1PLBA

High-resolution solution structure of reduced parsley plastocyanin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
AEVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPEYLNGAGETYEVTLTEKGTYKFYCEPHAGAGMKGEVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution solution structure of reduced parsley plastocyanin.
pubmed doi rcsb
source organism Petroselinum crispum
molecule tags Electron transport protein
molecule keywords PLASTOCYANIN
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plbA00
1RCYA 2VW6A 1URIA 3OMNB 4KO7A 3FYIB 4G71B 3PAVA 5I6KA 2YAOA 1ZDQA 2DY2A 4JKNA 1AIZA 2FT8A 1AQ8A 2XUWA 4GP8B 5B1BB 5B7MA 3FU8A 2PP8A 2VN3A 1M57B 3NJLA 2PP9A 1JZEA 4KO5A 3NSCA 4DP8X 3HEIB 2EINB 3WG7B 1PZBA 3IEAA 1ZPUA 3WI9A 4HCIA 1GY2A 1PAZA 1ZDSA 1JXDA 2H3XC 2IDUA 3EH5B 4FA7B 4HZ1A 2J5WA 2LLNA 2FT7A 3U25A 2IDTA 3RYMA 2GC4C 1V55B 4BDVB 4YSPA 4M3HA 3FSVA 4Q89A 1WA0X 3T6VA 2ZONA 2W8CA 2CJ3A 4W1TA 1W6LA 1CYWA 1W6WA 1AZBA 3BVDB 1PNDA 2J56A 5PAZA 4JHUA 2UXFA 6PAZA 2BP0B 2EILB 1IBYA 2GSMB 3JTBA 4L0PB 4W9ZA 4AZUA 5B3SB 1V54B 3EHBB 1SDDB 2VSMB 1TU2A 2N0MA 1XB6A 1OV8A 1ADWA 1GS6X 1PLCA 3GXUB 5AZUA 2TSAA 5ANHA 3WKQA 1I53A 2RACA 3N55A 4E9WA 2Y69B 1AG0A 1ILUA 2WSDA 4ENZA 2PPCA 1GW0A 3TBBA 1RZPA 3FQYA 2DWSA 1WAEA 1NWOA 1IUZA 3NP4A 2OV0A 1JXGA 1R1CA 3AG4B 2YXVA 1AR1B 4F2EA 4YSSA 3WNIA 1J5CA 1WS7A 3ASOB 2XV0A 4DP2X 1KCBA 3ZIYA 2XVBA 4PAZA 1IBZA 3CDZA 2IWKA 3T9WA 1L9PA 4YSQA 3JT2A 4HIPA 1OOWA 4MFHA 2I85A 4RH4A 2DYRB 1PZCA 2QDWA 3ZBMA 1JZJA 4GYBA 4A2HA 7PCYA 3S3CB 2CCWA 2E86A 1OCOB 5TK2A 1W8EA 3TA4D 3PLYA 1MZYA 3UADA 3AZUA 2AZUA 5D4HA 1PF3A 4DP4X 2GBAA 5E9NA 3X1EA 2CUAA 2H47C 1QNIA 1PNCA 2XWZA 1MG3C 1SHWA 2AVFA 2EIMB 5FC9A 2XXFA 1E5ZA 3EH3B 1WS8A 4HALA 1BAWA 4DP7X 1QHQA 3NP3A 5IY5B 1AOZA 4UF7C 3FQ1A 1E67A 1A3ZA 3ABMB 3UAEA 1GYCA 3S3DB 5I5MA 2W88A 4E9RA 1NINA 1XB3A 3S3BB 3BQVA 3S8GB 1GS8A 3ABLB 1RKRA 2BO0A 3FYEB 3NJMA 1BQRA 1ZV2A 1NWPA 4E9VA 3AY2A 1M9WA 2XYBA 3AG2B 1N70A 3ZX1A 6PCYA 3NSYA 4YSEA 1AZNA 2PCYA 4KNSA 2ZOOA 2YAPA 3QPKA 3GYRA 1CYXA 3KW8A 4BK5C 1A4BA 1CC3A 4HHGA 4BXSV 1SFDA 2MRYA 1L9QA 2HX8A 2YXWA 3NJNA 4A2FA 2CBPA 5I5IA 2H5UA 2YQBA 2BW4A 2PP7A 2EIKB 2QPEB 5I26A 1SFHA 1KDJA 2VW4A 4EF3A 4AX3A 2PPAA 5F7BA 3X1GA 4GXFA 3FQ2A 1ILSA 4P5RA 3G5WA 3NJKA 1NIAA 2FTAA 4GP5B 5I6PA 1ET8A 4KNTA 2AZAA 1MZZA 4N4YB 1OE3A 5I28A 1T5KA 2BP8B 1J9SA 2CALA 4E9YA 1XMEB 1NZRA 1AS6A 2ZXWB 5I6NA 4HHWA 4Q8BA 2VM4A 1JVLA 2IWEA 2NRDA 1HAUA 3IE9A 3SQRA 5F7AA 4DPAX 4KOBA 1SHXA 1TEGA 4N8UA 2HLEB 3CZUB 3QJSB 1ET7A 2XXGA 1FFTB 2UXVA 3EF4A 5B7EA 1DYZA 3QJTB 1PLAA 1BXVA 1AZUA 1B3IA 4G7RB 2FQFA 2DYSB 3TU6A 5I6LA 3AG3B 1PY0A 1OCCB 4F7KA 2R7EB 3QJUB 1N68A 2J55A 4X4KA 4CSZA 1QLEB 4A66A 4KO9A 4PCYA 3H4HA 1FWXA 2HX7A 3CVBA 5PCYA 5D4JA 3QJQB 1MG2C 2QDVA 2B3IA 2JKWA 1BEXA 3C75A 4UAHA 4YL4A 3X1FA 1A8ZA 3X1NA 4DP6X 1JERA 3NJJA 2JXMA 3CDZB 3GDCA 1ASQA 2MTAA 2YARA 2HXAA 1J9TA 2PPEA 4ZK8A 1JZFA 3T6XA 4HAKA 5I6MA 4YSDA 5EHFA 4WKXA 1WA2X 1X9RA 4E9QA 1NIEA 2YAQA 3SBPA 2WO2B 1SJMA 2FWLB 2Q5BA 1J9RA 3OD3A 4E9TA 5LDUA 1AAJA 4WTQA 3FU7B 2GI0A 1OCZB 4E9SA 2IH9A 1E5YA 3HB3B 2XV2A 4GY4A 3AW5A 4G7SB 3IN0A 2PPFA 2EIJB 3MX0B 1MDAA 2XX1A 1A4CA 2BHFA 3KW7A 4QKTA 3FSZA 1GY1A 1A65A 1JZHA 1SNRA 4YSRA 3UABA 1PMYA 4YVUA 2FJSA 2Q9OA 5D4IA 1KV7A 5I5JA 3PCYA 2FQGA 3ERXA 1OF0A 3ABKB 3OMAB 4BWWA 5B7FA 3FS9A 3DKHA 1L9OA 2I7SA 3FPXA 5I6OA 3T6ZA 2R7EA 1A4AA 2OJ1A 3WNJA 2IH8A 3X2QB 5B1JA 2BWIA 3FPYA 1PZAA 5AFAA 4YSOA 3NT0A 4BXVA 3H56A 4BWUA 2VMJA 3NJFA 3WIAA 3IN2A 1AACA 2VM3A 2Y1AA 3OM3B 1L9SA 4A2GA 4GP4B 2VSKB 4KO6A 1KYAA 1NDTA 1NPNA 3ZDWA 1E30A 3NJIA 2UXTA 2X87A 1GSKA 2IWFA 4K9JA 2FNWA 2GIMA 3T6WA 1KBVA 2HRHA 2X88A 1NIFA 3QJRB 1BYOA 3DTUB 1AZCA 3OMIB 2XX0A 2UXGA 4KNUA 1JXFA 1L9RA 1AANA 2ZWNA 2A3TA 2JFCA 4DP1X 1E65A 4HCFA 4DPBX 1RZQA 2GB2A 5B1AB 2XU9A 4AKPA 4CSPA 1V10A 2HZHA 2IDSA 4AI7A 3V9EA 2YAHA 2VW7A 3AG1B 2PPDA 3FT0A 5TK4A 2FQDA 4YSCA 2AANA 4A2DA 2IAAC 3D12B 2GHZA 2DV6A 3OQRA 2YAMA 4NAJA 1SF3A 4YVNA 3NJHA 4YSTA 1KGYE 4UANA 3PXLA 4G7QB 4F2FA 8PAZA 1CURA 4E9XA 2CAKA 4AKOA 1KCWA 1NIDA 3DIVA 2BZ7A 1HFUA 9PCYA 1WA1X 1AS8A 2PCFA 2GC7C 1GS7A 2DWTA 3CVCA 3NSDA 1J5DA 3ABGA 1ID2A 1NTDA 1SDDA 4AKQA 1AZRA 1CUOA 1YLBB 1NIBA 3PAZA 1BQ5A 2PLTA 3CG8A 2BP0A 2HRGA 1L9TA 4A68A 1ASPA 1BXUA 3UAAA 1BQKA 2OCCB 3ASNB 5AKRA 3SBRA 3S8FB 1AS7A 5B1KA 3UACA 3QQXA 4DP9X 1EZLA 2P80A 1VLXA 7PAZA 3NSFA 1UATA 4KOCA 1HAWA 4HCGA 5A7EA 1SF5A 1AG6A 3FSAA 1BYPA 1X9UA 3QJVB 4BWTA 1FA4A 3L45A 1KBWA 1PCSA 3MBWB 2BW5A 2XV3A 1KDIA 1NICA 3FU7A 3SBQA 2XLLA 2BZCA 1JOIA 5B1JC 3PAUA 1TEFA 2FQEA 2IDQA 1ASOA 2QT6A 4G72B 4NERA 2YAFA 2I7OA 1XB8A 3V9CA 4A2EA 2TSBA 1OCRB 2FT6A 3UGEA 3T71A 1JZIA 1PLBA 3PPSA 4NB7A 2QPDB 4JHVA 3IBOA 1NPJA 1EHKB 1OE1A 2HX9A 4G70B 3FSWA 1OE2A 1ET5A 1M56B 4P5SA 2UX6A 4YSAA 1J9QA 1IKOP 2BP8A 1ZIAA 3NJGA 2WO3B 2BWDA 2J57A 3NYKA 1BXAA 3FU9A 2UX7A 3EH4B 4BDVA 4FAAB 1ZIBA 3X1BA 1ETJA 3TBCA 2AFNA 4TXVB 2IDFA 1DZ0A 2YAEA 4M4RB 4A67A 4DP5X 3WKPA 1TKWA 4DPCX 2B08A 2P80D 1IC0A 3CVDA 3N2JA 4QLWA 1JZGA 1GR7A 4DP0X 4YSUA 3H4FA 1JVOA 1F56A 3TASA
chains in the Genus database with same CATH superfamily
3KM1A 3VA6A 3MLPA 2R39A 4MMXA 4LSQH 1ZLUK 1IAIH 3GI8L 4MNQE 1ZHKB 3SD5A 3HLAB 5JPMB 5I1AA 4PRHE 2LLGA 3FYIB 1Q38A 3VXSA 2WXFA 5EOCL 2MCMA 3IS1X 3IFPA 3P69A 1ZDQA 4KK6C 1KLGA 4W70A 2Z4QB 3P0YH 1FL6B 2HTLC 5JXEA 1AGEA 1T66C 5D7LE 1AGBA 2PUQT 2CO3A 1OM3H 3JUZA 3RWGB 3KYNB 4XBMA 3SYPA 2WC7A 4NC1E 3EDKA 4NM8H 1IGCH 3KLAB 2DQMA 3KCWA 1L7TH 3GJEA 1D5MA 4X9GA 4PJCA 2IMMA 2EEBA 2NNXA 4L9LA 3ZGIA 4DTGL 4M1DL 4BK4A 1DSYA 2F53D 1JNJA 5A40E 5LNDA 4ZMYA 1P7QD 4NZRL 1MRCH 3HBGA 4O4YL 1XEDA 2ALAA 2Y2TA 4Q9RL 3RWHB 3ZL4L 1IFHH 1S2EA 1WIOA 2IANA 1P7KB 4ISVB 1V55B 4HOZA 3MNZA 3DX9A 2PETA 2EDRA 4XAKE 2ZX7A 4TUJA 3CBKB 5DJYA 3OKEB 3MUGA 5C0NC 1JWSA 2Y9RT 4K8RH 5E8EA 5JO5A 1XBRA 2W9LA 2H6UA 3FUIA 3LD8B 1SOQA 3L3GA 3D2UD 3V4PA 5DEJA 5DQ9A 2FO1A 1H9VA 4ZAKC 5A16A 5JIQA 4G6AC 1JPGB 5KJ4A 1IQDB 2WXPA 2ZQKA 2EXSA 3B9VA 3RVTD 4DFHA 5E9DB 3DPBB 4D9LH 4WO4B 1EJFA 5E5UB 3U2JA 4JFHD 3LKNA 4LLMA 5DCCA 3RTQA 3OWRA 1KJ2L 4O02L 3HCVA 1E4XI 2XFGB 3UP6A 1TNMA 4MQSB 1TPXB 4ZOBA 1RIVL 5DVPA 1R3JB 1BJ1J 4LBAA 4K5NA 4K23L 3HI5H 4CBZA 2IADA 4MHHG 2HTKD 1DVUA 2YOAA 3ESMA 5AWNH 1T2JA 3MR9A 4ORZC 5CWSA 4RVBA 1G7IB 4NRZA 2X44D 3BN9D 4N2NA 3WNIA 4YSSA 3LZFL 1H6FA 2VJ8A 2OCJA 3ZO0A 5F1KC 1SLUA 1N59B 2XVBA 1MFCL 2OL3H 1IC7H 3CDZA 3D51A 5FYJE 5KSUB 1AXTL 2OMZA 4H26B 2FBRA 4EJ1C 4IYKA 2HA1A 1A22B 5DHDA 4IS6B 4XVJL 2BIPA 4A04A 2O6DA 1IMHC 3V9FA 1U8CB 1VJSA 2YD1A 43CAA 2EKJA 2XA8L 2MCAA 1FZOB 5KSBB 1QUNA 1WFOA 3ZHFA 4FXTA 5I8CA 3DO3A 3L2NA 5GISL 3ZE1F 1FZKA 4OJYA 2P5EE 2W9DH 4GW4A 4LL4A 4N0YL 5T3XD 3ZN6A 1CBVL 4U49A 4CMMB 1WEJL 2FE0A 1M2VB 1Z3GL 1P4LB 2HT3C 3Q06A 3MRJA 3ZQXA 2F7OA 3KXFE 2KKQA 2CLZA 4Z7UF 4B6ZA 3K5SA 1FNSH 2VDPH 4U1HA 4XHQA 2DQJH 5F1NA 4PY8I 1I1AC 2XXFA 4FQ2L 1MHPH 2UY6B 4QY8B 4F7EB 1NUGA 2R4SL 4PW9A 3DSFL 4ESKA 1HJCA 1AGFB 1MWAB 1N5AA 2WXQA 4DT2A 3PGFL 3FQ1A 1HZHH 3AGWA 4GW5A 1E4KA 1CBVH 2V7HA 3G6JF 1XB3A 4Y16A 5EBGA 3ABLB 3FCTA 2CGZA 1RP9A 4Q6IA 3UZQA 1Y0LA 4B97A 4HS6A 4OLZL 3AROA 1D6VL 5A2IH 1OP3H 1I4FB 3BLKA 1CXEA 4HOMA 3SDYH 1FYTE 1BGXH 3IYLW 3GC3A 6PCYA 2VAAA 3L08A 1UH4A 2YQ2A 3BPOB 2VXUL 3NPSC 4KC3B 3WN5A 4OD3L 2IEPA 2GJ6B 3FOMB 2CKBH 2VRQA 3GHPA 4J3VA 3AAZA 5D1XE 1YUHB 2UWEB 2IPKA 4A7GF 5IJCC 1ZK9A 1K3IA 2VZOA 3D06A 4B9JA 4C83A 5I8OL 1WISA 2IANB 5J5EA 3T3PB 4KRLB 1MQKH 2CJTA 4KX7A 1LP9B 4AIOA 2BY2A 4N9GA 1EGJL 4JFDD 2ARWA 2WLMA 1HIMH 4GXFA 1YC7A 3S34H 1J87A 1NC4A 3OJVC 5CD3B 4POZC 5LGHL 3HUJE 2Z31D 4KDTC 5KBMA 4IOIB 2MEJB 3F7QA 1FCGA 5G2NA 1VEMA 1ZTMA 4LHUA 5HSFA 2R1WA 2IWEA 3JWDH 4TUUA 1HZKA 3DV4A 5TH2B 1N5YH 2ZXAA 3N42B 5F7AA 3HG1A 3AU1A 4TN9A 3IFPB 2WWKO 4WUUA 5ILTH 2Q2LA 1XF1A 4LDLB 1A7RL 1JTPA 1JF6A 2ZCKH 2XXGA 3RL1A 1OQOA 2VC2L 3L5XL 4OZIE 5L8LB 1CCZA 3IVKB 4QYOB 2YA2A 3SB3A 3VXQB 3W3BA 4BUGA 1AZUA 1VEPA 2VQUA 4XMKL 4PLKC 5ACMA 1OCCB 2X42A 2HRPL 4HK0A 5CZKA 1P4BH 5F7EL 2YC1A 4PRDB 5IVXF 5D71L 2ITFA 4DGIL 5J6GA 3PWNA 3EUDA 3HE6C 2JK5B 1SUHA 3QJQB 4LU5H 2B14A 5D4JA 4D3CL 5DD1H 4X80L 1NC4B 4S1QH 2B3IA 2EH7L 1BEXA 1ZHLA 2JWYA 1QO3A 3NJJA 1USZA 4WUKH 1SOXA 3SE6A 4XWOD 3WO4C 4Y2NA 2HWZL 4W9EC 3EYQC 5DEZA 3WEXB 2YK1H 2R29L 2YZ1A 1FVCA 1IKNC 3HS8A 3GLAA 2FWLB 4PTTB 2Q5BA 2H0PA 1HHHB 2DDQH 2P45B 4MQ7B 4LFHD 5AZEL 1H5BB 3HRPA 5BZDB 4JAMA 4J3XA 3HG1D 4XAKD 3LN4B 1Q0XH 3T77B 1K8IA 1UG9A 4IRZA 3DA0A 4LEOB 3KPMA 1JNNH 1AP2A 4HCRH 2VDPB 1NCDL 4L5FE 4YFLF 1UD5A 5BS0E 1IGFL 1TJHL 3LQAH 3SGEI 4MXWH 4Z9KB 1JMXA 2XQYK 2YEZA 4X9IA 2XQBL 3QO1A 2CU9A 1PMYA 3LPPA 2DJMA 3V2AR 2CWRA 3CFEB 2Z1KA 4NN5C 4ELDA 3NBNA 4Y4KB 2XBTA 1HOCA 4F24A 5I1GL 3ZDXF 3A0OA 4HV8B 3I9PA 1Y07A 1H15B 2I7SA 3MRCA 4CVUA 2K7PA 4MTMA 1NEZA 2VXSL 3LNEA 3JV5A 5D7IF 3VXTB 4ONGL 5AFAA 5C0CB 5H94A 5A2BA 3A24A 4ODVH 3GBEA 1QTPA 5AW0B 5HDOA 2R2EA 2NSQA 3Q8BA 3PDOB 5I19L 4RX4A 4JR9L 3WIHA 3EOAA 4ODSH 4WI9A 2EEDA 3WY1A 3L48A 2GKIA 2VAJA 5FW6A 1K4CA 2IAMA 4N9GB 3QEGH 4ZAKD 4DGYH 4APQB 3MDJA 2BSCA 2WVUA 5E1HB 1AHKA 2JKLA 3D8MA 4NZUH 1NFDA 4U1JB 3WIIH 1XMWA 2BM3A 4WO4D 5DVLA 5JHLA 4G9DB 3RLSA 2ATPB 3T08A 1YEEL 5AENA 1YO4A 3ZZ1A 3A4EA 3ALPA 4L1LA 2EDQA 5GRJH 3ECVA 3VQ1C 4E68A 1OZUA 3VXTA 5I15H 5K69A 2FSDA 3TO4C 1IKFL 4XPHL 3VW3H 4CN1A 5IFHH 4JGJA 4LXFA 3UYPA 1XWVA 3HUJF 2IAND 2HAZA 3MUJA 3NIGF 3NN8A 3TJEH 3WNOA 1I1CA 3QR2A 4G59C 5ERWB 5FW8A 1S78D 3QO1B 2E3VA 1CD0A 2GSIB 4A38A 1MIEL 4JFPB 2AVGA 2VLJE 4WI7A 1HSAB 2O1AA 5HHNA 3H42H 5AAWC 4XMUA 2MCG1 5KVEE 35C8L 4LGSB 4BK5A 1D7BA 4JO1L 3DIVA 4JPIB 3VFNA 3L8QA 3WFZA 3OAUL 4X7SH 1ODUA 5IQMA 4JRFA 3RJOA 1KEGH 1MVUB 3WE6A 2NZ9C 4NZFA 1T6BX 5EBWA 1ORSB 2EJ1A 4PGCA 3C5SB 4AH2B 1CU4L 3HE6B 2FYYA 3ATBA 4X5XB 4YHML 1CUOA 3W9DB 4NC1C 4XBPB 1LO5B 3MLWL 1ZA3A 3OZKA 3EIFA 3DUSA 5C0IA 1NC2A 4OJCA 4HULB 3BZFA 4OGXL 2OCCB 1MCPL 2VDOL 4R7XA 3VI4E 4Z77B 1HWHB 2J12B 3FSOA 1J1PL 4L29A 3CIAA 1HAWA 4UQEA 4O51A 3BP4A 3E8VA 2BY0A 1JGLL 4M4PA 1JN6B 1KTCA 5FGCB 2EDJA 2XV3A 2ESVB 3F7YA 4G1MB 1E43A 2HMID 1S7SA 1G6RH 5DRWB 2JH2A 3ULSB 3BGAA 5I1CH 1TQVA 2NR6D 2X4QB 2MNWA 3FO9A 3FT3A 3QZWA 5GS1A 5GGTH 1A1MB 5JQ6L 2ZIDA 4H5SA 4YGVB 2EIBA 5JHLH 2OI9C 4EVNB 5JHMA 1KNOA 4H8VA 5BO1H 4R3SA 3VGEA 3CSYA 3B37A 3ML9A 2WQWA 2ZT9C 4FZ8H 2OL3B 1JHTA 3R06A 4GRWB 1BQSA 4PVBA 1WRFA 3T3MB 5CIPA 2J2ZA 3UGEA 3WFBH 3H85A 2Z91A 1LTXA 1WEJH 1A3QA 2WINA 2HX9A 1G43A 1KBBA 3STLB 3KJ4C 1N5YL 1AI1H 3WNLA 4E0RA 1A3RL 4CBPA 1M56B 4JE0A 1RZKH 4P46C 1UD8A 2B1HH 4FMKA 4X6CF 3LRSA 5E2VH 3EOTH 3GRWA 5EA0L 5HDLA 4WV1A 1C1EH 1K5NA 1MAML 4B9IA 3GIVB 4AEFA 4D8OA 3MNZB 2WLJA 4R84A 5LXGH 4NQVA 3NN8B 2IFFL 2BHUA 4MNGB 3SPIA 1MCIA 1VZIA 1XTLA 4KKCC 3CFQA 5ALBH 1MWOA 4EO5A 4X8JB 2VJXA 2FB4H 2VE6B 1OT4A 2D7PA 3V4VL 4QHLA 5DURD 2OR9L 5A3IC 3DV6A 2I07A 4HWUA 4JFEB 4EMZA 4BZ1H 1Q9LB 2JKJA 3BJ91 4UT9A 1N0LA 4V2BA 2BRRH 3NEXA 4NZJA 2VDML 2VO8A 1J11A 3N41B 3LPFA 3LZNA 3AMLA 4HS8L 4XN1A 2HG0A 2XTJE 4PYGA 3HG5A 2EO7A 5JOEA 5FW7A 3TCLA 2C1OA 3MFFA 4L8BA 1NPUA 4QKXB 5HY9A 4P5TB 1KYUA 2ZAIA 4LARH 3ARFA 1ZVSA 1XF5B 1KCKA 4EUPB 4DHLA 1MCRA 2A9NH 3AGVA 3LPGA 1GY2A 4DGVL 4ZUSA 2RMNA 2BH0A 4LB8A 1X7QA 4AC4A 4O9HH 2LLNA 3DX2A 4JRXB 4LCIL 3BPCA 5E9DE 1VFAA 5B38A 3LZOA 3H8NA 3SO5A 4P3WA 3F7YB 3ZOAA 4HQQH 3MNMA 4YK4B 1OAZL 2PR4H 4RFOH 2QPUA 5CKAA 3PG2A 3IGFA 3MJGX 4DK5A 2FYVA 3MV7B 2B4CC 5EMYA 1YEFL 3W56A 2DQHL 1CL7I 1OTTC 3GI9H 3D85B 5ADOL 3UBGA 2PTUA 3EGDA 3RGVA 4PP2A 4GG8B 3CZFA 3U79A 3NDZE 3E6FB 1SDDB 3NCJL 4WLCA 4G5ZL 5FYKE 3QRGH 3NRPA 5IQ9A 1UFGA 1OT2A 4G8IB 1FVEA 5BV7B 3NEEA 2E56A 5I73C 3H2WA 5EOTA 1F4YL 2X9WA 3CFNA 1KLFA 3BGMB 4HU8A 1JCKA 3APNA 2DLGA 1BZDA 3WEAA 2F6AA 2I9TA 4FQJH 1SOKA 3CFBA 1JV2B 4XP1H 2B0SH 3OJ2C 2BSTA 5EEWA 1B4JH 3FB7A 5KSAD 1KXHA 3CNKA 2QQKL 4KZEH 4F20A 2DYPD 4G80A 1S6NA 2CR6A 2I26N 3R1GH 3NEOA 3UBFA 5J6SA 2Q76A 3BX7C 4UV4L 3JBG7 1KOAA 2AAAA 2ZCZA 4BIKA 5IVOA 2D9CA 2Z3FA 1OP5K 4FQHB 4ZODA 4K3EL 3UJTL 1HNYA 1PDKA 2V5MA 5F7KC 1P53A 3GHEH 4X7CC 2CO6B 3CSGA 1SOSA 4N2DA 3NA4A 1F3RB 4XNUH 2EVFA 2X4OA 1ZVHA 4LRIA 3SZ6A 2LVEA 3UYPB 1XSIA 4OAWB 4YDJB 2XZCL 3Q5YA 4RGOL 2CCWA 4Y1AD 4P4RB 1OCOB 5BRZE 4JLRB 3VDBA 4P2OD 1YSOA 4ZPTB 4UQ2A 4IU2B 4LCUA 4A7SA 4TLSA 3D69B 2DQUL 2R23B 4UNTA 2Y1ZA 3GBDA 2I69A 4HD9A 3QNYA 2OW7A 5FO9A 2CUAA 2ZPKH 1I3VA 3QR1A 4W6WB 1F4AA 1HHGB 1N12A 4JFYB 5F6IC 1QFHA 1GPOL 1HWWA 3T8MA 1YN6A 3OAYH 3RA7H 1XR9A 4FFTA 3S88H 3BD4A 4MNQA 1QHQA 2ZKHL 1LMKA 4ZAKA 2Y07H 2KDGA 2OULB 4ONFL 4Y9GA 4B3VA 2BK8A 2EXWD 4AOFA 5IB1A 4LSTL 1TZIB 1I3UA 4MCYB 1IKFH 1YMMB 4RDBA 4XPHH 5G55A 1TZAA 1N7MH 4CU8A 3VW3L 1NINA 4PS4L 2NXZD 2NSXA 4QYAA 5AG8A 5GZND 4IMLB 1PKQA 4FG6C 3L16A 5L0QB 3P11H 5JMRA 4EAEA 3U0WH 1KY6A 3QDJD 1JWUA 3KZ8A 1W72A 3DYOA 2BS9A 3UEQA 4BXSV 3QEGL 3FO0H 4WEBH 3DOHA 5C0BB 4ZFZA 4P2YA 2C1OB 5JW3L 2FGZA 3MRNB 5TDPA 4OCYH 2JIXA 1SHSA 3T8VA 2WZ0A 1QSZA 3R0NA 5EOTB 2V8MA 2FD6H 1EUUA 4L05A 4P3CL 1MI5D 1ILSA 4PYHA 4TSAL 1FNLA 3PWUA 4FHBD 1ORQA 2VXSH 3O4LE 1GL4B 2Y06L 1MZZA 5LNGA 1H5BA 5BS0B 4FEMA 1MXDA 4L5FH 1CDUA 1UVQB 2RTTA 5DEGA 2YPVA 4PTTA 3ULVE 2I9LB 5DUBA 2B39A 4QWWC 4MMXC 4J12A 2OM5A 1WBZA 4UZSA 2XCMC 4I3GA 4XWGH 4XVSL 5AOKA 5LGJB 4FJZA 2RR3A 3D2TA 1RLWA 3QJSB 4OGQC 2BJMH 4O5LH 5BW7C 3MV9A 5DZLA 3LZQA 3EGXB 2CIIB 1T5WA 3WIFA 1S7TA 4YBHA 2FSEA 2CBOA 3IJSA 2DLEA 4G6FD 5GRVL 3ZTJG 4N0UA 1UEYA 25C8H 1IVTA 3PAYA 2PCPB 1J8HA 3CHQA 2X1WL 3FU0A 4JO5A 2R7EB 1YEEH 4QAMB 3QJUB 3BJLA 2EDKA 4QT5B 1Z9SB 2BIMA 3P0VH 2QTEA 1OAJA 1SJHA 3FTYA 4XODA 1LD9A 3CVBA 4JM4L 1OP5H 5L4FA 1BW8A 2EEAA 3QUYB 1QUPA 3K4ZA 1UXLA 2HG5B 5L6YH 3BCFA 1G7HB 1CLCA 1TITA 5IB3B 1XEUA 2DIAA 3GMMB 5DLMH 1KJ2B 4O02B 1OSPL 4JY5L 1VZHA 2ITCA 5EO0B 2P46B 3UG3A 1E0OB 2VL5B 4JN1L 1X9RA 3OPUA 5TE4H 3OSKA 1XIWC 5KSAB 1OY3B 3VTTA 1MH5A 4K7FA 4AG4L 1ZHNA 5BOJA 4P9HH 1JPTL 3QULB 4NPJA 4WTQA 4ZUWB 4B0MB 1AQDB 4AJVA 4B0MM 1UD3A 2P9RA 3ZDXB 4FNLL 1E5YA 4JE4B 2OCFD 4QRQB 2Q7NA 1FDLH 3WE1A 4I18A 4OVUA 3RWFB 3VFGH 3WL9A 4HWBH 1QSVA 1JYXA 1A6VH 4QKTA 3C60C 2AERT 1KG0A 1A65A 3IDUA 4G8GD 3US9A 2N56A 3CXHJ 5LDSA 1AZZC 4GUPA 2VDQH 5C9JB 4YVUA 4KAQH 4BFJA 3JQOB 1J0JA 3H0TA 4MKMA 2ERJC 1PZSA 5INCA 3SN6N 4YDKH 2GJ6A 3FOMA 3FAWA 2GABA 3PV7A 3PCYA 1RZGA 1TTGA 3AUWB 5HHPB 4YHNA 1DE4B 1ZE3C 5KG9A 5JW4M 5T1MB 1IBFA 1GTFA 3HZVA 3DOSA 5J3HD 5IEKB 1WQVT 3JXAA 4LLAA 2KPWA 2WB1A 1FH5L 1X9QA 3CTTA 1E40A 2F54A 1VGEH 1AGDB 2YMXL 3QRFM 3H7BA 3VFOA 2XICA 3RILA 3NJIA 1TQCC 1JXKA 4LP4A 4XX5A 1P9MA 2KZWA 2CGRH 4QRRE 1KBVA 4XC3L 1BBJA 3VWJC 5I1KL 3DTUB 1CFMA 5ICZA 2F53E 2Z93A 3I02A 2WTRB 5AVVB 3GXIA 5HHXL 1RJLA 3W9EB 4PJ8C 3ZJAA 2D7OA 3KVPA 4URTB 4IOFD 1QYGL 1U6AL 5FHAL 5I76B 3US0A 3VFPB 3DNKA 2OPCA 3FHEA 4ZMXA 4D3CH 2QSQA 2Q8AH 3SDDD 1N26A 4GIPD 2ZYRA 1T0NA 4OB5H 1J8HB 1Z9PA 4P9MH 4KNQA 1GIGH 3PREA 3TGXA 3K2UL 3NH7H 3FBKA 3F64A 3HZVB 4Q7DA 3FRPB 1SY6L 1U30A 3MFFB 4XPGL 1DUZB 3FUEA 3EOTL 5HVHC 1AH1A 2DQFB 2R1XA 1DLFL 3IU4L 3NCJH 3QR0A 1FFPB 3ZKXC 4BRVA 3LIZA 3HC4H 3O2DA 1IO4C 4NAJA 5GRVK 1GH7A 1J0ZA 1CFBA 1SYVB 1JV5A 4FFVC 3QAZB 5D7IE 4NQUA 2BIOA 4KJYA 1GIGL 3DRQB 3ZDXE 5FGRA 5BRZA 4ORGA 4Q0XH 3MXWL 1EFXD 1R24A 4M61B 1I8MA 1WLHA 2K45A 2H32H 4FADA 4LCIH 1AS8A 2CR0A 3FB6A 4XPGH 1JVKA 3O2WH 3T2LA 4GT0A 4YAQB 4MJ6A 2AKRB 1O5PA 2Y7QB 2DBLL 4WWKB 2H9GB 3JWNE 1KACB 2LW3A 1NEPA 1E4XH 2JIXB 4XXWA 3UBXI 3D4GA 2L3BA 5CO1A 5GS0C 1YUKB 2BP0A 3MGTB 1G9EA 2HRGA 3ESNA 1S7RA 1BQKA 1HHJB 3QDAA 4H0IA 1XH3B 2PCFB 4LVOC 3WNMA 4M7KL 3UYRL 1VLXA 5F7FA 1MF2L 3LH9A 4NQDA 2HT2C 3FSAA 3M17B 1QABA 3QFJA 3GSXB 5HDBB 4NLAA 1R3HA 2Y2YA 3G6JE 5MHSD 3BN9C 4X6DE 3O9WB 2JKXA 2ZD0A 2H26B 2C4XA 3H6AA 4ZW8A 3QP3A 4JY4A 1UUNA 1ASOA 4NKIH 1MFBH 1MLBA 1W91A 4PJBB 4Y1TA 5E2UH 3RL2B 3ZKMD 5D93B 2CHZA 1HYSD 2NY1D 2E27L 5C0CD 5D2LE 1XB8A 1EX0A 3MFGB 2OMZB 4H26A 1CLZL 4TQIA 3CK0H 1IAMA 5A6MA 4OZIF 4NB7A 4U3SB 2QPDB 1LDPH 3K72B 1OLLA 2LVCA 5C0CA 5BOZG 3VXPB 4MMZC 5CCKL 2FJFA 4QD2E 2BVQB 2XN0A 4NI3A 1I7ZB 2V2XB 1BOYA 2FHBA 4H0GA 1U3HD 2FGWH 1YAZA 3MV8B 1IL1B 3EHBD 1EAPA 2J57A 1MAJA 1QPXA 2DLHA 3LH2L 3L3IB 3O3BA 2VWEC 4K8RL 2E27H 5DJ0A 3N1PC 5EU3A 3TJHC 3V6OC 3BVVA 4HZLA 1HEHC 3CVDA 4AQ8A 4NYLA 3GJFB 4PRHB 1NDMA 4OBRA 4ZQKA 3EYFB 3TF4A 2NUTB 2IBZY 5DJAB 3IAGC 4Y4FA 3RIFF 3FN0H 2VXQL 4XCNA 2K0RA 5CILL 1D5IL 1TLMA 1FPTL 1W0VB 3U2SA 1NAMB 4IRSB 4WGKA 3BD3A 1A1OA 4MAYC 1Z1WA 3PDDA 3KEDA 3GSRB 4IBWA 1R3IH 1ZLVK 1MFEL 4YC2C 2ID5A 5AKTA 5BZXA 4TSBH 2LT9A 4WFFE 3WJMA 4I89A 4Q9QH 3UTSB 1QFWH 2VN3A 4F8QA 5BVJA 4JUSA 2XTSA 1ZOXA 3ZXAC 3TPUB 2ORBH 3QZPA 1GXEA 2J43A 4O58H 5EPMA 1TSRA 1AD0A 1I3RB 3FUFA 1FYTB 4J6RL 1QRNA 5CR8A 1OPGL 4HLZG 3QDMB 4ADIA 1F4HA 1O75A 5E2WL 1B90A 1CXIA 4Z77A 3HE7C 3MLZH 2NY5L 4KK8C 1RJZA 2AABL 4N8VB 4WUUD 4WKZB 2P8LB 5IGXL 5JXAH 1Q1JL 2EVGA 1EDYA 4YSPA 3EOBB 3FSVA 2AEOA 3HN3A 2D03L 3N9GH 3P77B 1IEBB 3T6VA 1HKLL 2W8CA 4YDJA 5KYWA 2PTTA 5TH2A 2LU5A 3AMKA 3ZSSA 5JZ7C 1JGEB 3BVDB 3UTTE 5EBWB 3BSGA 2X4UA 1MJUL 2NY2D 3O6ML 4P2RA 5I8OH 5I0YA 2P48B 1CQKA 4WFGE 2VQTA 3QFJB 3ALXA 2R59A 2GHWB 2N0MA 1FIGL 5FFGA 3QEHB 4AYGA 4WHCA 1JWMB 3MCKA 4Z7NE 1OPOA 3IMBA 3X13B 3R8QA 2PYEA 4MNQD 1E5CA 3P73B 1BMGA 4N0UB 2ZSVB 3JV0A 3MROB 3DTXB 2VDOH 4EDWH 5MEND 4JQVA 2J88H 3L3HA 3ZTNH 1WWAX 2ENSA 4AEHH 5D7LA 3UBHA 2H0FA 3CVHL 5I5RA 5IJKC 3N40F 1CGWA 4NO2B 1A7PH 3ZZQA 5IHWA 4TULL 4A6YA 1U3JA 5AL8A 1QSED 3ABZA 1PEWA 4V1DB 1QRNB 4AGMA 1KLUB 3VYNA 4S1SH 4YWGL 3SKUD 3VXPA 4YSQA 4FABH 4ZFOA 1OW0C 3JT2A 4R7DB 4NBYB 5IROC 1E8YA 2RALA 5BXFB 2NUPA 1ZK5A 5EN2B 3PQYA 1AXSA 4HMDA 4EBQH 1Q1JH 2BSRB 2Q7AA 3T0EE 4NFCA 2O61B 1DDTA 4LDEB 1GGIL 4DZ8A 1VAHA 1VGEL 4UUJB 2C9VA 3OKLB 3HC4L 3MRNA 3TA4D 3GHBH 4R5XA 4YDKL 1EAQA 4KKBC 2CGYA 1MJ7L 4XNQA 1UZGA 3O8XB 3WJLC 1QNIA 1MW2A 1BEYH 3MNWB 3EYFA 2PF6A 4F1ZA 1F3JB 3R0MA 4UBDD 5ACZB 2WLHA 1P6WA 2F7IA 4AEIL 1VACA 4NWUH 5D7SL 4QRPB 1QYGH 1VB9A 5FHAH 2FVNA 1QW9A 2YQ3A 3VI4B 5I0WA 2O72A 1CZ8H 4O2EB 1AIFB 2Y2WA 2A6IA 3I6KB 2VABB 1FV1A 4HS3B 3MLYH 1GJIA 2BO0A 2CBTA 1HSBA 4L3CB 3MGOB 2X4SA 1XR9B 4UM8B 4YHLH 1ZWIB 2LR4A 3V4VA 5ISZD 4TTDD 2TRYA 3MCG1 4U3SA 4I3SL 4MD0A 3FCBA 1BXXA 2UY7A 4XXCC 4M62H 4AJ0A 4NZDA 5D7HA 3TP4A 4HS8H 2FIRT 1YY8B 2Y6SD 2L7JA 3FT2B 2ZXDA 1S5IL 4ZT1A 3HMXL 4IIZA 3TF7C 1U21A 3II2A 5F88B 5I26A 1KDJA 4ODVL 1AYRA 3G5YB 4N2OA 5JR1L 1JZ8A 3QC6X 3ARGA 3I9GL 3UXFA 2PXYB 3GI8H 2E7DA 2FO8A 4P2RD 5DD0L 4X4XB 1MCJA 3AAZB 1CLYH 4A6YH 1UHVA 5ELIA 4N4YB 4PG9A 2ODIA 4LVHC 2MOQA 3WBDA 2OBGA 5DJAA 5I1LA 5FYJU 4U3CA 1E4HA 3VJ6A 3VFUA 1Q9WB 4ABUA 3HMXH 5T3ZH 1KCRH 1N2RB 4Z7UA 8FABA 2QQQA 3BCDA 3NCWA 2DM3A 4S1DD 1G7LA 4JZJB 4L9LC 2PO6B 4S1RH 2GBTA 4Z7WF 4Z0BL 1TVHA 1QFWI 4Z8FH 3GKZA 4G2AA 2D2OA 3P4NB 4UT6L 2NTFB 5I0XA 5LWYH 4P5MA 2FX7L 4Z7WE 4HWEH 4K9EL 3ESVF 4FFZA 4NAQA 5GGVL 3RFZA 3QIWC 1E9OB 5T33H 1GGCH 3VRIB 4QTIL 3X1FA 1BVOA 2EXYC 5F1OB 2APWA 3PV6A 4DP6X 4HUUA 4AM0Q 2VXQH 3RFZC 1MEXL 2F7PA 4ZFGH 4FL4B 3DOSB 4OLWH 3L81A 4PHZA 1FL3A 4JVWA 1HINH 4YHKH 3UIZA 5LXVA 5KG9B 4CVZB 4Q56A 3HRZC 4X6CB 1QI4A 2ZNWA 5CHNA 4C57C 4GKZB 4G42A 4LCYB 1JFQL 2CIKA 5SWZA 1I1YB 5D1ZD 5DWUH 3FCSB 4YPGB 4AT6A 1LEGB 2VDRL 3GFUA 4MDRA 2Q0ZX 3VFPA 3TCTA 1TG8A 4ZO8A 3MX0B 2F5AL 4A39A 1A4CA 4GKNB 1U3HA 1EHXA 3OB8A 4GG6B 2E6JA 5TQ2L 2ZWKA 3RZCC 1NUNB 5GRUH 4OCLC 4KPHL 1KV7A 5KVFE 1HKLH 3UMTA 2AEPL 2FD6L 4BWWA 1I1AA 5BUGA 5F96L 2BINA 4PJ5B 1EHNA 1NMAL 2PW2B 2X2IA 1ZKAA 4WFHE 2WLLB 2IH8A 1HN1A 3OB0K 1NDGA 1G6RL 3HTLX 1UQSA 4YSOA 1RURL 1HYSC 3WY4A 2Z35B 4O2CA 3WFHB 1IQDA 4DOHE 4ZW5A 5DHVH 3ZE2B 3IFOB 2VM3A 4Y4FC 1DVFC 1YNLL 5JHAA 4O58L 1AGCB 4OLUH 1PX3A 4M8UA 2JKIS 4JM2F 1I8UA 1T7ZA 2FH6A 3B9KC 2VIRB 5I2IB 2R9HD 1A6TB 4OZFA 3VGGA 1XF3B 2XDHA 3O6FD 1E90A 3OG6B 3M46A 4ATWA 1WWWX 2V2WB 3RX9A 2Z7YA 3KS0J 3SKJL 4Y19E 2A3TA 4NKOB 4KTEL 1KTBA 4NQCA 4WTZG 3L95B 1E65A 4HCFA 5SWSB 4JRYE 5IW1A 1CD1A 1Z9LA 5E9DD 4N90E 3VG0H 5B1AB 4AKPA 2FECL 3U4BH 3VCLA 4I4WB 1BIIB 2YO3A 1UVQA 5DEGB 4GQQA 2JB5L 3TVMC 5HYSG 3UO1L 4NS0A 1D6VH 4O2FB 2B1HL 4PJBE 3L1OH 1KEGL 4PQXA 5E2WH 2XWDA 1ORQB 1AGEB 4KAQL 4XCEA 4YGVA 4YXKL 4JLRA 2GHZA 4BK8A 5D1XD 1SF3A 3UAJA 4NKMB 3NJHA 1H3PH 2K8QA 4N25A 4Q74A 3VG9C 3VXNB 5L9DH 3C5XA 4PJ5A 4DVRL 1F1AA 4ANKA 4EIZC 5ANME 5FF6A 2GTZA 4R9HA 1NIDA 4M7JL 5E51A 2CHXA 1U2YA 1MJJB 4XO9A 4DKEL 5JW5B 3GUTB 3GD1C 4BKSC 5JMOC 5HI4C 1A7PL 4GOSA 4CVXA 1UACL 2VERA 1H8OA 4I2XA 3BAXA 4DGWC 2WWMD 5DLLA 2G3ZA 3D3VE 1MCWM 4MA8L 1Q9OB 1VFUA 3ABGA 3WS6C 3CC5B 3MUY1 5DJYB 3QVAA 4GMTL 1AZRA 4L0YA 4GSDH 3QGVA 5MEOB 4MD4A 2CK0H 4TLKA 2ADJA 5EF3A 2DEXX 1NBYB 2Z9TA 3G7TA 3GS7A 3GZPA 1ETZA 5FM4A 3ASNB 3GSNH 2IQ9L 5H37A 3A4AA 4XBGA 2QSVA 4XNDA 2YA0A 4URKA 3IAPA 1JCVA 1BYPA 4K0OA 4OM0H 5DRZA 3ARUA 1P0SE 4HJGB 2NY3B 3U7AA 2EUXA 3SZKC 3K8MA 3WXWH 3QIUA 1GC1H 1VSCA 1IBBA 1PFCA 2ZX6A 1G6VK 3ZL1A 1ZHNB 2AXFB 2N0KA 1VFBA 1ZGLM 4I1RA 4Y88A 4PVMA 4GQRA 4HT1H 5IP4A 3P2BA 3WNPA 4LU5L 5AOZA 4JG0H 2PR4L 1WFIA 3NCMA 4RFOL 2QT6A 4IM8A 1ZTXL 1IJNA 2X1XR 3DVIA 4A7GA 4N0FB 4NOBA 3MV8A 4JREC 3GBMH 1OCRB 4F15B 1T21A 2ALWA 3RUGA 1F4XH 4GKOA 4QTHB 4JDTH 2X6CA 4U7KA 2ZX8A 4JHVA 4DQOL 1M2VA 2DQUH 3QI9D 1N6QL 3QI9B 4AXWB 1D5XB 2D2CC 3ARDD 4Z7IA 3WS3B 5IMOB 3FTGB 2EO1A 1M3IA 1MXGA 2UX6A 1J9QA 3CN4A 4NC2B 5ILTL 1LP9E 1WCQA 1YHPA 1NMBH 5HP5A 3ORJA 5I1LB 1NGQL 1CGSH 3EJZC 4Z3FA 5D1XC 2ZOTA 5CZXC 3FU9A 4QRRB 2UZYA 3VQLA 2H3NA 2XPGB 4MASA 5I1IH 2RCSL 2XN9B 5EC2B 3GSVB 3OKKA 1DVZA 3MV9B 3UIYA 5DJ6B 3UDWC 5C2UB 2X6VA 1D6EB 3SE8L 1JZGA 1YN6B 3CAFA 5E24E 4PLJC 1FIEA 3K2KA 2OTWA 5EV7A 4X83A 1WSST 4S10A 1HIML 2F8XC 3M17A 3UTQA 4G8IA 2EE9A 1RK0A 5IQ9B 1S9KC 1CFQA 3NGBC 3OWEA 4HJ1A 2G3XA 3GBLA 4OIBA 4R26H 4WFED 4ZBJA 4I85A 3UROR 4GH7B 2BX5A 4Y1SA 2OZNA 4MNHB 1O6SB 2X7LA 5B7MA 5CU5A 3DDFA 4LSSL 4QF1B 2VR9A 4LL9A 1E4WL 1JZEA 4PGZA 3GT6A 3CFTA 3RA7L 1XH0A 2VL4A 2KZBA 4Y2DC 2IC2A 5I71B 2EINB 2Y7NA 4K4KA 1DVFD 1V3KA 2ZSVA 3P1VA 4X0NA 5DGQA 1IAIL 3FFDB 2ZWLT 1AP2B 1UC6A 4DVBA 4FKHA 1GZHC 3V4UL 1KYOK 3IXAB 3KYOA 3DETD 4PN6A 4RGMC 1WAPA 4GSUA 1M6OA 5I8KL 1EEQA 1U2HA 2ARJB 1LEGA 4IU3A 2XWBA 4P2RE 2GC4C 4G7YL 4M3HA 1S7UB 2VMCA 2YMOA 4U2YA 3REVA 4Q89A 3MZGB 2YBRA 3CFKB 3BGMA 1QMUA 4IRJA 1GGUA 1W6WA 4UUJA 3IGAA 4GMSL 4M6MH 1INDH 3QXAB 1PFOA 1PCXA 1RIHH 1U8CA 2A74C 4LLYB 4BZ2H 4DETA 4Z78B 3MTXA 3NRQA 1QTSA 4FNTA 4I9XA 4AZUA 5CCGE 4JGMA 3F2LA 2P8LA 2BPBA 4XR8C 2G0KA 4CC4A 4O51B 4FQIL 1ADWA 2W38A 4Z3HA 1FE8L 3ZYJA 3FO0L 2JJUA 5AYUL 4P2QD 3BFOA 4HKBB 1M42A 4QXUH 4BSVB 3IKCB 1CS6A 3CHRA 3Q2WA 4PGEB 3CPLB 4UM9A 2BOBA 2KQMA 4JFFD 4QO1A 3L13A 3P4NA 3VXUD 1ZY9A 4GFXA 1M6UA 1TVHB 4MAYA 3R4RA 1AIFA 3D39A 1IGML 2PO6A 3B4NA 4J4PA 4CNIA 2W07B 3W0WB 2V9TA 1E7UA 2EICA 3TNNA 1PZ3A 3WEBA 5ITBL 3ZE1B 5T33L 3WMPA 4DP2X 4KMQA 4JJ5B 5IQ7H 1ODAA 4FI6A 1KB5L 2DMBA 4QRTA 4LCWA 1QR1B 3QUZC 4Z7QE 3GRWL 4E0RB 1NMAH 4FXKB 4H8WL 1DDHB 3FAXA 2EDMA 4B9YA 1VFMA 2HJKB 2FZ3B 1OOWA 3CX5J 4BHUI 5I8KH 1B0RA 2I85A 2DYRB 2NUTA 4L0ZA 3ZU8A 1FFNA 1BWMA 4NJ9H 2ADGA 4QAWA 3GM8A 1RZIB 2XWTA 3FC8A 5E2VL 3S3CB 4R96B 1XF4B 3O3DA 4ODSL 5TK2A 3QUXA 4YE4L 5JXED 5EUOB 3PLYA 5KVEL 5B22A 1SXCA 5IFJB 2AZUA 3BPLC 3E2HB 4MVBD 4LVEA 5L9DL 2GFBB 3N41F 4J7RA 2I5YL 1GZQB 4KRPC 1EAPB 4I0KA 2OMNA 4HJ0D 2O6EA 4DO4A 3QNXA 4IIQA 1ZA6B 1Y18B 5FC9A 3R18A 5FUCE 3FB8B 3RTQD 4MZRA 3AXLB 2L4OA 7CGTA 5TE6H 5L2KA 1FL5A 3C5ZB 3VXRE 2CKBL 1Z66A 2E75C 4NNYB 1A3ZA 1E28B 5E1AB 4C56D 3S3DB 4KXDA 4HFWB 3EAKA 4LLQA 3S8GB 2QVKA 1N19A 3KR3L 3RDJA 2G30A 2EDHA 2A0LD 1H0DB 2IQ9H 4E9VA 2J25A 2C4FU 3DBSA 4Q9QL 2JNZA 4N2CA 1FN4B 2NNCA 2WXJA 3CN1A 1K8DA 1NMCB 2YSSA 1QTYT 2Z7ZA 3Q6GL 3W0WE 2KZ1B 4RMSA 1MFVA 5GPRA 4OGYH 3W2DH 3Q7JA 5F21B 2PCYA 1QASA 4FDWA 4JFWA 1KIUB 4BK5C 1CYXA 3NVQA 1I75A 4JANA 5G5DB 5L4IA 2EEXA 3C08H 4HUXA 5FUZL 3SDAB 1L6ZA 1QNZH 3ARBA 4MDJB 4PJFE 2J5LC 5ID0A 1YYML 4KHXH 1PJWA 1AE6L 3UTOA 2IF7A 3L3OA 4F33A 4AV5A 4X4MA 1NAKL 5T1LD 1EEZA 2GW5A 1RUAH 4KVNH 1EXGA 4JO3H 1ROCA 1JE6A 4OD2B 3NJKA 3R8BB 3TFKC 4XMPH 5M94B 1OAZH 3HAEG 1IVLA 4YZFF 3WFBL 4OLXL 1EFXA 4NNYA 1Q0YH 1I9RH 1OLZA 4DO6A 2RGSA 4F9PA 4I9WD 1K3ZA 5HVFB 3U6XS 1QD0A 2WN2A 2DQIH 1IT9H 3VFSA 3FQWB 3SHSA 3MRGA 3BIKA 4FJ6A 1NC2D 1A3RH 1HXMA 2IOMA 4F91B 5IK3B 5G4OA 2IADB 4OM0L 4I0PB 3MCLH 3STZA 5AW7B 3SQOL 5C0AD 3TWCH 3MLSH 2B5IB 3BKJL 2R0ZL 1A14H 1KWGA 4JRLA 5HGGS 2NQDA 1G7MA 4G7RB 1WFTA 2UZIL 1AQMA 3DTXA 1KZYA 1KXVA 3APFA 3DX7A 3SDDA 2YLKA 2ADGB 5TF0A 1VPOH 4OZHF 1AO7A 2ZYSA 2CUMA 3OKKB 3SPVB 1SUJA 3U82B 3LEXB 3FRPA 4NO0D 4LLDB 1MCDA 4H8HA 2Z91B 1UADC 4D9QE 2CRYA 1O7SA 3JVFC 4BD4A 5ISZB 4MA8H 4YL4A 4OD3H 1U93B 4WSGA 2XWXA 1AKJA 1A7NL 5HDBE 3FT4B 3NCYS 2J88L 3IMSA 3PJLA 3ZTNL 4J5VA 4OKVA 2HXAA 4X5LA 2V5RA 5CMAB 1S9WB 4FS0A 4EN3B 4NQSA 1U8PA 3TNNB 2VDKB 4TSCH 2M26A 4ZTOH 1OTSD 3I3BA 2WO2B 2MTPA 2WTRA 4AE1A 5LDUA 4UB0L 3APCA 1AAJA 4OIIL 2B9AA 3RRQA 4BFBD 1G4RA 5J13B 1ACZA 4WUUB 5E6IA 4JHWL 2KT6A 5IEHB 1BJMA 4J3UA 2IIJA 3D0LB 3ZMRA 1P2CA 3DX6B 4TQPA 4BINA 1X5MA 2GBUA 2H9GA 3OKNA 4JG1H 3LEVH 3QIBD 1M3JA 1RUPL 3DIFB 5F9WC 5CFAA 1CLOL 1AHMA 4Y9EA 2WBJD 1OAUL 4G9FA 4G8AC 1YEJL 2XC8A 1JZHA 2K9FB 4NQEB 4PB0H 3WD5L 1Q8MA 3NZUA 5EWIL 2QHLA 3K8KA 5F9JA 3HOGA 5EIIB 1A9BA 1ZTXH 4XHJD 2GFBA 2YSTA 1LGVA 4U6HB 5CINL 3TZVB 1AY1L 1KJVA 1GA2A 1OF0A 3VNZA 4EPSA 5JOFA 3V8OA 5CBAB 3MRQA 1CVSC 3WNJA 3EZ8A 3GGWA 3DECA 4F2ME 3SDXB 3U0TA 2ZUUA 3CDFA 3NT0A 4ZI8A 4LKCB 3NJFA 1VPOL 3M6DA 1JRHH 1NCCH 1I8LA 1C12B 2WZ5A 2PWFA 3ARED 3JUYA 2E7HA 4PJ9C 1DVXA 4WFFD 4WJKB 3OM3B 4W81A 3W5NA 3D4YA 1HI6A 3VWKC 1KYAA 5D55A 5HHNB 5DTFA 3GJFA 2EDFA 4PRHA 5IMOA 1UXMA 3SDCD 2R51A 3SDCB 3WS3A 4ETQA 4JFPA 1L7IL 4Q52A 5F1IB 4C54A 4R26L 3F01A 4HPYH 3O2VL 2J1ZA 3KCPB 2CMRL 3LPWA 2Q6WA 1AZCA 4AIZA 1YDPB 4F7MB 3WLWD 3I50H 5MEPA 3DOIA 4RSVA 1ZLSL 4HSQA 3PJSA 4NCDA 5JPMC 2R56H 2YD6A 2GYSA 1F6FB 2JFCA 4DP1X 1XL4A 1JBJA 4HQQL 3Q6FA 4DPBX 2X6MA 4QJ4B 1FZMB 3ETSA 4DQOH 1W9XA 4LHUB 4WCYL 1FHGA 4ZUTA 2X05A 1DCLA 3EDEA 3RAJH 3SY6A 3LQAC 1PQZB 4GXVH 4IJTA 2P43B 1G1KA 3KYAA 2E7CA 4JQIL 4PPTA 3ULVD 5T3ZL 5TQ0H 1FBIH 2I25N 4G8FB 3II3A 3OAZK 4LIQH 5EEXA 1VERA 2JJTA 1QSFA 5HJ3B 5J7CC 1MLBB 3OQRA 4PJBA 3RL2A 2WLNA 2WQSA 5BRQA 2G9KA 3DUHA 1QUNB 8PAZA 1FAIH 2FSEB 4K73A 3IJHA 1U8IA 3QQ9D 2QQNL 3MBXL 3S35H 1KCRL 4WCYH 2FX8H 1HZLA 4FJYA 1QP1A 2JB6B 3QFDB 2KZKA 4M6NH 4LRNL 5ETUA 1NBVL 5JHDB 1J0IA 1MCFA 3L6FB 4JQIH 3QI9A 2VDMB 4JS7A 4LOUD 2NY1C 5CS7A 3CSBA 5L4JA 3ZKMC 2YD2A 1HQ4B 5I8EB 3LZFH 5J8OA 3VXUA 3CCHB 1KB5H 4AZ8A 3ARFB 3ECUA 3QHZH 3FQNB 4IHOA 3FRUA 4N0FA 4P2CG 4RA0C 4BSWA 2GY7B 4W6YB 2GPZA 4WU5B 5HI3C 1L0PA 5E4IA 4ODHH 2X2YA 3DVNA 3D25A 2V8LA 3SJVB 1RH8A 5GJTL 3AC0A 3S8FB 2X4PA 1B6UA 2AKRA 1LO0H 4WWKA 4XPAL 4N1HB 3ULUF 3IT8D 2AJVH 3KMDA 3VWKA 2K70A 2WMPB 1BZ7A 4BE6A 5CEZD 1X5LA 4BKTC 2X10A 1DBMH 4PJIE 3MJ9H 2XHNA 5CCKH 3K1DA 1HHHA 1IAII 4ELMF 3ELQA 3VRJB 4MNGA 5C0FB 5TQ0L 1ONQA 5C7ZA 4NM4L 4OCNC 3S88L 4EDXA 3KE0A 1SRDA 3KGSA 3C6SA 3E1ZA 5DYFA 3NJXA 4ZXBD 4BQ6A 1X5YA 1XGPA 2ZUQC 1ADQA 5DHXB 3JTTA 4WI2A 2JK5A 5D1QC 3Q43A 3S96B 1EHKB 1TT6A 4JFDE 3KJ4B 2X9ZA 3RU8L 5DZAA 5BV7L 1GGTA 4GI6A 2FUTA 1ET5A 3DO7B 5D1ZA 2NYYD 2JJSC 5IGXH 3L3DB 3A6BL 1SMAA 3GJEB 1U41A 3PHOA 4JFYA 3GLDA 4OLYL 1SEBA 2G2PA 1N4XH 1RP8A 3GK8L 2JF1A 2AI0H 3I02B 4MJID 1IBHA 1C7SA 1UGKA 2GJZB 1J18A 3GNMH 1BBJB 2IDFA 3ECBA 4NSKB 4IKJA 4YFEA 2ED6A 1QLEL 2EO9A 5AVWB 1C16B 5IHHA 2CGRL 3CWGA 4EZJA 1A1MA 1SN0A 4UAOC 4AGNA 3PJSB 2WXGA 1T7YA 1KUMA 3HI1A 3VFOB 5GSVB 5KUKA 1N6VA 5BUAA 3O0RH 3FT9A 4Q6IC 4U1HB 1S7VB 4KK5C 2CO6A 1VA9A 2A99A 2G0LA 1NKRA 4X6CE 5DK2A 4F3FB 3KPSA 5EO9A 3Q9PA 2F19L 1KBKA 3VTMA 4IRSC 4H1LA 4GNKB 2VN4A 3RWJB 2OXHA 1G94A 3NAAL 2R8SL 1JHKL 1R0AL 4TF4A 5ANMB 3V4PB 2DWEA 3S4SA 4RMVA 4NKOA 1F3DH 3OAUH 4X7SL 4PJEB 1QLEH 4YXLL 4ZOEA 4P49A 1ADQL 2HUHA 2WTOA 4UQDA 2L7QA 4KVCH 3NSCA 1JGUL 5CUSH 4FQ2H 4B9PA 5F70A 1QBBA 4Z7WB 1IC4H 5HYIA 4R8WH 3IJHB 4I0PC 4WV1C 3LEVL 3NJVA 4JY6B 2DQHH 3CXHK 3K2MC 1MVUA 3TWCL 3U9WA 1ZGLP 2OMXA 4FQ1H 4PP1D 4XTRC 3Q2CA 1JSYA 5C2BL 2PXYD 3VFGL 2GITB 3W57A 2FT7A 1OTSC 1QACA 1IC1A 5HGBB 3DMMD 1RJCA 5EEUA 1KIQB 2RQ8A 3VX0A 1U6AH 5DVMA 1XCXA 5DK2B 4G9FB 4YOKA 3C60A 3CHXA 3B7UX 3PNRB 4PJDE 5DZ9A 1WA0X 3S3PA 5KWYC 4LLMB 2XTJC 3H9ZA 3QZMA 1PNDA 5DD3L 4W4NA 2A77H 1T1XA 3KGTA 3V5HB 3N0AA 1NKOA 5DHVA 3V6FB 3VD7A 1BD2A 1IBYA 1TF4A 3HPJB 4GUCA 1V05A 3PABB 3V79C 2YMXH 1FJ1A 4FYTA 3MLTB 1BP3B 1SJHB 2YRBA 5FUZH 5FOBA 4CMMA 1I53A 1JWSB 5JO5B 3T0WA 3ZDZF 3EF7A 4ZTPL 1OARH 2WQRA 4UMSA 3TEWA 1J1XL 5C08D 3TIEB 5FDWA 5K9QI 5HYSA 3BI9X 1MFAL 4NIKB 5E4EB 3UBXA 4WK2B 4UQ9A 1GW0A 1IRAY 2A74B 3FQYA 1ES0B 3I6GA 3ZQWA 2HWZH 3S98A 4DEPB 1WAEA 3LS5H 3IFNH 2DMGA 1EAJA 5AW5B 1J86A 3FOLA 3P4OA 4JUTA 1HHKA 4MX7A 5F7DB 1FL3B 1U36A 3A3YB 5A3ID 1XZ0B 2W60A 5ABDE 1KCBA 2O6FA 3KPLB 2IBGA 4ZMLA 5AB9A 3I2CL 3ZDZE 2VLJD 1BEYL 3CC1A 3EJUA 2EIZB 2NXYD 4IBYA 4BH8B 4RAVA 5C09B 1TTBA 4XMKH 5HHOD 1NCDH 4ABVA 3CZFB 4PJ5D 2V3EA 1X6NA 4H8WC 3AWFA 2ENJA 1WAAF 3PU7A 4A2HA 4IDJL 3L5XH 4MMZA 5EEVA 2UV3A 4TVUA 4ZXBB 3RB5A 2PMZA 3KHQA 3U9UA 3DI2B 1E8WA 2HT3D 4XPFL 5K93A 3MV7E 3V7MA 4NOFA 2XNAB 4X8GA 3NABH 3HRZA 5C0BD 2OFQA 4W9DC 1H9DA 3X1EA 1T5XA 3VSTA 2X89D 4PJGB 12E8H 2HT4C 1JPGA 2YK1L 3O4OC 1G6RA 2ZICA 5FKAB 1K4DB 4DP7X 1IFHL 2PYEB 1TQBC 5CSZB 2V2TA 5IY5B 3BKYH 4C55A 2W95A 3IGLA 2ESVD 5CAYB 3MRDB 2YA1A 2D7NA 5CILH 3FO2A 1PYWA 2DKSA 2YN3A 4P3DB 4M1DH 5FOBB 5J9PB 1R5WB 3OX8A 4YPGA 1JDCA 2W88A 4JANB 5G5DA 5C3TA 5ENWB 3SKNA 3BQVA 1AMYA 4R3SB 5GRZA 4HH8A 4NZ8A 5CBEB 3MREB 1P7KA 4ISVA 5HI3D 3ATEA 5HY9B 1L0XA 1MELA 12E8L 2ZAGA 3MRQB 3AG2B 3QPXL 2N7BA 4YSEA 3GMRA 4NRYB 1SJXA 4IOSA 1AZNA 3INOA 2L8AA 4P57A 3E38A 3ARPA 4PJIA 2GEEA 4DJMA 4MVBC 3U1SL 3GYRA 3K6IA 2VDNL 1RUQL 5CJOH 5DRXB 1E28A 4HIXH 2Y7SA 3IDIA 4N0CD 4XNYH 5DMIH 5JXEC 5F9OL 3LQMA 2YQBA 3WD5H 3QWRA 3P9MA 3HN8A 3KYNA 2WZPD 4TM9A 3ZTJH 3V6ZA 5TE7L 1ZWIA 3RVVD 4JPSA 2PPAA 1UTDA 3K4DA 3UO1H 1BLNB 2B8OT 4WJG3 4WUUE 3FTZA 3LIUA 1LE9A 3FQ2A 4NJAL 5B4MC 4GSXA 4QLRA 4MNGE 5I6PA 2R2CA 4UTCA 1YDPA 1K2DB 4I77L 3IFLH 3FZUD 4RRPM 5C0ND 4JDVB 3PL6A 3VU2A 4HKJA 4NPYA 2WNGA 5FB8A 5AAWA 1FC2D 4UT6A 2WCSA 4QRSB 3TVMB 1ZANL 3CZUB 4OFIA 4MBRA 1T1WB 1ET7A 1TMCB 4PRPD 1S7WA 3SKJH 3G5XB 3EF4A 3H3PL 2VISA 2W9DL 3SD2A 2YS4A 3QHTC 4JCMA 1HSAA 5IVZA 1NGXA 2EYRB 5IQLA 4OJEH 3NZ8A 4GSDL 1ZHBA 5C71A 1CICA 3FULA 1EHLL 2W07A 4PCYA 5F88A 1FPTH 4X6BA 2BCKB 5HHMD 2EC9U 3B9EA 2Q10A 2I32A 4CSTA 5EU6E 4ZNEE 3DSFH 4PJ9D 2AW2A 1RULL 5IBUB 5B3NA 1RUML 4QRUB 5FGCE 2MTAA 5AEAA 4ZZKA 3GS4A 1NGZB 1BOGB 5AWNL 3OC5A 4GQ9L 4P4KA 3V0WL 2DQJL 2BNRB 1U91A 3FB8A 3IXTA 4K5OA 5DJCA 1YMMD 3BMVA 1PLGL 2FX9L 1FIGH 4UTAL 4U1JA 4S0TD 4E9SA 3FU7B 3BAWA 4FLOA 4GW5B 5HHOB 1T7VA 3NZHL 2G9HB 2W65A 3HB3B 3MBXH 2MHAB 3ELAT 2ROYA 3PE9A 1SJEA 1CDYA 4DPAX 4FQLH 4ZDHB 1X5JA 1MDAA 1FLRH 1KT2B 2XA8H 4Y2DD 2EYRA 4JG5A 3LKQA 4TVPE 4H13C 4UIKH 4BFGA 4D0DB 15C8H 4XVSH 3OX8B 2IGLA 1WGOA 3CZKA 3AWGA 2A5UA 2CR3A 5IHZB 4JFTA 3B9AA 3TH3T 3CUPA 1XDTT 1X4ZA 4LOVA 2JKTM 4XI5D 2OZ4H 4UI2A 1JI2A 3FS9A 3D05A 1ZT7B 3S36H 2DLFH 2AS5M 4FNLH 1F8TL 3O6KL 2NW2B 3SDDB 4W9IC 5E8PA 2LU4A 4JBSA 3VVWA 1O5DT 4ZO6A 3Q5TA 3BP7A 1QZ1A 1PZAA 3FPYA 4LAQH 4HWNA 4HUVA 1S7QB 3DXAD 1MCKA 5E1AA 1PGRB 5D96B 1U4FA 2OMUA 1JYVA 3WGUB 1JK8A 3GO1H 4UYQA 1T20B 3WENA 1NCNA 1BECA 2AJYH 2OK0L 4P5TD 3V6ZB 5CR1A 3CV5A 4YHOL 1U3NA 2R0ZH 4IBQA 4N68A 1RK0B 2HRHA 2ETWA 5TE4L 2WVVA 4P8QA 1YQ2A 2CCLA 3W9DA 4KJYB 2IPTL 4WVRA 5D5MA 4B27A 5AB2A 5IFJA 2WCGA 3CVIL 4N20A 1H8SA 2J3SA 1QWHA 4PJXE 5HHOE 4PMFA 2APFA 3RJQB 4DN4H 3PJNA 4WI6A 2EDYA 5EA0H 1KCUH 3WFEL 3EGSA 4PWKA 1E4KC 5IVZB 1CLYL 2P8PB 4Y2DA 3HI6H 4A6YL 1YPZB 1OGAE 2BNRE 1WD8A 2XU9A 1NAMA 2XPGA 1KC5L 1JWMA 4J1UA 1B9KA 4LLWA 3ZZSA 2PPDA 2WBJB 3NIFE 3LKRB 4PGDB 5F6IB 1WFNA 3DTDA 4FFYL 3RUGE 2B1OA 3HS0C 5MEQA 4PJAF 3LKPB 2IWGA 5HPMA 4OY9A 2H1LM 4B9GA 3K6DA 1FZJB 4R8WL 1X7TA 1GAFH 3SIKA 3PXLA 3CJJA 4I48A 5ICZB 3WXVH 1R9FA 3FO9B 5CXPA 2KI6A 4YH6A 2JCCF 3CU1A 3MJ8A 2JV6A 1YCSA 4K15A 2OMVA 2OTUA 1C5CH 4MS6A 4GO6B 1S3KL 4YHPB 1DJGA 4P2QB 5GS2D 1HXKA 3LQAL 5DSCB 7FABH 3FUNA 1ZMYA 1MF2H 3SPHA 3U30C 1GTNA 1NGPH 1D3CA 1TZGL 1NOAA 3L9RA 4ETQB 3P9MB 3N06B 2GAZB 4ZO9A 5DTFB 5D1ZI 3WXWL 1MFUA 1ID2A 2Z4TA 4GO9A 2F9BT 3S35X 3QWQB 4PGJA 1A7NH 2Z7UA 3SODB 4E9LA 4Z78A 2XIBA 1QX1A 5HI4D 1BXUA 4JRYB 4X5QA 4DPRA 3NG5A 1Z6JT 1H3VA 5ALCL 4Z5RB 3M88A 5IMLA 1T1YB 3E9UA 1KFAL 2RHEA 4HCGA 4UTBA 1SF5A 1FO0B 3QJVB 1TZGH 1P5UA 1ZHKA 3L7EB 4OGAC 4WFEE 2IPKB 1PU0A 3VDAA 2WUBL 5MEOA 5DU7A 3MBWB 2JCCA 3RTQC 4P23B 4F5CE 3GZOA 3BHBB 3KPSD 2Y36L 3WN5B 5C2BH 3ME0A 4GXUM 3AB0C 5D1QD 1WBXA 2ATKA 4HBCH 4K9EC 3P9LA 2HH0H 2CNYA 4NLHA 1SQMA 4PWHA 4CN6A 1YNKL 5ANMA 2AQ3A 3LTVA 1XGYH 4ZQKB 2APVA 1W0YT 2GAZA 4MZ2A 4RIRA 3KXFD 2IQAB 2D3JA 4HAFA 2GSIA 3BP5A 4OZHE 3TBTA 3B8YA 1DANT 1KYFA 3FHAA 4U3HA 2B77A 3BSZL 5FUOH 4I77H 3JZYA 4TUOA 1F86A 1YEFH 4WHYG 4A2EA 2UZPA 4OF8A 4KH9A 3G6JB 3BZDA 4Y9CA 5G4NA 1EJOL 2ESVE 5F97E 1E6OL 1OE1A 4YIQA 2PYFA 2MQCA 3HG1B 3IDJA 4ODTL 2VZ3A 2P26A 1AVAA 3UEZA 3UTPD 3GMMA 1UWGH 2E59A 1ZIAA 3K6OA 3H6JA 5T3ZD 1KB3A 4JB9L 4IJ3B 3S9DB 1RZ8A 1F1GA 1KN2H 2PYEE 2R9HC 2CLZB 3G6DH 2IH3A 3VYPA 3G9VA 3Q44A 5EU4B 5D7JC 5DMJB 5AD0B 3AU0A 3B1TA 3T04D 3NH7L 3IMUA 1A7OH 4M5ZH 3TT1L 1NFDF 4YZFE 3ARSA 4A67A 4DP5X 1F6LL 3QDJB 3SPVA 4JL2A 4Y4FD 4U33A 5TDOA 2P8PA 4A2LA 4NQDD 1IBGL 1K4CB 1SDAB 5HGHB 1WG3A 2CHNA 1UURA 1T83A 3ESPA 4QRRA 1HL9A 3P3TA 4OTXH 4LOUC 4UV4H 3V7AG 4QJ3B 3V5DB 1URIA 5EF2A 4ZMOA 1TU2B 3PWNB 2X89A 5EZOH 4ACTA 3IMVA 4RZCB 1JF1B 4GKSA 5ITFA 1A6UL 3AWEA 4XN8A 2AQNA 4JRYD 4FZEL 4PREB 4JO1H 5J89A 3FF8A 3EDDA 3LYRA 1IQWH 3QG6B 3M8OH 1UB6A 4QTHA 5IREA 4ZFOL 1JNLH 3OKDB 3QS2A 3AY4C 2OSYA 4G8GE 1BD2B 1KFGA 1I8AA 4NQED 3KPSB 3WG7B 4AMXA 3KL5A 5TDNB 1A4JA 1PD1A 1S7QA 5CJOL 5IIEB 4OLVL 1U8LA 3MXVH 1S7XA 2LFGA 2HFFA 3EH5B 3B5TA 3UP1A 4XCFL 4F33B 5AOIA 5JOPE 2VLJA 3ZO9A 4NJ9L 5C09A 1WTGT 1ACCA 4P23A 3BVNB 1HQ4A 3ZTCC 4D0DA 4ERSL 2OP4H 1WCBB 2ZONA 3MRLB 4Y4HC 3L6FA 1FORH 4V1DD 4CN4A 1T1YA 1XZ0A 1AHWB 1I7UB 3KPNB 3NCXA 3NQKA 4WO0A 5KVGH 5I8CB 2C9XA 3JTBA 1MREH 4L4TE 5AZ2H 3PPEA 3WKMH 3O0RL 5KYXA 5ID1A 1GKEA 5BMFL 1B2WH 2A74A 4AG4H 4HU2A 4FMFA 1QBMH 4KZ0A 4XPAH 43C9B 3EJSA 1JTOA 3C08L 4LLUB 3KPOB 3WSQL 2WWKT 3BE1L 5L2JB 3VD9A 4JFZH 4XP6L 3CQPA 5IB2B 1BMZA 4UT7H 4LSRL 2XIIA 4Y16B 3UZQB 3QZWG 2I24N 3HW7A 1AR2A 5IMMA 2PPCA 1J1PH 4XH2A 3TNMB 3HPJA 1IEHA 4HEMA 4XE5B 3LZRA 4FTVA 5ISZE 2WMPA 1UZ8B 3CZGA 1B4LA 5A2FA 4RGNB 5D70H 1UQSB 5K1VA 1A0QL 5C0RL 3ETTA 3FUDA 3HCVB 4OAWA 1BBDL 4GQZA 3FQXA 5BJTB 2FR4A 4FYQA 1ZHBB 4N0RA 1LO3L 3NIDF 1F5WA 3JWDC 5EZLA 4NKDB 3GF8A 4ODWA 3T9WA 4BA0A 1F8TH 3O6KH 2K7QA 2Q7YA 1OB0A 2CLVB 3UPCA 3QS3A 2F8IA 3KEHA 1EEYB 5I1DB 3TBTB 1INEH 4P2OA 4ZUUB 3L9BA 4QRPE 2EDOA 3N40P 1KGCE 2N7AA 2V9RA 1LK2B 3WYRA 1Y6MR 3WTTA 3S4SG 4LCWB 1XBDA 2NNFA 1W8EA 2XVKA 3JTTB 4HWZA 1IAKB 3MRHB 3NAAH 5DR5L 4OV5A 5IW6A 3DURA 3BEWB 2BIIA 4LF3A 4POUB 1Z9NA 2GBAA 4QUOA 3PY9A 4K3GA 2BVUA 3APDA 4NP4H 5C86A 3N3EA 2QVIA 3WGVB 3O9WC 3SYAA 2WBKA 3GMQA 2PWGA 4R2GC 3ARGB 3WFDL 4CVWA 1KG0B 3WO4B 4HUWA 2W0LA 5DFTA 4ZG1A 5KZCB 1J8RA 5GHWL 1CQYA 1F18A 1G5AA 4IGBB 4QHKJ 1NAMH 1NLDH 1UYWL 2MQ3A 1UFUA 4OF5A 4DFIA 3TURA 4N8VG 1ACYH 3GS0A 4L1HA 3VXME 2P3YA 1H3GA 4G43B 4JZOA 2PABA 2GCYB 1JUFB 5E5RB 4G82A 4GAJL 3KLAA 1KPVB 2FB4L 1BZ9B 3LS4L 2DI9A 2PWEA 5EFIB 3VSUA 1F97A 4XC3H 3EG9A 1N70A 1MWAA 2RIKA 2XJKA 3DVNB 3NFSL 2NNRA 2CRIA 3K46A 4PLOB 4APQC 5FCUL 3MOBH 2HFTA 1OWRM 4GJTB 3ZVVA 1A4BA 1CC3A 1TQUA 1RSYA 2CO1A 2H6PA 1PS3A 3SO3B 4PRNA 1OAUH 3FQRA 9CGTA 1FVDB 3QA3B 4HFUL 3SKNB 3V0VB 2DQIL 2XWBB 2EIKB 2QPEB 1JGUH 1KPRB 4LNVA 5CUSL 5DMKB 3BGFC 2ARJA 32C2B 1HWGB 4YHZH 1PZ2A 5CP3H 4EF3A 2LTQB 4IMLA 3WAJA 3TJPA 4I0CC 1NSNH 1MHHA 1L0QA 3MJ7B 2CPCA 5A2AA 1F4WH 5E95B 3GHBL 3QCTL 1OE3A 3EGXA 2BP8B 2UWEF 1DFBL 3GBML 4Y2DB 3QPQC 1AC6A 4DNLA 4QCIA 3QWOB 5HYEA 2VIRA 5HVHB 4AGQA 1NEZG 5HJDA 2BY3A 4JMNA 5JPNC 4DEPC 4MB3A 3KBFA 1HAUA 4DKAA 3FTVA 3KDMA 2EVJA 5FFOA 4M6OL 1COBA 2O5NA 3RNKA 2HLEB 2MOGA 1EDQA 3GSQB 2HUEA 3A67H 5E94A 4N3TA 3FT2A 4HHAA 1OKEA 3ZHKA 3E6FA 2Z65C 1MCLA 1KB9J 2ED8A 1H6TA 3VFSB 1IGIL 1NDGB 4AQOA 2OTWB 3TT1H 3AQDA 4NN7B 1IC5L 1ZSHA 4GAYB 4N2IA 3ZMNA 3VXSB 4YC2B 4N2HA 4TNEA 5JYMA 3RHWF 5JPMA 5DS8B 1XGRA 2QDVA 4ODUA 2XTJB 1Z5LB 3BEWA 1WHOA 3I6GB 3HZ3A 5JIDA 5GRXG 3B1UA 3OXRA 2X70B 1QHOA 1W80A 3FB5B 1P1ZB 4YSDA 4FFYH 5IB4B 1XFPA 4NZUL 4BFIA 1DBBL 4BKLB 1CTOA 3OJDB 4JFEE 2MPAH 4XB8A 5ITFB 3SBPA 4HIHB 4JO2H 4KROC 4Y7OC 4HIIB 2WSPA 2EE2A 5T8IA 3RB7A 4PV9B 1JYNA 3O8XA 4MZIA 1K2DA 2YRZA 4P5TA 2OYPA 4HKZA 5T3ZE 3WY2A 1T7WA 4JZNB 3AW5A 1LWHA 2WKOA 1KCLA 2NY6B 3FF7A 4Z0XA 2VERN 2W0KA 1RUQH 4HBCL 4O4YH 5LAXA 3CDGB 2G2RB 3TJEL 3V0IA 4I9WE 1SNRA 4FI8A 5DFWH 2AXFA 4FLSA 3L4ZA 3C60B 1L4IA 3S0PA 3STZB 1KPVA 5FS5A 4KTYA 2Z8VC 3DC0A 2MJWA 5DRXA 5L2KB 4NGHH 1FI8C 2NY3C 5IOPA 2Z0UA 4XN4A 3OKMA 2X4SB 1RUKH 3DYMA 2DJSA 3L3JB 3H7LA 5FECA 5KJ7E 4L3CA 4LP5A 4YIQB 2J4WL 2QELA 4XZ4A 3I50L 1B2WL 3ARQA 3RVUC 5LAPA 5EBMA 1TQCB 2VM9A 4IGBD 3VI4A 4GT7A 5ENWA 3T4YB 1K5NB 3S5LG 5KANG 4FNQA 3GLZA 3GSOB 3S36X 4K71C 1K5WA 1DQDH 5CMAA 3UTSD 1NDTA 1Q9OA 3LKPA 1UOLA 1AR1D 3PGCB 2UXTA 2IWFA 2X70A 3VFRB 3EHBC 2AK4A 3QQDA 5ID0B 3VRLE 4E41B 3IDXL 4XWGL 4G80B 2CA4A 2X0UA 2IAMD 4J1UB 1R75A 4LLWB 5E6SB 1ROWA 2Y0SA 5JPNB 4GLRI 2AQQA 2UXGA 3NUKA 1PY9A 4NYLB 1YA5A 2DQCH 4DKTA 1L9RA 3LNGA 4L8DB 4J8RA 5DC0A 5AQ0A 5IHLB 2OJEB 4Z5RA 5IG7B 3CK0L 3KYMB 4JFQB 3BIBX 2OP4L 2A4CA 4OLXH 1BBDH 2BVYA 4Z7AA 3LMJH 4ZJ9A 5EBMB 4WTZA 3J07A 4K7PX 2X4QA 3EBGA 3V9EA 1AXIB 1TVDA 3ILQC 5F9JB 3ULSA 4F58L 1CDJA 4UM9B 3MRGB 4A2DA 1QSEE 4HGWA 4UDTA 2ZUVA 1ZS8B 1A6WH 4UILL 2H2SD 3SO3C 3KXFA 1IZJA 4F8PA 1EIBA 4KI1A 3TV3L 5IT2H 1FYTA 5K59E 1TCMA 5CLYA 1PAMA 3L7FA 5E5LA 2YPKA 4EDWL 9PCYA 3D48R 1OGSA 2JTDA 4L4TB 3PHQA 2BNQD 4ETYA 3DROB 4TULH 4A37A 1S46A 3QUYC 4OIFA 5FHBH 2FJHA 3RI5F 1ACYL 1MFCH 3AXIA 4MSWA 4AKQA 2YD0A 1YLBB 3VFNB 4Z1PA 1FJ1B 3ARBC 4LSDA 4C58B 4BKLA 2E6PA 2X4UB 4IKIA 4B3EA 4AQ1A 1AC0A 4P46A 5J6HB 4XMTA 1HTYA 4BGLA 1DO6A 4OF0A 3D18B 3C2SA 5FO7A 5KYWB 2QVFB 5H8DA 5C0AA 5LBSH 3RTLA 3GMPA 4AYMC 3ZGHA 3KGRA 2NXYC 4OD1L 3GB7B 1KTLB 4FFYA 3M1CA 5A7EA 4OLVH 1VRSA 3HG0A 3MLSL 3HVNA 3T2NL 3IWVA 5D8JH 4G6KL 4X7EC 4FFVD 3V8CA 2JE8A 4XGZB 4JDZB 1MJ7H 4L8CA 2VZ1A 4Q97A 3B3IB 1PX8A 2LV4A 5E8NB 4HFUH 2D7QA 3JSSA 2YPLD 2CJSA 3U6RA 1K8IB 3MV8D 4LEOA 4HGWB 4UDTB 3NZHH 3SYCA 2CE6A 2F58H 2Y5TA 3MNDA 4ODXA 3RPBA 2NY4C 3EJCA 4Y5VA 1CI5A 5ICYA 5IROA 2GK2A 2YAFA 4XP9H 3BQUB 2JCCB 1A6VL 2ERJB 2J8HA 2BDNL 3FONB 3SGEH 4JFOA 3CU7A 1YVLA 2F5BL 3PWJA 3BH9A 3KNBA 1OE2A 1S9XA 3FQUA 1ZT4B 4BA8A 4P5SA 3MRMB 2BP8A 4MQXC 1XD0A 3Q2VA 4KY1H 3PIQA 3ZDYB 1C5BL 1UWFA 2E74C 2VISB 1I7RB 5LN4A 4CGTA 4AE0A 3WNNA 3JZ7A 4F57L 4JFZL 5J12C 2J2ZB 3RWJA 3BO8A 4OB5L 5I1DA 1ZIBA 1ETJA 3BKYL 4RQQA 2EYSB 4TXVB 4M7LH 4LPUA 4QRTB 4HK0B 2FO4B 5AG9A 1IM9B 2VLLA 3OTTA 5GIRA 2K1MA 3V5KB 3QQNA 1FZMA 3IXAA 3NMEA 4DP0X 4J39A 1K6QL 1OHZA 4R7NA 4IBSA 3TYGL 1IEBA 5AAPA 1XD1A 2DQEH 5FK9B 1NMBL 1WE5A 2V17L 1KCSL 5DRWA 3BYYA 4AEEA 3MOAH 1AO7D 4N8CL 4UQBA 4Y19D 4M8VA 3F85A 2J1XA 1AQKH 2YAOA 3ZYOA 3F7RA 3VFWA 1A6ZB 2IQAA 2WJ5A 3VH8G 4Z7QB 3N1QC 4PB9L 5A7BA 2PP8A 7FABL 3UJIL 5K9JH 3K74B 5ALBL 3F7VA 4N9OB 3IPFA 2IDCA 5HGBA 3HC2A 2VLMD 5I19H 1GMIA 5EORH 4AEIH 2MPAL 1GGBH 3V55A 5I6XB 1WPCA 4JFUA 1QFUL 5D6DA 5INDB 1CFTA 2IGFL 4G8GA 3RWDB 4LHUD 3EYOB 1PAZA 3ESUF 1UA7A 4XE0A 4JDTL 2R2BA 4AMWA 1ZEAL 4G9FE 2VDRB 1JPSH 4PJ5E 2WY3B 5ADPL 5E6ZA 4ZYKB 1RL1A 2B15A 4D94A 2J1YA 2EECA 3ISRA 3BP6A 3PWPA 3X3GL 3L54A 2IGTA 4IQHA 1MPAH 4ICWA 1MFBL 1T2QL 4QTIH 3GWJA 1QR1A 2NY4B 3UAJD 3OXSA 3QHZL 3QAQA 1MJJA 5LBVA 1ITBB 3ZLQC 4JHUA 2YD4A 1T5XB 3MUZ1 4H8QA 4NZRH 4XMLH 3HRZB 2G5BA 2CLVA 1CXHA 1BFVL 1OAXL 4HUVB 1XB6A 5EU6A 5T1DL 4ZNEA 4YHYB 1EHLH 4FL4C 2TSAA 3C2AH 4S1RL 1QBLH 1L5GB 5EO1A 1NFDE 2NT0A 3BUIA 2ADYA 2X1OA 4XPTL 2JCCE 2VRKA 5ESQB 2KYIA 4WHTA 5KBPA 4RAVB 1AKJB 2AQSA 3P0YL 3BVXA 4KHTH 1DVSA 3N42F 5HHME 1TIUA 4UT9L 1TO5A 1I1RA 1R46A 1BYNA 4GW4B 4YE4H 4OBSA 4XN2A 3MC0A 4LLUA 3RUGF 1BVKB 1DFBH 3RWDA 4BFFA 2V2WA 2X40A 3QDJA 1FGVH 3PWJB 1SBSH 5F2FA 3WIFB 3EOAB 4C83B 1NBQA 1B0WA 2PKDA 2WQXA 5K9QG 2YRLA 2YPVL 4ALAL 1IGJB 1DBKL 4IMKA 3ARXA 2FLRT 4CW1A 3GXTA 3EFDL 32C2A 4LAJH 4PD4K 3INUH 1FNGA 3VFVB 3W39A 3THML 3JV4A 5I18H 5LG6A 2VQ1A 2PYFB 5JW5A 3F3HA 4AUYA 5FK9A 5HYFA 3FCTB 4F7CB 5GSRB 4RNRA 3B2VH 1ZS2A 3IMRA 2OR7A 5ESAB 2AJZB 1U0QA 3HJEA 3KPPA 4MS8C 1MCQA 2HJLB 5BMFH 4PJDB 4GBXA 4ZXBA 5EFIA 5AW9B 4UNIA 1KWKA 1NA8A 2G3NA 5D7EA 1CU4H 1WV7T 3P9WB 4YHMH 5AYUH 3QZBA 4H2CA 2X6BA 3KYKH 4I5BB 4N2BA 4CMHB 4IOIA 4J3TA 4YLBA 1HI6B 2AHIA 4HIJA 3G5XA 3SE4A 1KB5A 5F89A 1JGVH 1RPUA 1U8NA 3EXJA 1WC7B 2J72A 3OAZH 3P30H 2AJ3A 3ECQA 4EUPG 2FJHB 1NWPA 2NX5B 1C5DA 4PG2A 1M9WA 4EI0A 4S1DC 1Z9SA 3ULVC 1KYDA 4U0QB 1FO0A 4UIKL 3B9KA 2V0AA 4K7PL 2EDXA 3FXIC 1F90L 1JF1A 3BAYA 4G8EA 4GKSB 4JFOB 4KNSA 1TJXA 2D4DA 3KJ6L 5EUKB 1DN0A 1KYOJ 4KJPC 4WWKD 2EDWA 4YHIB 2H32A