1PLBA

High-resolution solution structure of reduced parsley plastocyanin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
b'AEVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPEYLNGAGETYEVTLTEKGTYKFYCEPHAGAGMKGEVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title High-resolution solution structure of reduced parsley plastocyanin.
pubmed doi rcsb
source organism Petroselinum crispum
molecule tags Electron transport protein
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plbA00
1TEFA 2NRDA 2XV0A 1AZNA 5B7FA 5I6OA 1JVLA 3NSFA 5B7EA 2AFNA 1NPJA 4A2DA 4A2EA 2FNWA 7PAZA 1AZBA 4E9SA 3QQXA 1J9RA 2IAAC 3QJVB 1A4BA 3EF4A 1NPNA 3OD3A 4YSOA 1ILSA 1SDDB 3UADA 3NJJA 2DY2A 2W8CA 3SBQA 4E9WA 3X2QB 3PLYA 1XB8A 1AQ8A 1JXFA 4DPAX 4HCGA 3MX0B 3FSWA 1BXVA 5I6NA 5I6LA 2VW6A 1OCRB 2PP9A 3HB3B 4W9ZA 3S3DB 4DP4X 3FU8A 4DP0X 1KGYE 1OV8A 2MRYA 2VSMB 3FYIB 1MZZA 2IWKA 3SBRA 1KCWA 3UAAA 1OE1A 1IBZA 3NJLA 4G71B 3ZX1A 4HHWA 4G7RB 3DTUB 2P80D 1SFHA 3C75A 2PPDA 3IN2A 4DP9X 4Q89A 3AG4B 3NJHA 2LLNA 2JXMA 1AG6A 2XV2A 4UANA 1ZV2A 1AACA 1GW0A 2GB2A 2BP0A 1EHKB 4E9YA 1V10A 1ZIBA 1BAWA 2YARA 2Y69B 3FPYA 1A4AA 2BWDA 3T6ZA 2WO2B 8PAZA 1E67A 1ADWA 1BQKA 2ZONA 1NWPA 4G72B 3PAUA 3OMNB 4JHVA 2HX8A 1AAJA 2HZHA 3CVCA 5B3SB 1L9SA 1VLXA 4M4RB 3TA4D 3SBPA 2B3IA 3X1EA 1A8ZA 1L9OA 4KNUA 9PCYA 3NJKA 1L9PA 3N2JA 4BWWA 2XXFA 2DV6A 4YSTA 3WI9A 3OMIB 4N8UA 1PLBA 1EZLA 2XWZA 4JHUA 1XB6A 1X9RA 1ZDQA 1RKRA 3FSAA 2XLLA 4GY4A 3HEIB 2FQEA 2QPDB 4BXVA 4Q8BA 1A3ZA 5TK2A 1NIFA 3ZDWA 7PCYA 3PAVA 2PPCA 4QKTA 2CCWA 2CUAA 1WA1X 2PPAA 3NJMA 3ZBMA 2XX0A 4YVUA 2JFCA 4E9VA 1WA2X 4GXFA 2DYRB 1W6WA 1HAWA 1DZ0A 2IDTA 2XXGA 3AG2B 1BQ5A 2YAHA 1IC0A 2OCCB 1GS7A 2YQBA 5IY5B 1SF5A 2PP8A 2J5WA 1NZRA 4DP7X 2IDSA 4YL4A 4W1TA 4YSRA 5B1BB 1XB3A 2E86A 5EHFA 1RZPA 3GYRA 2UX7A 4HAKA 3H4HA 2PCYA 4YSPA 4AKPA 4G7QB 3OMAB 1SF3A 1ET5A 5E9NA 1AZCA 3V9EA 1PNCA 3OQRA 3AZUA 3FU9A 1NDTA 2Q5BA 4AI7A 3ABMB 4NERA 2GC4C 3NSYA 3T71A 3TASA 1GS6X 2Q9OA 4KNSA 1A65A 1JXDA 3WKPA 3X1NA 2I85A 3ASNB 1MG3C 2BW4A 1OOWA 4AZUA 4YSEA 2IWEA 1SDDA 5B1JA 1KDIA 1TEGA 4NB7A 2XYBA 4FAAB 1QLEB 3EHBB 3SQRA 2XUWA 1QHQA 3X1FA 2AZUA 1AIZA 5I6KA 3QJTB 1GYCA 3KW8A 3OM3B 4KO7A 1FFTB 3H4FA 1OCCB 4E9XA 2GSMB 2X88A 1J5DA 6PCYA 2DWSA 3QPKA 3FQ1A 2VN3A 4E9RA 2YAPA 4KOBA 3GXUB 3NJFA 2HLEB 3ABGA 3G5WA 4ZK8A 1IBYA 3DIVA 1AS6A 2XU9A 1AR1B 2BWIA 2TSBA 3PXLA 2YXWA 1SJMA 3WNJA 2FQGA 1L9RA 4HCIA 3UACA 4A2GA 4F7KA 3UAEA 1UATA 1CC3A 3UGEA 1N68A 1ZDSA 3BVDB 3EH5B 1B3IA 1KBWA 3WIAA 1BQRA 2R7EB 3CDZB 1F56A 3S3BB 1JZEA 1PF3A 3L45A 3CDZA 2BZ7A 2EINB 3NSDA 4FA7B 1CURA 3BQVA 2H5UA 3T9WA 2EILB 3QJSB 3MBWB 2BO0A 1JVOA 4DP5X 1XMEB 1AOZA 3NP3A 1WS7A 3ASOB 3FQYA 4WKXA 3T6XA 2IH9A 2UXFA 1ASPA 4AKQA 1CYWA 4HALA 2HXAA 1J5CA 2BZCA 2FQDA 5I28A 2PCFA 4HZ1A 1PZBA 5LDUA 1NIBA 2Y1AA 3ZIYA 1M9WA 1A4CA 2CALA 4G7SB 5D4HA 4PAZA 2EIKB 4A2FA 1OCZB 1TKWA 4GP4B 2YAQA 3CZUB 3H56A 1OE2A 1PY0A 2CAKA 2XX1A 4UAHA 5B1KA 4A67A 5PCYA 2P80A 4ENZA 1I53A 2VW7A 2GIMA 4NAJA 3QJRB 4DPBX 2BP8B 2VSKB 1ILUA 3UABA 4TXVB 1PAZA 1ETJA 2VW4A 1HAUA 1ASQA 1NIAA 1E65A 3JT2A 4QLWA 5B7MA 3ABLB 3DKHA 4HIPA 4PCYA 1ASOA 1KBVA 1NICA 1ET7A 4AKOA 1AZUA 1PMYA 1L9TA 1J9SA 2H47C 4JKNA 2B08A 2ZXWB 5B1AB 2PPEA 2UXVA 3D12B 1AG0A 2HRHA 1J9QA 2BW5A 2OV0A 3KW7A 2I7SA 1MDAA 2AANA 4BK5C 5F7BA 1SNRA 1ZIAA 3NT0A 5AZUA 1NWOA 3AW5A 4DP8X 1IKOP 3X1BA 2FT6A 3NSCA 4KNTA 3FS9A 3T6WA 1NIDA 3FT0A 2GI0A 2YXVA 1T5KA 4P5SA 1GY1A 3AG1B 4M3HA 1MZYA 2PP7A 3S8GB 1PNDA 3ABKB 4A2HA 6PAZA 1CUOA 4YSQA 2IH8A 3IN0A 2BHFA 1X9UA 1MG2C 3TU6A 3FYEB 2J55A 4KO5A 5PAZA 1BYOA 2HX7A 3CVBA 2OJ1A 1M57B 1L9QA 4X4KA 4GP8B 3FSVA 1OCOB 4G70B 4HHGA 4EF3A 2FT8A 1WAEA 2YAEA 1BXAA 5I26A 4YSCA 3QJUB 1NINA 1E5ZA 4MFHA 3PCYA 3WG7B 5ANHA 1JZHA 4UF7C 3S8FB 2VM3A 1BXUA 4A68A 3JTBA 2IDUA 4BWUA 2W88A 1ID2A 1KCBA 4AX3A 1JZFA 1BEXA 1JZGA 2UX6A 1R1CA 1GR7A 2YAFA 1V54B 2XVBA 1PZCA 1ZPUA 2FT7A 4BXSV 5D4IA 2IDQA 4CSPA 3CVDA 4KO9A 5TK4A 1OE3A 2YAMA 1WA0X 2R7EA 1DYZA 1JOIA 3AG3B 3FPXA 4F2FA 1GS8A 3FU7B 4L0PB 2WO3B 1TU2A 3NYKA 2AVFA 3FU7A 1KYAA 4YSDA 4E9TA 3IE9A 4DP1X 2X87A 2DWTA 1E30A 2N0MA 3IEAA 2BP0B 1E5YA 2I7OA 5I6PA 1YLBB 3NJGA 2HRGA 2QDWA 4YSUA 1BYPA 2UXTA 5AKRA 4CSZA 1PLAA 1ET8A 1FA4A 1IUZA 2ZWNA 4DPCX 5AFAA 2GC7C 4RH4A 3S3CB 2ZOOA 1AANA 4GYBA 2FJSA 4HCFA 1N70A 3IBOA 1JZJA 1J9TA 1OF0A 5I5JA 2VM4A 5I5MA 1KV7A 2DYSB 4F2EA 4KO6A 2HX9A 3TBBA 1W6LA 4KOCA 1NTDA 3NJNA 4BWTA 3V9CA 1AS8A 1PZAA 1SHXA 2QDVA 1HFUA 3FSZA 1AS7A 1AZRA 5FC9A 2RACA 4YSSA 2XV3A 2BP8A 4N4YB 2IDFA 2H3XC 3EH4B 1WS8A 3PPSA 4DP6X 1SFDA 3WNIA 3QJQB 3AY2A 5A7EA 2JKWA 5I6MA 2J56A 2IWFA 4P5RA 3TBCA 2CBPA 2QT6A 3NJIA 1FWXA 2VMJA 1CYXA 2FWLB 5I5IA 1PLCA 3X1GA 1URIA 2TSAA 2FQFA 1M56B 2WSDA 1GY2A 1RZQA 2PPFA 1NIEA 4K9JA 1V55B 2FTAA 2EIJB 3U25A 3PAZA 1JXGA 5F7AA 3T6VA 2PLTA 4WTQA 5B1JC 1QNIA 5D4JA 3CG8A 2UXGA 2CJ3A 3FQ2A 3RYMA 1W8EA 4YVNA 1SHWA 1JERA 4YSAA 2AZAA 1JZIA 2J57A 3ERXA 2A3TA 3WKQA 4BDVB 1GSKA 1KDJA 4GP5B 2MTAA 2GBAA 2QPEB 4BDVA 3N55A 4DP2X 3NP4A 1PCSA 2GHZA 4A66A 4E9QA 3GDCA 1RCYA 3EH3B 2EIMB 2YAOA
chains in the Genus database with same CATH superfamily
1YNKL 3KPSA 1L0QA 5DS1A 1OAUH 4HKXB 3OX8A 4XOCA 1ANUA 5I1JH 7FABH 4G8AC 2HA1A 1UQSA 3LQAH 2R2EB 5EB9A 3W9DB 4PJFA 1AKPA 1WBZB 4KK8C 4DZ8A 5I1EH 3LH9A 5C07A 1HXMB 2JQAA 3FFCE 4XPFL 2FHFA 5KOVC 3DSNB 3CFMA 4PJGA 1O75A 1BAFH 4K3EL 2B9BA 2A9CA 3AREA 1MF2H 3RVVD 4FLOA 3TONA 4FFZL 2GG1A 4FQPA 4X4XA 1YY8A 3QWRD 1SM3L 5EU6E 4OZIB 4N2KA 3V0EA 1YYMH 4PJ9D 2OMNA 1G7JA 1HHIB 4L5FL 2A83A 2W95A 1H5BC 1TLKA 1WCQA 3CC5B 4HUMB 4WFHD 3QFGA 1CL7L 1VFAA 3FO0L 3S3JA 3HLAB 3O9WB 2FHBA 3HZKB 1DBML 5I1CH 5KYXA 4HUXA 3LKNB 1NGZB 2B1OA 3CJJA 3U46B 1IBZA 2FR4B 1XTMA 1XH2A 3AQZA 4PJ5B 2VDNL 3D34A 4RRPM 5AALA 4LSQH 3UEQA 3PWVA 1AQHA 2NYZA 1ZK9A 4GRMB 3BW9B 4XZ4A 3W57A 1U8OA 2R23A 3MJ6A 3E3QE 3IFNL 1RUQL 4RMRA 2BP0A 5HJ3B 3L5XL 1IVTA 4HBCH 3JYBA 2AK4A 1D6VL 4CW1B 1KB5A 1YEGH 4TSAH 1JVKA 2WN2A 3E3QC 5HVFB 1H9VA 1JWMB 1SM3H 5GGVL 3QRGL 1NGXA 3HAEB 1MJUL 3TH3T 2P26A 4MJIE 4L5FH 2VL5A 3O8XB 5AKTA 1A8ZA 2VMEA 2FYYB 3K46A 1UACL 9PCYA 3TS8A 3NCYS 4YSTA 4WJG3 5JOPD 3S0PA 1JFQL 2FX8H 4PJXF 3UO1L 2CE6A 2VDNH 3F7YA 3C2AH 5C3TA 3KL3A 4ZS7L 4Y4FB 4F91B 1RPQA 4FG0A 1OTTC 2VQ1B 3T3MF 1AXSB 4JANA 2OCFD 4KJQC 2BC4B 4X0KB 1ZT7A 3POCA 1JD9A 1A1NB 5IQ9B 2Y5TA 4YK4C 2AMUA 1H3UA 2X4QA 4TULL 5F72S 1K8DB 1SYSA 1WLHA 4WTXA 3L5XH 3N44F 5EZIL 3U36B 1CDYA 1T20A 1NBYA 2IH1B 2QGCA 1TZ8A 2AJXL 1SJEB 2ZAIA 1D6VH 1RJZB 1SF5A 4FTVE 3OR7A 3TH4T 5BRZA 4BQ9A 4UT7L 4WK0B 2V6HA 5DUPH 1E3FA 5IG7B 4KJWC 5GGVH 5EHFA 5KANG 3RIKA 4NC2B 4B9PA 1B0RB 1KJ3L 2DQUL 4HUCA 4M7ZC 3RHWK 1UACH 5AB0A 4JG1H 4NRZA 2BFGA 2CRIA 4AKPA 4YNYB 3IMVA 3PV6A 1M71B 4NHUB 1OTUD 4ORGB 1DVFD 2OYMA 4BEIA 1D6EA 1JFQH 1INEL 1QPKA 2L3BA 3E9UA 4JFFD 4Y5YC 1NJ9A 2MCG1 2BNRB 3RJQB 4KKAD 3IFOB 4PI0A 2VDQH 2GUOA 3QFJA 4ZS7H 1UA7A 4IOFC 2H32B 1N2RB 4WNQB 3MNVB 3TASA 4ZJ9A 1Q9KB 2AEQL 4HK0B 3KCWA 3EDFA 4GG6B 1MWAA 3WY2A 5I75B 2DOCA 1GGYA 3GWJA 3QJZA 4TULH 3TBYB 2DEYX 1FV1B 1ZT4A 2E6JA 1ZLUK 1NGWA 2LVCA 1FCCA 5AZEH 2AJXH 1DBKL 2YMOA 1OOWA 4QXTA 3WTTA 2VZ1A 1SDDA 3MRNA 4UT7H 4P5TB 4Y9FA 1AD9A 4UT9L 3QJTB 3EOTL 2I24N 2J12B 1ZWIB 2XPGA 4ZXBD 3RA7L 1DQQA 4WV1A 3QXUA 4AV5A 1EDYA 2EXTA 1KACB 3L4ZA 5AVSB 2EKSB 4NLHA 1J1PL 1PD1A 2IH3A 3TN0C 3VXOB 3ULVE 2Y72A 3BP5A 3J8F7 4FQQB 4WW2C 1KJ2B 4M4PA 2PW1A 4G6KL 5H8DA 3I9PA 5HDBE 3M1CA 3S97C 4UNIA 1TCRB 2ICEA 5A2LH 1NC4D 4OB5L 3JV0A 4N8VB 1JPGA 1YEEL 4F7EB 1MI5E 1YSOA 1A7QL 2ESVD 4MZ2A 2H6UA 2QGEA 3BPLC 3OHXB 4N26A 5C0GB 3BVVA 1TJGL 2VDKL 2X12A 1UWEH 1VJSA 3P9LA 4L29A 3B43A 3PJNA 5HI5C 2YWZA 3F85A 1K3ZA 1QOKA 3ZRFC 1DJHA 3ATAA 3KLSA 4LT7A 5CHNA 1QR1A 2B77A 2IPTH 2EDLA 2JF1A 2YD5A 4DP5X 3IVKB 3QUMA 3LNGA 3U7WH 4HXAH 4N6QA 5IB4B 3RA7H 3ES6A 5GGSB 5CEZE 2SEBA 1HEZB 5DJDA 1AHMA 2LFGA 3CFUA 3HPJA 1FFOA 1N26A 5I28A 2YSSA 4F33A 4FI8A 4YDLC 1FN4A 1A21A 3GMNA 4KWUA 4DN3L 3L5WA 3T0EE 3LPFA 1VFOA 3QA3B 4ELME 4PAZA 1MHCB 2DQJH 2NT1A 4IOIA 2CMRH 3HR5A 1KB9J 3FO9A 3GHEL 3GS7A 1B2WL 1H3PH 4FKHA 5E08H 5I0XA 2EXSA 3T0EC 4OLYL 4ENZA 3ZMEA 3Q6GL 3DOHA 3PQYB 1I53A 2A6KB 5CCKH 1VFUA 4WHCA 1PKQB 2VDKH 3RWEB 1OL0A 2XV6B 1R47A 4JUSA 2C3GA 4OU3A 3VCLA 3WS6C 4K8RL 5CJXA 4LSPL 3RWCA 5LVEA 1NCBH 1LNUA 1G4RA 3GTVA 3FUDA 4NC1E 2HT3D 1AD0A 4RRPA 2VZSA 4PB0L 4JY5H 2WAQA 2OMWB 3EYSH 2MQGA 5EU7C 3ARBB 3WENA 1IM9A 4QXGL 3KMDA 3M8OL 4G3YL 1OKEA 3N6YA 1OSPL 2E59A 1MVYA 4HH8A 4OD3L 4KJPC 1U93A 3K6OA 3NCYP 1KCVH 5B39A 2DMGA 3MV7A 4OZFH 5AZUA 3F05A 4DN3H 3PHQA 3KGRA 1XCXA 3RL1A 1CFNA 1ZANL 3DIFB 2H1XA 5BJTA 5E6RB 1HHGB 4RMVA 4FXKB 4XBPB 5FA4B 5A6MA 1BFOB 1U8NB 3AT0A 2QKIC 2B20A 1YNTA 3FONA 1T0NA 3SDAC 4GPVA 4ES9A 1LWRA 4BQBA 2Q7YA 1L7TH 4LSPH 3BPCA 3DUSA 3QXTA 2ZG3A 4DKTA 1P5VB 4GJTB 3TWYA 4X6BB 4B5ZA 5ADPH 5EN3A 5FKPA 1I3RA 4HMCA 5JIDA 4PB0H 2J6EH 4JZOB 4KV5E 1JGEB 3Q05A 2FUQA 1MFMA 1X4YA 3VSVA 3O6FB 1K5WA 4XNYL 3ULVF 3FSVA 4QXGH 3EJYD 4G3YH 1J05A 3FB7B 1UB5B 2HJKB 4X6FB 3H9YA 1F5WA 3W0WB 1OSPH 3VD5A 1E8XA 4I3SL 3CH1B 4WO4D 4AEEA 1EEUA 2AEWA 3NZUA 2FWSA 5E4AA 4MFHA 5GHWL 4HFWA 3DVNB 3GXMA 3WG7B 1ZHKB 4U6YB 1MAJA 3QEQA 5DVLA 3CVHB 3VYOA 3BQUD 1BXUA 3ZVVA 1UCTA 3I6GA 2CKNA 5ENWB 3E80A 1ZANH 5AD0B 4YLCA 1YN6A 4JJOA 3QK0A 3R1GH 3DHJA 1BEXA 4TVPE 3T0WA 4JB9L 1F4AA 2VLLB 2EEFA 3RGBA 1OXYA 3AITA 4QAWA 3H9SD 3VM5A 3L4TA 4PJEA 1JXKA 2TAAA 4EQ2A 3EJZD 2CG9X 1JHKH 2Y7LA 3F65A 2AITA 3CN1A 3U7YH 2R7EA 5AVRB 3BDYL 2BCMA 2HLAB 3BXNB 3QXAA 2PMZA 3ESOA 1OHQA 1Q90A 2JKTM 1D5XB 1FG2B 2VT0A 3TWCL 2DQGH 4Z23A 1QVOB 4TLKA 2R2CA 2X4SB 1AI1H 2R1YA 3FCTB 4L4VD 2VC2B 3S48A 2NY3B 1JWSA 8FABB 1U3HD 4HJ0D 3D85D 3VTTA 3OKMB 2CIKA 4BZ2L 4F5CE 1FG9C 3MV8A 5CR8A 5AFAA 5BQ7B 4XNUH 1U95B 3QQ4A 2EECA 1N70A 4JFHD 5FW8A 1U8QA 3CLFL 4PGBA 3VI3E 1FH5L 4P2YA 4M48H 4LMQI 2F61A 1AOHA 1DJXA 1IGFL 1PZAA 5DI8B 3D30A 1A4KB 4U1JA 2QVIA 2MOGA 3SB3A 3O45A 1FIGH 3L9BA 3HZMA 1KWKA 2CDFB 3BDYH 3NA4A 4G1MA 1VEOA 4IEFA 5D1ZI 5F9DC 1G9HA 4DGWC 1WISA 1KY7A 2KT6A 5EU3A 2VISB 3D39E 1OP9A 1ECYA 1TETL 3TWCH 2CHWA 2QQNH 3BN9C 4XWOD 4YDJB 1PEZA 5F0MB 1Q9WA 4KJYA 1IBHA 3HAEH 1BIIB 4DHLA 1CGWA 1WC7A 4OM0L 4ERSL 3HFML 2JJTC 4BIKA 4M1CD 4FG6D 1EGJA 4BZ2H 2EIJB 3CSYB 4I18A 4XVUD 4QEGA 5D7IA 5E9AA 4QAMB 1UOLA 1ZA6A 4R7XA 2WXPA 2FJHB 2AQQA 4MJ2A 1IU1A 4OGQC 3FQXA 4LSRL 3CLFH 4LCYB 3AS1A 1ZJBA 3GZKA 2BERA 4AH2A 3OJ2C 2GITA 3ERXA 3VE0A 3GO1H 4LQFL 2JIXB 4B7LA 2GBAA 4NBYB 4F7PA 5BS0D 4HEMA 2NW2B 2WNGA 1RZ8B 4KV5F 4BKLB 4JKLA 2RAMA 2GHZA 3C5JB 4MCNA 4NM8L 3TA3A 1R3KB 4JL2A 4B9KC 2V7NB 4LLYA 5FGBA 4HHAB 3SKJH 4N0FB 2HJFB 4XMLL 3LKOB 2GI7A 5IB2B 5CM1A 1CDIA 4LCCC 2ZX9A 4BCZA 2VZTA 4IMLA 1SN0A 1IEHA 2VUKA 5IWLC 1GYAA 1NPJA 1XR8B 1YEHL 4ZX5A 2ZP8A 4A39A 3VD0A 2P45B 5BXFB 1Y1DA 4OM0H 4EXPX 2Y7NA 4ERSH 1UZ6E 2X44D 4U1NB 2X9YA 1UFUA 4ADGA 2WB7A 3MACH 1WHPA 4E0RA 4ODUA 1E8WA 4W4OC 1DFBH 4RBPK 3SPVB 1RHHB 5CCGE 2WCPA 3HCVA 3S8WA 4OKDA 1N0LB 3C5SB 4ZAKC 1XFPA 4AVHA 2CUHA 2H32H 3IBEA 4MNQA 4QYOA 5I66B 2ZOKB 3NEEA 4IOSD 1RU9L 4O51B 3V4LA 4HUVB 1N59B 4LQFH 2NY0D 4NKQB 3UJIH 1MCJA 2MRYA 3ZZLA 3LKRB 1RK1A 2O6FA 5D6CB 1MSPA 4Y1SA 1CBVL 1JNNL 1T5WB 3QQ3B 4N2LA 3U1PA 2MHAA 4GIAA 4XMLH 4A7UA 2YD1A 1Z5YD 4R26H 3OVUB 3QEUA 4XMZA 1Q9LA 1P4IH 2ADFL 3B7RL 3S35L 4EI6A 5C3LD 3F83A 1BFSA 3O0RL 1JPTL 3WTSA 1OW0A 3HI6L 2KHAA 5GRVL 3E2HB 5E9DB 3MBED 3TEUA 1SBSH 2BXZA 4I88A 3T2PA 3P9MB 4HPOL 2VDRB 5DD1H 2G2RB 3EZJB 1JPEA 4WF7A 4E9YA 1BGXL 1BFVL 5G2NA 4P2OA 5AW1B 4DGUA 3UTTA 3VI3F 1H8OA 1QR4A 5BO1H 3ZTJH 1M1XB 3QI9A 1F11B 2MEJB 1EMTL 5DHVA 4BUHA 1KJ2H 2HX8A 2NDFA 1RJLB 5D7LD 4FE9A 1BIHA 1XCTA 1RU9H 5C0JB 3R19A 2XKNA 4AYEC 4MMYA 2ODIA 1MCKA 1J86A 2XXFA 2XICA 3ARDB 4F15B 5FM8A 4AGOA 4XN4A 2FB4L 3BWAB 3Q48A 1LO2L 2LU7A 4QRQB 5I74C 1CBVH 2OJZH 4XP5H 1CFSA 1IEAA 3K8KA 4KY1L 5BW7A 1TTBA 3BVWA 4OF7A 5CMAB 2Z4TA 4OCXH 4I2XB 3S35H 4Q8BA 3TBWA 4C4BA 2UUDH 1Q8MA 3O0RH 3TF7C 4OCYL 2FX9L 3T8MA 2FLBT 4LP4A 1A6VL 4YVUA 1NOFA 3WMSA 5E2VH 4QHUB 5J6SA 1KJMA 1W6WA 3FN0L 4HJJL 2Y7OA 1WO2A 4HWNA 5DRWA 2J20A 1QLRA 3MLYL 1CFQA 1I7RB 4XB8A 3BD5A 1WQVT 1OM9A 2YKLL 4NNYA 4DP7X 4MNGB 5C0FA 2NLJB 1X6LA 5FO2A 1EMTH 2CBQA 4YSRA 1XAUA 4S2SB 2XZAL 3V0DA 4PJCE 4LCWA 3GMMB 2EDKA 4MD0A 2PXYC 3B2UC 4X7FC 2G5UA 1AHKA 1FE8L 3QJFA 3RL2B 4YSPA 2Q87A 2XTJB 3GGWA 3QUZB 1EO8H 3GFUA 3OQ3B 4M5ZL 2FB4H 4MJ4A 5JA8B 1AR1D 4BGDA 1UXLA 2YA1A 2ZXDA 4MMZB 1ADQA 1M2VB 3RBSA 3TIEB 2HSIA 1E6JL 2FX9H 4OCYH 4RIRB 5E6SB 3KCPA 1A6VH 2GJPA 4N90E 1EO5A 1T5XB 2IAND 1NFIA 2DM2A 4UM8A 1IILE 3JTSA 3PP3K 4HJJH 4M93B 1TJHH 4HJEA 2MWCA 5ALBL 5KSBE 5HJBA 1H8LA 1H6EA 3CVIL 2YKLH 4WFFE 1ZLVH 2AZUA 2Y0SA 3X1FA 1NFAA 2XZAH 3WN6A 4ABQA 3ARTA 3MR9A 4E5XG 3MX0A 4U1IA 4RGNB 3RWHA 5DR5H 3TZVC 3G7TA 2DM7A 4HVBA 2EDWA 1ODUA 2F74A 1MFDH 1DFXA 2F18A 4PM1A 4F8TA 3ABGA 2R0ZH 3DX8B 3G5WA 4LLDB 1MRCL 4D94A 1NMAL 5EMYA 4L3EA 4W9KC 5F7NC 5A2KH 1AS6A 2XU9A 5BUAA 2WBWB 2WQUA 1CF8H 2X6AA 3IF1A 4Y16A 3CN2A 2DMHA 1I7UA 5HI4D 5AVVB 3W39A 3L9RA 4JFEB 1JF1A 4AOFA 4XP9L 2YFNA 15C8H 1P4LA 2ZKMX 3WEBA 3L6FA 3GNML 4DKAA 1N8ZB 5HYJA 2P44B 2YXFA 1FSKC 4ZMVA 3I9AA 3S5YA 3S3SA 1R5VB 1SUHA 1PF3A 3MV9A 3CVIH 3HS0B 3MLUL 4J1UB 3CHOA 3CVHH 1SXSA 1ZVSA 1RZIA 2MOVA 1K5NA 3R4DA 4ODXA 4CUCA 1ZCRA 3EO1B 3MQIA 4Z7IA 5C8JA 1LE9B 4LU5L 3KPPB 4YWGL 2DQHL 2BFVH 4AY0A 3E7JA 5L2JB 1OTTD 2ISDA 1QZNA 4KJQD 4M00A 1NMAH 5EOCJ 2W5PA 5IESL 3UYRL 1UXWA 4OUOA 1G7PB 4XOBA 2HYMA 2G3MA 4FQJL 5C6WH 4XP9H 3ENEA 2P80A 2JQZA 4LSTH 2LU3A 3LY6A 5ECJE 5EIIA 4DPBX 3IJHA 4PJCF 1CU4L 3UABA 3HRZA 2E6QA 4QCIA 3FH5A 2VC2H 1YC8A 2E27L 4W4NA 3SE6A 3GSOB 2H6PA 4U6XB 4ZFZB 4ODWA 1I82A 4XXDB 4H8HA 1G7LB 1PLGH 3F62A 1JGVL 2WQXA 1X4XA 5DDHA 2EJ1A 2Z64C 4A7VA 43C9B 2QVFB 3VFNB 4ZQTA 2AQSA 4H8QA 3TNMA 2Y7SA 1ZXQA 3V4VL 3C6SB 5F9AC 4BRJA 4YWGH 4OCRH 2DQHH 3MRQB 1QKZL 5DK0B 2NX5A 5E8OA 5F7BA 5FO8B 4OUUB 3UYRH 3FN9A 3Q8CA 2KH2B 4U1MB 4D9RD 2N01B 1CGVA 4UDUB 3ETSA 3MZTA 1YJDH 1M7DA 4ZX3A 3FFDA 1S7SA 5GSRA 3BZ4B 3DJRA 3UZQB 1T1ZB 3T0XA 2GTWA 1OGTA 2HG5B 3BVTA 4LASL 4M61A 4PRHE 5LN4A 3D2UB 4PRPD 3NG5A 5B4MD 5HHXL 2NNFA 3A22A 4L8DB 4DVBA 3TEWA 5DT1L 1AHWB 1MG2C 2P8LB 3I50H 5PAZA 2AV1A 4X80H 1YEIH 4HIJB 3QR2A 3TN0D 2VAAB 4FOMA 3CSTA 5CGYD 4ODVL 4ETQB 3P0VL 2OMYA 3BFQG 5I26A 4DQOL 4YSCA 1T4KA 4ALAL 2VQTA 3Q13A 1DUZB 1QKZH 3PPEA 2XY2A 3CSFA 3SDCA 3K6IA 2QVKA 4FFZA 2C4FU 4GAYB 1TZHA 4ODBD 5DHEA 2OMUA 4IBLT 1JHTB 4QRPE 1IC7L 1HWWA 5EZLA 4WK4B 3UTPE 1X5IA 4LEXH 1T03L 2DLFH 4HK3J 2W0FA 3KG5A 2ZUQC 6TAAA 1INQA 3FO2A 2BIOA 1OM3H 5IZ7A 5D7SL 2FD6H 3DX9A 1Z9OA 2AABH 3LTVA 3UZVA 2PO6D 4GMSL 4GSDH 3DPBA 1V3KA 1Z5LB 5HHXH 4WHTB 2VDRL 4NQCD 3F84A 5DT1H 1X5LA 3CLEH 1KPRB 4MRCA 1E5UI 4LHUD 2QPFA 4CADB 3WSQL 3N9GL 5C0CB 3VXUE 4N9GB 4ODVH 2UY6A 2ORBL 5DJ0A 5IVXE 3EYVA 1AR2A 4Z7QE 4DQOH 1MFUA 2OTPA 5J6GB 4MA1C 3WGVB 4ALAH 2WLIB 2R59A 1PLAA 2WK2A 5KJRL 1XH3B 1IAKB 1G94A 1BZQK 1T03H 3IBOA 4L3AA 1JZJA 3ULVL 1KGIA 1QD0A 1T22B 4L8CB 1NFDF 4WI0A 1AIFA 4AIZA 1SYVA 1W6LA 3Q2CA 2EYRA 5D7SH 1OQOA 4PRID 1HFUA 4GMSH 3KS0J 1MEXL 5C0DA 1O9WA 3B7UX 3PV7A 2VDRH 4Y7MA 4M1DL 1S7RA 5JOFB 1IKNA 4PWHA 4MYPA 2Q3ZA 4L48A 4JDEA 1WS8A 3AXLA 1KZQA 3A5VA 2XBDA 4GQRA 1DVQA 5CEYA 3GI9H 1RIVH 1MHHA 4FP8L 2J21A 4HLEA 3O0LA 4NX0A 4ATWA 3LQMA 1KB3A 1OGSA 5L88L 2ORBH 4G9FE 5CS7A 2XWTA 1FRGL 3VB8A 2QHRL 2B7DT 2ZT9C 4HMEA 5AOJA 3QAQA 1URIA 5BOZG 4WW1B 4BH8B 2G9HB 3H9HB 4PRDA 5CEZL 2BS9A 1I8LA 4FQXB 1MPAL 1DEEB 5KJRH 3U25A 1BF2A 2YOAA 5IMOA 4OLXL 5DHDA 5E5LA 2YUWA 5IB5A 3FAWA 5L8KB 4PQXA 3RYMA 4QIRA 1E3XA 1XBDA 4ZUSA 4UINH 4IIZA 4NZRL 4O2CB 4AYFB 3SKOB 5MENE 2AZAA 3BUYA 2NNAB 1DBJL 3NJXA 1A7PL 3HG1D 1P1ZB 1AO7E 2V2XB 5GSVB 1J8HD 4MDIA 1FH2A 4IBSA 4PJHE 2MKLC 4ELDA 4PJ7E 3GDCA 5ELIA 4M1DH 4URKA 3MA9H 4W93A 1U2CA 2LU5A 4UZUA 4Z7WA 3JTTB 1OP4A 1NMCB 2GUYA 1GGCL 4KRPB 3KDMA 3UPRB 2Q8AL 1EQWA 2YGPA 3SGKC 1JHLH 2GTQA 2C3HA 4N5UA 1CICC 1S7VA 4R84A 5HPMA 5HYIA 2O5ZL 3U4BH 3QQXA 4APQB 5JORB 1J9RA 1A25A 4AE0A 5D1QA 2OW6A 4QYAA 3G5ZA 4PG2A 5KG9B 3QUKA 4I0PA 5KBPA 4KUZL 4X50A 4DGIL 3LNEA 2NZ9C 5F7EL 3BSHA 1Q72L 4E9WA 5F96L 4OLXH 4UT9A 5L9DL 1DCLA 5I1DA 3LRLA 1A6ZB 1XB8A 1AQ8A 2VZVA 3BH8A 4BCXA 3BT2L 4HSAC 1OGAB 1I7ZB 4JG0H 4PJDA 3TO4B 1EDQA 3QHFL 3LPOA 1LE5B 3SBWC 3FU8A 3LXAA 2BNQA 2AJSL 1RUPH 3J07A 5HVHC 4G43B 1OV8A 1WZLA 3MYJA 3DXAD 3BHBB 4EQ3A 5MEPA 4MQ7A 1FCGA 5LAXB 2PTTA 2ARJB 1CT8A 4N0UE 4JREB 5AKSA 1NCNA 3FUKA 3UBXG 3II1A 2QR0A 1UXSA 5IVXF 2ZIDA 2X05A 3ZL2A 5F3BB 1SFHA 2OXGA 1R75A 3KPRD 3Q0HA 1GGCH 3IN2A 4U7MA 4L8SA 4K23L 2ZAGA 2HTKC 2X70A 4WFGE 4K7FB 4HJ1A 3LZFH 5EU5B 4QI3A 4YE0A 4CC0A 1FNEA 1SDYA 4TLSA 3D25B 3RTQC 3FT4A 1Z3GH 1WD9A 1XV8A 3Q8EA 2CHDA 5CSGA 3UP6A 3ARWA 4HKJA 4KUZH 5DC4B 2X3CA 4DGIH 1FL5A 1U8PB 3M17B 4AVIA 5INCB 1CDHA 1E5BA 4GKNA 5L9DH 1WYJA 2C3WA 2WXOA 3BP4B 3FBKA 4UOJA 4F57L 4OFVA 3WD5L 1JK9B 3U1SL 2EXWC 3CN4A 4R90L 1L9SA 4KKZA 3QHFH 4Z7VA 5IBLC 1HX0A 1L9OA 3NDZE 3KYAA 2CO1A 2PYFA 3MLPA 1IGML 2WLYA 3WI9A 2OAAA 1R5WB 3RI5K 1AQKL 1PLBA 4OZFA 3VI4E 2WLNA 3X12B 2AJZA 1FVDB 4U1GB 3BRDA 3FSAA 3KBFA 2BXYA 4H1LA 1E27B 2VXUH 4OTXL 5KSUA 4HIHA 1WFJA 3K4ZA 3OC8A 4GRLC 1BVLB 2GJ6A 3VXPB 4K23H 2G3NA 2W1NA 4H26A 3WY3A 4FQ1L 4L37B 1UKTA 1INDH 1WITA 2FBRA 3VG0L 1N9PA 2X4NA 4JN2B 4NQED 1S7TB 4R0LC 4H25A 1Z9SA 4CNIA 3QQ9D 3SE9L 1I31A 2DYPA 4J3WA 1EA9C 1NANH 4QHPA 4U31A 5E8DL 4F57H 3TV8A 4FDWA 1GZQA 3WD5H 4P2QE 1EEYB 1XB3A 2FGWL 2ZYSA 4NUPA 3U1SH 5IHLB 4PJHF 4R90H 4JKKA 4PJ7F 2X1PA 3IFLL 1P9MC 3HE6B 4ISVA 4BSJA 3T6QC 4D7PA 3H55A 1QYGL 4FS0A 4C58B 5DO8A 3S2CA 2J3SA 2HFFA 3IDMA 2I25N 4Y2OB 4ICWA 5C0AD 4I0CC 1JBJA 3K0YA 2ZUTA 5DRZB 2B4CC 1PNCA 4UCFA 4B0MB 2O6DA 1NDTA 3D0VA 1U3JA 2CDEB 2DQCL 5ILTL 1C08B 5DJZA 5AAPA 2C26A 1ONQA 1RPKA 4MQTB 4O00A 1OALA 3MJ9L 4XC3L 3OWEA 4HKXA 1WH0A 3ATEA 3VG0H 5F97E 3OZ9L 3TYGL 3QQDB 5I73B 3GXTA 1Q1JL 2R2EA 4B97A 1K6QL 1WBZA 4ZAKD 2WXFA 1HXMA 4AZUA 3DSNA 3SE9H 1NFDB 5ID0B 4MD4B 1QLEB 2AXGB 2D7MA 1YNLL 3WFBH 5D2LB 2FGWH 1Q9OB 2DI8A 1FJ1A 1ETB1 3AXIA 3B6SA 3IFLH 3U2SA 1HHIA 4H8UA 3L1OH 1XGQB 3WUWB 3BOVA 4P2AA 2E47A 1P7QD 5FYKH 1ZLSL 3VFUA 3L2MA 4KZEL 3O9WA 5DMKA 3CHQA 1KGXA 3GUTB 3JQOB 3HZKA 1IFHL 1DVFB 2WBJC 2NYYD 3BAXA 3LKNA 2CO4A 2CH8A 4ZUTB 4JFFB 5T1DH 3OXSB 2BP3A 3NIGB 1EZSA 4IHBA 3NN8B 5AW0B 1C9SA 4WI3A 2RBLA 1B2YA 2DLHA 2Q0ZX 2F1BA 1SJMA 3WNJA 3DBSA 5CZXC 3O3BB 3VFRB 5FAAA 1T21B 4XC3H 3TP4A 4GRMA 4Y0GA 1IL1B 3ETBF 2LOEA 2V2TA 3OZ9H 4UIKH 3J27A 4JRYE 1HQRB 5B8CA 1Q1JH 4M8QA 5C08D 1K6QH 3CDZB 3TTYA 4LL1A 5FA3B 4XN7A 3I9IA 1CTOA 4W6WB 4CW1A 3C60C 3SKMB 2X6CA 4NO0D 4C83B 4F2MB 1CURA 3NTCH 1KXHA 3B5HA 4FKEA 3TBSB 1JWMA 1WAAA 1EXGA 3JVFC 5HHQB 1XMEB 3WDHA 3VI4F 3V8OA 3FTGA 3LKPB 3NP3A 3PG2A 4S0SD 4X5QA 3F8UB 1QRND 3HJEA 3EJUA 3O8XA 3P4MB 4N8CL 4OD1L 1GVIA 3PJLA 2WGXA 4ZXBB 2FYYA 5CO1A 5A2BA 4PLNC 1MIEH 2XIBA 3U30C 4BZ2A 1KYFA 5LDUA 5J12B 1J0JA 5EBWB 2ZG1A 3QPQC 1UD3A 1I9RH 1RQ5A 4JN1L 5D4HA 5FS5A 4PJBE 5AZ2L 5TE7H 4AW7A 1Q0EA 4Q9QL 2BOBA 3JVGA 1BZ9B 3LXBA 2YAQA 5IVNA 4KAQL 4Y4FA 4KNQA 2CM5A 4FNLL 1NC4B 1GW6A 2VQ1A 3FU3A 1AXSA 2R4SH 4X0KA 2BC4A 4NXSA 3R4RA 2JE8A 1A1NA 1F58H 4NAJA 5IQ9A 2ESVB 2WM0A 2AQPA 5IMLB 3VSQA 2YPLD 3CZFB 3GSRB 4BUQA 4G6JL 3U36A 1T89A 2IH1A 3B2UD 3QQNA 1E65A 1HKLH 5D1XE 5AEAA 5GZOC 1ASOA 1Y18B 5G4OA 2GJJA 4GQ9L 2SODB 4HJTA 2WCGA 2WZAA 2J8OA 3QULB 5AOKA 1B0RA 2OMXB 2EYSA 2QQLH 5J3HC 3OWRA 4YXHH 3ROOB 4HWBH 5EH1A 2IPUK 4M5YL 1M71A 2BWQA 4NHUA 2C1OB 4ORGA 5IEHB 3HKZA 2DLEA 3AY4C 2BNRA 5AZ2H 4EN3C 4Q9QH 3MLRH 3PWJA 5JZ7D 3A6BL 1MVFA 4P5SA 4C56D 2H32A 4WNQA 5C71A 1HYSD 4CU7A 3MNVA 1Q9KA 1GPOL 1WE5A 2JI1A 4M3HA 1H6UA 4HK0A 5KS9B 4GG6A 3DURB 3HPLA 3Q5YA 3RUGB 3D52A 3TBYA 4L4TD 2OFQA 1FV1A 4LSUH 4FLHA 1AGCB 1PQZB 4XPHH 3QP3A 5ANME 3X17A 2ATPA 5IJDC 3GHPA 4JMNA 2Z0UA 3O4OB 3ZTNL 1MAKA 3TZVD 3K80A 3ORJA 4P5TA 1JK8B 1CXLA 4YOKA 7TAAA 1G1YA 4GP8B 2ADIA 3QUYC 2X89D 1IQDB 3MGOB 4MA3B 5T8IA 4JGNA 2UZYB 4KK6C 1AGDA 4P5KA 1NL0H 1BXAA 1ZWIA 2EZ0C 2CLRB 4DKEL 3MMEB 1NINA 4LLQB 3GXIA 3FQTB 3OPUA 1RZ7H 2EKSA 5A1AA 1A5FL 2PN5A 3VXOA 2UWEE 4FQQA 4G7YL 4TS6A 2HFEA 3F6IA 1KJ2A 2BRRL 3T2NL 2P5WD 2QHLA 3MOQA 3WJJA 4XP4H 5D9SB 3A6BH 4AE1A 2XVKA 1JZFA 2L0DA 1TCRA 3ZW3A 1JZGA 2EC9U 2OXHB 4GINA 1GPOH 3NSXA 4YDIL 3ZUCA 4F7EA 2A77H 2F7QA 4DT2A 3R0NA 5KJ4A 1F4XH 3OHXA 1KNOB 1Z9MA 3AWGA 1F6AB 2KLTA 4GXUM 4RDQG 1EHNA 2GTZB 4C4KO 2DWYA 4Q6IA 4ZS6D 4BQ8A 1E4KA 3NCXA 1HXYA 2J8HA 3O6LL 1HCFX 3P30L 2BSEA 3F2LA 3ZTNH 2PETA 3QDHA 2FJUB 1V3JA 3HNTH 2FEJA 4DP1X 3P2DA 1ECZA 1ZT1A 2W07B 4BFFA 5IB4A 1SDAB 2DD8H 3A6OA 3L8QA 5ICXB 4BH7A 2WNKA 5GGSA 1E43A 1NM9A 5HHPB 2E75C 3U9UB 5EUOE 4X5PA 3U0PB 2GJZA 4OR1A 1A5FH 4ONFL 1OCWL 4RH4A 1A7RL 3DSFL 3E1F1 2XDHA 3GMPB 4CVXA 3VWKB 3BQUB 1H15B 5G4MA 3QA3A 1MHCA 2KZWA 4U1KB 5GJSL 4N0CC 4L3CA 1C1EH 4J3OG 4YDIH 3ELQA 3QEHA 4AL8C 2XPZA 3CCHB 2XHNA 3PABA 2ENYA 1GGBL 4JZNB 3PQYA 2A6KA 2QTVA 3H9SB 1PKQA 3GJEB 3M88A 4QOKD 4HOZA 2YEZB 4XCEB 3TJPA 4PLKC 2YOCA 1TFHA 2CR6A 5FGRA 1J0ZA 1JCVA 2ED7A 4HGMA 4LNVA 2XETA 1KN2H 3MNZA 4JFUA 1ZLWH 4BZYA 3ARBA 4QDGA 3LCYA 1QSED 5DU7A 5BOJA 2WTOA 5FCUL 1DLFL 4W68A 5GGVY 5GRZA 2L4OA 2CIIB 4GIOA 5JHAA 4GRWE 1CF1A 5J0BA 2JJSC 4L4VB 2VUOA 1X7QA 2VR5A 5CP7A 2APXA 1OCWH 1U3HB 3D85B 4D3CL 1E7VA 3DSFH 5B1JC 4ELKB 4EOWH 1MCLA 1SQMA 4L9LC 5F1NB 2A9BA 3HB3D 4FQCL 1FC2D 4UIMB 3DIFA 2BOCB 2ZX6A 4WK2B 2VXTL 3AS0A 5CN1A 2IV8A 1CGYA 4OGXH 4YSAA 2ZXQA 4HQQH 4HS3A 4U4IA 2J57A 3WKQA 1HHGA 4XBPA 3C12A 1UWXK 5AYTA 1KZYA 4Q0XH 4U0RC 4RGOL 3P4NB 3L3DB 2EH7H 2XA3A 2F7PA 4M7LT 4XNBA 3TESA 3FUEA 3N55A 3S4SB 1TF4A 2VABB 3A67H 3HHSB 3IK2A 3PUUA 2OR7A 1RZFL 5E5UB 1RPUA 1TT6A 3D18A 3AB0C 5JHDE 2R69L 2E7LC 2L7UA 2NRDA 4JZJA 4X6BA 3Q8FA 3ZYIA 2CJUL 4JZOA 1QLEL 1JGEA 1BQHB 4J4PD 3EDJA 3FU6A 2IF7A 2UWEF 1DLFH 2ALAA 3I75B 4WDIB 4N2BA 3N91A 4R2GC 2P7TB 1GKOA 2MTPA 4N68A 1J8SA 1WFTA 2HJKA 2X1OA 4PJXA 1JSYA 4TTDC 3EF4A 1MXDA 4U7KA 1NCWH 3W0WA 1MKFA 3CH1A 1CFBA 1BZOA 4ODTH 3DVNA 3MJ7A 1ZHKA 3G08B 4A04A 4KTDL 5IOPB 5CU9A 1CD1A 3BAEL 5IV2B 3PL6C 2YJLA 3V6ZA 3VGEA 4FQCH 1ESOA 1JL8A 1G9EA 2Y06L 3NAAL 3BWUF 1N64L 5AD0A 3KWVA 2VW6A 5HYQB 2A7BA 5CZVH 4RMWA 2F53D 1BV8A 4OLWL 4NRXA 3I2CL 2DN7A 3EGXB 4RGOH 2D3LA 4DERA 4AWJC 5GRJH 2IJ0C 4G42A 4G6AC 5F7KC 2ARWA 1N4XL 2EDTA 3DC0A 3U4KA 4W9LC 5BS0B 1RZFH 4UQ9A 3ZX1A 3MLVH 4ZODA 4HHWA 3WIHL 3ZDXB 2OM5A 4NZDA 1E9PB 4K0OA 4KZDL 3KLQA 2HLAA 4QO1B 5K1JA 5EZOL 4YHYB 2P28B 1FL3B 1RI8A 2Y7QA 4KC3B 4B95C 2CLVB 2WVTA 4EJ1C 1D5XA 1FG2A 3AFLA 2NY5L 3WV0A 2WXIA 1PG7H 2GB2A 3LPPA 5KEZA 4FMKA 3G9VA 2FSEB 4JQIL 2OLDA 2X4SA 3FCTA 3VFPB 3CXHK 4MD5B 1CGUA 1Q0YL 1THCA 1A6AB 2HFGL 4AJ0A 2EH8L 4YDKL 3OKMA 1A6WL 3IGAB 4OVUA 3IAPA 2AQ2A 3BAEH 5EOCL 5HGAB 4HIEB 5LNDA 2DMBA 3EXJA 2HZHA 4U1SB 3NAAH 4YZFF 5DD0L 2PYED 3VXRD 3ZZQA 4X7CC 5FM5O 1BJ1J 3QXDB 1VGEL 4OLWH 5EU6A 1XF3B 3I2CH 1QSFA 4UDTB 1DJIA 2B9AA 1NUGA 4HUWA 4JM2F 1U8KB 3EFFB 3BGFC 3PE9A 3BYTA 2DLTA 2ED8A 2NY0B 1N4XH 4KQ0A 5DI8A 5EF0A 3O11B 3O3DB 1ZDQA 4FFTA 4I9WE 2ROYA 1ML0A 2J8UF 3S3PA 3DROB 3WIHH 4GI9A 3VXMD 3HEIB 3ZE2E 2CDFA 4Y2LA 1NUDA 1OT1A 4GRWF 3LNHA 1BLNB 3MRHB 3DRQB 3D4ZA 2XQYK 2VISA 3L7EA 1DQML 3EYOB 4EIGB 3RU8L 4QXUL 5CR1A 3QYMA 3MBEB 3S7GA 3NCJL 1OK8A 3VGAB 3AG2B 1BIIA 2ZKHL 4JQIH 4DAGL 2IXQB 1ZE3C 1P6AB 2HFGH 2GSIB 5GS3A 1JG9A 1A6WH 3CSYA 4P3CH 3T65B 2M2DA 2C1PB 2N4IA 1YMME 3U82B 2DIAA 4HX1A 5JDSB 3V4VA 4KMQA 4UQBA 1VGEH 4LCYA 5EF3A 3OR6A 2C7UB 4AQEB 1B6UA 5D7LB 1OEZW 4Z7UF 5DEGB 5D70L 1PVHA 3MLZL 4Y1AB 3SKNB 2IOMA 3GINA 2VLKE 2JIXA 1FZOB 4QHNB 2OYKA 1YQVL 2NW2A 2WLJA 1URLA 1P5UB 4BQCA 1RZ8A 4BKLA 2H9GA 3C5JA 2DQFB 3ILPA 4XNQB 1G1CA 2HKFL 1R3KA 1OOAA 2V7NA 4HHAA 4QTIL 3DMMB 4N0FA 4L3FA 2Y22A 1I1AD 1F45A 4I3RL 1A7OL 1A9EA 1DVZA 1UEYA 4NKDA 5IB2A 5K69A 1BVOA 5LG1A 3EJCA 4FZEH 3QW9A 2OP4L 1PD0A 3EBGA 4HKBA 1DQMH 2NZ9D 3MI6A 3TURA 4QXUH 2AV7A 4C47A 5A16B 4ZTPL 3FUMA 5CINL 5F7WC 1DE4B 1A1OB 5E0QA 3WFEL 4KPHH 2ZP9A 3ARXA 1DL7L 3JWNG 4YEEA 3AQXA 3TVMC 4U1NA 4MMXB 3WJLA 1J48A 2WGNB 4A2MA 2XYBA 1F3JB 2DDQH 3SQRA 2VR6A 5G4NA 2ZQKA 3RVXC 1QWNA 3UG3A 2CBMA 4PWKA 4KO7A 1YQ2A 2E7HA 1P4UA 3SPVA 3GSWA 1N0LA 2E7DA 4W9FC 4P2RE 4WEUD 1L0YA 4GBXC 1KIRA 1U8MB 2ERJC 2ALWA 5I66A 2VR3A 2ZOKA 1LO3L 3IDYC 2V3DA 4QGYA 1N59A 5T5FH 4L1LA 1Y7VA 3LKRA 2F1AA 2HTKD 1EHLH 4HV8B 1IZKA 3CFEB 4AC2A 1AR1B 2WQVA 1DJSA 3GEFA 3PXLA 3HNVL 4QRFA 4HS8H 3V0HA 2OKMA 3EAKA 4XGZA 1KPUA 4YDVB 3RGVA 4B3VA 4JFXB 3V0AC 4J3OC 5E9DA 2EQDA 4N3TA 1A02N 3DJTA 7CGTA 3P4OB 2D7PA 3GIVB 2R1WB 5KVFE 2IANB 3WFEH 3AJ7A 4N2HA 4NEHB 1KSRA 2VLJE 3S3BB 1LP9B 3FFCB 3CZJA 1CIDA 5IBLD 1GC1L 4MZ3A 3LEYH 1IGIL 4OFQA 4Z76B 2FBJH 1R5IB 1H5BB 1I1FB 3E8UL 3LKQB 1U8IB 5JQ6L 4KVCL 1M1XA 4BK4A 2BO0A 3BEWB 3KZ8A 1F11A 3ZE1E 3PWPD 4BGLA 2BSTB 3FZUC 1XF1A 1DZBA 3VTMA 5F7UA 1ASPA 1OAXL 1MAML 1YEJL 1LO3H 3LH2L 4LKXB 4YGAB 3D3VA 5C0JA 3U9WA 2WPGA 3ZE2F 1GTFA 5FECB 4PUBL 4TNFA 5DWUH 5DRNB 4A7GA 4MLSA 1DVTA 4XX1E 1XWVA 3QDMA 2HP4A 3BWAA 1TYJA 3V4PB 4QRQA 2EIKB 1MFCH 1OCZB 4H7VA 3HNVH 5CMAA 1CXIA 4A67A 1NEPA 1U58B 4JM4L 4YXLL 4I2XA 5D96B 3V79C 4IU3A 4H20L 2CO7B 1N18A 3GRBA 3OKEB 3GBNL 4FG2A 5D55A 2R8SL 2HRPL 4Z3HA 1FUNA 2XN1A 1KXVA 3IMBA 2VSKB 3QG6B 1F6FB 1TVDA 3UO8B 3Q2WA 5C3IA 4CN4A 2HMIC 4PI2A 4XOAA 1IGIH 2DKSA 3QIBD 4PPTA 1U9KA 3OLIA 4RRPG 4HIPA 1RZKC 3L3IB 1NCIA 4LGPB 4NNPL 4JKMA 4MNGA 4PJFE 2NLJA 1MFBL 1NICA 4DFIA 3QZPA 4S2SA 5C07E 3T0AA 3DJSA 1RMFL 4PJGE 2EICA 1T7YA 3DECA 2MMXA 2PPEA 3D12B 4WGWB 2OV0A 2HH0L 2MKWA 3LH2H 3VU1A 2I7SA 4PUBH 3CSPA 3RL2A 4GSXA 4MZRA 3NCBB 4AG4L 3KS0H 4M7JH 4DTGL 1IKOP 3O4LD 5K1NA 3AREC 2J1WA 2JCCB 5CZRA 5AYQA 4KNTA 4X9FA 3T6WA 4YK4B 5CLZA 4IRJA 2HCZX 1TTUA 4JM4H 1M2VA 4AC4A 5HDOA 4OJCA 1DQLL 4RIRA 2R8SH 4PVBA 2HRPH 1PZDA 1FGVL 1T5XA 3LD8C 6PAZA 2ZNXA 3MZGB 2IH8A 3V95A 1UT2A 4CN1A 4JVUA 3TU6A 4ZG1A 4FTVB 5GS0L 4OZHF 2A74B 1Y6KR 3QZWB 4W6XB 4OFPA 4M7ZB 1MFBH 4TKWA 2HT2D 5AW6B 4QY8B 5DO2C 1RMFH 1TVHB 2YAEA 4Y5YB 1N10A 2J8UB 1TO5A 3VFOA 1FZMA 3GC3A 2ZOTA 1NLBL 2GFBA 3MJGX 2WUBL 4W9DC 1UVQB 2OMTB 1JN6B 4PG9B 3DX8A 4DTGH 3FHEA 4LLDA 2I69A 2ZX7A 4MNHB 5C6TH 5C2BL 3BYYA 2O61B 2C5DC 3NH7L 4J12A 4JFEA 4F3FB 1V54B 3T1FA 5BVPL 1SXZA 3DRTB 5IW1B 5T3ZE 5KVGE 2AQTA 5FYJD 3GXFA 2VQUA 4K7PL 1CLYH 1MIMH 3ZE1F 1OE3A 1XR9B 4PRPB 1MFEH 5JDJA 1H0DB 3WEAA 2P49B 1R5VA 1QI3A 1YVLA 2C4XA 3B2PA 4Z7UB 1W0YT 4J1UA 5EF1A 5CJQL 1IAIM 3T3PE 4O5LL 2C34A 3TN0B 3QPQD 1PY4A 1ITBB 1LE9A 4KUCD 4M6ML 5BRZE 1XT5A 3A23A 4ZZKA 5F7HA 1J5OL 1Y0LB 1E5AA 3KPPA 1T0MB 2Z93B 3KWWA 1QEXA 2EC8A 1HHHB 2WUBH 4I8DA 1IUZA 5L2JA 3S3CB 2IPKB 3U4EB 4XN2A 2QSVA 5GRXG 4D0BB 1NAMB 1P2CB 3BPLB 1G7PA 3BDBA 1J11A 1ZSDB 3BH4A 1NTDA 4H13C 1FHNA 4UMGA 1MI5B 4YMPA 3FULA 1SEBB 3EYUL 3QFJE 1EX0A 2Y2WA 3LB6C 2IGFL 2BVOB 1I9JH 3L5HA 3IKCB 5GGSY 1TMQA 4NQCB 3FU0A 1CR9L 5J3HD 3GSOA 3QRFM 3HG3A 4Z95L 1VPOH 4RFNC 5FUOH 3S34L 5T1JA 1M2OA 4LHUB 4XXDA 4O5LH 1G7LA 5DEJA 43C9A 3JWNE 5IB1A 3VFNA 4YDLB 2OL3B 4ABUA 4Z7NE 1BOYA 1M6UA 1J5OH 1A2YB 2COQA 2X2YA 5FYLD 1BREA 1PTZA 4MAYA 5DZ9A 2IPUG 5DK0A 3JWNC 3D69A 4YX2L 3KPLB 5FO8A 5JMOC 4OUUA 1J12A 4R7DB 3NCCB 4U1MA 4ELMB 3V5DB 4KITB 1BBJB 4ANUA 4UDUA 4ODSH 4KH9A 2O93L 1M7UA 3F3HA 5ESQB 4DGVH 4PGZA 5HHMB 5D1ZA 5L4MA 4NM4H 2MTAA 1KCKA 2QPEB 1T1ZA 3QDJE 3EYUH 4H8PA 5AOMA 3F01A 3ET9F 3FTVA 3ETTA 3LIUA 2ZAHA 4RMBA 4PRIB 2PNDA 3B34A 5ERWA 2DWXA 2IGFH 2W80C 4LOVA 3UYPB 1AHWA 2DH3A 3MCG1 1IGCL 2P8LA 4Z95H 3S34H 5E6IA 4N2DA 3KBPA 3MJ9A 1JWUB 3ELAT 5JHBA 4WFED 1KEGL 1XIWD 4HIJA 4Q6YA 3GIZH 2VAAA 3NACH 5ESAB 1GGIH 2O5YL 5EOTB 1USZA 5E8EB 1QI4A 4KKQA 4ETQA 2FBOJ 3KGTA 1P4BL 4YGVB 5TE4L 3AGWA 4PRNA 1FYTD 2ZJSL 4W70A 5B38A 3RAJH 4GAYA 3WS3A 5D2NB 1ZA3B 1JHTA 2HVJB 2QKIB 3EH1A 2ZSWB 3FSWA 3SDAB 1RH8A 2Y24A 1RLBA 3GSVB 4NHCL 4W9ZA 2BS8A 5L4IA 2DIJA 4M9PA 5JW4Q 3ESUF 2JK5B 1MN4A 5CSBA 3RY6A 4I77L 4OCWL 5DZVA 3T3PF 5T1LB 5DCCA 3APCA 2J72A 1J8HB 1Z5LA 4WHTA 5IBTL 3R06B 5CBAA 3U0TB 2BP5M 1OVZA 1KPRA 5AUMA 4XMTA 3QIUC 2Q1EA 4CADA 1KEGH 5E23A 2EE9A 2F54D 1ZVYA 3EFOA 2WOYA 4N9GA 5D6DA 5C0CA 4JLRA 1AH1A 4P9HC 3SSGA 1EJ8A 4K3HA 2Q2LA 3VX1A 1EO7A 1P4BH 1LK3L 5C7ZA 3IWVA 3RTLA 1WWCA 2WLIA 3TEZA 2A4EA 3LN4A 4TQ8A 3VA2C 3KVDD 3AU1A 1QWHA 2EO7A 3BWSA 4JHVA 1AAJA 5EEUA 2J4WH 1CMOA 1RZJL 3P77B 1F1DA 2BCKB 5C6PB 1VLXA 1T22A 4NHCH 4MQSB 4PLKD 4L8CA 5IEKB 2KC0A 3MV7E 1D7BA 5IQOA 4ZYKB 2BNUB 3RX7A 1HZHL 2D2OA 3P11L 4PV9B 4CU6A 5ISZD 4JFZL 4OCWH 1ULVA 3DXAB 1TTRA 2F8IA 3GTTA 3OPZL 1W0WA 3HHRB 3Q9QA 5IBTH 4J8RA 2Z65C 3ULSB 1UYWL 4BA0A 2J44A 4Z7NF 1K72A 3DOSA 2H8PB 3B3IB 3DX6B 2CLZB 3LVEA 4R8WH 3KPRB 4PD4J 3NCEB 1WA1X 3NJMA 2GY5A 4UZGA 3RKPA 1TQCC 5LQBL 1KTCA 3JV6B 3BJLA 2AXJA 3H3PL 4LEOB 4NQSA 2OCCB 1LK3H 5I15L 1VIWA 3CFIC 1K2DB 2PP8A 4WW1A 4HMDA 4BH8A 2G9HA 3NABL 5KVEL 2CRMA 3LRHA 2MNJB 4FQXA 1DEEA 4GT7A 5ID1B 4HC1H 5F3FA 5B1BB 3RWJB 5C0NC 5JO5B 3V4PH 5DFWH 1RZJH 1S9WA 1Z1WA 1AKJD 1SJVA 3QEQE 4NO2B 3RY5A 1S5HB 4O2CA 1HZHH 3OAYH 4AYFA 4PMEA 3P11H 1T6WA 3FRPG 5T1KD 1XH1A 3O3EB 4JFZH 4ZPTB 1O5DT 1P1ZA 1N5AB 1ET5A 2WXRA 4KTEH 3IM1A 5GSVA 2CPCA 2QFRA 4NUMA 4R4FL 3AZUA 1KV3A 5ALCH 2Q5BA 2AMGA 3B9EA 4LL9A 3QNXB 1UYWH 2W60B 4UBDD 3JTTA 4PJEE 3RY4A 1U30A 4KDTA 4O02B 3V0VB 2AEPL 4BK5A 5TE6L 2W94A 3BMWA 3H3PH 1X5JA 4PWFA 2W92A 3PDDA 5E4EC 4APQA 3W81A 3IU3B 1UD4A 5KG9A 4NQEB 2XN9E 4DUXA 3NABH 4P3DB 2J1KA 5KVEH 5BV7C 2JKIS 1T1XB 3HHMA 5ABAA 3APFA 1AIZA 2E0PA 5I6KA 1WWWX 3GB7B 1A6ZA 4ABVA 3BIAX 1JZDC 4ONHB 3PS6A 4OZGB 5F3HA 4YJZL 1OO2A 4KXZH 4BSVB 3TO4A 1TQVA 1LE5A 3NDYE 4UOW1 4YFLI 5K1VA 2C3XA 1X5YA 2A5UA 4FXTA 4Y2DD 4OF3A 1IKFL 2OYPA 5DXWA 3BHBA 4PVMA 1ACYH 1NCUA 1IBDA 5LAXA 3TV3L 3NEXA 5DYFA 5GGRB 2ARJA 2NCMA 4IQHA 3L2LA 2GIYA 5JW3H 3H8NA 3K74B 1LEKB 2H1PH 4V33A 3OKDB 5EA0L 3VGBA 2EIZB 5ABZA 2GY7B 4B60A 4XCFL 4JR9H 1L5GA 5I1IL 3KXFD 2HPOA 3QE5A 4K7FA 4ENEC 4EDWL 1CLOL 1FHGA 3FMGL 2VZOA 5I6XC 3D25A 1JGUH 2DIEA 1BWWA 2R4RL 4QRRD 4ZAKB 3KLHD 4E41B 3NSDA 3NRPA 1NC2B 3SPCA 4ZFOB 1MCOL 1U8PA 2XY1A 3M17A 4BV1A 4MQXC 3BP6B 5INCA 3BP4A 1FPTL 2W9DL 1JK9A 2A6IB 3PNWB 1FC1A 3CBJB 1G0XA 1U8HA 3ASOB 3QWRA 4OQTH 4PW3A 4D9QE 3MC0A 4P57B 4DPRA 1C5DA 3AWEA 4PJ9A 4Q52A 4AKQA 3O3AB 5D7IE 1A7NH 3IJSB 4WEBL 3AUWB 1IKFH 2F9BT 1P7QB 1R5WA 4CVUA 5H2BB 3X12A 2CALA 4TN9A 1FVDA 2YWYA 4E9LA 1MJ7L 3QORC 1FVCB 3UG5A 4LK4A 1E27A 2CAKA 3ESMA 4B7IA 4HEME 3MLSL 1KBKA 4XCYB 4BFEA 1BVLA 3VXPA 2P48B 4F7MB 2XQYG 4G9DB 4JW3A 4S11A 2VW7A 4L37A 2BP8B 4DFHA 3FMGH 3IGUA 1TTAA 4XHJD 4HWUA 4OIFA 2DH2A 2VW4A 3L54A 4KH2A 5KYUA 1ED3B 5C08B 3QDGB 3TA3C 1G6RB 3WHXA 2K70A 4YUEL 5TF1L 3F6JA 5FGBC 1A0QL 4F8NA 1MCOH 1NBVL 1IGTB 1U92A 4HETA 1Z0MA 4NO0B 5I0WA 2Y6SC 1AZUA 3SYAA 1PMYA 4NIYE 3CSBA 1EEYA 3ECQA 2RJMA 1NAMH 5C7XH 4QKXB 2B08A 3RZCC 2YRPA 5B1AB 2UXVA 5I74B 2MIZA 1NDMA 2Z7UA 3KW7A 1QRNB 4QF1A 1HL9A 1WFUA 1ZIAA 2GQHA 1JYNA 4KZCA 3KLLA 3SDXB 1ZLVK 1N3NB 4MNQE 4KXBA 4NKIL 3I3BA 4M6AA 4MXQD 4HU2A 1MJ7H 1SXNA 3EBAA 1A47A 1OARL 2YPVL 3P3YA 2JI2A 4HFUL 3W5MA 2VLME 5EO1B 2HLFD 1UCBH 4JDVB 4QRTB 5DVKA 5AW3B 4GUPA 3VH8G 2UYLB 1TTFA 3TGXA 2WD0A 2B5IC 4PJ5D 2W38A 3FU5A 2DLGA 4NWUH 1CUOA 3QQDA 1OD9A 3ARYA 2OL3H 1UTDA 5HYEA 4XXCA 2YPLB 4IJ3C 4YUEH 2R69A 5F7LB 4F9LA 2PXYB 1YRKA 2C9AA 1CE6B 1NFDA 2WW8A 3NTCL 2OJ1A 4MD4A 5B22A 2AXGA 1UZGA 4H44C 5MP6L 1TZOA 3B2VH 3MBXL 1OW0C 1ODAA 3JV5A 4AGQA 1Q9OA 3UTTE 3FF8A 4GAGH 3T77B 3LSOB 1NEZB 2XWDA 3TO2B 1ZTMA 2RH0A 3ZLQC 5MERA 1UG9A 4NZFA 3WUWA 1E4HA 5ANHA 4UF7C 5F1OB 3HE7C 5IT2L 4P2OC 2YZ8A 4POYA 2IALB 1JPFB 5D5MB 3UERA 2PUQT 4J3OD 3GUTA 3MDJA 4NKIH 4Q9BA 3QI9C 4JFFA 2FO4B 3OXSA 4KHXH 1MUJB 2NXZD 1OARH 2HKHL 4HYTB 5SWZD 4FQ2L 2YPVH 1GIGL 1UOWA 4GG8B 3GTNA 4C56B 1C16B 3CQPA 1L6PA 3VFRA 1VB9A 1T21A 4RAVB 1VDGA 3CAFA 2MPVA 1PZCA 2NQCA 3FTWA 4X6CB 4HG4J 3OXRA 2IDQA 3CN3A 1A6PA 1HQRA 2ICCA 5IMMA 3WIHA 4L4TB 1OF2B 1L0PA 3LDBC 1EEZB 3WEXA 5BW7C 1IARB 2RR3A 3DLQR 2PCPB 3FU7A 4PBXA 2LW3A 4C83A 4F2MA 3P2BA 3TZVB 5MP6H 5GGQH 1DANT 5GZND 1GSMA 4N2OA 3BZEB 4ZUWA 4Y5XA 3UJTL 5A40E 1HIML 1G7QB 3N43F 3TFBA 4JQIA 4U6VL 3P4MA 2I9TA 4MWFB 4ZXBA 4F37F 5AW2B 5IT2H 3OKKB 1SXCA 5GQBA 1QP1A 3D2TA 5HJGA 5EBWA 2VERA 2V8LA 2P5ED 5I2IA 2ZUXA 1IIIA 2P5WB 4F2EA 4FQ2H 1ETA1 1GIGH 4MXWH 1FSKB 1NC4A 2X4OB 4NUJB 3KYNB 1EHXA 1BFTA 1XGRB 3EYFB 3LH8A 3MUGB 2RACA 3CHSA 2ESVA 3KPSD 4QJ5B 4LGSB 5IMLA 4OV5B 1MW1A 4D8OA 3CZFA 3GSRA 1H8NA 3JWDL 5KW9H 4K7PX 4M1GH 4DP6X 3NGBB 3HFFA 3WLBB 5A7EA 5KVFL 3IMUA 3HBZA 1I7TB 4MS8D 3M7OA 2IWFA 3AM8A 3W9EB 4F8QA 1BZ7A 4QRAA 3US1A 4YO0B 3ARED 5J1SC 3UJTH 5I71B 1BJ1H 1HIMH 2QFPA 3MREB 5BNXD 3K6FA 4U6VH 3QULA 4P46C 5BZWA 3ZKMC 4OF8A 4NQQA 2YPKB 1NIEA 2DQEL 3MCLH 4HJGB 5EO9B 1BQLL 1N67A 1NEUA 3SYQA 3BCDA 5FKAB 5JYMA 4NI6A 4ZO7A 1HINL 2R2BA 2C1OA 1SBBA 5IEHA 1XGYL 4LVHC 4G7VL 4L8BA 4D0CA 4JPSA 1M05B 1HU8A 1SEQL 3EHBC 1JERA 5IUSA 3ECUA 1QFWI 1CS6A 3ARFA 4GW5B 3REVB 1JZIA 4GH7B 2CDGB 3MCYA 4L3EE 5DJ8B 5I0DA 1MFVA 4Q4EA 3L3HB 4AV0A 1RK7A 2P9RA 5DQJB 4Z3IA 1ZD6A 4QOKB 2DTMH 1AGCA 1PQZA 5I8OH 5B7FA 5DC9B 3I74A 3BUDA 3RBGA 4XP6L 4L1SA 4AMXA 5HYJE 1JK8A 4DEPC 2AK4D 4PY8J 2DB8A 4DESA 1IQDA 3MV9E 5K9QG 4MA3A 1JV5B 4P05A 2PWFA 4FL4C 1QSEB 1E8ZA 5EFIB 4TQIA 2VDOL 2CLRA 3MMEA 2DQEH 3FQTA 1BQLH 2DY2A 3G04B 5DJAB 3GKWH 1HINH 2FWUA 4G7VH 5DUML 5KBDA 2X4PA 2GT9A 5D9SA 3HB3B 4RMTA 5INDA 3ZKNC 4DP4X 5HD8C 2YD0A 3NBNA 1DBAL 4LO9A 3HIZA 2OXHA 1CWVA 3VGFA 5GS1B 1YMHB 3SODB 3OTTA 3G6JB 3MUJA 4O02H 4PRHB 4JE0A 3UAAA 1KNOA 4ZTOH 3TX4A 2I60L 5EEYA 2NSMA 2BY2A 1F6AA 3C09C 5EDSA 2GTZA 2JNZA 3C5ZD 4IGBD 4CC1A 5AVTB 3C75A 2PF6A 2B8OT 2PPDA 3O2WL 4XH2B 4YHOL 1T6BX 3HUJE 4POZD 5GS2D 4JG5A 4TSCH 1I85A 1MJ8L 1OD7A 4LXFA 5FM5M 3GT6A 2YLKA 3CXFA 4UQIM 5EC1B 3VO0A 1YEWA 5D8JL 2OSLA 2XQBL 2X4TB 2W07A 5F1KC 1CXFA 2CHZA 4WJ5B 4HUKB 1M7IB 1WHOA 3ARQA 2D7TL 3N1MC 5ICXA 3RX5A 1TQTA 4GW4B 5HHPA 4XBEL 3L16A 3DJZA 3HRZC 1RUAH 2VERN 4WO4A 3U0PA 1BQKA 2XT1B 2ZONA 4GLRI 2ZUQB 4P04A 4G72B 1U8LB 1VRSA 4K07A 1NCJA 2H3NB 4JO4H 4QRPB 3BE1L 3GMPA 3BQUA 3CVCA 4LNRA 1H15A 1FNFA 1OZUA 1FZJB 3MLXL 2NX5E 3SBPA 3ZMNA 3U9PH 5I82A 1FNLA 3LQAC 1F3RB 2F53B 4PEEA 4BWWA 3VWJC 3CCHA 4PB9L 2QGDA 5I0VA 2NNRA 4N6RB 1LILA 4OZFG 3MKKA 4ETYA 2WZPD 3RWGB 3H9SA 3DI3B 3OAWA 4DOHE 4XCEA 4JCLA 1S9YB 1D5RA 2GCYB 4H1LG 4UM9D 2QPDB 4JRWA 2Z7WA 3O2WH 4M02A 4YHOH 2X4UB 3VRLE 3QZLA 1QNZH 2D0HA 1FP5A 1MJ8H 2NZ1A 3HI5H 2FO8A 4MA1B 4QT5B 1E28B 2BHYA 3QNZA 4PCSA 4LEBA 2F8OA 2Q20A 5E6YA 2XQBH 3DO7B 1T2QH 4LSDA 1HAWA 4OI9A 4HZLB 5LBVA 4AYSA 2CIIA 1KIPB 4XBEH 2N7SA 1B4JL 3QB7C 4X98B 3LJ3A 4L4VA 4A7QA 2YD8A 4BCYA 3O6FD 1U3HA 4PY8I 3D85A 4BBWA 3GHBH 3WO4C 2E74C 1IT9L 4K3JL 3UBFA 4ELKA 3QWNA 4PV1C 3ZE0E 5IR1B 4G6FD 2WQ8A 3EO0B 3MLXH 3SDDC 4UIMA 3UIZA 2BOCA 3JYCA 3VXRB 4HWZA 4PREB 4ZMWA 4NLAA 3C6LA 3LXCA 3F00A 4YBLB 4PB9H 3L3DA 4N9OB 6FABL 1F4WL 4HKZA 4JFTA 1FO0L 2VABA 3HHSA 2UZIL 4JFOB 4L5FE 3SDCC 3Q5TA 3VXQB 4LGRB 2A0LC 2ZUVA 4WWKD 3JWOL 1FL6B 1G6RH 3VXMB 1YCSA 3N43B 1JXDA 5JXAL 4JY4B 2BH0A 2FWOB 3WKPA 2P52A 2VN6A 4WSKA 3VNZA 4PR5A 2EE0A 4ZX4A 2Z0BA 1MWAL 4RQQB 1BQHA 2CCVA 3I75A 4G9FB 4WDIA 1CFVL 1IB5A 3EKCA 1NOLA 4KTGA 5E2UL 3JV4B 1U3YA 4K5OA 4NOFA 3P3RA 1J5HA 1B4JH 2ZF8A 4X9BA 1TEGA 2XWJB 2KQNA 5DVOA 4E5XB 5IOPA 4BFBD 4K3JH 3SOBH 5IV2A 1KYDA 4LPVA 1OSYA 4YHIB 4KXDA 4V1DE 1W8OA 5DJCB 5DFAA 2WWMD 5HYQA 3CXDH 4EPSA 5KVDL 5LGKA 2ZKXA 1HILB 3EGXA 5J1TC 3HUJF 3QIUD 2VLRD 1F4WH 4TLUA 4NNXB 4TNGA 2UZIH 5BS0A 2LTQC 3FHQA 1HWGB 3QXVA 1CICB 1S2EA 2KZBA 1A3LH 4GMTL 4KUCF 4DUVA 1X5GA 2DRUA 5H37G 1OWRM 1VHPA 1PDKB 2NDGA 1UWFA 1UATA 4QD2E 5GRUL 5K9KA 1DSYA 5CIPB 3SEPA 3RDTD 4J27A 1QLFB 4YBHA 2X09A 4Y9BA 5E5RB 5EUKB 4EBQH 2Q10A 1AXIB 4KI5C 1CFVH 2G3XA 2VJXA 3DWTA 1VACB 3RNKA 3CPLB 4PCKA 1XAKA 2FSEA 1LDSA 3GMQB 1NDGB 1IM9D 3A0OA 4MD5A 4UOW0 3ZHLA 4A7SA 1IKNC 1A6AA 2H5UA 1EEQA 1S3RA 2VH5L 3OKNA 5IFHL 1P7HL 1J8KA 5DK2B 3IGAA 1JVOA 3L7FA 2XBTA 5HGAA 4HIEA 1AOZA 4P4KC 4PGCB 3MBWA 3BISA 2IEPA 2QZ5A 4IIQA 3T6XA 3V0IA 4HW6A 4CMHB 2CGZA 2B39A 1XF3A 1OP3H 5KVDH 1J5CA 4M62L 3MTXA 4TNVF 3VRLF 2CD0A 1EERB 2EEAA 3BUIA 3GSUA 4IOSA 3EFFA 4UTAH 4DKDC 3DTXA 3NMEA 5BO0D 1YEKL 2EDEA 5E99H 2OS7A 1I8LC 3O3DA 1WBXB 3F5WB 4N0UB 4N3UA 3X3FL 3WDIA 1LO5A 2NXYC 4GMTH 4GP4B 2O1AA 3VGDA 3DROA 5KSAC 4NO3B 2Y36L 4JBSA 5F7FA 1KB9K 4X8CA 1AFVL 3TNNA 1BLNA 3BP7A 1DUYB 5DZJA 5JHLL 4HUNB 3EYOA 1G1OA 4Z7WE 3MBEA 1ILUA 3L3OA 1NCCL 4WI8A 2VRKA 4LAQL 3UTQB 3ZE0F 3K2UL 3VG9C 1CXEA 1KXTB 2IXQA 1O6VA 1W15A 1JMZA 1AMYA 2GSIA 2VH5H 5FXCH 3T4YB 4ECNA 3EDEA 5IFHH 5JW5A 3HJ0A 3RG1C 4LCIL 3HG0A 4YHKL 4DW2L 3T65A 1L9TA 2JKNA 4YLBA 5JDSA 3PWPB 3F7LA 4XN5A 5I76B 2F68X 2C7UA 4OZ4B 1KGJA 1W80A 2B0SL 1P1VA 5D7LA 4AQEA 5ADOL 5CD5C 1R24B 1UD2A 3FF7A 5D1QC 4PG2C 4LSSL 3UTZB 4LRNL 1FZOA 4GRLB 4PJDE 4P59L 3UJJL 1P5UA 1MCRA 3WFHB 3VFGH 4XNQA 3ARZA 2DQFA 4MB5A 3C6EA 1CFTB 2BNQE 1NIDA 4FG4A 5TJWK 2YXVA 3MUY1 1JNLH 4YIQB 4J3UA 4APXA 4KROC 2X7LB 2W59A 2JKJA 5H35B 4Q2ZA 4NDMB 1NCCH 3HR6A 3V7AG 5A16A 2AI0L 4XR8C 2Z35B 1DE4A 1A1OA 2K4AA 4LAQH 3D9AL 2NY6C 3K2UH 1RJCA 4HXBL 4D0DB 1UOKA 1EAQA 3AAZB 1ZPLA 5J11C 3QIBB 5GIRB 4BA8A 4F20A 1S9XB 4LCIH 1TENA 3P0GB 4DW2H 2VKXA 4L8SC 1XGTB 4OJDH 1QMUA 3IB4A 5KZCD 5IP4A 1UT9A 1OQXA 4R83A 1N6VA 4JGJA 3MV8D 2ZE0A 1HC1A 4K3GA 1YDPB 2GK2A 2WTRB 4XPBL 3RB7A 4JFDD 1ETZB 4DO6A 3I3EA 4LRNH 3QH3B 1O7SA 2CGRH 2JSFA 4KX8A 4Z7VE 1IVLA 4WI6A 3NA9L 2Y3AA 3IDNB 3O4LB 4HV8A 2QV4A 3CFEA 4MJJA 5DJ6B 5FFGA 2QSQA 4ENED 2GPZA 5HYSA 4FF9A 5TDPB 5IKCB 4X7DC 1N12A 3ARDD 4YDVA 3CDFA 4JFXA 4E68A 4PLOB 1ZXKA 4XMKL 2YXMA 3V6FB 4E42B 4MQXD 4LPCA 5EU4A 4U2YA 4HISA 2AI0H 1YYLL 3P4OA 3GIVA 3UTSD 2GJ6E 2R1WA 2IANA 4UAOC 4HXBH 1VZGA 1GMEA 2A9MH 1LP9A 2IG2L 2C9SA 2WO3B 5FOBB 4XAKD 3S96A 1BECA 3CZGA 4K94L 4LF3B 1R5IA 1H5BA 3KL0A 4HEPG 3BEWA 1E30A 2N0MA 4YHZL 3OKYA 1M3IA 3GDBA 5EPMB 4N1EA 2WBJB 1Y07A 4MTMA 1KTRL 3QORD 4UILL 4HH9B 2E9GA 4K8RC 1AVAA 3OLEA 4LKXA 3ZPDA 4OGAC 1GXEA 2WYZA 4DF9A 3HW7A 1FAKT 2ZF9A 2H41A 2CUMA 2VR7A 4RWYH 4UQDA 3CLWA 5D7KD 5FECA 4PW4A 1A3QA 2UZXB 1S78D 1LL1A 1Z66A 4GYBA 3NA9H 4HCFA 2OPCA 4NAQA 4Y19D 5IK3A 3OF6D 5CBEB 2IIJA 1JZ8A 4Y4KD 5AYUL 2FZ3B 1U58A 3IDXL 1G9NL 3QUZD 2CO7A 1B0GB 2Z31D 3OKEA 2J1ZA 4JO1L 4XMKH 3C60B 3SO5A 1YYLH 1DQJB 1EZVX 4LPYA 4IS6B 3ZR6A 2IG2H 3RZCD 1SFDA 1BW8A 3M7FB 2QBWA 2JLPA 2GK0A 3BPNB 1NOAA 4G8EB 3GSNB 3K72A 4H0GA 3VACA 3DA0A 2JKWA 4K94H 1JTOA 3UXFA 3L3IA 4P5RA 1JGLL 3L3KB 3HC4L 3EOAA 1FNSL 4YHZH 1QBLH 1S7WB 2FWLB 3U30B 5MHSE 5HGDA 4AUJA 2JKLA 2TSAA 2FQFA 2ITEA 1RZQA 3DK0A 4H8WL 1N6QL 3THML 1AJ7L 1EGJL 4Q9RL 1A22B 4P4RB 3II3A 4KFZC 2O4EA 4WU5B 3IDGA 3S36L 3STZB 2JCCA 2JJUA 1GKEA 2D31B 2WXKA 5AYUH 1DLHB 4G1EB 2QLYA 4G11A 5CWSB 4ZO9A 3UG4A 1KDJA 4E2OA 4UNUA 3FTXA 4X9HA 4JY6B 3PIQB 1MCQA 2YUVA 3D4CA 4OLVH 1VERA 4Z7AA 3KLAB 4PJ5E 5I8KH 4NSKB 3O9WC 3NCMA 2KQMA 2YGOA 1J1OH 3MO1B 4ZSOB 4KKPA 4X42A 3L3JB 2V5TA 3KHQA 2F08A 2FH6A 4MDJB 5I1AB 2A74A 3HE7D 2AFNA 5SV3A 2YEQA 4QY8A 3GZOA 5ITBL 5L2KD 4MB3A 2ZWZA 4MJ6B 2J8UA 5B8CC 2ZG2A 3WEOA 4H8WH 3W3BA 4Z3GA 5F9OL 1WAAE 3THMH 4MJ5B 4FFVC 4Q9RH 1UVQA 2XWEA 2OMTA 4QUOA 3X2QB 4L18A 1JN6A 4PG9A 1E4XI 3BEVB 2IBBA 4X5RA 1BVNP 4NP9A 3H0TA 4NZTH 4MNHA 5BCAA 1BXVA 1IBGL 4PWIA 1E2WA 5EBMB 3RVWD 4OQTA 5AVZB 2KLSA 3IS1X 4XNAA 3UC0H 2O61A 3VAEA 3SIKA 3RILA 1LHZA 4F3FA 3TT1H 3FT1A 3DRTA 3O8XC 1UGNA 1RVFL 3SBRA 3FB8A 1BEYL 3BKML 2LAAA 2BY3A 1R9FA 1AMXA 1XR9A 4PRPA 1H0DA 5DQDH 4XVJL 2MH4A 3JZYA 2ZNWA 3I6LE 2X6VA 1RIHH 3QAZC 5B21A 3ZHDA 3JVGC 4GKZA 5J13C 3NJHA 4Z7UA 3R7QA 3GMOB 1SZNA 4Y4FC 1I3GH 1ZV2A 2AGJH 5JIQA 4JO5A 5DRXB 1XIWB 5HHOD 3IXTB 2XFXA 3TN0A 3VDBA 5HGGS 1V10A 4S0TD 1NGPL 1HNFA 1TYEB 2Y69B 3I9GH 2FIKB 3SY0B 4PY7B 4LCWD 1T0MA 2KS0A 5TTRA 4L0ZA 1UWGL 3SZ6A 1BF5A 1FYTB 1TZGH 4GSRA 2HWZL 3WL9B 3FK3A 2IPKA 4RFEA 4K73A 4TM9A 4W9CC 3U4EA 3VXSD 1XGUB 4AJVA 4D0BA 4MB4A 1O6SB 1P2CA 1SXAA 2A6JB 4XCCH 1ZSDA 4KNUA 1L9PA 3F58L 5IQLA 2PCFB 1KELL 1U8CA 3HTLX 2BNRE 3BSZH 4BSWB 5CIPH 1SEBA 2EIDA 4WWPA 4BHUI 4Z78A 2PO6A 4GOSA 1ZEAL 2XLLA 1CD9B 2BVOA 2CJTA 5KWYC 4C54A 1ACZA 4FQHB 4XNDA 1E7UA 2Q76B 1WJ3A 5C09D 3IJYB 4NQCA 4P46D 5FYKD 2W9LA 4GG6E 2X0UA 4YHMH 1CDBA 2CUAA 5E0FA 3FQRA 3V7AE 4AXWA 3DX3A 4YHNB 4LHUA 5I0ZA 4XMXA 3MROB 3D2UD 4H5SA 4OZIF 1XSJA 1DQDL 1MRFH 2WSPA 1EUUA 5I75C 1BQ5A 1O6TA 1XF2B 3BWZA 5BOPA 1QHOA 4RDQF 3ECVA 1BOGB 4EMZA 1U91B 5IFJA 1O9ZA 2Z4QB 2HWZH 5I8CB 3O41B 3KPLA 4R4BB 1KPVB 2E86A 2QQQA 4P5TC 2BVTA 4R7DA 5D7EA 5BZZA 1BBJA 2UX7A 3DO3A 3BC9A 4WY7H 5K39B 2FAUA 2NSXA 3F58H 4XRCB 5SWSD 1UGKA 2R0WL 2Y07L 1SF3A 1MNUL 3CFBB 4U3XA 4U3SB 3N1QC 35C8L 3H53A 5ISZB 4NT6A 3BLPX 1DO6A 4PRIA 1B4TA 1ZEAH 4OLZH 1MFAL 4UT6L 3ABMB 3S37X 2GC4C 2MNUA 1KTDA 1F4YL 2IQAB 2YPVA 3UYPA 3WJJC 5J8OA 3VVWA 2VKWA 2ROXA 1WAAF 4IRSC 3MRRB 1P0SE 4IBYA 3ASNB 4PJ8D 5EOTA 1EAPA 3T0VA 4F27A 3TC9A 3VW3H 3OHXC 2HT4D 3UOAB 1BJ8A 3DGGA 3CUPB 2BVPB 4YGVA 2Q3XA 4Q6IC 2G60H 4F24A 4JPWL 3UL4A 2ZCKL 3Q3GB 2F7RA 5AOLA 5D2NA 1ZA3A 3BRFA 1ZGLB 4I5BB 1U3ZA 3V0WL 2A6DB 3IRZA 1M1SA 4X9GA 2ZSWA 4CDGC 4JKPL 1KOAA 2FCBA 2VO5A 5MEQB 4G82A 5TDOB 3GSVA