1PLBA

High-resolution solution structure of reduced parsley plastocyanin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
AEVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPEYLNGAGETYEVTLTEKGTYKFYCEPHAGAGMKGEVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title High-resolution solution structure of reduced parsley plastocyanin.
pubmed doi rcsb
source organism Petroselinum crispum
molecule tags Electron transport protein
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plbA00
2IWFA 1BAWA 2IAAC 4AI7A 3FU7A 2YAOA 1BYOA 1NPNA 1OCCB 3H56A 4N4YB 2IDFA 4AZUA 1OCZB 4M4RB 4KOCA 3NJGA 2HXAA 4W1TA 2FT6A 1AG0A 4F2FA 2JFCA 2PPFA 4A2HA 5B7FA 3H4HA 4KO5A 1SJMA 3EHBB 4A68A 1CYXA 3X1GA 1CC3A 1EHKB 3WIAA 1J9TA 4UAHA 2DWTA 4MFHA 4Q89A 2OCCB 3UACA 3PLYA 2BW4A 3X1BA 1M9WA 3ZX1A 3QJRB 2J57A 2CJ3A 2N0MA 4KO7A 5TK4A 3MX0B 4KNTA 3L45A 2CCWA 2E86A 3DTUB 4L0PB 4AKQA 3U25A 2HLEB 3ASOB 1ASQA 1EZLA 1N68A 1PF3A 2JXMA 1JZJA 1GR7A 3TBBA 4KNUA 1RZPA 2H5UA 2YXVA 1RCYA 1KDJA 4DP2X 3PPSA 1BQKA 2XXGA 2EIJB 2JKWA 3WNJA 2B3IA 3T6ZA 4FAAB 3X2QB 1NIDA 2IDTA 4GP5B 2IH9A 1QNIA 2AFNA 2HX8A 1SNRA 2DV6A 2ZXWB 5D4HA 4HCIA 1IBZA 2XX0A 1JERA 4PAZA 3IE9A 1QLEB 3FSVA 5B1KA 1PY0A 4RH4A 3NP3A 3V9EA 4YSPA 1CYWA 2IDUA 1NDTA 4N8UA 2VSKB 4YSOA 2IWKA 1V10A 3QJVB 4GYBA 1SHXA 4BXVA 1X9UA 3NT0A 2YARA 3T6VA 1E30A 2Q9OA 4KO9A 1AAJA 3S8GB 1KCBA 2AZAA 3NSCA 1SFDA 4YSCA 1PZCA 1OF0A 3OMIB 1ZV2A 1OE1A 1TU2A 2VMJA 4DP4X 2AANA 1AZCA 1JVOA 3QJQB 2UX6A 2MTAA 2FT8A 3DIVA 3CVCA 4P5SA 2PP7A 2BP0B 2XV0A 2ZOOA 4HCGA 1SF5A 3NJLA 2OV0A 2DYSB 2GI0A 3FS9A 4NAJA 4ENZA 1FFTB 1L9SA 2IH8A 3NSDA 5I6NA 1A4AA 4E9XA 3T71A 1ZIAA 3EH3B 2QDWA 1SDDB 4BK5C 1GY2A 1AZRA 2CAKA 2W88A 3FSAA 2FQEA 1BEXA 1OCRB 1BQRA 2BZ7A 3MBWB 4GXFA 3NSFA 2HRHA 2UXGA 4E9WA 4A67A 2VM3A 3GDCA 3CDZB 2Q5BA 3FSWA 4A2FA 2FNWA 2VM4A 3KW8A 3OD3A 5B1BB 1V55B 1PAZA 3D12B 1ADWA 4DPAX 5I6KA 1NPJA 2CALA 3T9WA 2YAEA 3NJFA 1HFUA 1W6WA 1IC0A 4A2EA 1AS8A 4CSZA 1WA0X 2BP8B 2UXTA 4DP5X 1NIBA 2PPEA 1A3ZA 5B7EA 1WA1X 2H47C 2QPEB 1A65A 4JKNA 2EILB 1MDAA 3S8FB 2XX1A 3PXLA 3UADA 4M3HA 4YVUA 1MG2C 2I85A 7PAZA 2NRDA 4KO6A 1IBYA 1MZZA 3NJIA 2DY2A 2FQGA 1IUZA 2GHZA 3H4FA 1AOZA 3IEAA 3SBRA 1JZIA 2BWDA 3NJHA 1ET7A 2XVBA 2BW5A 4E9QA 4DP0X 3X1NA 2WSDA 2J55A 3S3CB 2PP8A 4AKPA 1TEFA 3OMAB 5I5IA 3FYIB 1NWOA 2CBPA 4WTQA 4YSQA 5I5JA 1NZRA 3PAZA 4BDVB 4G7SB 3AG2B 2XYBA 4K9JA 1OOWA 2XLLA 1NIEA 2QDVA 5B1JA 1CURA 5B3SB 3WI9A 1AZNA 1ASPA 5B1AB 4G7QB 3SBPA 1JXDA 2P80A 3C75A 5E9NA 1DYZA 4HHWA 1NTDA 4HALA 3PCYA 1KBWA 3PAVA 4HHGA 1AR1B 2FT7A 2HX9A 2HZHA 5PAZA 4YSEA 1BXAA 2J5WA 1WS8A 5F7BA 3N2JA 3HEIB 1JVLA 1AZUA 1W6LA 4E9YA 3OMNB 1HAUA 2X88A 1E67A 5D4IA 3X1EA 5LDUA 3FQ2A 2Y69B 3WG7B 4AKOA 5EHFA 5I6LA 2PPAA 3EF4A 1F56A 3GXUB 3AG4B 1L9PA 2HX7A 1PNDA 1TEGA 1W8EA 3EH5B 4ZK8A 2YXWA 5B7MA 3BQVA 4W9ZA 4G71B 1PLAA 1WS7A 2W8CA 2FTAA 2FWLB 2BP0A 4DP1X 4DPCX 1J9QA 4QLWA 4JHVA 3JTBA 1ET5A 3ABKB 4DPBX 4YL4A 1AANA 2OJ1A 4YSUA 2HRGA 4KNSA 1GW0A 2QPDB 3CVBA 2B08A 3QQXA 5FC9A 4YSAA 2XV3A 5TK2A 2TSAA 1GS6X 1NICA 5F7AA 1AIZA 1XB3A 3TBCA 1HAWA 2GC4C 1B3IA 3NP4A 3AY2A 2ZONA 3CG8A 3FU9A 2A3TA 3CDZA 2UX7A 3NSYA 2BO0A 1ILSA 1I53A 1KBVA 3SBQA 3WKPA 2YAHA 2ZWNA 4PCYA 9PCYA 1AQ8A 3CZUB 1KYAA 1YLBB 1BXUA 1PNCA 3EH4B 3T6WA 2DYRB 2WO2B 1E5YA 1ZIBA 3AZUA 1UATA 2DWSA 3WKQA 3OM3B 3ZDWA 3ABGA 1PZAA 4Q8BA 2VN3A 2BHFA 4E9SA 2GSMB 5AKRA 5I28A 1BYPA 4EF3A 4F2EA 3GYRA 3SQRA 1WAEA 1ASOA 4BWUA 1AS7A 3TASA 2TSBA 4CSPA 4F7KA 1KV7A 3JT2A 4HCFA 2MRYA 1R1CA 1SF3A 5IY5B 1J5CA 2XV2A 1NINA 3ZIYA 3AW5A 1NIAA 2PCFA 3ABLB 2R7EB 3S3DB 1L9QA 2YAPA 1XB6A 4FA7B 1JXFA 1ILUA 4YSSA 4BDVA 2GB2A 2XWZA 4YSDA 2FJSA 3OQRA 2EINB 5I6OA 3NJKA 4A2DA 1AG6A 1XMEB 2XUWA 3AG1B 4YSTA 1RKRA 1MZYA 3RYMA 4GY4A 5AZUA 3X1FA 2LLNA 1KGYE 3BVDB 3DKHA 3PAUA 3TU6A 1T5KA 1FWXA 1A8ZA 6PCYA 3S3BB 4AX3A 2BWIA 1SFHA 3FSZA 1ETJA 3T6XA 1M56B 8PAZA 2UXFA 1M57B 1L9TA 1GYCA 5I6MA 4TXVB 2YAQA 3FYEB 3FPYA 4JHUA 3FQYA 4QKTA 1GSKA 1JOIA 1PLBA 3NJMA 1DZ0A 2UXVA 4HAKA 3KW7A 1GY1A 3UAEA 1PLCA 2RACA 1AACA 1FA4A 2X87A 2CUAA 1JZEA 5D4JA 5AFAA 1ZDQA 4YVNA 1IKOP 1PCSA 1OCOB 4G72B 4X4KA 2VW7A 3WNIA 1OV8A 3FU7B 7PCYA 3G5WA 2WO3B 3TA4D 3NYKA 4NB7A 1BQ5A 3V9CA 2I7OA 2YQBA 1CUOA 2Y1AA 1E65A 4BWWA 5I26A 1A4CA 2FQDA 1V54B 3IBOA 3UABA 4G7RB 4A66A 2GC7C 4DP7X 2VW6A 3ZBMA 1BXVA 1JZFA 1KDIA 3FU8A 1SDDA 3QPKA 2BZCA 1VLXA 3NJJA 2H3XC 1JXGA 5A7EA 3NJNA 1J9SA 2YAMA 1AS6A 5PCYA 5B1JC 1ZPUA 2PCYA 3FPXA 3N55A 1ZDSA 4P5RA 1PZBA 1OE3A 3QJSB 1N70A 1JZGA 1XB8A 4YSRA 4E9VA 1J9RA 1A4BA 4E9RA 3IN0A 1E5ZA 3ERXA 2FQFA 2BP8A 1ID2A 1KCWA 3ABMB 2AZUA 2P80D 3IN2A 1WA2X 4BXSV 2R7EA 5I6PA 1SHWA 2QT6A 2XU9A 1MG3C 4E9TA 3UGEA 4DP8X 2EIKB 1AZBA 1OE2A 1TKWA 2YAFA 2IDQA 1GS7A 2J56A 2PLTA 3QJUB 3FT0A 1GS8A 4A2GA 4HZ1A 1JZHA 2AVFA 4UF7C 4HIPA 2GBAA 3ASNB 4NERA 2PP9A 2GIMA 2PPCA 6PAZA 2XXFA 1RZQA 4DP6X 5I5MA 1ET8A 2EIMB 4G70B 3CVDA 5ANHA 3FQ1A 2VSMB 4WKXA 3UAAA 2IWEA 1J5DA 1PMYA 2I7SA 4GP8B 1L9RA 3AG3B 3QJTB 4BWTA 2PPDA 2IDSA 1URIA 4KOBA 1L9OA 4UANA 1NIFA 1QHQA 1X9RA 3HB3B 4GP4B 1NWPA 4DP9X 2VW4A
chains in the Genus database with same CATH superfamily
3RUGF 4XO5A 3ARVA 1CQKA 4J4PD 3F7PC 2VABA 1E43A 3ARBA 3BWZA 5DRXB 3U83A 2J20A 5IG7A 1DLFL 4KKZA 3MRNA 5LBSH 2EYTB 1NGWB 1M3JA 4MMZA 3ZU8A 3A3YB 1N2RB 1OCZB 4LHUB 1PS3A 1SVBA 3N0PB 4KKCD 4HWZB 4MDIB 2FT6A 3L1GA 4L3FA 4F9LA 1I8MB 1A25A 3PF2A 3N06B 5B7FA 3RWDB 4JFHE 3D5OF 3FFCD 1U2YA 2J88L 5IHBA 4MMYA 3GJFB 5CZRA 3QR2A 4QNPF 1T0OA 1P7HL 1U95B 4F7TB 1FZJA 4LCCB 5KSUA 3K6SB 4XRCA 2ZP9A 3LPFA 3GSRB 5F9AC 5FO9A 2AJZB 1KLGB 2CCWA 4JRLA 4DN3L 1HS6A 3R1GL 5H8DA 4JN2B 4DFHA 4LFHD 3TXAA 3ASOB 4FXKC 1CS6A 3N50A 1QFUH 1ADQA 3IK2A 2I9LA 2ZXDA 4N5ED 5ERWA 3RVUD 1M53A 2F6AA 2Y36L 3CXDH 2W9EL 3BC9A 3W9DA 3QJFB 4HJJH 1RJYB 3C8KB 5HPMB 3ALXA 1JFQH 1ZT7B 3IJYB 3PHSA 5I74B 5DC2A 2Z8RA 3A22A 2FBJL 4GP5B 2N7AA 3FTXA 3LZPA 3JWNH 4UM9A 3AAZB 4QMEA 3NTCL 4HUWA 1UGNA 3NCWA 4UNVA 3V9EA 1R47A 3OKLA 1N5AA 2B4CC 3M7FB 4ZFZB 1CYWA 5F9OH 5CGMA 4OLWH 1NANI 5IHZA 3RWIA 3RTLA 2UZYA 5DI8B 2PYFB 1WSST 2RFXB 1QI5A 3WIIH 1X9UA 2IC2A 3AQZA 3N6YA 1IAMA 4FQXB 3KDPB 5DJ0B 1UT9A 3GKWL 4O00A 4KO9A 3NQIA 4WNSA 2L7EA 3MMEA 2XWXA 1AR2A 1WZLA 4UTAA 4YSCA 1KEGH 1DVYA 4R97B 3D87B 2AQ3A 3SIKA 4JHAL 4NXSA 2EDQA 1AY1H 4G8EB 4Z7VA 5AALA 4M6ML 1I75A 4CW1A 4WJKB 1MY5A 4I0PA 3GMQA 4R7VA 4CU7A 1H3UA 1TYEB 2BIHA 3KHOA 4HCGA 4TVUA 3SGJC 2DYSB 1RUMH 4L1LA 2GI0A 1T4KB 3GSNB 1I1CA 4AQZA 2X70B 4LQFL 5KVDH 3CUPB 3I02B 1J1PH 1C5DA 1T83A 5I6NA 3JWOL 3O6LH 4N2HA 2PYEE 2ZCLH 3L2NA 2ZF9A 4GMSL 1BXXA 2CIKA 3IU4L 2EICA 4JANA 2FQEA 2BRQA 4GT7A 3ROLA 4E41D 1ACZA 1CF8L 2WLHA 5K9JL 1X6NA 1PFOA 2VCOA 4A2FA 2GTQA 1CPUA 3A23A 2Q86B 3OD3A 1ORSA 1XAUA 5AVSB 4M43L 1ZHLB 4BGLA 1XTMA 4FERA 1UCBH 1IC5L 3CSPA 3CVIL 3EFFB 3SJVE 2BX5A 4JHWH 4MB3A 4X0NA 2ODIA 3ES6A 3QEHB 5H37H 4EUPB 1QBAA 4UU9B 1ETZA 4LPCA 5ICZA 1R3HB 4QXUH 3OG6B 4GW4A 4NN6C 4V1DE 4H8WL 5AAPA 5DJXA 2RAMA 3AB0B 2MKWA 3GMOA 5JW4M 3MX0A 5HDBE 4L1SA 2DJ4A 2X0UA 4NZUL 3PE9A 2KZBA 3DYPA 2AQRA 1JZIA 3BVWA 5FGBA 1KPRB 4KHXL 1I9JL 3TT1L 2J55A 3QQ3B 3QDMA 1HE7A 5CJBA 2R4RL 5CS7A 1BX2B 4GRMA 3GO1H 1CD9B 1NWOA 4G1MB 2HN7B 4A7SA 3D2UA 1RUQL 4BDVB 3LN9A 5LQBH 3V0FA 2QFRA 4I9WD 1FFQA 2MEJB 1H9DA 1RL1A 3F6LA 5I82A 1G5GA 3VG0L 5AW4B 1B0WA 3HG1D 3D0VA 2EDMA 1VESA 4DK3A 3K2KA 3UERA 1DJIA 4N0UB 5I8CB 4GO6B 2VXQL 3AREB 1DYZA 4IDJL 4Q9BA 5C0DB 2ZF8A 4HALA 4K71C 3VFUB 3BUYB 4LGRB 1MCPL 1TZIB 1R34A 2X4PA 2ZCHH 1OTTD 3O6KH 3QNFA 4X8JB 2EIEA 2FDBP 1FVDA 2YN5A 4OCWH 4HOXA 2ICWB 1WS8A 2FJFA 4AGQA 2IPKB 3H7BA 1RHHA 3G9AB 5F7WC 3VXSE 1JZ7A 4F37F 2VO5A 3UTTA 2UZIL 3FQ2A 4B9YA 3FTGA 4HV8B 1Q90A 2EC9T 4YK4B 1CIUA 5BJTB 3QG7L 2Q3AA 1F56A 4OLZL 4UT6L 3L81A 3SCMC 1KG0A 4KHTL 3IFPA 1WO2A 3ROOB 2Q76A 1XF4B 4YZWA 3CH1A 4QLWA 2BP0A 3EGSB 3CZGA 4MBRA 2C7UA 4JM2C 4TSAL 5L4IA 5JNYA 2BVEA 4DPBX 3GMLB 2VITB 1KB5B 3KH3A 3BZ5A 4EDWH 3DJZA 1UA3A 5DUPL 5TK2A 5DJCA 4XX1G 2EE6A 3ZTJG 1QPPA 3UJTH 5HDBF 5ANMA 6FABH 2MCG1 4FKEA 4CUCA 3K6OA 4BFIB 3N9GL 2W81C 3C9NA 3HCVB 3NSYA 5HVHB 2IANB 1B0RB 1ZPLA 5FLVA 3M17B 1I53A 4PN6A 3RB7A 1S7XA 1KV3A 3N0AA 1E28A 1NBVH 3QHZL 1KJVA 4FABH 2AQSA 5FFGA 5IBLD 2BSDA 4FP8L 3WLWC 1YLBB 3PAYA 3BP4B 2DJSA 1U8MA 5HHME 4HWBL 2YLHA 2AV1B 4L8BA 2B2XH 3HVDA 4JO4H 1MF2H 3D51A 3F64A 5J6GA 5I1KL 3OX8B 2H3NB 2XBTA 2ICEB 5AL8A 1IGFL 1L0PA 4FFZA 4NEHB 5CCKL 2AHIA 1IU1A 4GXUN 4TULL 1KENL 3BFWA 1BYPA 2GTZB 3SPHA 5GZNC 5J13C 3ATFA 3UZQB 1RZ8B 1IBGL 1F90H 3K5RA 5FX3A 1MCBA 2WXLA 4BWUA 4Y5VB 3UTSB 3INUL 3WIHH 1Z5LA 5E7BA 2MRYA 3HMXH 4Q9RL 2X4RA 1VB9A 2FR4A 5TGBA 1CICB 1CR9L 4URKA 3U4KA 1IM9D 5CGYC 1K4DB 1JDAA 1UB5B 2H2PC 4YHNA 1NIAA 2WQWA 5E6IC 3QZLA 5AOIA 4ANXA 2Z4QA 1L9QA 2YAPA 4L4TE 3L4TA 2A0LD 3GMNA 5IFHH 3SY0A 3AS0A 3F6JA 2AK1H 1CFTB 3BO8B 4RGND 5MEPA 1IX2A 3WFZA 3KE0A 3CAFA 4FFVC 2KLSA 4JQVC 1YHPA 3WENA 3KJ6L 3RYMA 4PM1A 3SPJA 1Q0YH 1QLEL 4W9DC 3KYKH 3O4LA 3S96B 1HXMA 3O3BB 1EAPA 4O58H 4OGAC 1TQCC 2Y07L 3UG3A 1CL7L 2XWRA 3VI3E 3FQRB 1WVZA 3PWLA 3MRJB 3U0WH 1N8ZB 5E8DL 4JR9H 1JRHL 1KXTB 2NYYC 3VJ6B 4NENB 1R5IB 2ORBL 4KTYA 4UQIM 3BGFC 2D31B 4HS6A 5I75B 4LLUB 2UXVA 1UWFA 1OGTA 4WTXA 4KI5E 4MJID 3RX8A 3ZHKA 1CJYA 1FO0A 5EEWA 3AMLA 1MAKA 3CLFH 4MD0A 5KZCD 5ESQA 4PJIB 4LCWA 5G2NA 5K9OB 1EIBA 2WYTA 5D4JA 4JO8A 3NGBB 1HKFA 5C0RH 2NLJA 3TCXA 4M7KL 2PXYA 4MA7H 3G5XB 2OR9L 3HFML 1YEJH 1QSFE 4AC2A 1ERNA 2JI1A 2BY1A 2W65B 2Y7OA 5AW1B 4LGSB 1K6QH 5D1QD 3QO1A 4WY7H 1JSYA 4G6FD 4CADA 5A3IC 1BIIB 2VTFA 4WHCA 5T1JA 3CZFB 1BBJB 1J8HE 2DI8A 4XO3A 3GBMH 2JK5A 3QCTH 3KM2A 1L0XA 5EA0L 3KR3H 3MLXH 3TCTA 5JOFA 4N0YH 3UABA 1NKRA 2WQAA 4JFSA 2JCCE 3AC0A 1N26A 1MHEB 4X5WA 4A66A 5DJYB 1PD0A 4ZO8A 3V79C 4P9MH 3EYQC 4Q6IC 1JZFA 1EHXA 3TP4A 1J0IA 3DPBB 1KDIA 3M8OH 5F0MB 4BV1A 2GTWB 3SKMB 2ITDA 1P5VB 3BH9B 4F24A 1JHLH 1NL0H 1EEZB 2JELL 1WYJA 2BFGA 2R29A 3OKDB 4XN9A 3QIUD 3BZFA 5H94A 4CGTA 2IQAA 4NQEE 3RZCA 4EIGB 1IT9H 2J8HA 4K5OA 3SKOA 4YDLC 3T04D 1WZAA 2IPUK 3VI3F 1LE5A 4NGHH 4O02H 4KDVA 4N2DA 2V9TA 1KCRH 1M7UA 3QNZA 4AQ1A 2JXMB 2ZE0A 1BZDA 2LLGA 3OMZA 3WJMB 3KWWA 3CVHH 2GK2A 4HSAC 3CHRA 4E9RA 1QRND 1KBGH 1R24B 3QEQD 3TBWB 3K8KA 5IMKB 2BINA 2R7EA 3DHJA 3IFOB 1RU9H 3UTQA 3CXDL 4KI5F 3IMTA 4Y9CA 1JFQL 4B96A 2Z7WA 3VFOA 1YSOA 4GRLC 1HNFA 3H8NA 1G7QB 4Y7OC 4GUOA 4EEEA 1JNJA 1KC5H 1R0AL 1DBBH 5A2BA 1TT6A 2NX5E 3TPUA 3TT3H 3I6SA 4FQLH 3N85H 4HJTA 1NGYB 4PJXE 2EUZA 5F9OL 4P4KD 4OLWL 5LGJA 1TTUA 4FNPA 1N0XH 4LEOB 1IGIH 4BKSC 3GSOB 5KOMC 3U1SH 1PX3A 3VFPA 4AIXA 1S7UA 1AHMA 2VE6A 4YPGA 3MA7A 4OGYH 2BC4A 4JPVH 5C0AD 3LH9A 2Y7SA 4PY7B 4P5TA 2VSMB 4Z77B 1KEGL 3KPPA 2E56A 5F3BB 1L9RA 2I5YH 3K2IA 3BT2H 1IL1A 5C08D 4DKDC 2JCCF 2LVCA 1AY1L 2FBOJ 1P9MC 3ARFD 4U1NA 4IGBA 4UM8A 4WO0A 3GTVA 1BGXH 2PPDA 3MJWA 4P46A 4F57H 2O5XH 4K8RC 3GPEA 1BZOA 4P2OC 1L6XA 1JFHA 4R4NC 1RUML 2AQNA 3VXUE 4Z7OB 5IOPB 2YD2A 5KVDL 3NK3A 5SX4H 5E6ZA 5AOKA 1G1KA 1J1PL 2IWFA 1W0YT 1MFBH 1BAWA 1I9IH 3O6LL 4YIQB 5ACMA 2ZCLL 5MHSD 3GI8L 4NQSA 2JQZA 3IF1B 4X4XB 5FM5O 3SE4C 5AAMC 3LH8A 1G84A 4L8CA 3EGXA 4CVXB 4ABVA 1UD5A 4WVRA 5D2LE 3JQOB 4ZX3A 1OW0A 3TWYA 1H8NA 1XCQB 3O6FC 4X7EC 3ARPA 3F7RA 3QWNA 4KGLA 1A9EB 2GJJA 3WTSA 3HG0A 1NCNA 2QTEA 4OZGB 3HI1B 4PJ9D 4Z76A 4PJHA 4M1CC 4PJGE 4AM0A 1DFBH 4CU8A 5EUKB 1UCBL 2PCPA 2DWTA 4Q89A 5BO0D 3HPJA 3HZMA 1NAMH 3IJHB 4JHWL 3ZDZB 2DMKA 3KL0A 1S9XA 1D7CA 2Z7UA 4WI7A 1W72B 3QJRB 2J57A 4QXUL 4YWGL 4AQAA 3QP3A 2IAMD 1DDHA 4AGMA 4K07A 2EECA 4PJXF 1IC1A 5GS2D 4UQ2B 4JQIH 3EOAB 4UTCA 3SE6A 4Y4HD 1JWSA 1P1ZA 4J3SA 3N04A 4Z3GA 2R1WA 2WSKA 4MMXB 2A74C 3D25B 3UO8B 3QDHA 1TETL 1ZLSL 3RL1B 3K4ZA 4BK8A 1XSKA 2ARJB 5HP5A 3MV7E 5DS8A 5HJ3B 2OTPA 2UUDK 3UZEC 1OCWH 3B6SB 4KKLC 5FDWA 4QWWC 4PBXA 4YHOL 4QHKI 2ZUQB 3SE3C 4NI6A 3DX8A 2CLZB 3GO1L 1DJZA 1FCGA 1ZGLA 4CAGA 1QNIA 1CDJA 2HX8A 5LQBL 1C08A 3UBFA 3VFWB 3VWJB 1F8TH 3ZKXB 4RH4A 4UZGA 2VERN 3LXCA 4JG1H 4CILA 2EYRA 3V6BR 2OKMA 4YSOA 3SDDA 4I89A 1PSKH 4QRPD 1NFDA 3RRQA 1C5CH 3Q2CA 3W39B 1T1YB 4JM0A 3TN0B 1T1WB 3O6KL 3FQUB 2Z9TA 1NCTA 4OCWL 4YAQA 1D7FA 4HIIA 2ZUTA 4AQEB 2PTTB 2WXKA 1U8NA 3OMIB 3QCVH 5CILH 5D2LF 5IROC 4DP4X 3FAWA 1M7IB 3WEAA 3HHSA 3RFZA 3MPCA 3V0VA 5D2NC 4PJGF 1S7RA 1O6SA 4LLDA 4X6CE 1IGML 5DS1A 3GSUB 4HWEL 2IH3A 2ZOKA 2F19H 3KLAA 4NKDB 2DRUA 4AV0A 1L9SA 5SWQA 4N9OB 2VZUA 3BGAA 4CL7A 3BCDA 2CAKA 5CP3H 3WV0A 3KNBB 1OL0A 4WTZA 2B1AH 1J10A 4WHTB 5BS0A 4G8GE 1CE1L 3GDCA 1YZZA 2G9HA 6FABL 1UH2A 4ZOCA 4LPXA 2VR9A 4G42A 3RNKB 3UDWA 3PWNA 2X6UA 4JO3H 4Y4FD 3RPKA 2C3GA 4AQOA 3TFKC 2C8NA 1V55B 5DR5H 1DQTA 1OAUH 4DPAX 4TQHA 2FWOA 4H88H 1NBVL 4NKOA 5AEAA 4WTZG 4FABL 3TBSA 4L9LB 4N2EA 4PWHA 4LARH 5IEHA 3ZE0E 2YZ8A 5D9SB 1NFIA 1T7VA 3P3TA 4YNYA 4ZBJA 2B16A 1T5WA 2B2XL 2WXGA 4H1LB 4JO4L 4JKNA 4WEEA 1E3XA 4GBXB 3ZDYE 1ZHKA 2NY5C 3KPSB 3PXLA 4N24A 2B9AA 4WWID 1MG2C 5TE6L 1AKJA 3MROA 2B8OT 2Y7MA 2MPAH 1XIWB 3NJIA 3GJEB 1FFPB 1DVFD 1F90L 3KL5A 5DZ9A 5BRPA 2DF3A 4TNEA 5IVZA 3L3KA 2OQJA 3WIHL 1E2VA 4H0HB 1NUDA 1IRAY 2YZ1A 3HMXL 3R8QA 2E7HA 4Z3IA 3H0TB 1NZRA 4B0MB 1X44A 2UV3A 3BQUC 3DX4A 5C70A 1N10A 1LEGB 3PJSA 4FHBD 4HF5H 3V5HA 3FZUD 3F2LA 5IFHL 3MCLL 1ZE3H 1HXYB 1G7IB 2AK1L 2ILLA 4AVIA 3TA3A 4H8QA 4OT1H 1LEKA 1JXDA 4M3JA 4OFVA 3DMMB 4AJVA 4P04A 1U3YA 4ZAKA 3VCLB 2D4FA 3KYKL 1M2VB 5C0ND 1AR1B 1KT2B 1U8KB 5FW6A 1PAMA 2P5WB 5DA0B 3HC4H 4U2YA 1I1FB 4E9YA 4Z1PA 4L3AA 2OCJA 4HXBL 4JR9L 1OAQH 2W92A 4XP6H 3TO4A 5FS5A 2EACA 3MNVA 1OPGH 2QHRL 1TEGA 3T65B 1Y6KR 3VA2C 1SJHA 2HKFH 4AEFA 4F7EB 4PJ5A 4EBQH 5ENWA 1TTBA 3ZE0F 5EORL 1WPCA 2NOYA 4X83A 3S4SB 5E1GA 1ED3A 1QPXA 2BSEA 2F1EA 4YR6A 1ZLUK 2JKLA 2E76C 4IS6B 3CLFL 4NZRH 3C60B 1HWGB 3ZDYF 2OMXA 3KMDA 4KNQA 5FC9A 3K8MA 4JLRB 1O5DT 3OKOB 4HKXA 1KJMB 4TF4A 4ZODA 5AVYB 5C0RL 2NXZD 2TAAA 4MA7L 3BD3A 4IRJA 1HAWA 1YEJL 3QUYB 3CSYA 4N5UA 4MA3A 5CZVL 4RA3A 2Z8SA 1ILSA 1SY6H 4WY7L 4WWKB 1A6WL 4FRWA 4KTDH 4DO4A 1CD0A 3C5JB 5IB1A 3V0WH 4B27A 1FZMB 9PCYA 4ZT1A 2PO6D 1MFVA 4ILDA 4NN5B 5D7EA 1PNCA 3EH4B 5C2UB 1UWXH 2YQGA 5G4OA 5HYEA 3GBML 3QCTL 1UQSB 3KR3L 5DEZA 5E99L 5J06A 4N0YL 3K91A 4OZFA 1CXFA 3C2SA 3DBXB 4P9ML 4LLAA 2IPTH 1PDKA 2KMWA 3JTTA 3DRQA 3M8OL 1KGJA 1NC2B 2VUOA 1JHLL 1NL0L 5ESVB 4Y16D 3SGEH 2J21A 4ZW6A 3GXNA 4M5YH 2V0AA 3TASA 3GPSA 2BOBB 4NGHL 3GBNH 3EDFA 3RGHA 5DHDA 5IY5B 4YOKA 3N1FC 2P7TA 3VXSD 4ZSOA 5JXEC 1XL4A 5KVGE 1KJ3L 3CVHL 5HGAA 4GRWH 4DZBA 1ZAGA 2FNBA 2EXWD 1KBGL 4U1SA 5L9DH 2VLRA 3DRTA 1U8PB 4FHKA 1UACH 1EWHA 2TRYA 4ALAH 2QQQA 3VGHA 1YNTA 3OQRA 1ONQA 3W11C 5J4MA 3NJKA 4DIXA 1I1AA 4MYWB 1LXMA 4H2AA 3MRRA 3P4NB 3RVTC 3FU0A 3QXAB 4RMSA 4C4BA 2AEPH 2EDFA 5AB1A 1EVTC 3S35H 1HIMH 3DX6A 1EXGA 1DBBL 3QORC 4IMLA 3TVMA 5CHNB 1WK0A 2F9BT 3TT3L 4FQLL 3QUXD 1QR1A 5C8JB 5L2KD 4R7LA 3BHBA 1JPTL 3KXFA 3MXVH 1N0XL 2J8UA 3PWPA 5TFSH 1S5IL 4HFUH 3AUVA 1X4XA 4D9QD 2DLIA 3RWFB 3U1SL 5MENB 5CKAA 1CZ8H 1O7VA 1DQDL 4FI6A 4LLQA 4OGYL 1MREH 4AIOA 4PREB 5ID0A 3T1WA 4FEMA 3IBEA 5J8OA 4HAKA 4NQXA 3QDJA 2I5YL 4WW2A 5DJAB 5F44A 3BT2L 4HETA 2Q7YB 4TUJB 2OMVA 1B6DA 2XBZA 3ASWA 4PRIE 3EYVA 2FHBA 4K94H 4XXCA 4F57L 1U58B 4CA4A 1FNLA 2FWSA 4KVNL 1MEXH 1A66A 3FH8A 1EMTH 2HLFC 2X6MA 3PV6A 3AADB 5CLYA 1A1MA 1I9IL 3P4OB 4PLJC 1Q1PA 3SDXA 3VFMB 1UOVA 4QHLB 4U1KB 2QKIC 4JJ5B 4MMZC 4S1QH 3HZ3A 5E9DA 3QFGA 2W9DL 3EG9B 1E90A 3JTSA 4NC0B 3IM1A 4X5XA 2IPUG 2QPUA 1OXYA 4FXTA 2R2HA 2IALA 5E8NB 4XNDA 4UBDC 5AAWC 3WY1A 3QYMA 3NA4A 1LK2A 4J12A 5BZZA 2F68X 5FK9A 3RP1A 1R75A 1SDDA 3J7HA 1NAML 4ZUVA 4AT6A 5I74C 3DPDA 1SJEA 4BELD 1RZJC 1JD7A 4EO5A 3C6LB 2KZ1B 4M03A 2IF7A 3L17A 4FNLH 15C8H 2R0LH 1E5CA 4F9PC 2EDYA 4JQIL 2C1PB 3SDAA 1E5UI 4XNXH 2CHDA 3J8F7 5AW8B 5I0XA 2IADA 1E5ZA 3IN0A 4POUB 1YJDC 1JV2B 2GG1A 4GKSB 3CDCA 1ID2A 2YD0A 3R0MA 2CO7B 4FQXC 1KLFB 4L23A 5K9KB 1JBJA 1OCWL 1CGUA 4XN7A 4A7VA 4G80B 3UG5A 2BCKA 4JFDB 5GSVB 5I76B 2DWYA 2YPLA 5C0JA 4K3EL 3L3IB 2YMXL 3QZOA 4LCUA 1P4IL 3MRKB 5MERA 4LVEA 1AIFA 1DVUA 4DETA 5MEQA 5IR1B 2Y5QA 2UZXB 2MJWA 4JG1L 4X4ZA 1F3JA 5DQJB 4ZX6A 2E0PA 2FIKA 4NHUA 2J1WA 4HUVB 4DUVA 1QNZH 2BSCA 1C5CL 2NY1D 4JKPH 5I5MA 3BYTA 2H41A 4NO5B 5JHLH 3FQNA 1BVKA 1J48A 5EH1A 4MAYD 2GUOA 1D5IH 1N4XL 4P2RA 3GRBA 4BQCA 5F0PB 1BPLB 2DMHA 5C0BA 1J86A 2W07A 4QRRA 3GBDA 2FL5B 3QCVL 4G2AA 5CILL 1KLUB 3SOBL 4PS8A 4I5BA 2ZXAA 2CO6B 3V8CA 1BFOA 4YC2B 2BFVH 1LGVA 2AKRA 2YGNA 5DRZA 4IEFB 4K55A 1KFAH 3W1ZA 3HRZB 4MNQB 2ED9A 2MOVA 2NY7L 3HZKB 1ITBB 2DYPB 3HBPA 2F19L 3QXDA 2GITB 1IQDB 1PY9A 4QAMB 5I8OH 3RNQA 3W37A 5IUCA 1OCCB 3STLA 4G6KH 3UTZB 5D70H 1AGDA 3AB0C 1FSKB 2B1AL 3HB3D 4L4VE 3G5VB 1TSHA 4HFWA 4BGDA 1NQBA 2Y2YA 5AL0A 4JO3L 1XXFC 1BF8A 1C5BH 5DR5L 2BVUA 1OAUL 3NIDB 4DAGL 3U4EA 2QPSA 4FL4B 1D5XA 5FWQA 1IM3A 3CFTA 3D05A 2P5EA 4JO5A 4JPKL 4LARL 5CKGA 5D7JD 4OLXH 1OSZB 1TSRA 3D69B 2B20A 5I1DB 4LB8A 4ZPVB 1OGSA 2NSQA 1UD2A 3U79A 4AZ8A 1ZSHA 3DO7A 1OTSC 3CMOH 2WKOA 5FECA 1HQ4A 4PBVC 5HHOA 4I77H 1U8QB 3FB7B 1KTJA 4QHMB 4ELMA 2YA2A 2X9ZA 1QLFB 1WGVA 3RWGA 5HD8D 2FEEL 2E3VA 3D9AH 4IJ3C 3V4UH 2EVHA 1DZBA 3DNKA 2WW8A 1YVLA 2MPAL 1PF3A 1ZHBB 3HE7C 4ICXA 3AREC 2OM5A 4N0CD 4UI2A 3O9WD 5EO9B 2WTRB 5L4FA 3REVB 5HI5C 2FK9A 1VFBA 2B9BA 4NM4H 3MGTB 5GGUA 3RBSA 2JLPA 4MNHA 4F2ME 3L6FB 1QVOA 1BQKA 4WAFA 4CC4C 1SPDA 2EIJB 4ISVA 1T6BX 1INDH 2VDLH 4OM1H 4LASH 4MDJB 5HYQA 3V5KA 5GXBB 4W6WB 4X4YB 4NNPH 3RGVB 1KXVA 2DV6A 5D4HA 4YK4C 1PPIA 3I6KB 2C3WA 1CD1B 4HF5L 5IW6B 1T20B 2J2ZA 3FSVA 3DSNA 4R5XA 4ZNCD 5HHPA 3VXMB 3AS2A 3QNXB 3CFNA 4ZUUA 4RX4D 1QSZA 1T21A 4N8UA 4OT1L 4ZW5A 3GXMA 4JM2F 3AXHA 3VXUD 4NM8H 3UP1A 3EYOA 4EMZA 1I8IA 3LIZH 1AXSA 2F53D 4F5CE 4ZZFA 5LG6A 1BBDL 1KIRB 3LEXB 1KCBA 1MIMH 1FL6A 1I7RA 3RB5A 3HC4L 3MLTB 1UXMA 5IEKA 2GK0B 1COBA 5CIPB 5I1EH 3LKNB 4DJMA 1T0NA 5HDLA 2A99A 4LKCB 4EDXA 4WU5A 1OAQL 1R3IH 4W9GC 3BIKA 1I1YB 2XPZA 2IXQA 4XP6L 2P8PA 5HVHC 1OPGL 1YY9D 4PJAB 4GS7B 3S36X 1EPFA 2HKFL 2AMGA 3R7RA 4EBQL 4R4BA 5CZKA 3ARGA 5CN1A 5E6YA 1IGTB 3NCBB 1TJMA 1S7SB 3Q2WA 3MTRA 1A4KA 5I1AB 2DL9A 4N2LA 1ZIAA 4NZRL 1JNHA 3GWJA 5ADPH 4L1BA 3QA3A 4CVZA 2WBXA 2P24A 3OJDA 4YBLB 3QPQC 4E9WA 1J8SA 2F15A 2R2BB 5DFVC 3EOTL 2QTVA 5J1SC 3SQBA 2QSCH 3WKNA 1IB5A 3V6OC 3NN8B 5DC4B 1EGJA 1ADQH 4HC1H 1SY6L 5E1AA 2NY3C 3MV9D 4I3RL 4Y5VC 4P2QE 3BAXA 4KTDL 3MV7D 3NJFA 3V0WL 2ESVB 1UM6L 3QUZA 3H9SB 4JMXA 5DC9B 3MUZ1 1CICC 4ZFOB 4HK3J 5GRVL 4ORZC 3CPLB 2ZWYA 3DUUB 5FO2A 2D73A 3O0RH 4M5SA 5F1IA 5I30H 2BNQA 4TNFA 1Z0MA 5J12C 1DSYA 4OCRH 3BP5A 2D2CC 5L4JA 3FFCB 2IPTL 2NQ3A 7PAZA 4TV3A 2J6WA 1CE6B 4WTWA 1D9KD 2NR6A 2DEXX 5E5UB 1C9SA 1IAKB 3NIFB 4L5FL 5KYWA 4ZUWA 3G3LA 3QHFH 3I3EA 5D93B 4M5YL 4PS4H 4RFNB 1XGPA 2YS4A 5FYLH 1YEDB 1NC4B 1VEPA 2SEBB 3FN3A 3ARXA 3GBNL 1NJ9B 3RVWD 5I5IA 3O2WH 1VKXA 4HJ0D 1NGZB 4GG6E 4RMBA 5BPPA 4WFFE 4Y1AB 2BSRA 5L9DL 2X6BA 4X6DB 1UACL 2HJLB 4MBOA 2V8MA 4F8OA 1KEMH 3PNWB 4P5MB 5E8EA 1CURA 4DGYL 2G5BB 5B3SB 2VT0A 3MLPA 1DN0A 1XFPA 4F7PA 5HHQB 3UIYA 4K7PY 1U92B 1NTDA 3TJHD 2C1OA 1A6AA 1HDMB 3UROR 2AEPL 1FHNA 5DJZA 5F7DA 4MHHG 4ORGA 3DGGB 1K8IA 1HIML 2BY2A 5PAZA 2NYZA 3LXBA 5MI0B 3V0IA 5GS1A 3NGBC 4A2MA 2VLJA 4EIBA 2BMKA 3OMNB 1UVQB 5AWNH 4CN1A 4G8GD 5FB8A 2CDFA 1QEXA 3MJ7B 5DQ9B 1AGCA 3MXVL 1BLNB 4LPYA 1ZLEA 3QIWA 3V95A 5TFSL 3EH5B 4HFUL 1VCAA 2XN9D 2V2WB 1YMME 3CHOA 4D0CB 3OSVA 1CZ8L 2W8CA 2FTAA 1MREL 1FJ1B 4XVUC 2DEWX 4ODWB 4E41A 4NJ9L 3MV8B 3ABKB 3REWB 3S2AA 2ZZUT 3PPEA 3QXTA 4KNSA 4PH8A 4J1UB 1Q9WB 1AGBA 2XFXA 4O2CB 1Z9SB 3POCA 5KSAA 4YSAA 2WJ5A 5AYQA 1IBFA 3CFCH 4FNSA 4K94L 1U91A 1X6LA 1G7JB 1KIUB 1MEXL 2CR3A 4XVOA 4FNUA 4XCEB 3ZMRA 3QZPA 4JRYB 5L4MA 1EMTL 1YNLH 1JF6A 4GLRH 2Y1YA 3QS2A 3HFFA 3CZJA 1GGBH 4NQUA 5D1ZB 5KYUA 2XPYA 2KS0A 2BS71 3D85A 3T77B 4S1QL 1E7UA 1XGQB 4QKXB 4GG6F 3HUJA 1WZMA 4S1SH 5HHNA 2WZ5A 1KY7A 2HJFB 4JRFA 1MIEH 1XGUB 3QULB 3DTXB 2P46B 1MCEA 5EBWB 2BVOB 3GLDA 4XWOC 3CFEB 4ZMZA 1XGZA 3BIAX 4Z7WB 3VWKD 4GOSA 4ODSL 1G5AA 2BERA 5AOLA 3SQRA 1NGWA 5F7EL 3M1BA 4MNGA 4BFBD 5F88B 4LHUA 1CXIA 1A6TA 5SWZE 2FHFA 4MDIA 1T0PB 2YKLH 4YMPA 1TZGL 3TJPA 1N5YH 3FXIC 4JN1H 4N2FA 4FNLL 15C8L 1F4AA 1SN5A 4FKKA 4N2CA 5D7IB 4HOZA 3RWDA 1UTDA 1AXTH 4L8DA 5IWLC 2VKWA 4IYKA 3X14B 3VE0A 3DHUA 1A3RH 2VL4A 3DA0A 5I1KH 3MRFB 2LHAA 3KEHA 2GB2A 4PJEE 1F3DH 1FIGL 5B1CA 3TJEL 5HDQL 3OR7B 2IIJA 1WBZB 1KLGA 1I7TA 4GY4A 4G5ZH 4N3TA 4HLZH 1WAAA 4TM9A 2UY7A 4JN2A 3WS6A 1MCHA 1EK3A 4X4MA 4XNMB 4AVKA 5DXWA 4RESB 1SN2A 4IKLA 1NMBL 3MA9H 5E94A 2WXFA 1HHJA 2CWRA 3HG1B 2EKSB 1M56B 2A73B 4KX7A 3HS0B 2F5BH 3QZWG 1QNZL 1RJYA 2WZ0A 5IK3A 1GJUA 3Q3GA 3IJYA 4HS3B 4L5FE 4JKPL 1X5GA 2F1AA 4TXVB 1K5WA 5JHLL 1V7MH 3T0BA 3MRBB 4AL8C 5ETUA 1D5IL 4HPYH 4P5TC 1SYVA 1QOKA 3A4EA 5DO8A 1QEWA 5IJVA 3NJVA 4IKKA 4KRNA 3U6RA 3NFNA 3HR5B 3P0YH 2BFVL 1AO7D 2RFXA 5IJCC 1QZNA 1UZ8A 2BDNH 5D2NE 3BPOB 1KFAL 4RETB 1RZKH 4RSYA 3GFUA 4H5SA 3SO5A 2ZOLA 1J1OH 1O9WA 5K93A 3ALWA 5FCUH 5CUSL 2J71A 5EBGA 3IMBA 1F13A 2XNAB 2NNAB 2YD1A 4Y2OB 3RPIA 5I8OL 3VGBA 5EF3A 3MR9B 1YEFH 4UB0H 3ZQWA 4KUZH 2Y1AA 3MGAA 4G6KL 1C8QA 2W60B 4OF0A 5ICXA 5IOKA 3WEBA 1F4WH 4UT7H 2VR5A 4W4OA 2BVQA 2OXGB 5BNXD 4TVSa 2PTUA 4QXTA 3ESPA 1OW0C 1QSED 2F54D 1T4KA 3WGUB 2ZKWA 2H0JA 2VOTA 2X70A 2YSSB 4DVRL 2GW5A 2LW3A 2R1XB 1C5BL 4DP7X 2Z4TA 5HYSB 1WG3A 5J6HB 1YEWA 3QE5A 2WGXA 4WUKL 4WUUB 3RL2B 4AY0A 4UTBL 1HI6B 1FNSH 4B95C 4Z7QE 4J3OH 2ZUQC 2X41A 5A7EA 4JDTH 1SEQH 1DJXA 1SYSA 3TOPA 2OMTA 2AJUH 1KTCA 3FC8A 2OCFD 3CMOL 4EIUA 2VH5H 3CFDA 4U1MA 2UVFA 4I77L 5HJBA 2Q8BH 3VWJC 3K81A 4G6JL 1A02N 3RAJH 1FVCB 1SOXA 1UKQA 3D9AL 4A7UA 3V4UL 3BI9X 2GBUA 4RDQG 5ICYA 2WQVA 4E9VA 4PLNC 1EANA 4PCTA 4EN2A 2FQFA 3ULUL 2A9MH 4UIKH 3D06A 1UWYA 3QEHA 2M26A 3V0JA 1EXUA 2BSTB 1LDSA 4NM4L 4UDUA 2JJUA 4XBPB 1Z5YD 5AYUH 2W0KA 3QCUL 5LG1A 1K5NB 2WWNA 4TNVF 4JRXA 4F33B 3GS7A 1INDL 4JGUA 1LM8V 1MJ8H 2VDLL 4NNXB 4LASL 1IM9B 4XZUA 1XEDA 3FKUS 2PMZA 4YZFE 5E4AA 4NNPL 5AW6B 4Q97A 2YFOA 1DO6A 1AD0A 1F00I 1H3WM 2IDQA 2QSQA 3Q1SH 4TSCH 5IHWA 3FB5B 3EJRA 3B5HA 3TNNA 2DQGH 1WD9A 4RGNB 3P0GB 5CR8A 3P69A 3NIGB 4UQ3B 3RWJB 4NM8L 1GRWA 2GIMA 2IOIA 4IU3A 2KLTA 1WIOA 3LIZL 3OAUL 1EJ6A 1BX2A 2XWBB 1EO7A 4IHBA 4W9KC 4R3SB 2CO2A 4X6EB 2H32B 2IWEA 3DO3A 5I1EL 1T66D 1Q0XH 1JK8B 1PG7L 1R4XA 3QJTB 2HT3C 5LHDA 3VB8A 1R3IL 1EHLL 3W0WD 3VFNB 5I8CA 4Q52A 5AVQB 1E2ZA 4OUUB 3BUYA 1L9MA 4Z7QF 5TDOA 1JGLH 3IJEB 1JAEA 2QMJA 4L9LC 4NC2B 3S2CA 2ICWA 3ZUNC 5INCB 1KIPB 1RK0A 2EEFA 3UIZA 4PB9H 3SY6A 1HCVA 5C07D 1OGAE 3ULVH 1CG9B 5ADPL 5BJTA 3WN6A 1OD7A 4YXKL 3U46A 5DJDA 4Q2ZB 3S98A 3TEWA 5E2TH 5K1JA 1AG0A 1JHTB 4BCXA 3BXNA 1SHSA 1XIWC 1VPOH 5IMLA 4NAQA 3WFHA 1ADQL 5D1QB 3KPNB 1R5WA 3VX0A 1KB5A 2P3YA 1GC1H 2IG2H 5F2FA 2DQMA 1CFBA 2ZUUA 4PRHE 1BZ9A 4CMMA 4OZHE 4QHPA 4X0KA 4YDNA 5EN2A 5KS9E 3IRPX 4MJ5B 1WCBB 1ZWIA 3BPNB 4LRIC 2ZUVA 1B4RA 3O0RL 5I30L 2X6VA 5JHDD 2P44B 2DMCA 2EKJA 4OCRL 1T0MB 3DTUB 1XXDC 3M17A 4NPYA 1E2WA 3OR6A 4QF1B 4QAWA 2BK8A 4QTIH 4OGQC 3K7UA 2DKSA 3P3UA 2NW2A 1L5GB 2VDQH 3QBTB 3B1TA 4KNUA 1RZPA 3BP4A 4Y9EA 3QIUB 4OM0H 3QHFL 1KDJA 1AR1C 3RX9A 1C16B 4PS4L 1GYUA 2PUQT 5FYLL 4A6YB 4RRPM 4FAAB 3GLAA 5LNGA 2XKNB 4P4KA 3FHEA 4IOSA 5E2UH 4E9LA 4WO4D 1QRNB 2DWEA 2HA1A 3QRBA 2AQPA 4QEGA 2X4TA 1QUNB 3F6IA 1KYFA 2GTZA 5LAPA 1NGQL 5B1KA 1NDTA 1KEML 3UTSA 1VDGA 3BN3B 3U48A 3LZOA 1T3FB 2YBRB 2EH8H 3WS3A 3DYOA 3MKGA 1ETB1 4HJGA 1CLCA 2HT2C 3T5WA 1K4DA 2X53A 1DTUA 2KZKA 3IGLA 3ESUF 2XYCA 3NRQA 1SFDA 1XSIA 2Y7QB 3TZVA 5AWNL 1BZ8A 3FH5A 3V55A 3UPRA 3H3KA 2HFEB 4NQVB 1CFTA 1ITCA 1NMCB 5AVWB 1JPGA 3DIVA 2G4EA 4WCYH 2A5UA 4NX0A 3MBEA 3CXHJ 3ZPDA 3X13B 5C0AB 1RIHH 4OZHF 4E0RB 2JJVA 2OYMA 5AOJA 5KS9F 1S5HB 4FFYA 5FXCH 1H6FA 4E5XB 5C08B 1SMDA 1N8ZA 2WCPA 3ARFB 4RMUA 3EIFA 4DHLA 3WE6A 3V6FA 1ZD6A 2AW2A 3CFCL 4G7YH 4M7ZC 4EI0A 4Z9KB 5EO0B 3OHXB 4XTRC 1JS4A 3FSWA 4U6YB 2OYPA 3W5MA 3DWTA 4X5RA 4XX5A 3VH8B 2YN3A 1PIFA 2DPKA 3ZDXE 4POYA 1BEYH 1WLHA 1YNLL 5MEOA 5I6KA 4X80H 1GGBL 2WAHA 1U8CB 3QUKA 3GIZH 4I2XA 3RUGB 5ADOH 5K9OA 1JYVA 2ZKHH 2R4SH 2IAMA 4GXVH 2UXTA 2BNUB 1CFQB 4ZDHA 1A3ZA 1AC6A 4K5NA 5LCVH 3I3BA 3O45B 3G5XA 3FUKA 4HK0B 4K7FA 1DL7H 3CXHK 1JWUB 2GJPA 2HKAA 4FI7A 4I7ZC 4S1SL 1MDAA 1NEZG 5SWSD 1MIEL 5HI4C 3OAYK 5F7FA 3UAJA 1KTDA 2F74B 5L8LB 2YA1A 1TLMA 2I85A 3VGGA 1NCOA 4IIQA 1OLZA 3BDYH 4GKLA 2J1YA 1S7TA 2J12B 2W0PA 3EYFA 3MRGB 3BUBA 1NEZB 4MA8H 2BW5A 1AMYA 2VZOA 2YKLL 4TL4A 4F8NA 1DJYA 4QHUB 1N5YL 2IOOA 2PP8A 4NO0B 5C3TA 4JN1L 5KBDA 1QWNA 4Y4HB 1AXTL 1V8HA 2VJXA 3OKKA 5B8CC 2H0FA 3DPBA 2GTWA 3SKMA 1J12A 2EEAA 3KS0H 4GAYB 1A3RL 4QRPA 3CHPA 5KJ4A 3L3GB 2R0WH 1BJ1H 1OOWA 1TJGH 3BT0A 4RAVB 2WC7A 2QDVA 4F20A 1Z0NA 5ACLA 1D5MB 4OJYA 3LB6C 4G5ZL 1ZT4A 5DHVH 5EUOB 4JE0A 1BOYA 1F1DA 1P69B 5GSRB 2FT7A 3WJMA 1C1EH 4J7RA 3CFKA 4EJ1C 1ZVSA 4ZPTA 3TBWA 3MA9L 3GTNA 1UJ3B 5GISH 2BP3A 2MQGA 5E00B 1F11B 3IFOA 3ZDXF 4TUKH 1XH1A 2F5BL 5ITBH 3IDNA 1DJHA 4XCYA 4BH8B 4W9ZA 1GA2A 3QIBD 1V7ML 3U9PH 4Y9FA 4HPYL 3HJ0A 2XWDA 3KLSA 4G6AD 5C0EB 3FTSA 2VDOH 5GPRA 3P0YL 3PWUA 4Z7VE 1TO5A 1BWWA 3ZHFA 4B3VA 3JV6A 1NICA 1U8IB 3CC1A 1RZKL 2G2RB 5HPOA 3VGFA 1J1OL 4UNTA 2A3TA 5AG9A 1DQMH 4PY7A 1JXKA 5FCUL 5A2IH 2E47A 4Y5YB 1QUPA 4NCC2 2OZ4A 2K1MA 5K5YA 3V4PA 5E5RB 3HS9A 3E2HB 5F3BA 2RQEA 1YEFL 2D9QB 1MUJA 4KUZL 1MWOA 4WV1C 4XNZB 4I48B 1F4WL 2JMRA 5DJ6A 3KLDA 1ZIBA 4AVHA 4Y4FB 5J7CC 2HMID 1UURA 2DKUA 5K1NA 2Z8VC 1DVFA 1RD6A 2R69H 5ESAA 1RP8A 2P26A 3IF1A 1FNSL 1P5UB 4X4XA 5IW1B 1G0YR 3LS4H 2CPCA 1SEQL 1FFOA 1HEHC 4ZFGH 3IWVA 3E80A 1OF2B 3AWFA 2VH5L 4N8CH 4A1RA 4FCAA 5AVXB 1KV7A 2YD3A 3SD2A 2Q8BL 3LKOA 3RAJL 2YJLA 1JGEA 1E0OB 3CV5A 4LVNB 4WI4A 1X4ZA 3ILDA 3RLSA 1JNLH 1PYWA 4AQ8A 2QR0B 3N1MC 3ABLB 5BO1H 1ECYA 3PFQA 4UINH 1FG2B 2A9ML 1ILUA 1JIBA 4LSSH 4UIKL 4NIYE 2WZAA 3RHWK 4LIQH 1NKOA 1G7PA 5AYUL 3TCLA 2VLME 5JDSA 2OSYA 5EU6D 3AG1B 3N5AA 1YEEH 1MCFA 4A04A 1MJ8L 3ATBA 4UQ2A 1VERA 4LK4A 1PCXA 1NM4A 4MMXA 4OFYD 2WTPA 4PJBA 4N9GA 1A8ZA 4MLIA 3IJ9A 5ISZD 3Q1SL 4TSCL 3RL1A 3S3BB 2BWIA 2OA9A 4L37B 3EDEA 3HRZC 1Y7VA 5HJ3A 1EDQA 4KMLB 2BSSB 3DX9B 3MLSL 1UASA 1FZKB 3ISWA 4RIRB 4NQDE 2VR4A 5I6MA 3LNGA 2PYEB 2CH8A 3WLBB 4LF3A 4AGOA 2GIXA 4F8QA 1TFPA 3QWQB 2WLZA 3IDIB 1U4EA 1H0DA 2X4SB 4MQXD 3UTTE 2ZKMX 4Y5XA 4JFWA 3CSGA 4OZFH 3W39A 2CLVB 1UCTA 2XWTA 4FL4C 4XX1E 4Y2DD 1JGLL 1FVEA 4WW1B 4DN4H 3L9BA 5D1XD 2ITFA 5D6DC 4UOJA 2VL5B 1YEGH 4I1PA 3S0PA 4AQEA 2NCEA 4AVJA 4LCVA 1F4YH 2WSPA 3WFBL 2Y9RT 4PB9L 3T1FA 1S4IA 3HG2A 3I75B 3NYKA 2W9LA 4D8PB 3ULVL 4WHYG 2YQBA 4H20H 4ZS7H 2NXZB 3ZHDA 5I73B 1WH0A 1WBYB 1PX8A 4PLKC 3UYRH 4DPRA 3BH4A 2HTLC 1EJOL 5E2TL 5JLZB 4WI0A 5C09A 1AYRA 1VPOL 2G2PA 4OCNC 5DWPA 4WKZB 3P9LB 3ZBMA 2GSIB 4BFGA 5I1CH 3G6AA 4ONFH 2K3HA 4JFFA 1GC1L 2IG2L 1SMOA 2CRYA 1IE5A 4K5LA 1JZ4A 4MHHI 5E5MB 3ZL1A 4F7CB 3NZ8B 4NZTL 1VEMA 3RIFF 4ZMPA 2OMYA 3COOA 4DQOH 1CLZH 3MRIB 4AYBA 3G9VA 3D30A 3KYMB 3RGVC 5JORA 3Q2VA 5FO8B 5B1JC 4XR8C 4U6VH 1DUZA 2PCYA 3O6MH 4KKNA 4V33A 1OP3H 1MFDH 1AGFB 1OWWA 4YHYB 2EO9A 4P5RA 3GSWB 4ACPA 3QJSB 1F1AA 4RNRB 3T3PE 4QTIL 1DJWA 2EUWA 2V9UA 1ROWA 4KRPC 3O11A 3L13A 3MOQA 4U1LA 4RGMB 4P23D 2P80D 2CUHA 5IESH 4OM0L 5A1AA 3TYFB 2BHZA 1KN2H 1MG3C 1PG7W 3EUUA 4ONHB 3QUXA 3ARRA 3MHZA 1XF2B 3T2QA 1CFNB 3VXSB 1A6VL 4F8TA 3HAEA 3PGFH 3SPCA 1A9BB 3CWGA 1FL5B 4A2GA 3D48R 1MAJA 1IAIM 1IAIH 2LVEA 3CN3A 4BFJA 1RK1B 1FNGA 3RDTD 5JIIA 1SOKA 2XXFA 4QTHA 4UZUA 4DP6X 1UEYA 3HAEG 1C12B 1KPVA 1IIIA 3O4LE 4X6BA 5H4ZA 4PJIE 2NUPB 4PJCA 2LE9A 4ODVH 4TTDC 4YBLC 2BHYA 4WJ5B 3T2OA 1SQ2N 3UBHA 4C57C 3AGWA 3LNDA 1HL9A 4LSTH 2MHAB 4KDTA 1IZKA 1QQDB 4MB5A 3CDGA 1FRGH 4LZKA 5DK2A 3WNOA 3DMMA 4WCYL 1L9OA 4J4PC 2FJUB 3VCLA 2D7MA 3BP7A 1NIFA 1QHQA 1X9RA 4V2CB 4FNQA 5E8PB 4Z0XB 3GD1C 3WAKA 1KT2A 1U8KA 1RIHL 1A21A 4OKVB 1H15B 3S34H 3HS8A 3N43F 4KKCC 1QD0A 4EZLA 5HHMB 3QC5X 1JJUA 4O51B 3LY6A 4RZCA 1U3HB 3LRSB 4UOZA 4ETYA 5KSVA 3CBKB 4AMWA 1KCVH 4XVSH 3T3PF 2KZWA 2V3EA 3V0AC 4ZG1A 3FO9B 1P4BH 4XB7A 4JKMA 2Q0ZX 1BEYL 2GI7A 3WNLA 4BEIA 3WIAA 3L7FA 2VZTA 4X80L 4LEXH 2P52A 1TZHA 3GIZL 1YMHB 1QHPA 5ADOL 2ZKHL 2R4SL 1A4JB 3QB7C 4ZS6C 4UV7L 1KJMA 1ZA6A 2XA8H 3X1BA 5LCVL 2ATPB 4LNRA 2CDEB 4KPHH 4P5KA 1DL7L 4MASA 1X5MA 4KNTA 3U2SA 3WO3B 2Q7NA 3ULUH 4L4TB 4YHMH 4G11A 4N5EC 2XWEA 3RVUC 1JUFA 1X5KA 5GJTH 1FZMA 5C0IB 1P4LB 3KPTA 4MKMA 5CN3A 4RAUA 4FXGB 1QWHA 3LV3A 2E74C 3MOBL 2FH8A 4LOVA 4MA8L 1LNUA 4PJIF 2XWJA 2EYSA 4BZ2H 1HZKA 1G7LA 3VDBA 5MI0C 2KL6A 4NWUH 4C4KT 2QVTA 5DHYA 2NY4B 1H3TA 2X5PA 4TQIA 3VI3B 2CHWA 4KQ4H 3MN8A 2BJML 2VLKE 4HIHA 2AFNA 3FO2B 1QLRB 5LLIC 1J5OH 3MRPA 3QPXH 1PY0A 2R0WL 4QRUB 1WITA 4WI3A 2P1YA 3MCG1 4IBYA 4KWUA 4EAEA 3U30B 5IV2B 2BOBA 3OKYA 1BG1A 4PR5B 3QZNA 2ZCKH 4KKAD 1H3PL 3P11H 3T8XA 1C1EL 4NKMB 2VMCA 1JWMB 2OTWB 2WBJB 3DOIA 3GRWA 4ELKB 2A77H 1OF0A 3MRLB 5L2JA 5BUGA 1YPZA 5GISL 3IDMB 5KVFE 5E24E 2AANA 1T04A 3MUHL 2UUDH 3QJQB 1HH6A 3C6SA 3TIDA 1QSFB 4TUKL 3ZJAA 4AEEA 4FDWA 5ITBL 2XTJE 3P4NA 1Q9LB 1M71A 2PP7A 2XV0A 2Y06H 3L7EB 5BVJA 2Y4SA 5J0BA 4HBQA 3HE6B 5D1ZC 2D2OA 3Q6FB 5BVPH 3CHXA 4MAYB 3RVVD 4BH7B 5BUPA 4OIFA 2XDHA 4HIJA 1OZTG 3S7GA 4JY4B 1AQKH 2A4EA 3R4RA 1J8HB 5KYNA 2VDOL 5HYJE 1DQIA 5FA3A 2X6CA 3DXAD 4Z95H 3VD5A 4KTGA 2JCCB 3AUWB 3NFPB 3W57A 5BV7L 4AW4A 3G5YA 1A1NB 3CDZB 2YOCA 4M6OH 4GW1B 5MENA 3FQXB 4C83A 5EWIL 3D39A 4M4RA 1ZTXE 2YBGA 4LOEA 3DROA 3H2QA 5D7JA 1DQML 3VFSB 2VC2B 1S9WA 5BRZA 3CE1A 4ZQKA 2GEEA 2YAEA 3MLRH 4D94A 4HWBA 1JF5A 1OARH 1WA0X 4RWYH 2KDYA 5FKAB 3NUKA 4ATWA 1N6UA 3ZOAA 1LTXA 4KQ3H 4P48A 5JUEH 2WBKA 5L8KB 3DIFB 1JK9A 1JP5A 4LLVA 3T0ED 2WP3T 2XX1A 3UADA 4XPBH 1N9PA 1DQQA 4IBVA 3VFMA 4KO6A 3L9RB 1UZ6E 4PJHE 2F0CA 3BSHA 3KLLA 4U1GB 2DQCH 2NY2B 4HXAL 4GB9A 4K3JH 3LS4L 4M9PA 3T0WA 4K9EH 5B39B 4F80A 3A24A 4H26B 1ET7A 4ZFGL 1B9ZA 2CQVA 1JMZA 1NBCA 3ULSA 1NCHA 3BAIA 4N8CL 3X1NA 4OZIB 1TEFA 2NX5B 2NY5H 1MVYA 5BRQA 2K70A 3OMAB 3OWEA 2ZOWA 3B2UD 3A67H 3J2PA 1UXLA 5ALBH 1XF5B 3D8MA 4PJXB 2IDCA 4GW5A 4LLWB 4L3ED 1E9OA 2XYBA 4UINL 3VTTA 2Q6WB 4ADIA 4M6NH 1FPTH 3ULUD 2FWUA 4GEJA 2F53A 4LIQL 2NSXA 3C6LA 2OBGA 3L16A 3BGMB 3KPQA 1GPOH 2HRPH 4HHWA 1YEEL 3WMPA 1RLBA 3BUPA 3FHQA 3FSOA 2C1PA 4HHGA 1AP2A 1TJIH 4GT0A 3B83A 5F97E 1J05A 5TD4A 1SBSH 3HEIB 5DZAA 1J8KA 1JV2A 5LXGL 4OZGF 4F58H 5I1LB 1B6UA 1HAUA 3BPOC 1XCXA 4RCAA 3WUWB 5K9KA 3D07A 3VXUB 3PY9A 1FLRH 1GH7A 1W8EA 1O0VA 1NFDE 2FLBT 1EQWA 2HVKA 3MCKA 4EVNA 3L5XH 4XN1A 2A9DA 2R23A 3TV8A 5I16B 4U3CA 3H9YA 5DMKB 1AJ7H 5IBUB 1MSPA 4Y19E 3ARBD 4QOKE 3B2PA 3OGCA 3MRKA 4L1HA 3LZQA 3QDGE 2MNWA 1G9EA 1RJZA 2UZXA 3EJYD 2ATKA 2Z31D 5DQJA 4WQOA 3D50A 4XMZA 3D0AA 2VNCA 4HUVA 4NJAL 1RI8A 1UZ6F 2DMGA 3MV9A 4PJHF 4DN4L 5IBLC 4NBYB 2GFBA 4FG0A 2B0SH 1YEGL 1VZIA 2IO5A 2ZXBA 1F4YL 5LBSA 2L8AA 4BQ8A 5D5ME 5A2LH 3SPVA 2X42A 3OC5A 2E6PA 4NWTH 4ZS7L 3H54A 4H20L 2MOGA 4NO3B 5BS0E 3T6WA 2R2CA 2WQUA 4KK6D 3IS0X 3N1QC 3ESOA 1NDMB 1NGXA 3BKYH 4IKNA 1D9KA 3O8XB 3V5DB 2VDMH 1KNOA 3CIQA 1MOEA 3LKPB 2GITA 3HC0B 1E4HA 3O2DH 3V7MA 5I1CL 2VN3A 4MQ7B 4ONFL 1UD4A 3MV7B 3D18B 3NBNA 4GUPA 4CNIA 4Z0BH 5HVFB 3SYCA 3GYRA 3L9YA 4HKJA 3QARA 5DEFB 1NOAA 2QQNH 4DQOL 1CLZL 3G5VA 3C5ZD 2H6PA 3QW9A 1LYQA 2BVTA 2DAVA 2E7CA 2H26A 3K72A 4U6VL 3N42B 4R7NB 5DJ8B 1R1CA 1MFDL 2N1TE 2A0LC 4PMEA 1M7XA 4RGNC 4GKNA 4NT6B 3FCSA 1UEMA 1TITA 1T80A 4YSSA 1IEHA 3H6JA 1G7HA 3D3VD 5IESL 3U36A 3FJTA 4Y4KD 1KN2L 2CRIA 3HLAA 1TKWB 3KM1A 3G08A 3CIAA 4QHMA 5EBLB 4HPOH 4QJ4B 2XWCA 5EIIA 5FYLD 7TAAA 5I66B 4OR1A 2VDPH 3B9KD 4ZTEA 3LSOA 1AQHA 5JR1H 3R06B 3PGFL 5GZOD 1T6VN 1T5KA 2O6CA 3LQAC 1ZHBA 1QTPA 3PG2A 4U2ZA 4X5QA 5EO9A 4K0OA 2X1QA 4RLDA 4P49A 5G5DB 4I0PD 3MGTA 3VTMA 4W70A 4X6CB 1BMZA 3L6FA 1WEJL 3JWNG 2MNUA 5EIIG 3RIAK 2DICA 3JZYA 4TUOA 5D5MF 1YN6A 2YAQA 2G75A 1EJFA 2Q3XA 4KKQA 4CVWA 4S2SB 2IEPA 4R9HA 4X4YA 3K71A 5AZ2H 3KYAA 3N41F 4RZKA 4ODVL 4URTB 4PJFE 4G8GB 1CLYH 3FB6B 3LXUX 4XPGL 1QR4A 2AK4D 4CN4A 2EXYD 1MHCA 1HWHB 1FRGL 2L4OA 3I9IA 3JVGC 5BZXA 3WFCH 4WGWB 4R0LB 5AVUB 3VTAA 4BSVB 3P77A 2GIYA 5D1QC 4PTUB 4ZTOH 4S1DD 4PRPA 1W80A 1IKOP 2XPGB 1R3JA 3O3AB 5ELIA 3TBTA 5EIQA 4PJ5E 3IPFA 4W9EC 3NRFA 5GGTA 5I1JH 1FYTD 1G4RA 4JFED 4RAHA 5CIPA 3ZE0B 5JDJA 1VA9A 3HC3H 4TVPH 4NB7A 4KJYA 4FLOA 5KUKA 2OSXA 2NY0B 3PQYD 3ZDYB 3TNMA 3L3HB 2C9RA 1KCVL 1A4CA 2FQDA 1T1ZB 1P4BL 3BP6B 3TBYA 5DVKA 3QG6B 1A0QH 1IGTA 1S7SA 3E6HA 3R19A 3QIUC 3PL6A 3LZFL 3FH7A 4DGWC 2XTLA 4LEXL 5H37A 4K3GA 3L3DB 3QPKA 1SDYA 2BZCA 2QHLA 4OJEH 1G9NC 3ZVVA 4L8SB 2CNYA 4XBGA 1I8LC 2XA8L 3QDMD 2R2BA 2WQXA 3UBXB 3HNSH 4GFXA 4KPHL 4ANWA 1B9KA 3D0LB 3D2UD 3NN8A 4YHML 1I3VA 4CSTA 1ZVYA 5AUMB 2EZ0D 3ZGIA 5H37G 1F97A 3U1PA 1EV2E 4F91B 3UH8A 4X2UA 3VWKB 4YH6A 4JZJB 1A4BA 4QT5B 1E3ZA 2ESVA 1BREA 3B8YA 1KBKA 1TCRA 2E59A 4P59H 3ISYA 4GQZA 3IN2A 1J7VR 1PZ3A 3CZSA 4ZFOA 1RZJH 1OANA 4N2BA 4EN3B 3DUUA 4BZ2L 3P9WB 4PJFF 5HY9B 4NWUL 1F1GA 5DUBA 3DO4A 4KQ4L 1INEH 2P5PA 4AGPA 4ZSOE 4GI9A 1NMCC 3RI5K 1CE6A 2CD0A 1J5OL 1YJDH 3QPXL 3LKSB 1GYVA 3AROA 1AGEA 5D55A 2X2JA 3Q2NA 2VQTA 3PWVA 5EULV 3IMVA 4LPUA 2C3VB 2Y2WA 3RKDD 4DWHA 4HLEA 1NC4A 6PAZA 3AY4A 2FEDD 4LSDA 1HTYA 4R2GB 3UPAA 4A7GA 3QJHB 1NGZA 2LAAA 3ARFC 4YGVB 5HDRA 4XODA 2HVJB 1N0LA 1J5DA 1PMYA 2A77L 2I7SA 4B9IA 1BPVA 3EOYG 4KY1H 4ZZKA 4P5MA 3PNWA 4FLSA 2D0HA 3GSNH 3KXFE 3QDAA 3RURA 2IDSA 3SPGA 1LVEA 2Y06L 1HDMA 3U7YL 5BVPL 2WD0A 4AENB 5LN4A 4DP9X 5CLWA 1TCMA 3I74A 2A6DB 4PG2A 3PGDB 3FT4A 1SJXA 5F93C 1NUNB 1CTMA 3K2UH 4PVMA 3S88H 1UVQA 4AI7A 3B5TA 3WHE0 3QDJE 1NMAH 2AI0H 1QSEA 1BYOA 4BD4A 3BZEB 2F58H 4NNYB 2NUTA 2IV8A 3FFDB 2OTUA 4IOIA 4Z95L 1QFWI 3GZOA 2WUBH 2Y7LA 2IBZY 4PJ9C 5EEZA 3QXVA 5BZWB 2VXSH 4NUMA 4ZUSB 1DFXA 1ND0B 1XGTB 2OJEB 2P8MB 2GY5A 3MV8A 4ODTH 3REWA 4EUPH 5ITFA 4XH2A 1WWBX 3KVDD 5IKCB 3L4ZA 4AG4H 1DQVA 2Q20A 3MLRL 4J1UA 4UAHA 1Q9WA 3CC5B 3RY5A 1OARL 1YDPA 2VIRB 4KQ3L 4Y4HC 1IAOB 3Q06A 3SKNB 1G7JA 2OW6A 3QS3A 4O2FB 4KO7A 2OI9C 3EHBD 2XACC 4JRYA 4Q14A 2VAAB 2P8LB 1I7UA 4J3WA 1RZIA 5DURB 4XPBL 1YNTF 5L7XL 3RE0A 2O30A 4NYLB 1R46A 1SVZA 4FA8A 3BKJH 2DQCL 3T77A 5C0CA 4MTMA 3WIHA 5C92A 1TF4A 4K3JL 1WICA 4K9EL 4WSKA 1CU4H 3APDA 4J3OD 4L3CA 5HHXL 4DP2X 3ZT6A 3DI2B 3HBGA 4XNYH 4LSRH 2JKWA 2WHVA 2W0FB 4Q9CA 2FYYB 2WNWA 3QAZC 2NY5L 1AXIB 3QULA 2HTKC 1UJ3C 3ENEA 4D3CH 2IH9A 3MGOA 1YY8A 5ALBL 3ZZSA 4CJ0A 4HUNB 5GRVK 5C6PB 1EZVX 1DHKA 2WWMD 3DVGA 2I07B 2XX0A 3GSVB 3S5LB 2HPTA 4M6NL 4I18B 1FPTL 2GEQA 4OTXH 5F88A 4N1HB 2WCGA 5EZOH 3FQTB 2X6AA 5AVVB 3X11B 1V10A 3BWUC 1GPOL 2HPOA 2HRPL 5DK0B 2JIXA 1OEZW 3E0GA 5D7IA 4KZDH 4QCIA 5J89A 1HQRB 3KDMB 1EEYB 1TJIL 2JJSC 2CBQA 4NDMB 3HR6A 1SBSL 4LCWD 5DZVA 2C4FT 1P53A 2N1KA 3MREB 4TQPA 4PRIB 5D7KD 4F58L 2M1KA 4QD2E 4ZMOA 2QGEA 3KLHD 3OR7A 4PS3A 2PXYD 4MNQE 5KBMA 4HEPG 1FLRL 3L95B 3LPGA 4Y5YC 1AYOA 1KB5H 3L5XL 5KW9L 4J5VA 3T3ME 1WFIA 3G5ZB 2VB5A 1JZ2A 4Y2NA 5CJ5A 4QO1B 5ECJE 1AJ7L 1FFTB 4XNMA 4XNZC 4AIEA 1ZLVH 3L4WA 4OF7A 5C0BE 2OULB 4JFOB 4MZIA 4HJ1A 4X8CA 1LQBC 2VQ4A 1LLAA 2O5ZH 3CZEA 4Y4FC 3MBWB 4X9IA 3II2A 5I71B 3HS0A 4BCYA 1Q0EA 2XJKA 4DKTA 1U3ZA 3K3QA 3O41A 4FEIA 4U33A 3RJDA 2P4AB 5J9PA 2K7PA 4WGKA 5JPNB 3TBVB 1MW0A 2D7OA 3MRBA 4N22A 3WJJC 2AQ1A 2B0SL 3ARDA 2Y24A 4R90H 1REIA 4ZUTB 3L9EA 1EHAA 5C07B 1E9QA 4WNJA 1Z66A 1BVOA 2X4UB 4S1RH 1YCSA 4NWTL 4CSZA 1ROCA 4DP5X 5JHDA 4MA1B 2X1OA 3RZCD 2R59A 3ULVD 3VXQA 1FAIL 3B1UA 4LVNC 2KDGA 3BKYL 3AT9A 4AUUA 2DBLH 1M1SA 3E7JA 2VDML 5EOCH 1DVFC 1GZHA 2K8QA 5C2BH 1F2XK 1BM3H 4Y2LA 2ZG1A 4AW7A 5I9QB 4PWKA 4G1EB 1DE4A 4RGOH 2DIJA 3MR9A 1U2CA 1MZZA 2C9UA 4Z0BL 2P5EE 1T1XB 5DVPA 1QO3B 2CLRB 2E6QA 2XRAL 2PW2B 2QQNL 4OJAA 3ECBB 2K0RA 2AQTA 2OXGA 4O02A 5EOTB 1YEIH 5BW7C 1TR7A 4WO4A 4Z3TA 5JIHA 3IXTB 3MODL 2AS5M 4DOHE 3FZUC 3O81A 5HHOE 2XVKA 1W9XA 2R1XA 2CZNA 4YHIB 2IGFH 5C9JB 5I5JA 2FZ3B 3VXME 4NRZB 1QMUA 3UJJH 2K9FB 5J6HA 4IRSA 4WUUA 4MRCA 4F37K 4Q4IA 4HAGA 2XTJD 3T3MF 2V5YA 4OLYH 1Z3GH 4RVBA 2JJTA 5EEVA 2HFFB 5I1GH 2F7PA 4AMKH 1CVRA 1UXSA 4K71B 4PRBB 4N26A 1BFTA 4G43B 1B4LA 1HSAA 3FCUB 2EDWA 3SEPA 5D96C 1KGXA 4FFYH 5DMJB 2Z1PA 4G8IB 4HPOL 1GYAA 3SGKA 1BFSA 5T3ZE 1D5BB 2VDPL 5D72H 5DSCA 3RWHA 1G6RB 4KK5C 3SDYH 2DQHH 4V2BA 3CVHB 5CGBA 4IU2B 3GXFA 5K39B 1PD6A 4IGBD 3CDYA 3V6ZB 5F3HB 5C0GA 3QJXA 3BD5A 4RQQA 4P46D 3WG7B 3OWRA 1KYOK 1MCOH 2F8VA 2IQ9H 3BX7C 3EF4A 4GSXA 4IW4C 5ACZB 1PNDA 2GJ6D 2HX7A 4J6RH 4F33A 2AJ3A 4RWHA 2C26A 5FOJA 2OX5A 3DHPA 2WJ7A 4L05A 1C8PA 1JV5B 1VGKB 1WS7A 3VFVB 1I4FA 1LK3H 5AZ2L 4Z7NB 4JFZH 5HGBB 4Z3JA 3QQ4B 2ZXGA 2NXZC 5I73C 4YSUA 1TO4A 4L4VB 1ANUA 1CLYL 2HT4D 3H53A 4M8QA 3LN5A 2O61A 5HTSA 4LBEB 4N68A 1WF5A 2X7LB 3CFMA 1UKTA 4MQSB 4PJDB 1GZPA 4Y5XC 5EBMA 5IMOB 3WFCL 2NDFA 1SLVA 2V5TA 4WWNA 4ZTOL 2DQFB 3PABB 1MLBA 5CR1A 4MXVE 4F1SA 5F0JB 2PO6C 4JY6B 1CYGA 1JD9A 3MJGX 5I1JL 1PGRB 3HC3L 4TVPL 1HX0A 3PIQB 5EZPA 2EAEA 4GFTB 4YHYC 1MCSA 3K74B 4PW3A 4HT1H 3DOSB 5IIEB 1NM9A 2CIIB 1IEAB 5CJQL 5D7LD 3ZDWA 1TEYA 1O5PA 1A0QL 4WF7A 2BLFA 4LU5H 1PG7X 3NJXA 4Y16C 2ZIDA 4BE5A 5B38A 5IFAL 2ZSWA 2YQ3A 1CTNA 4AYGA 3ARSA 3EJCA 4F2MB 1E27B 2CKNA 4NOFA 2XY2A 3P0VH 4NP9A 4U1JB 3BAKA 3WN5C 3WUZA 25C8L 4LSUH 1UB6A 3HNSL 3WTTA 5IVXE 4JEGB 1JHTA 2EXWC 2ADGB 4JDEA 3HMWH 4B9PA 5EZJA 3MC0A 5SWSB 3H55A 1XR9B 1TQWA 2H6UA 2XV2A 1JXJA 2XTSA 5KVEH 3KYOB 2ED7A 4BZ1H 2MWCA 3MYJA 4FA7B 4JNXA 3EW3B 1NGPH 2X3CA 5AOMA 4P59L 1IGYB 3SDDD 1NAMB 2EDKA 2UWEA 1OOAA 1RZJL 2ZXEB 2EINB 4MCZB 4PYGA 4MD5B 2HJKB 5EC2B 5FOBA 1MZYA 4C56A 5AZUA 4PJ6A 1LP9A 2A4ZA 4IBLT 4PRAB 1INEL 3KCPB 3BVDB 4QF1A 3CX2A 5LGYA 2OYKA 1YJDL 2C4FU 3K0WA 1L5GA 3U2IA 5DEGB 3U0TB 2FX8H 2MOQA 3WTXA 4MXVF 2VISA 4LKXA 3FHAA 4ZOBA 2HSIA 4ONGH 1DLHA 3LXAA 5JA9A 1QBBA 2P42B 3BGFB 2CK2A 1A6ZB 4A6YA 4QRTB 2EVIA 1ZSDB 4AXWB 3V4PH 1IFRA 3BUDA 4EIZC 3QUHA 4HH9A 3FF8A 2WLIB 4ZRGA 4BHUA 4MWFB 2Y25A 1U8HA 2YPKB 5JW3L 3BH8B 4KY1L 4AV4A 3GSNL 3E9UA 2C3XA 5EC1A 1CT8A 3MV11 2CUAA 5KJRH 2ENSA 4PWIA 1T3FA 3NIFF 3OLIA 1ZDQA 3WELA 1K8DB 1WP6A 5HHVH 1GHFH 1QFPA 5FF6B 4GAAA 4LVOB 5ID1B 3QIBB 4G72B 3DVFA 3JWOC 4P2QB 4TLUA 3TH4T 5IMMA 4KZEH 4E41E 1TFHA 5CP3A 2Y7QA 2WO3B 1VFAB 3VFTA 5IVXF 3I9AA 2QADD 2AI0L 2BH0A 2JI3A 3B9AA 3BD4A 2F58L 4OLUH 5DTFB 4X6DF 2WUBL 1N7ML 3Q44A 5KG9B 4GINA 2VXSL 1ZTXH 2WIIB 3MLVH 1BOGB 3SCMD 3PYCA 2DTSA 4Q6IB 4Z7WE 4E0RA 2MMXA 2X3BA 4FXGC 3D34A 4ODTL 4QY8A 1URLA 2J1KA 4E5XA 3C12A 3QEUB 4WK4B 3BPCA 3EDJA 5EIVA 1DJGA 1TVDA 4H8WC 4QI3A 2NY4C 4YDLB 2D3LA 3OHXA 3HUJE 4GG6B 3P4MB 1G94A 1Q1JL 1ZS8B 4U6YA 4QYOB 5CSZB 3VH8A 4NO2A 3VRJA 5CLZA 3U30C 3RUGA 3BAEH 5EU6A 3F00A 3BKJL 2VXTH 5EEUA 3TA3D 1IGJA 5IQOA 1J0KA 2AXFB 2EIBA 3OXSA 4I3SH 4KI5C 1JN6B 1CU4L 3SZKC 3FUIA 3O45A 4M61B 2D3JA 4XNYL 2WBJC 4LSRL 2QV4A 2ZICA 4I9WE 5ISZA 1KCUH 4PBDA 3FL7A 4G6MH 5AW5B 1U8JB 3QRGH 2F74A 3GXTA 1DBMH 1DEEA 3HZYA 1N59A 1O6TA 3QWOA 1NBYA 4PRDB 4JFXB 3CN0A 3HKFA 2WXQA 2P49B 2NY1C 1UWEH 2OK0H 2WN2A 3TO4D 2CDGB 4OTXL 3HE6C 5EZOL 1TQSA 5KN5A 1XX9C 1YMMB 2AVFA 4MAYC 2LV4A 2DI9A 4XOAA 3SKJH 3VG9C 3IETB 4PJ5D 3B7TA 3FQWB 1U8OA 5FGSA 1Y6MR 4KZDL 2A2QT 3T0AA 4PFEA 2MCMA 1TU2B 4PGBB 5LNDA 1JTOA 4X4ME 3UAAA 1A7BA 5KYXB 3L3GA 3DGDA 4Y2DA 4Z7WF 2FO4A 3QFJA 4P2OB 5D1XA 5TE4H 1A3LH 2NY6D 1OQOA 1DBJH 1KB5L 1AQMA 4GP4B 3GM8A 3LIUA 3P73B 2A9NH 5JW4R 1FV1A 4G8FA 3HB3C 2G9KA 1JGDA 2VMEA 1R5VB 3JSSA 4J28A 4AV5A 5TDNA 4NAMA 1CD8A 2ZTBA 2RTTA 3I9GH 3H3PH 2AXGA 1U8LA 1K72A 1D5ZA 4KOCA 2NYYD 1ICTA 3IPBA 4FTVD 3KWUA 4ODUA 2CA3A 4N0FA 1SY6A 3ARYA 2XT1B 3MFFB 2NY2C 2G2NA 3DIDA 5D7JC 5GJSH 5I1IH 4R90L 1SEBA 1O7DC 1HH9B 2ENPA 5JPMA 1HHKA 2XY1A 5C0EA 1EHKB 4UDTB 5SWZB 1J88A 5IBTH 1P0SE 4H1LH 4ZX5A 4X42A 4NFDA 3UG4A 4Q9QH 4S1RL 4HKZA 3LYRA 4JFTA 3WXVH 5HD8C 3EOBB 2BW4A 2DM7A 32C2B 2OMZB 1WBXB 3X3GH 5FA4A 4DKAA 5TK4A 2G2RA 3ZYOA 3RX7A 2JKRM 4N0CC 4B3EA 2DBLL 1G4MA 3RTQD 1NEUA 3O9WC 5KYYB 5EOCL 4S11A 5C2BL 3BE1L 2R2EB 1BM3L 3KWXA 2VLRD 4PJEB 2VN4A 1FNEB 2HUEA 3Q43A 3AVEA 2CRMA 5A40E 4TLTA 3C8HA 1YO4A 3IDGA 4H25B 4ZXBB 3SDCB 1YEIL 2YRBA 5EO1A 2C9QA 3F58H 1N19A 1PKQA 3G04B 4OGZA 5LAXB 2JLLA 4YEEA 4JB9H 5TH2A 2IGFL 1F3DJ 3C5SB 1AE6H 4PG9B 4BINA 4OJDH 3UJJL 1RPKA 3TIEB 3EYQD 1XTLA 1HHIB 3L1FA 4OV6F 3T2NH 2P48B 4EI6A 2BIIA 4MZ2A 4P23B 3PWPD 5CEZH 4NSKA 1Z3GL 4OLYL 4AMKL 1U21A 1E6JH 3MJ8A 5CMAB 1OF2A 2BSBA 4AH2B 2HH0H 4X99A 4FFYL 1SHXA 4KXZH 4L29A 3STZB 1U3JA 4KX9A 3I6GA 3T6VA 1E30A 5D72L 3P40A 1WFMA 2UZPA 3OJ2C 3OKEB 3SDYL 1WZ1H 2DQHL 5EEYA 1FG2A 1YY9C 2WP3O 3EFDH 4ZMXA 2APBA 2CKBB 5D2NB 1MQ8A 5J5EA 4X7TB 1HZHH 1KGWA 3JT0A 1MCOL 2IQ9L 4LLYB 3RDTB 2AV7B 2V7NB 4PGEB 4HS8H 4J6RL 3THMH 1FN4B 1SF5A 4MJIE 1HOCB 2DL2A 2UY6A 1LK3L 1SLWA 1H5BB 1T5XA 4JFZL 4DESA 1T2QH 4L37A 1X7QA 3HG4A 3SPIA 2I60H 3DLQR 1OAYH 4M5TA 5E9DD 2NW3B 3GXDA 1G7MA 1H3GA 1J5IA 3O8XC 4QHNA 3NSFA 3CFJB 3O0LA 3BRGC 3VD2A 4GKZB 2RD0A 3EXLA 4IHOA 5D1QE 3JV5A 3QAQA 3N91A 4PTTA 4RDQF 1I9RH 2PYEA 2BNRA 4JVPA 3MRHB 2YD7A 1MXGA 1U41A 3MRQA 1E4KA 2ADJB 5T1KB 3C5XA 3BUTA 5F6HJ 4IJTA 3VI4B 2VZ3A 3IDIA 2ATAA 4WFHD 3GI9H 1W6WA 1ZY9A 1NDGA 3P30L 3OKMA 3WIFA 4JG5A 1BZ7B 2CLVA 4HT1L 4QRFA 5A2KH 3NIGF 3VDAA 1J9CT 1IV8A 1D9KC 3Q8CA 1OIOA 3SDAD 1K4CB 3AXIA 2F7OA 4ZMLA 3SJVA 4LU5L 5FM4A 4M3HA 5EU4A 2E7LA 1QTSA 1MHHA 1Z9OA 1CXEA 3I75A 4TOYH