 4D9QD 2NLJA 3TP4A 3IFNL 1EO8L 3QZMA 1T0NA 4LOEA 4QHLA 4TLTA 4JKLA 2VDOH 3ARFD 3APMA 4HK0B 3RP1A 4LLWB 4GOSA 3C5JA 5E4AA 4NQED 4WFEE 3CUPB 3O4LA 1XH0A 1D6VH 1AGCB 1AO7A 3V6ZB 4IDLA 5SX4I 2HRGA 4XNYL 1JN6A 4OI7A 1JNHB 3RY4A 4R4FH 4F8QA 4YDIL 4DOHE 3ZO0A 3WIHL 2IDUA 3F01A 5F97E 3I75A 2WN2A 3B7YA 3HG1E 2UZIL 1GZQB 1LO4H 2KZWA 2E9GA 1KLGB 1X5IA 4V11A 3N6YA 4QT5A 3DHMA 3ZLQC 1P2CB 1PCSA 3QJRB 3K2IA 4JHWH 4WFFE 1YCSA 4R7DB 3WI9A 4MQ7B 4WKXA 4FG6D 2W9EH 3QQ9D 4GMSH 1NWPA 4WTXA 1G1KA 4JRXA 5CZRA 5SWSE 3B8YA 1OK0A 3NOIA 1TJIL 5D7LE 1FCGA 4PJGF 4EPSA 3D12B 2F1BA 2X6MA 3GNMH 1WYJA 4LLVB 3NDYE 1RZGB 3C6LB 5FA4A 2XN1A 1VEPA 5LHDA 3B2UC 1YNTB 2D73A 4QGTA 4B9ZA 3VFUB 4TNEA 1JZ8A 3Q5TA 4Z7VF 3ULVE 1TZGL 2R4RL 5C2UB 2J8UA 2NY3B 2XWJB 1QW8A 2CZNA 2QQKL 1R75A 2PLTA 3QRGL 4HIIB 4LVEA 5TE4H 4WWKB 3U7WL 4RGMC 3V10A 5IVNA 3O3BA 1P7QD 5C9JA 4JG1L 2HLFD 2JTYA 1BFVL 1R34A 5CZVL 5DR5H 1ZHLA 4HS3B 1CR9H 4IOSD 3HMXH 5TF1L 4I8DA 3FTUA 3L48A 3MROA 8CGTA 3TT3H 4AYFB 3BXNA 4LRNH 2O72A 3P9MA 4E9SA 3SQBA 2F1EA 3UTSB 1Q90A 2FEJA 5INDB 2WWMC 1H3GA 1OSZB 5GIRB 4BCYA 1ZK9A 3BHBB 4XH2B 5FYJE 1IT9H 1D6EA 5CR1A 4OCSH 1XR9B 3N43F 1E67A 4HS8H 1L0YA 1A64A 2A6JB 3GTNA 3RDTC 5DJ0A 1GL4B 2VXQA 2CLZB 3N43B 3B2UD 3RUGE 4UF7C 4ZTPL 3SPHA 1J11A 4YLQT 3P2BA 5JA9A 4LLWA 3FO0H 3LNHA 4B0MM 2ADFL 2DTML 3ARGA 4L37A 1OAYH 4PFEA 1IGJB 3MOAL 3FU5A 3WELA 4B5EA 1B4JH 2BY0A 4LARH 3QUKA 4PH8A 2QADB 2ZKYA 3SHSA 1T1XA 2BWDA 2VXUL 2WLYA 3B83A 1KIUA 1S9YB 3ULUD 4IM8A 3VU2A 3QUXC 4X5QA 5EUKB 5I0YA 2R0ZL 1YYLH 2TSBA 2CDEB 1HHIB 4JM0A 4MX7A 3P73A 4F7CB 3L3GA 1SOQA 3GMPB 1K6QL 2C9PA 2BO0A 4ZS6C 5L2KD 1RZJC 2HB0A 3MBWA 1KMGA 1A8JH 1EWHA 1PFOA 1WZ1L 3DXAB 1YA5A 3RGVD 1XB6A 4H0LC 5D7SL 3OVUB 2W80C 5FGBC 2O1AA 2FLRT 1W0WA 4JM2D 2ZUWA 2ZCLL 4R7DA 1ZA3B 5IJCC 2XV6B 4ZX6A 2IG2L 2CBPA 2XZCH 3PAYA 4NPYB 3AU0A 2R23B 4FE9A 3UP6A 1JGUL 1VFUA 4HIXL 4GS7B 1ZV2A 4IDJH 2COVD 2ENJA 2HH0L 3QI9A 3T2LA 1CUOA 3TIDB 4AQEB 3VFTB 3T2OA 4WUKL 5BXFB 1FZKA 2CJUL 2IQ9L 3CTTA 4XXWC 4JZNA 4AEHL 1S8DA 1OB1B 1SXZA 4QOKD 3H55A 3DXAE 1JFQH 4OLUH 3GXTA 4UQ3A 1HILA 1BGXL 1U8MA 4YZFE 5IBTL 2W38A 1A1MA 2YPLE 3GLDA 2OMTA 2V2XA 3D39E 4PGDB 1KDJA 4I5BA 4ZFOB 1U92A 1KJVA 4WV1A 1XGUB 4PV8A 1EEUA 2YQGA 5F9OH 4IOIA 2CWRA 4XCNA 1LDPH 3F64A 3VXRA 1HHGA 3RVXD 2BMKB 1XB8A 3D0AA 2G60L 1FJ1A 1KUMA 2F08A 2WYZA 3RBSA 2D31A 2NY4B 5E2WL 3C6EA 3MDJA 3EYOB 3WAKA 4J8QA 4HG4K 1RK1B 2E0PA 3GO1H 3B1UA 4OD1L 5F2FA 2OI9C 4Z77B 3T0WA 1SEBA 5CGYC 2ROYA 2GJRA 2F5BL 2O6CA 5AZEL 3P0VH 4GRWE 2AV1B 4YIQB 2EE2A 5DYOB 2BWQA 3WLBA 5K39A 3LQAL 4LBEB 3WMSA 4KO7A 5KVDL 1BDYA 1DQJA 1KFAH 1EEZA 4UOW1 5L88L 4YLCA 5ECGA 3NA9H 4U49A 2H32B 4IKIA 4S1QL 1AE6H 2ICEC 4GP8B 2YS4A 4YXKL 5I16B 1UZ8B 4ZFFA 1P4BL 3VMOA 5D7LD 5EH1A 3U30C 1BZDA 3G6JF 4M93B 5DEGA 3ESNA 3QR0A 5IB3A 4HQQL 4BFNA 2YBGA 1J0HA 4QRSA 5KVEE 3O8XB 3UTPE 4KXZH 1S3KL 4W93A 3RTQB 2EDJA 1T7XA 4YDKL 4YVNA 5C3LD 5BRZE 3OKNA 5IQNA 5LNDA 4AKPA 4YFEA 3HPJA 4MCYB 3Q8EA 4TVPE 3OLGA 1JWUA 1MLBA 5GSRB 5C0BE 3QFDB 2B59B 3U2SB 1NEPA 5KZCD 4G6AD 4ETYA 4NDMA 5KVFH 4I3GA 4M03A 2Q2EB 1IGML 3FUDA 4X6EB 5E1AB 2J73A 3KDMB 2NQCA 1XD0A 3FOMB 2OZ4L 2EH7L 3R06A 2AQ2A 3BMVA 3R4DA 3PUUA 2LU3A 3SQOL 1WZMA 3OKEB 4PJFB 4IHOA 1XGQB 5AFAA 1HQ4A 1LMKA 2X70A 2XKNB 1GS7A 4GSXA 4TQEL 1T3FA 2I5YL 4HF5H 2FEEL 3VD2A 1NBZB 1X5ZA 3GXIA 4JM4L 4IJ3C 3L3JA 4Y16A 1MF2H 2J20A 3O11A 4JE4B 2CR0A 5C2BL 4NN6C 4YQXL 3QIWB 5F7FA 4ODHL 2OXHB 3FQ1A 3F7VB 2HVJA 4X83A 1BOYA 4BK4A 4X5RA 3QJUB 4PJDE 5F21B 1G5AA 2YRZA 3OKKB 3MXWL 1U8QB 3KGRA 1YEHH 3N0AA 3NCYP 1CFTA 3CGTA 4W9DC 3L3OC 5CJOL 3KVPA 3SGKA 4U2YA 3VXUD 1V3LA 3MRQB 4KQ4H 4LT7A 3EBGA 4PTUA 3NFSH 3SD2A 2VLJA 2Z7UA 5A2KH 2GUOA 4PAZA 4PV1C 3OXSB 5J12B 3CSYB 1RZJL 4FQPA 4RLDA 2R2EA 2C9QA 3SZ6A 1NUDA 2JCCA 3MR9B 3P69A 4L4JA 3QIBC 3N55A 4FEIA 4H40A 4UDUA 2F53D 4TF4A 3GMRB 3GHEL 3ES6A 3D2TA 3KGTA 4G71B 4GPVA 3U7YL 3I6GA 1GH7A 2DICA 4D9LH 2PR4H 3UTTA 1N59B 3TO4D 3FCBA 3V6OA 4DVRL 1J5IA 1U2YA 1XGRA 4LKXA 4H25A 1FDLL 4RRPA 1AGCA 3PP4L 4Z7NF 5IHUL 3B2DC 3R0MA 5GRUL 2JXMB 3FOLB 2OW6A 1IEHA 5SX5H 1YYMH 1G0DA 1T1YA 4ZAKB 2YRPA 1YMMA 3KLHC 1ID2A 2CBQA 4L1DA 4IRJB 5JNYB 3FT9A 4KROD 5KVGH 1QR1A 4JY4B 1QI4A 3MX0B 2DJSA 4MNHB 4RWHA 3VXUE 1JZIA 2C9VA 2ZUQB 4G9FB 4DO6A 1O7SA 3AJ7A 3I75B 3QDJA 1Q0YH 1MFMA 5DD3H 3K2UL 1KNOA 2LVCA 2E9JA 4IBQA 4JO2L 1I1YA 4Y5XC 3MACL 3CFKB 5E2UH 3H9SD 3DUSA 3DWTA 3LRHA 4WWKC 4QHNA 4JEGB 5B39G 1FYTE 2P43B 1MW1A 3BQUD 2BCMA 3EOTL 1P7KA 4B41A 1MIML 5TDPB 3BZDA 3HRPA 3N44B 5JUEH 4P4RA 3ULAB 4GXFA 3CFMA 1P84K 4P5KB 4ODSH 4BE5A 5DVKA 3FBQA 1KJ3L 3RZCA 4W6WB 1NJ9A 1C7SA 2DPKA 1JTTA 3W3BA 1EBAA 5FYKL 3QXAB 1OGAB 1N64H 5IROA 1FE8L 2A9AA 4UZUA 4CRPA 1FL5A 5IB4B 2YEVB 5GS1B 2CK0H 2F5AL 3H9HB 5DRXB 2H41A 2V2WB 4MXVE 5EA0H 4OLVH 4XHJD 1P5UA 3QUML 1PU0A 4M6MH 1TZHA 5DA4A 3EG9A 3UBXI 3GGWB 5ANHA 4DH2A 4I77H 4WKZB 1S7RB 2MHAB 4HLZG 1JVOA 1FA4A 1MWOA 1SGKA 4N86A 3UERA 4HJJH 2IEPA 4G59C 4WHDA 1QSFE 3HI1B 1EDQA 2Y22A 3HE7C 3H3PL 3QI9D 4OIBA 4AYID 2BC4B 2P8MB 2AJSH 3LEVH 1A7RL 3MRCA 1KY7A 1K4DA 1I3GL 3N3EA 4CNIB 2J88L 4K23L 5A2CA 1QEWA 3H42H 4P2QB 1G9NH 1BFSA 2F15A 1NMAL 1PZUB 3T1FB 2EQDA 4FFYL 2Q7YA 4MZ3A 5CP3A 3VRLF 5IT2L 2MRYA 1E4XL 3M6DA 4JFEB 3UAEA 3WFZA 2NXZD 2XN0A 2DIJA 3OXSA 2B1AH 4WEMB 2YXMA 3RE0A 1GZPB 3MLSL 3O41B 3CIAA 5JXEA 3IGUA 4HC1L 2UZPA 2H1XA 2FX9H 1QBLL 3VH8G 3W81A 1BWWA 5GZOC 2XA8L 2HUHA 1IEAB 1CD0A 3B3BA 3AQYA 5IQ9A 2XXGA 2JB5L 1IJNA 1TJGH 3Q5YA 5EBLA 3FUKA 5EOCL 3V0WH 1G7PA 5DFAA 1DEEB 1ZPUA 3HA0A 3GXFA 4Y2OB 4H7VA 1WA2X 1XB3A 4PPTA 5ESAA 4OM1L 5F7DA 4W1TA 4ZUTA 5ACMA 2GI7A 2QHRL 4RMTA 4U7MA 1T0MA 3Q44A 3IPFA 4NGHH 1AQMA 2FGWL 1FAIH 3K71A 2X4NA 3BAKA 3VG9B 3LZRA 2NSXA 3D87B 3EW3B 3C6SA 1KYFA 4PRHA 5KVEH 1PEZA 1J12A 2PWFA 1WFIA 3RAJH 2WC7A 1DDHB 1XSIA 1JCVA 2MTPA 2P3YA 3SDCA 4V2BA 2NY6B 1AGEA 1JPFB 2BHZA 3QSKB 4G11A 5D2LB 3PY9A 1Q9WB 5I17A 4F2ME 2DL9A 2ITDB 1MZZA 2YUXA 4JFEE 5DJ8B 2Q2LA 4PJHB 2N7AA 3QXVA 4WZ9A 2C1PA 3BPLC 1H6UA 1MCIA 3D85B 4GH7B 3HZVB 4NUGL 1X5FA 5D2LF 5EU5A 1T5WB 3ZDXE 2KDYA 4TLUA 4LNRA 4M7LH 2JQMA 2ORBH 4HLJA 5EU6A 2OSXA 3IWVA 1RFDL 5BZXA 4QT5B 1L7TL 3FONA 4MJ5A 5A2FA 2P45B 3T8XB 1T21A 4FYRA 1OGAE 3C6LD 1P69B 4DNLA 2QVTA 2FCBA 4WSGA 4H88L 3TBCA 3E9UA 4RGOH 1I7TA 5AW8B 3SN6N 3WUZA 5KYXA 4ISVB 5EF1A 5JORA 2DEYX 1EAPB 3IDIA 2OMTB 3NZUA 5IEHB 1G7HA 2Y6TE 5BZZA 2O5ZL 3B9KB 3LKOA 3VXOB 4Q97A 1A7PH 1ESOA 2ED7A 2EXTA 3QE5A 4UQDA 2VLME 4ZOCA 1ZHBA 3JWNG 4KHXH 4G1EB 4LF3A 4J2XA 1J5DA 4JG0L 2ALWA 1U3ZA 5I1DA 5J6GA 4DZBA 3EGXB 1Q94A 4MYWB 1XSJA 5DZOA 2IH3B 4OGAC 1U36A 2Q5BA 1ZWIA 3W9EA 1M2VA 1OP3K 5T3ZL 3V0HA 5H2BB 4KKCC 5CCJA 1JPTL 5MERA 5F71A 5CJBA 4G8GB 1QLEL 2IAMC 5KG9B 4J3TA 2A6DB 4NAJA 3K6FA 4LLDA 4DCQB 1Q72H 4PJFF 2O4EA 4NJAL 1NGYA 1MI5E 2DQMA 3ASOB 1SJHB 1N6QL 4X6BB 1DQLH 1ZLSL 3FUEA 5IQ9B 3T3ME 4Y5VC 1F18A 1A6UH 4QXTA 3TO4B 5JPNA 4L8CA 4NZUH 3BSHA 3C60D 4JRYB 1LO5B 2LLLA 4Z7OF 1BQSA 12E8L 1N8ZB 2E46A 3BZ4A 3Q8CA 1ZVSA 2WXOA 4AEFA 3OGCB 2YPLD 2HG5A 2HKFL 1S2EA 3MU3A 3AB0C 3U36B 2I9TB 3QR2A 2C9AA 4HA1A 1I4FA 3FPXA 4S0TD 5EUOF 4AH2B 3B2VL 3EOAA 1AHKA 3NK4A 5IWLC 1DJWA 4MRBA 3RNQA 4FNLL 5LXVA 4NKMA 3FOMA 4A2GA 1F6AA 1J8RA 1TNNA 2CR3A 3MLXL 3CVHA 4K4KA 4NZRL 1XH3B 4ELDA 3TWCH 4XO8A 5DD6A 5EOTB 3VDAA 1DL7L 4KVCH 5I1CH 1WGOA 5EEZA 1NGWB 3FU7B 1KY6A 5GRJL 3O0RL 1ZSDB 4BWWA 1RIUL 1XT5A 1DANT 4G72B 5TQ2L 1XD1A 3EYUL 1AKJA 3GF8A 1JNNL 3BKMH 1EMTL 4MCZA 2AAVA 5E94A 4L8SB 3SGDI 2J71A 1FIEA 1ORQB 1CK0L 4P59L 2JJSA 2XIIA 3ARXA 3QR1A 4KTYA 1ZGLB 2CUIA 3CZSA 5IHWA 5C86A 2ZKWA 3X2QB 3C09C 2N1TE 1YNKH 4OKDA 4EN2A 4JFPB 3OWRA 4IRJC 1CVRA 3PWPD 4XX1G 4A37A 1UWEL 2ZP8A 1YEGL 1AYRA 4EUPG 3ZTNH 4BQ6A 4I18B 3II3A 3EJSA 4OQTH 3RQ3A 5BPPA 2GY7B 2W94A 3LV3B 2Y7LA 3PL6A 3BOVA 3MV9D 4DQAA 3LPFA 5ITBH 3VXNA 5D7IF 2FQDA 1ZVNA 3VFRA 5LN8A 2WBWB 3MOBL 1BX2B 2K3HA 3WNNA 4A2DA 3EGDA 4I1NB 5IIEB 4QOKE 1CGUA 1DVUA 1MVFA 3G9AB 4UQ2A 1CGSL 3RU8H 2HPOA 1RXLA 4PB0L 4WCYH 2NY4D 5D1ZI 4HCIA 2OTWA 1I8MB 2AGJH 2BNQD 1KJVB 1T2QH 2JXMA 1KEMH 5JHLA 2UUDK 2JJUA 1HXKA 5DUML 3V4UL 5E70A 3DUUA 3TF7C 5J1AB 4Y2DA 3HC3L 5IM7A 3WY2A 5B7EA 1F3RB 3R4RA 4Q2ZA 4JFTA 2JCCF 1AZBA 4XP5L 5J57B 4QO1B 4LCUB 4M02A 3KR3L 2VERA 4L1HA 3HNSH 2ESVB 2WO2B 1AAJA 2DLFL 5E8PB 4Q6IA 1FI8C 4BE6A 3NIDE 4G2AA 2O5YL 2YA2A 4ZUVB 1D9KA 4BGLA 1IL1A 1OP4A 2FWOB 4XVTH 5DK2A 1DVZA 1QUPA 3SY0B 2A74B 1FVEB 1VGKB 3BUTA 2P5EE 1ZTXL 3NABH 2BFVL 3C08L 4WGVB 3VSVA 4L4TB 2HJFB 1JTPA 1QX1A 3CFCH 1GAFL 4WEEA 1KCVL 4WDIB 4Q56A 3DRQB 4MHHI 3RGBA 3UTTB 1BQHG 1EJOH 2GJ6D 1ANUA 2FH6A 1OF2B 4XODA 1UWFA 4KTDH 4AGNA 2XQYA 2C4XA 1JK8A 2Y6SD 3B43A 2ADJA 1DLFL 1CXIA 1P5UB 4S0SD 5HYJD 1DBAH 5C0BD 3P3YA 4E5XG 5EIVA 2BOBA 4DWHA 1CL7H 2X2IA 2ADGB 1ETB1 4XN7A 4PYHA 5DURB 2ICWA 2HKHL 4C58B 3MLVH 1N2RB 4L4TE 4DK3A 3BAYA 2IOOA 1MFCH 2NY2C 3AS3A 1OB0A 3G08A 1JPEA 3HRZC 4PWEA 3LEXB 2IH1B 1MFVA 1IGIH 2XPYA 1AD9A 4XNQA 3KPNB 4NC1C 4F7TB 1M71B 2AQNA