1PLBA

High-resolution solution structure of reduced parsley plastocyanin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
AEVKLGSDDGGLVFSPSSFTVAAGEKITFKNNAGFPHNIVFDEDEVPAGVNAEKISQPEYLNGAGETYEVTLTEKGTYKFYCEPHAGAGMKGEVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution solution structure of reduced parsley plastocyanin.
pubmed doi rcsb
source organism Petroselinum crispum
molecule tags Electron transport protein
molecule keywords PLASTOCYANIN
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1plbA00
1BQRA 4L0PB 2UXVA 3ZDWA 1J5CA 2HX9A 2XYBA 2VM3A 1RZPA 2BHFA 1PLBA 2PP8A 3AG1B 3S8GB 5PAZA 1QHQA 3CVCA 4KOBA 1ILSA 1W6LA 1R1CA 1YLBB 1JZGA 1OCRB 2IH8A 2Y69B 3OD3A 1NTDA 4W9ZA 4GP5B 4DP0X 3AW5A 4KO6A 4PAZA 3FU7A 4AZUA 1J9QA 1N70A 3X1NA 3PAVA 1MG3C 2CUAA 2XX0A 4YSDA 4NERA 1A4BA 4QKTA 3T71A 3T9WA 1URIA 2XX1A 5I6NA 4A2FA 2UX6A 3FSVA 1NIAA 4UF7C 3FQ2A 3X2QB 2YAEA 3TBBA 5D4JA 4YSUA 9PCYA 1JZHA 4KNSA 3QJQB 1AQ8A 1NIEA 3BQVA 2NRDA 4ZK8A 1MG2C 4HALA 4FAAB 1OCCB 1RKRA 3EHBB 2VSMB 3NJGA 4Q89A 4EF3A 1GS6X 1KBWA 2WO3B 2X87A 3EH4B 2DV6A 1OE3A 2GHZA 1WA2X 2CAKA 2W88A 3NJLA 8PAZA 3TA4D 1AS6A 3GXUB 1CC3A 2FT7A 2UX7A 4TXVB 2CALA 1XB3A 4M3HA 3ZBMA 5F7BA 1NZRA 2IDQA 5I5IA 3EH3B 1BQKA 5B1KA 4E9QA 1BYPA 4YSOA 3FQ1A 3X1FA 1GSKA 5FC9A 2BW5A 2BW4A 4F7KA 5F7AA 3UABA 2A3TA 1ET5A 1OV8A 1AZNA 1E5ZA 2XV0A 3ASOB 4YVNA 2XXGA 1HAWA 3MX0B 2BZ7A 4GYBA 1A8ZA 2JKWA 1AZRA 4M4RB 3BVDB 1JZIA 1ZIBA 3FT0A 3H4FA 4E9SA 4JKNA 2P80A 2VW4A 3NJHA 2GI0A 2FWLB 1M56B 2J57A 2IH9A 1A3ZA 3AZUA 1GY2A 4A68A 2FJSA 3EF4A 2BZCA 1JXDA 2CBPA 4YL4A 5AZUA 1JERA 3NT0A 2FQGA 3NP4A 2Y1AA 2X88A 3JT2A 2J56A 4RH4A 2TSBA 3FU7B 2BWIA 4MFHA 1RZQA 2I7SA 1IKOP 3HB3B 5B3SB 1M9WA 1PZCA 3NSYA 2Q9OA 4NB7A 2HZHA 3X1BA 3NSCA 2XLLA 3TBCA 2BWDA 2IAAC 5PCYA 3ZX1A 1QLEB 2H47C 2QPEB 4YSEA 1KGYE 2YAOA 4BWTA 2GBAA 2VMJA 1X9RA 4Q8BA 2DWSA 5B1BB 4DP7X 4AKQA 4PCYA 4GY4A 3NJMA 2LLNA 1DZ0A 3N55A 1HFUA 3FSZA 4AKOA 1PF3A 1GS8A 1NWOA 1PNCA 1XMEB 2JXMA 2PPFA 3NSFA 4BK5C 2PCYA 2YAQA 1ZIAA 4YVUA 1KDIA 1XB8A 3N2JA 4GP8B 3X1EA 1VLXA 2AZUA 1OCZB 5LDUA 2YXVA 4A66A 1T5KA 1BXAA 4YSRA 2OCCB 3PCYA 7PCYA 1ET7A 1NIBA 2FQEA 3FQYA 1PCSA 4GP4B 5I28A 4G7QB 4YSTA 3SBPA 3QJRB 1BYOA 1DYZA 1PNDA 3FSAA 3QJVB 2VW7A 3CG8A 2YAMA 3DTUB 1PY0A 4KNUA 1BQ5A 1GYCA 2CJ3A 3CDZB 3S3CB 4QLWA 3NJIA 4YSPA 1WAEA 1L9OA 4P5RA 3DKHA 2IDSA 2ZONA 1PZAA 3T6ZA 3PPSA 3H56A 3RYMA 4HCIA 5AKRA 3ABMB 3C75A 4FA7B 2DY2A 5IY5B 2R7EA 2EIKB 2XXFA 4N8UA 2HX8A 3WNJA 1PZBA 4F2FA 3NJNA 1ETJA 3KW8A 3FSWA 1BAWA 4DP5X 4E9YA 2HXAA 3QJUB 1IC0A 3CVDA 1NIFA 1MZZA 2I85A 3FU8A 3G5WA 3UACA 3V9CA 2BO0A 1ZDSA 4A67A 3SBRA 4HHGA 4HZ1A 1OF0A 1X9UA 1J5DA 1ZDQA 4HCGA 3ABLB 1KCWA 1GW0A 2P80D 2FNWA 2OV0A 2BP8B 1OOWA 1OCOB 2R7EB 4A2HA 1EHKB 1JXGA 4X4KA 3FS9A 4NAJA 4BDVB 4JHVA 2HRGA 1WS7A 1KV7A 4HHWA 4E9XA 4YSSA 2AANA 4UAHA 1V10A 3CDZA 4KO9A 2AFNA 2Q5BA 4BXVA 1B3IA 1TKWA 2WO2B 4ENZA 2PLTA 2QT6A 4BWUA 1ASOA 3AG3B 3S8FB 2GC7C 4HIPA 2YXWA 5E9NA 2PPEA 4YSQA 4HCFA 4BWWA 3T6WA 4A2DA 3T6VA 4A2EA 5D4IA 3WKPA 1JZFA 3TU6A 2H3XC 3QQXA 1FWXA 3FPXA 1WA0X 5B1JC 1PLCA 3QJSB 4UANA 1AAJA 3UADA 1RCYA 2QPDB 1AIZA 2PPAA 1AG0A 3ERXA 5I6KA 1QNIA 5I5MA 2PCFA 2PP7A 2FQDA 1W6WA 2QDVA 3NYKA 2FT6A 3AG4B 1E5YA 1L9SA 1CURA 2PP9A 1V55B 1CUOA 1V54B 4HAKA 2EILB 2IWEA 2XV2A 2XVBA 2J55A 1IUZA 3MBWB 3WI9A 5I26A 3HEIB 1JVLA 3PXLA 4E9TA 1JZJA 1SHXA 3NJKA 2GB2A 2OJ1A 5B1JA 3QPKA 1W8EA 4WTQA 3IEAA 1JXFA 4G71B 1SDDA 3WG7B 1JZEA 2VSKB 3AG2B 3WKQA 2MRYA 4E9WA 5I6OA 1NINA 3PLYA 3OMNB 2DYSB 4KNTA 2I7OA 1SDDB 4P5SA 6PCYA 3FYIB 4YSCA 2FT8A 3JTBA 2FQFA 3IN2A 2H5UA 4AI7A 4G70B 1GR7A 2PPDA 2ZXWB 4KO5A 3WIAA 1SJMA 2MTAA 3SBQA 3PAUA 1NWPA 4G7SB 3IN0A 5I6LA 2E86A 1I53A 1ILUA 1WS8A 5I6PA 1NPNA 1FA4A 1J9TA 3NJFA 1E65A 1XB6A 1JVOA 1SFHA 4A2GA 4E9RA 1ADWA 6PAZA 5I6MA 1PMYA 2GSMB 3U25A 4G7RB 3V9EA 1JOIA 4DP6X 2UXGA 1IBYA 3FPYA 1AG6A 1UATA 3H4HA 1KCBA 4DP9X 2W8CA 5TK2A 1E30A 3X1GA 4DP2X 2CCWA 3NSDA 3S3DB 2IDUA 5AFAA 4N4YB 2ZOOA 3CZUB 2YARA 2EINB 1BEXA 3GYRA 1MDAA 4DP4X 1KBVA 4DP8X 1ID2A 1AZUA 2RACA 1TU2A 1ZV2A 3OMIB 1PAZA 3IE9A 1NDTA 3EH5B 4K9JA 2XV3A 5B7EA 1AS8A 1SF5A 1GY1A 3UAAA 3OM3B 4DPBX 2QDWA 1AANA 5D4HA 4KO7A 3T6XA 4CSZA 5A7EA 4W1TA 3D12B 4JHUA 2AZAA 2WSDA 1PLAA 2B3IA 3NJJA 3ZIYA 4BDVA 3TASA 5B1AB 3FU9A 1SNRA 3S3BB 2BP8A 1MZYA 2HRHA 1AS7A 1AR1B 2PPCA 2YAFA 4WKXA 1AOZA 1EZLA 5B7FA 1NIDA 2YAHA 5EHFA 2ZWNA 5I5JA 1OE2A 3UAEA 2IWFA 4DPCX 2FTAA 1CYXA 2XUWA 3IBOA 3SQRA 3PAZA 1IBZA 4KOCA 2VM4A 3CVBA 1L9TA 2XWZA 1HAUA 1A4AA 2J5WA 4G72B 1SFDA 2TSAA 3ABGA 1KYAA 3FYEB 3GDCA 2HX7A 2IWKA 1NICA 1E67A 2BP0A 4AX3A 1J9RA 4GXFA 4AKPA 4E9VA 2JFCA 2VW6A 4BXSV 2AVFA 1F56A 3L45A 4DP1X 1ET8A 1A4CA 2HLEB 1BXUA 3QJTB 2DYRB 4F2EA 1L9RA 2BP0B 2IDFA 5ANHA 1SHWA 2UXFA 3OMAB 3KW7A 1ASPA 1J9SA 1WA1X 3UGEA 2B08A 1SF3A 2N0MA 2GC4C 2XU9A 3OQRA 2UXTA 7PAZA 5TK4A 1OE1A 2GIMA 3NP3A 2DWTA 1TEGA 1L9PA 2IDTA 1ZPUA 2EIJB 5B7MA 1CYWA 1L9QA 1FFTB 1NPJA 2VN3A 2YAPA 1A65A 4YSAA 3WNIA 2YQBA 4DPAX 3ABKB 3DIVA 1AZCA 2EIMB 1BXVA 1N68A 1AACA 3AY2A 4CSPA 3ASNB 1GS7A 1TEFA 1M57B 1ASQA 1KDJA 1AZBA
chains in the Genus database with same CATH superfamily
2APSA 5EG6C 1NAKL 2ZXBA 3GRWH 3VXMA 4B0MM 1ROWA 1KTBA 3DDGA 4LOUC 1KJMB 5EMYA 2Y9RT 4H0GA 1PEZA 1I85A 2EDOA 2NYYC 2XIDA 1R1CA 1OCRB 3UOAB 3SGKA 3OD3A 4R0LB 2IEPA 1N3NA 3L3HA 3VFWB 3WN5C 3OG4B 3CBKB 1FNFA 4H8VA 4C59B 3WFDL 2MQ0A 4RMRA 5KBDA 1WEJH 3ZXAC 5SWZA 2A74C 3PAVA 4OVUA 1XF4A 3E6FA 4YDVB 3OLIA 4FTVD 4JQXA 3SKJH 2H2PC 3MROB 4PJFF 3HS9A 2XZAH 5GS1B 2PW2B 4YC2B 2MJWA 1AIFB 1DANU 1DJYA 4YDIH 4CSTA 1NJ9B 5E0FA 3KS0J 1Q90A 2IC2A 5D2LE 5D4JA 5E1QA 4ZXBC 4AUUA 4EI5C 4WHYH 5D8JL 2EDFA 4R9HA 5DHXB 1KC5H 2X4OB 3BPCB 5IVZB 5I5RA 1HSBB 5LBVA 2GJPA 5T1LB 4BZ2H 5CILH 3NPSB 5ICXB 4P4RA 4F7EB 5IFHH 3PIQB 1P9MC 1Q72H 4Y19E 5B8CB 3QAZB 3RVUC 3ZKXB 2WTRB 1UCBH 5FO9B 1CZ8L 2I07A 4TSCH 3GXMA 5A2FA 4YFLI 2XDHA 4WW2F 1H8SA 4IBUA 1JPTL 2VWEC 1PX4A 2ZICA 4CDHA 2CDGA 4YXLL 2OJEB 2QFRA 3MODH 3R7QA 5ACLA 4DZ8A 2Z92A 3N1GC 4RMQA 4U33A 4P2AA 4D0BB 4ODVL 2X9WA 4L37B 2H0EA 2X89D 4RFEB 2YMXL 4GQZA 3WY2A 1C8PA 2BW4A 4WQOA 2LU5A 2R9HC 5IB3A 3UABA 2GJRA 1UWGH 4G8GA 3BP7A 5TPWH 3CFKB 3GI9L 3WIIH 1E5ZA 4OCSH 2GFBB 4DJMA 1Z32X 3FB8A 2W0PA 1F90L 4PBWD 3IDJB 3KPSA 3L4CA 4X6DA 4JRYD 3OWRA 4LSQH 3AC0A 1QKZH 5FO7B 1D6VH 3T8XA 1P7KB 2G60H 2IADB 4I3RH 3Q1SL 4GW1B 1JRHI 1I7TA 3C5SA 4NENA 2BIOA 5JO5A 3UH8A 1NOFA 4PH8A 4BCXA 1ZS8A 4ELMA 3CN1A 4XRCA 5C0DA 5BS0B 4A68A 4PJCE 5EOCL 3GMRB 4RNRA 5FGSA 3ZSSA 5AW7B 5EA0H 1P1ZB 2APWA 1IC1A 3KCPA 12E8L 3MJ8A 2JELL 4H5SB 4QWWC 1QHPA 2J56A 2Q76A 3DTDA 4JPKH 5GSVA 5KYXB 3GEWB 5FFLA 3QDGD 1KXTA 5CP3H 1EJ6A 4LSQL 1AI1L 4JG9A 2WLMA 3ROLB 1U36A 5IMKB 2CHDA 2Z93A 3ILPB 4LASL 3NSCA 4L23A 1QAWA 4TLUA 4Z7VE 2VLRD 4IBQA 4NQCA 5FYJU 2IAAC 4FQ1H 3KCWA 3PFQA 3PJSA 4F8QA 1GZPA 43C9B 2X1OA 3MGTB 2O6FA 4DP7X 4DUWA 4GKZB 2UZXA 2CPCA 2AQPA 2BIPA 3VD4A 3RHWK 3MFFB 5DK2A 4N5ED 1I1YA 3QDMB 4U0RB 4WZ9A 2YMXH 2B9AA 2VN4A 4YS4A 3HG4A 4A66A 2OA9A 3SDCD 4F8NA 2O61B 2RQ8A 4ABWA 4P2QA 7PCYA 2O5ZH 2X09A 4I18C 4LLDA 1NIBA 4M61A 3GXDA 4R4BB 4X7SH 2FE0A 3FQYA 3QNXB 5AB0A 2BERA 4IMLB 5CMAB 3RPBA 3HMXH 3SPVA 3FSAA 4JQXC 3OAZH 5FYJD 1UT2A 1NCDH 4UTBA 1Q9LA 4QRSA 4Z5RA 3ARQA 4PJXA 4PWIA 1YECL 5GS2D 3QEQB 1KIRB 4TULH 2GK0B 2CJ3A 3FT1A 2EDKA 2ITDB 2O30A 2FRGP 4A7GF 2ZONA 2ZPKH 1RIVL 2XQYG 1GIGH 1PKOA 4JE0A 2YXMA 2NNAB 3OZKA 1KIUA 3IDGA 2P52A 4HH8A 2XBDA 4FA7B 4QRPA 3QA3B 3T04D 2HX8A 4KKNA 4WHTA 5DO2D 1UZ6E 1AQMA 3RZCB 4J39A 2QMJA 3WFDH 4XO5A 3S5LB 4GAGH 3CVDA 5KSUB 3EFOB 4RMUA 3SBRA 1TLMA 3E1ZA 1RUPH 1LEKA 3ETSA 2D31A 2J8UB 3BH9A 4PLKC 5EOQH 1ZDQA 4Y4HA 4OLVH 4F7TB 2KYIA 1FVDB 1TCMA 1Y6NR 3KDMA 1FCCA 2FIKA 4GSXA 1YPZE 1X6LA 3PWPB 1ZEAL 2ZOTA 3SE3A 5D71H 5E70A 4RESB 5C08E 2R2CA 5CU9A 1QWHA 1A6AA 4U4BA 2E6PA 5AVVB 1CF1A 3WUWA 5A6LA 4KVNL 1GMIA 2BY3A 3ILQC 3VGDA 1JZ7A 2ZOLB 1OY3B 3B9KC 5EBGA 2I60H 4NQQA 3A6CH 2Q5BA 3RDTC 3IDNA 4YN3A 1FE8H 1AGBB 1INDL 2AJXH 1CTOA 1RUML 4N2EA 4CSSA 3VFNB 2PPEA 1U8HA 3S2AA 1J10A 2HVKB 4KI1A 4LHUB 3K71B 1UUSA 3KYNA 5BV7B 3FH8A 4HAGA 2CUHA 3QQ4B 4OLWL 1UADC 2N3JA 5D4IA 5DUBB 1XTLA 4A2EA 4F15C 4ZX3A 3BSZL 3TU6A 3QORA 4RGNE 4NYLA 5E2TH 4MQ7A 1J8SA 4LVEA 3U7YH 5AZ2L 3K3QA 4O2EB 3DX2A 3HHMA 1EHAA 1R3IL 2AV7B 1RL1A 3U4BL 2YD0A 1AAJA 3CK0L 2I9LB 2IH3B 3BMWA 4APXB 4XBGB 1O5DT 1Q4NX 2WLYA 4XBMA 5CN3A 3C5ZB 3V6ZA 4Z7QF 4MNQE 4YNYB 1CGVA 2TAAA 3BT0A 3MRKA 4P4KB 4P07A 3WMQA 1P84K 2VXVL 4UOW1 4PRID 1G6RB 1IM9A 2X0WA 1R5WB 4LSPH 2DQJL 4EUPG 4AYEC 3MUHL 2PP9A 1T20B 1I3GL 3DSNA 3MGOB 2CUIA 2P5WE 1YSOA 3M17B 2XVBA 3L7FB 2QELA 3WFBL 2NCEA 1Z3RA 1EXGA 2CCVA 5I1EH 5F3BA 1JZJA 1ADQL 1XF5A 3K0YA 4WO4C 3RWFB 5K5YA 4NZJA 1UM6L 1I1FA 1YDPA 3EKCA 1BX2B 1VESA 3O6MH 4PGBB 4F24A 4A7VA 3QQDB 1KCUH 5DVPA 1HHJA 2QKIB 3L3IA 3B9DA 1LK3L 3DVGB 3IJSB 2XRAH 3O4LD 2I7OA 2H3NB 3VFRB 3JTSB 3MRPA 1NCAL 1JI1A 3CQFA 4P5SA 3T0WA 3FN0H 2CKBH 5HHMD 2NY1B 1FYTA 3H8NA 3FYIB 3IF1A 2F61A 4YFEA 1VGEH 2F58L 5F9OH 1U93A 1JG9A 4X6FB 3ZT5A 5EEYA 4OZIF 3ROOA 5FOBA 5F3BB 4YHIB 3MUY1 1BOGB 3K8KA 5DZPA 3RL2A 1QVOB 4JM4L 1FRGH 5JOEA 3STLB 4M8VA 2WLHA 1R5WA 5HDOA 1N0LA 1U95A 4QJ4B 4L8DB 2E8YA 4NCC2 4ZUUA 4PWGA 4XMLL 1KPUA 1XCQB 4N0RA 3ARDB 2QGDA 1G7LA 1DUZB 5C0CD 4CMHB 3ULVL 2IH3A 4H1LA 3RY6C 4AGLA 2P8LA 5KVDH 2VKWA 3PUCA 5C0IB 4PRIA 4MQ7B 3CFJB 1E30A 1OARL 2YRPA 3HE7B 5IQ9A 1LEGB 1XT5A 4LCCA 1IGTA 1A5FL 5BVPH 5H94A 5D7IB 4S0HA 1BZEA 4K73A 5AFAA 1YHPA 5HDBE 4GQ9L 3SIKA 3DO4A 3AFLA 1AD9A 2VUOA 2EH7H 2PABA 2DIJA 4K4KA 5T5FH 3FONA 5CO1A 3F7RA 4UU9B 3RUGA 3CN4A 3HZMA 6FABH 3QEHB 3GBEA 4X9IA 1E6OH 3EH5B 3VCLA 3OHXC 4HXAH 3U0PA 4JCMA 1DQLH 1QPKA 1TXKA 1SN2A 1NCHA 4K07A 4K7PL 3CLFH 3OM3B 1AP2A 1MJJA 5T3ZL 2IANA 2AQQA 2JKNA 4HIEA 2ZTBA 4W9HC 3VXNB 3T6XA 4O4YH 4JPIB 4OCRH 1MVUB 1B4TA 3MRHB 4FYTA 2Y22A 1V7NH 3CPLB 2UY6B 3JT0A 4H8HA 4U3SA 5GGTL 2F74B 2PPCA 3RTLA 2AJYH 3IDMB 1O9WA 3LVEA 1T5XA 3IAPA 4KX9A 2E27L 5EHFA 3DSFH 3CN3A 3P2DA 1N4XL 1OAQH 3MOQA 4YHOH 1IEHA 1Q0XH 3BD3A 2FECL 5EIIG 5D7EA 2D0HA 2X9XA 1J0HA 2WXPA 1D5MB 1JWMA 3FCSA 4TPRH 2X4RB 1C8QA 3HZ3A 3GDCA 3LS4H 4HIJA 3VXRA 5JIPA 5ALBL 3R1GL 2HP4A 5J12C 4OZIE 2RB8A 2X3BA 1C08B 3G5ZB 1U4EA 5DS8B 3O3DB 1FNEA 4CMMA 4Z3TA 4WIQA 1XF1A 3TWCL 2WNKA 5DA0B 4CC4A 2BHYA 1BFVH 3ULUH 2ESVB 4DP1X 3F7QA 5F9JA 5DHVB 3SCMC 2XYCA 4HIXH 2CZNA 3OMAB 1VZGA 1Q9LB 2HFTA 2KLSA 4NC2B 2CLRA 3MJ9H 1FP5A 4XODA 2P8MA 4A2MA 3VXUD 7PAZA 5LWYL 3MLTA 3B5GA 1KBKA 3LDBB 3WHXA 1CFNB 1CR9H 3CFEB 3RVVD 5GGSA 1X7QA 4OFDA 5KS9B 4LLDB 1NMAL 1Z5YD 1BVKB 4N6RA 4DVRH 1H0DA 4LKXA 3MOAL 5IQMA 4H1LH 5E4EC 5JHLH 1G4RA 3HFFA 4HQQH 1BGXH 2XY1A 1IC5L 3NACH 4WW2A 3S5LG 3VFGH 1WPCA 4NOFA 3BP5A 4MNGB 3MLUL 1K9TA 2Z64C 5B4MC 2UYLA 4I3SH 5MENE 3BSHA 3IJ7A 1N12A 3ZDWA 3L5JA 4XGZA 3TV8A 2VDMB 1GOHA 3OF6A 5KJRL 4GKZA 1Z3GL 3LRKA 2UZIH 2ZX9A 1D7DA 4I4WA 1PDKA 2AQSA 4LP8A 5BVJB 1QFPA 4EN3A 1TQCC 2HT3C 3BUYB 3WNKA 2PKDA 2YQGA 3AW5A 3HLKA 3RKPA 1M42A 4Z0XA 1NLDL 3HBQA 4BQ9A 3TFKC 3MTRA 4G8EA 4JFEA 4QLRA 4TF4A 5C6TL 1I9JL 1JNJA 3VE0A 4YFDB 2WYHA 3E8UL 2VO5A 4WFFE 4E5XG 3ZKND 2DH3A 1RJCA 5E6SB 1E4XL 3FQTA 3IBEA 3VGFA 2V7HA 2YPKB 3RJQB 3TH4T 4JDVA 4NSKA 3NN8B 1FVEB 4KNSA 1WCBA 3Q7JA 4IRJC 4J8RB 4PJHE 3E2HB 2J1ZA 4MX7B 5EZLA 4DT2A 4PB9H 4PLJC 3OB0K 3JWNE 4LOFA 3U6RA 2RAMA 5C09E 3IDXL 1IKFH 3FUJA 1GS6X 2NYYD 5D7SL 3MOAH 1CGSL 3RRQA 4X8GA 3JZYA 5FB8A 1EO5A 3P0VH 4UIMA 1NUNB 2IAMD 1DFXA 4GEIA 1XB3A 5I1DB 3T0AA 1MFNA 1UYWL 4WNSA 3HNTL 5D7KD 4ACTA 1HXYA 3KPMB 3QFDB 3TYGH 3BGFB 4PJDB 3QAQA 2WBJC 2P5WB 5GGQL 3L3KA 3T4AA 5E5MB 1DBKL 2IXQB 2DM4A 4HJ0D 1R5IA 5FC9A 2JB6A 4PS4L 2JLPA 5CS7A 5F7AA 1RK1B 5J12B 3LN9A 2C9SA 3HI5L 2OPCA 3X12A 5B8CA 4M00A 1I8LC 1SLXA 3ISYA 4P4RB 4XNAA 4CBZA 2VN5A 3DOIA 1T2JA 1MF2L 3NRPA 1KBGL 2MH4A 5IVZA 1S4IA 2BRRH 3FN9A 4ZOEA 3H9YA 5FF6A 3FT0A 2BSTA 4L3EE 4Y88A 4TVSa 5L7XH 1NBQA 4UT6A 1LYQA 3FL7A 3RDTB 4AEIH 4CN4A 2HMID 4FDWA 4JHAH 1RLWA 2UV3A 1A25A 5C0NC 1NGYA 4GKNA 4Y9GA 2FJSA 5LNDA 3OAUL 1H5BA 5HGGS 1LO2L 4QYAA 2R0LH 4PJ8C 2JXMB 4XN7A 1CL7L 2Y1YA 3MRBB 3JT2A 2W0FA 4L3EA 4AY0A 1G7JA 1KYFA 4ZOBA 4MFHA 3ARFC 4NB7A 1D6VL 2MKWA 4R0LA 1MH5B 3WIHL 3EBHA 3P40A 5GZNA 4YSEA 5JOPD 5I71B 2VR8A 5EO9B 1BQHB 2PWGA 4AQ1C 2BP3A 2WCSA 4EQ2A 1IGCH 2J6WA 3MV9B 5DJAA 1XGPA 2BVPA 1KCUL 2JCWA 2XN9D 3AVEA 3QCVL 5CZXD 1L5GA 5KG9B 1RZIB 5F88A 2L7EA 1KULA 3AUVA 3H6JA 3EYSH 4OZGA 3WGUB 3IGKA 4ODVH 35C8L 2RR3A 3O3UN 1U8OB 5I1KH 1K72A 2VAAB 3IMSA 1OLZA 3ARYA 4YDJA 2BSTB 1B0GA 5BCAA 3BP6B 4OQTL 1ET7A 4DO5A 3V0HA 3IMBA 2WXQA 3V0VA 3L1EA 4G7QB 3QO1A 3UEZA 5HGDA 1T22A 1QSFA 5CD5D 4ZD3L 3MLZL 5CEYA 4XMZA 3VTMA 4RMWA 1AY1H 5DURD 1T4KB 4DZBA 2CRMA 4L9LB 1WFTA 3BAEL 4NWUH 2P5WA 2QKIC 1BLIA 4PLOB 5LG6A 2F8IA 1KLFB 4AJYV 1IFHL 4ZFFB 3TT3L 4B9IA 4QRFA 1T7WA 5G55A 1UZ6F 1YJDC 2XQ0A 4KUCF 3FTWA 3IDYC 5EUOE 5TDOA 4JRFA 3W39A 3VX1A 3OVUB 4F91B 3FMGH 4HGKC 2HRPH 3RB7A 4U1MB 4A7UA 2NY2C 2QLVB 3WNJA 3P69A 1S9YA 1ESOA 2BVQB 1MPAL 3EO0B 3LV3A 3RY5A 3LVTA 1F8TH 2WLLA 1C5DA 2XACC 3OR6B 1E2ZA 4JFXB 1A1OB 3K6IA 4JFSA 5B3JF 2HFFB 3G5XB 1ZDSA 3QWOA 2JVUA 3SSGA 5FCSH 1P2CB 1R19A 2F1BA 5FGBA 2JIXA 4HKXB 3IFPA 5C0JB 2WWKT 1MW0A 5H4ZA 2VSCA 1BD2E 1QI5A 1BIIA 4JRYB 4X4KA 3FS9A 5I1JL 2P1YA 1M4KA 1TTBA 2CO7A 2ZUSA 4JHVA 3SE4C 1B88A 1MJ7H 1MWAL 1HDMA 4N25A 5JQ6H 2UZIL 5BXFA 1MHCA 3EJZD 1XGZA 4UQ2B 4Z95L 1JL8A 2Y5QA 4KHXL 5HY9B 1IEAA 3S4SB 3V4UH 1B3IA 4WU7B 1IX2A 3HMWH 3K1DA 4CA4A 3N43B 1I7RB 3F5WB 4PGEA 1E9PB 5DJ8B 3V0VB 1FZKA 4HIPA 4FQCL 1WHOA 1IGMH 4FP8H 3V7AE 2X41A 4PP2B 4HCFA 4FX5A 2IGFL 2N7AA 1TNMA 5E8OA 4ZJ9A 4ZMYA 1AYOA 1BWMA 4FNPA 2R69A 2Z31A 4O51B 1FDLL 4YUEH 4ETQA 5GISL 4PJXF 1FHGA 4B9KC 4H4NA 2D7QA 1DQJB 4RBPH 1WIOA 4UWQB 5AOZA 3SJVE 5L2JB 5B1JC 1DDHB 3NESA 4N1HB 2AQ2A 4UANA 1ZVNA 1OP5K 5E00B 1SJEB 3GGWB 1RCYA 2FWOA 2PYEA 3KG5A 4PJ9A 3FU5A 4DH2A 1YYLH 4D0DB 1EZVY 1N59B 1Q9KA 3DI3B 1MCHA 3KDPB 5EO9A 2CLRB 2YEQA 4G6AC 5I1HH 2IPKB 3Q8BA 4PUBH 1BFSA 2H9GB 3MA7B 4MAZA 4XR8C 2ESVA 3IAQA 5HHXH 3GBNL 3WYRA 1DL7H 2GJJA 4OGYH 5C0RL 2ZXDA 1V3LA 4JRXA 3D0LB 5DS8A 4OM0L 1A4KB 2VMCA 3WI9A 2X1XR 5JHLA 3C8KB 4PJAF 3HOGA 4AEEA 1BM3L 1IARB 2VE6B 4TNFA 3SGJA 3MBXL 2C9RA 1AFVH 1KTRL 5LAXA 3IRZA 4V1DE 4ANVA 1KNOA 2PTTA 3SB3A 2XN2A 3QR0A 3G08B 1DBAL 4XNXH 1SDDA 2J6EA 1IGCL 2VSKB 2WINB 1MDTA 5FF6B 2F19L 1LE9A 1AO7B 5L88L 4YE4H 4YMPA 3RVTD 3DV4A 4HETA 5HDRA 4HFWA 3CSYA 5T3XE 1MFMA 1KXVA 4NZRH 2IPTL 2WTPA 3HBGA 3W81A 3SGDI 3IRCA 2HMIC 2E8ZA 4ATTA 4FFZL 5D1XE 3NZHH 4PJ5D 3LB6C 1TO4A 1ZHNA 3F7KA 1A6TA 3BKCH 1J12A 2ZUQB 4KO5A 5E5MA 2EICA 2DTMH 3L7EA 1BP3B 5GIRB 2O4EA 2Z8VC 4YBQC 1QO3A 2ICWB 2X2UA 3N44F 3QZPA 1Z9LA 3HMXL 5KBNC 3L16A 4RFNC 1H3VA 4XPTH 2C3HA 3GSVB 5DURB 1EZVX 2LU4A 4JDTH 1LM8V 4KDTC 1FORH 4RGNC 5FYJE 4Q52A 1DLHB 1W72H 4L48A 2B1OA 1O7VA 4QI3A 4X4XB 3QIUA 4B7LA 1D5XB 1RERA 3TT3H 2GIYA 2H26B 2Y3NA 3L4XA 4QRRD 3Q8FA 1KCBA 3V79C 3I50H 4F8TA 2R2BA 5T5NF 5LB1A 3V6OE 5GZOD 4L0YA 4Y4FC 3WTWA 4DP2X 2CCWA 4PGCA 3S3DB 4Z3GA 1WAAE 3HHRB 3BLKA 2AJ3B 2MCMA 5DO2C 2EO1A 4HDIB 4OLUH 4WGWB 3CZUB 2YARA 4LBEB 4AYMC 3OX8A 3KGUA 3QUYC 3VI4E 1GH7A 5D2NA 2P42B 4AC4A 2VC2H 1MDAA 1F86A 4LHUD 4DP8X 1F18A 2PWFA 1ZV2A 3L3DA 4Z0XB 3HVNA 3HNSL 1G7LB 1G7PA 1NCWH 1TZGL 2DQCH 2H7WA 3WS3A 4FA6A 4J28A 2DDQH 3QEGL 5E1AB 4PJGB 2X6UA 3NH7H 5F7MC 1I8KB 3CN2A 2Z8SA 3OKDA 3B9EA 2HT4D 4X9FA 1WZ1H 2Z4TA 5DSCB 1DO6A 1JNLL 1HQ4A 1R3HB 4FEIA 4W1TA 3D12B 4IBWA 4AGOA 1JCVA 1KJ2A 4D9LL 1SHMA 1DN0A 1NGXA 5M94B 3PXHA 5FOBB 4MNGA 1D5IH 1E0OB 4KMTH 1MCQA 4XVUC 2VDKB 4PJAA 2HRHA 2HFEB 5A2IH 3TJHC 1J8HD 1OT1A 2V3FA 3HS0A 5AW8B 4WKXA 2YLHA 3T3MF 2QQQA 5D1XA 4HJGB 4KY1L 4XPGH 4MMXC 4X6CE 2FTAA 1QSEA 3ALPA 4L4VB 4QT5A 4ZS7H 2X2HA 3ARVA 4Z8FL 1WT5C 1EZUA 1I75A 3OGOE 3LZPA 2XHNA 2WQUA 1FVCB 3AT0A 4G72B 2P8MB 4M6OL 4BZ2A 4HS6A 4N3TA 4BA0A 4QXUL 1I3RB 4PB0H 4NUMA 4A6YH 2OKMA 1BBJA 1I1AA 2BJMH 3BH8A 3CHSA 4EN3C 3HZYA 5E6IA 4YX2L 2Y0SA 4PJFB 3FHEA 4TRPH 1GTFA 3F58H 1AGFA 4HZLA 1U9KA 5DD0H 2XN9B 3S3SA 5JHDE 3QWNA 3BDXA 4ZYKA 5IVXA 2AK1H 4AYDC 2GC4C 1QFHA 4YNYA 2FWUA 2UXTA 3FT2A 1DVFA 4RRPA 1E28A 2F7PA 5KUMA 2Y2WA 5B7MA 4NN7B 1PFCA 2KMWA 4PG2C 4CADB 2NY3D 1PJWA 1NDGA 4MBRA 3CSFA 2IGFH 5HYIA 4W81A 4FJYA 4OLWH 1HILB 1NUDA 4KK6C 1QASA 2DMHA 1KPVA 1U8PA 1ZMYA 1U21A 4OFQA 3RJDA 2HVKA 3F04A 3L54A 4BKLB 4XE5B 1MHEA 4OVVA 2HUHA 5JW4Q 1OP4A 2QHRH 4MS6A 3L5WA 4ELMF 1VPOL 1AGBA 2DLIA 1E4XH 1NCNA 3TF7C 3IJEB 2VC2B 3DX4A 5BRZB 1QHQA 3T2PA 4ANXA 3WEXB 1RZKL 4J1UA 5GRYA 1EHLH 2WXMA 2EVIA 2VRKA 4FFYL 3WJLA 1XGTB 2EEBA 3O6LH 1Z0MA 2C7FA 3L13A 5LBSL 4P0DA 2NSQA 3EYFB 1D5ZA 1JYWA 3BX7C 3UIZA 2CNYA 3U4AA 5KJRH 3D2TA 2ETWA 2HA1A 3GZPA 1CJYA 2VRAA 1CZ8H 1C12B 1TJIH 3ET9F 3FSVA 3KHQA 1Z66A 4FFVC 4TNWK 3QK0A 2CR0A 4G6KH 5EOQL 3TZVC 3W9DA 1E8WA 1OW0C 3PQYA 1RHHA 2E7LC 4HWZA 3WTVA 4GUOA 1HEZB 4GG6F 5C0IA 3UO8B 2BNUB 4H13C 5EF0A 4YHYC 2DKMA 2NRDA 4G3YL 3IDYB 3J8F7 3OKNA 3WMPA 2VDRL 2BNRE 3GSNH 4UIKH 4D0CA 4PRHE 1JPEA 4UNVA 4FZ8H 3O6KH 5DJYB 2J1XA 4F1ZA 1KPUB 5FM5O 1X6NA 2KZWA 4KHXH 2E56A 3WTXA 3BDBA 3CWGA 3GSOA 4WCYL 5F7BA 5D5MF 3QXDA 3ZYJA 5I5IA 2LABA 3E3QE 4LDLB 4L4TE 3BD5A 3HZYB 1IFGA 5E6IB 1D2PA 3LNIA 1C5BL 4ZUWB 4DN3H 2WLIB 1I1AB 2Z1KA 1GSKA 4RDQF 1KGIA 2A9NL 2B1AH 1S5HA 3ZZLA 3MKKA 4X6FA 4NQEA 3BSGA 4PMEA 3PJLA 4BFOA 3RWJA 3IF1B 5G4NA 1GKOA 1OALA 4JM2B 5E9DB 4X4MA 3L2LA 4IMLA 5CMAA 3RIKA 1OT4A 2H3NA 3KWTA 4BFIB 1S7VB 3BKJH 3NVQA 4OJFH 1ZIBA 2ZKHL 3V5HB 4Z7NB 1PY4A 4BKTC 4YHPB 3EHBC 1OZUA 3WAKA 1XGYL 4I18B 4DGYL 1E5BA 4L3CB 3W38A 1XF5B 3RU8L 3ZDYF 3EOAB 4PJBF 1J5OH 5D96B 2WGNB 3K2MC 5AZUA 4R6UA 2X88A 4GKOA 5DMIL 4GS7C 2TSBA 2RFXA 5F9DC 3S97C 2I7SA 4IOFC 4ODHL 1ZLDA 2R0ZH 4R7LA 2ADIB 5L8KB 2AW2A 2YS4A 2C3VA 4R7DA 5C0GB 4QRPD 1ZK9A 2A6KA 3H42L 1EUTA 4ZFQA 1YNLL 1JJUA 4X98A 2P43B 3HC2A 3KLAB 1W72L 4BWTA 3WS3B 2LTQB 1EFXB 1CFTB 1YG9A 5EOCH 1L9MA 4S2SA 2LLNA 3O4LE 4HP5A 4ZFOB 1BOYA 1XMEB 4KI5C 2WZ0A 4DK5A 4XT1C 2BSDA 3ZL4L 3GB7A 1ZIAA 4KK5C 3MZTA 2CJTA 1KSRA 3V4PL 1FAKT 4G7VL 2IPTH 3TO4C 1TDQA 1Z6JT 4LPCA 1P7KA 3W0WB 1OAQL 4KFZC 4YHOL 1HN1A 2GT9A 2E7LA 4FTVB 3DMMD 4QNPE 1T2QH 2ZYSA 4PQXA 5T1JA 1EGJL 3O8XD 1INEL 1DO5A 3NFSH 3QHFH 4EN2A 3VI4A 2LLLA 3WKMH 3E8VA 4HCRH 4XPHH 3V4PH 3RX9A 1P5VA 2IGTA 4JRWA 2ZX7A 3MCKB 4WI7A 2X9ZA 1BJMA 2A6JA 3IE4A 4K2UH 3R4DA 2GG1A 1G5AA 2K0RA 2DW5A 3OKYA 4ONFH 2H6UA 5BJTB 2DQHH 1VA9A 4JG1H 3CDYA 4UAOB 3UJJH 3H42H 3TO4D 3QORD 2Y1VA 3MV8E 4Y4HB 5FWRA 3BH9B 2HFGL 1F97A 3ARZA 1FGNH 2EE2A 2W9DH 4KQ3H 5C7ZA 4HMDA 1NCBL 4E9YA 3TPUA 4MXVE 2HVBA 2EH7L 3BPCA 4FNLH 1N8OE 3CHPA 4N87A 4A67A 5JIMA 3O2DH 1X9UA 1HOEA 1NJ9A 3GEFA 1WICA 3L1GA 5LDSA 3MV01 2I9TB 4WI4A 4A2HA 3BAWA 3NCMA 4FQHA 4IRZL 4Q6IC 5KOVC 5I30L 3L95A 5EIIA 4M7ZC 4ELDA 2HRGA 2X7LB 5A6IA 2WGXA 1RZJL 4X8CA 4O5LL 2X4TA 3U2JA 2YMTA 3N40F 4PI2A 4ANWA 1SXCA 3U46A 2H9GA 3MA7A 2AJVH 4L29B 3RHWF 4PJFE 4FXKB 3BUTA 5B22A 4Y2LA 2V7NB 5F6HI 3OKMB 2E6QA 4BEIA 3IRPX 5KYUB 1LE5A 5E08L 1Z5HA 4P05A 4DQOH 1QG3A 1GPOH 1ONQA 5GGQH 3S8FB 1RXLA 2BVTA 4NNYA 5CJOL 5JIHA 1H8LA 2ZCKL 3LCYA 2FGZA 1MQ8A 4IM8A 2VXVH 3KPRE 4NNPL 2Z1PA 1FGVL 1KT2B 1PQZA 3FCTA 1CI5A 4O51A 3S96B 4ZUVB 3KH4A 5JW3L 2B59A 4U3XA 4MMXA 5LQBH 2XFXB 5CIPH 1FZKB 3QJSB 2VDRH 1OKEA 1KG0B 1OPGH 3QUZC 1IKFL 1LWRA 5DJ8A 3K72A 2HG5B 2IPUK 3L4UA 1AGDA 4WU5A 2X0UA 4I2XB 5I6KA 3VI3F 5IFJB 3GMNA 1FL3B 4CVXA 5DMKA 2VLKA 5I24A 5I5MA 1VEMA 4AE1A 3BUDA 4G6ML 5DLMH 1LHZA 4P5TB 4UQ2A 3VXUE 2Z93B 3ILPA 2QGEA 3L1FA 2VMFA 1J1PL 1YAZA 1V55B 1CUOA 3QHTC 5L2KB 3QNFA 5AVUB 3KVDD 4NPYA 3ZY7A 5CCHE 1F4YH 5D7JB 4KKBC 4OSUL 4XP9L 5DVLA 2LW3A 2GJZB 3RB5A 4LB8A 5KSVB 4Y9BA 4OFYD 3T0ED 3NJKA 3HKFA 4FJZA 2J1KA 2I60L 4ELMB 1QEXA 1LNUB 1W8EA 4PYGA 1U8QA 4G71B 4X50A 2FZ3B 1UB6A 2X4QB 2JCCF 4JGUA 2V8LA 4NS0A 1EERB 4L3AA 4JUSA 4U05A 4L1DA 4TQIA 3PWLA 3ZSTA 5DS1A 3MV11 3OMNB 1DL7L 2FDBP 2HFFA 2N01B 4Y19B 3OXSA 3FCUB 5ESVB 1Z5LA 3WELA 3MPCA 2H3KA 2CSPA 4ERSL 4JX0A 1HHKA 4PY7A 5C86A 1W2KT 2V2WA 2F7RA 2OSYA 3O2DA 4IRSD 4UZGA 4MNQA 1CQKA 1M2VB 2WB7A 2R0LL 5TH2B 4BFKA 2D7NA 4RFEA 3AY4A 3R18A 4MAYB 2B2XL 4CN1A 1VADB 3KXFE 2X6BA 1N67A 3FT4A 3SE9H 4XP6L 5C97A 5JXAL 4FTVE 4HPHA 4A7SA 1AHMA 5I6LA 1J5HA 2E4TA 3HMXA 2CJSA 2G5BB 4P5TA 1OP5H 2DI9A 1JPST 2AK4E 3AITA 4P48A 5EU5A 1E5UI 4XO8A 1LDPH 1XB6A 4MCZA 5EPMA 1JVOA 3PQYD 1XEUA 3HG1A 2FX7H 1QSFB 4U2YA 4ONHB 5HHOA 4J6IA 2ZX6A 3QEQE 1INQB 2J72A 2NZ1A 5JDJA 1KG0A 1FO0H 3PHSA 5CJ5A 4MJ5A 4Y5VA 1Z9NA 1IAIH 5IWLC 3FPYA 1VIWA 2CM5A 3K6SA 5CZXC 5E6UB 5AVTB 4DP9X 4ZOCA 3MXWH 5BO0D 4Y2DC 4NQEE 1J0ZA 2UVEA 3GS7A 1JHTB 1SQ2N 3VNZA 3ZE2E 3NSDA 1KGCD 4CBPA 2HT2C 1B4LA 1A21A 1A6ZA 1HT6A 3HR6A 1XXDC 3K8MA 4APQA 1XGPB 3L4VA 1IILE 1G1YA 1EA9C 3BIKA 2AMUA 1SPDA 3HUJF 1NDTA 4JZOB 3S48A 2DMKA 2ZE0A 3IGLA 2NW2B 4XMKH 1IKNA 1I1AD 3VWKB 3RIAK 1QSFE 2IAMA 5ABAA 3V6FA 1TSRA 3QYMA 2IFGA 1KTDB 3VG0L 4KY1H 2BNRA 4BFBD 4FFZH 3U46B 3O3BA 4R2GC 2LR4A 1NCJA 4PVNA 4PW4A 5KSBB 2FEJA 3AS2A 4JHUA 1JTTA 4M1DL 4DOHB 3NJJA 3RFRA 4BELD 3VXOA 1JK9A 5JMRA 1CK0H 4YK4C 2YEVB 3EYOA 4JHZA 5KBMA 3GO1L 2HJLA 3TVMD 1RU9H 4HT1H 4HD5A 4DGYH 5SX5H 4MJIE 2Y2YA 1OE2A 3UAEA 1CYXA 4F8OA 1QYGL 3ULVH 3FO0L 3BGFC 4JJHA 1EEYA 4ODHH 2C1PB 5IV2B 5I1IH 2BPBA 1RK1A 2DEWX 2IWKA 1MFAL 2DBLL 2L4OA 4HC1L 4QHLA 1J9RA 1R5IB 2ISDA 3IKCA 1SBSL 4IS6B 4LSVL 4F1SA 3TURA 4KNQA 4ZQTA 3AS3A 2A6JB 3EFFA 4AYGA 4Y1AE 4TNEA 4ORGA 2DQ6A 4JAMA 4N5EC 5D7HA 1T83A 4PVMA 2EDLA 4MNHA 4PHXA 2HJKB 4MJIB 1M6OB 2XOTA 2B08A 3GSNB 1S78D 3NH7L 1DQKA 2MEJB 2XVLA 2GIMA 3EXLA 3FFOA 4FMFA 2NUPB 2YJQA 3ES6A 5DUPH 1S7RB 4RFOH 5IFHL 3RNQA 3T2QA 4YLQT 4PRAB 5IB5B 3WNIA 2CO1A 1CF8L 1CK0L 1EHNA 4K5OA 3TN0D 2J7LA 3GK8H 2LTQC 1XGRA 5DHVH 4MZ3A 3UTSE 5JPNC 1KDJA 3A4FA 4EE2A 1TZHB 1BQRA 4XCEA 5IUCA 4LSRH 1A7BA 1ZSDA 2FJGA 5DRXA 3TNNA 1YN6B 1NAMB 1AZVA 4R8WH 3VO0A 2MPVA 4ZAKD 3DJRA 4OLYH 4ZDHB 4I88A 4OR1A 4ES8A 3S8GB 1IGYB 1XR9B 2HKAA 2YPVA 4HMCA 3VG9C 3ULUD 1T6VN 1LQBC 4XNQB 3Q2WA 4F92B 5BVJA 5KSAD 1Y1UA 3CC1A 3QYNA 1SVZA 1GTNA 1ZXQA 1CGXA 5JPMC 2J2ZB 2P44B 1XSIA 4NI3A 4POZD 1UOKA 1DVQA 3QUKA 3RZCD 1A1NB 4JZNA 4OIFA 5C0RH 5I0XA 4I0PA 5F97E 1F4YL 2D3JA 1PX3A 2FX9L 2UYLB 1GCYA 4H8UA 2IQAB 3UC0L 1URIA 1LWJA 1Z3GH 3BGMB 4FQJH 1PW3A 5ISZE 3MRJB 3X3FL 3VFOA 4OUUB 4WW2B 1WC7A 5E95B 2O6EA 4MZ2A 1OAJA 2NUTA 1KJ2H 5FFOA 5KS9A 3D3VA 4BFIA 5KBPA 2OYKA 2B8OT 4ICXA 1L6XA 1ZAGA 5MENA 4MMYB 3NUKA 2DV6A 3RWJB 4XNZC 2C7UA 3TESA 1HZHL 2UWEB 2XWTB 1AXTH 3PWJA 1CXFA 3GK8L 3JV4A 5CEZD 1W80A 5KVEH 5C3LD 3WTUA 1JDDA 4KQ0A 3SHSA 2WCGA 2R1XB 7TAAA 5GZNC 3D48R 2CLZB 2AQNA 2R1YB 3DVNA 1AC0A 3V4VH 5IEKA 4CJ1A 3QXTA 1R3KB 1T3FA 2ALWA 5TE6H 3F65A 4YVNA 1DHKA 2R4RL 4NKDA 1OAYH 5J6HA 1S3RA 3O4OC 3RDJA 1USQA 2J21A 4OZFA 3HRZA 4WWPA 4AYFA 1GHFL 5CBAB 3JTTA 3M8OL 4C56D 3OKNB 4KRPB 5JA9A 4M4RB 1AZRA 2M26A 4LLMB 2BNUA 5HPMA 4MS8C 4XC3H 3LMJH 1GVIA 1UWEL 4KV5E 4NHCL 2A83B 3TFBA 1T5XB 2N7SA 1XD1A 3NJHA 1M56B 2YOCA 3DUUA 4BKSC 1AQKL 2AJYL 1RMFH 3MLRL 3N42B 4Y1SA 4ZSOA 5KJ4A 3SDAB 4LHUG 4H1LG 1LO3H 4Z18A 4WI8A 1U8IB 3F12A 2D7MA 4KTEL 2PYFB 2VZ3A 5JZ7C 4LCWB 3F6IA 1YN7A 1ACYL 4NPJA 4PJBA 1A3RL 4M1GH 2OI9B 1IQWH 1TQUA 5L0QB 3HS8A 4FADA 3N3EA 4PWHA 5D7LA 4M29A 4ZUTB 4Z7OB 2K7PA 5I8CB 2JKXA 5F6HJ 1K5NA 2M2DA 3G6DL 2BWDA 3TBSB 4GBXD 2X3AA 1KGYE 3RKDD 1NFIA 5JIQA 2W9EH 3PHOA 4AMXA 1MI5D 3R0NA 1HHGA 3NJMA 2Y72A 4AMKH 1VJSA 3V8CA 3FONB 4G7YH 5EOTA 1LO0L 3F12B 4BKLA 5L9DL 5J3HD 1OHZA 3DX6A 1RUAL 4M43H 1KPVB 4LP4A 3X1EA 4JJ5A 3D7PA 1VFUA 2GJ6B 5HHMB 3AU1B 2J43A 2OL3A 3HE7A 4QY8A 4IEFA 4I48A 4B9CA 3P11L 5JQHC 4KZEH 3CFCH 4CILA 4XNUL 3BW9A 3VGHA 4MJ2A 5D72L 3VWJA 3QC5X 2D03L 2DQFB 4P99A 3N1PC 4CVZB 1ZPLA 3EGSA 4NO5A 1I8UA 4ZYKB 3K2UL 3O0LA 2Q6WB 5IVXB 4Z9KB 2KZBA 1OF2B 1U91A 1F8TL 1SOKA 3BQUA 4P3WA 2WXLA 1FL6B 3CCHA 4YSPA 2WPGA 1HE8A 1CXIA 32C2A 5JORB 1IKNC 4Z76A 5MEND 5D72H 4GUQA 1RPKA 1NLBL 2VABB 3NCFB 4XNZB 4EMZA 3ABMB 2J71A 4FLHA 3O6FB 3ML8A 1A8JH 1KB5L 5JW5B 4MD0B 4NQDE 1PZBA 1FYTB 3CIAA 4WDIA 3HC4H 3GXPA 2H6PB 5D2NC 5CXPA 4RWYH 2OYPA 3WD5H 1D6EA 4UT6H 1NIFA 5HGBA 3D3VB 4MB4A 5FDWB 3L3IB 1XCTB 4DKFH 3WFEH 3FUDA 4LCYA 1J5DA 3FFCA 4AQAB 4RFNB 1DEEA 3SJVB 1MCOL 3ABLB 2ARWA 1LLAA 1MCPL 4HCGA 4JM2D 5F8RC 2P80D 2NTFA 4OLXL 4JFVA 2QADD 4XBEL 3TN0C 4K7PH 3BGMA 3G5YB 3SY0A 4V33A 2OR7A 5CUSH 3FB6A 4JQVC 1UACL 5EUKA 1KJ2B 4HLZH 1MQKL 1WE5A 4KI5E 4YSSA 4YHKL 4WK4B 4AVKA 3CJJA 4UAHA 1T20A 2P9RA 3ZMRA 1XDTT 2YWZA 3WEAA 3MRNA 3RAJH 1J8HE 5I73B 2CO4A 1T7XA 4DCQB 3MYZA 4ZX5A 1IGYA 5LBSA 5FCUL 4K7PX 5FW8A 1UB5B 4GI8A 5K93A 2OTUA 5I1CH 1U3HD 3LTVA 2A4CA 3TYGL 3T4YA 3QWRA 1U58B 4DN3L 3ATFA 3APNA 4OAWA 4FGMA 5E9NA 1SLUA 3BWSA 5EU3A 3WN6A 4HDIA 2WNGA 3V8OA 3RFZB 5JYMA 4QY8B 3D87B 5JW4N 5LLIC 2X6MA 3IT8D 3RTQD 3T6VA 4BE5A 3KJ6L 4MD5B 5IM7A 2YGQA 2KHAA 3NA9L 1CU4H 1FO0B 3WDIA 1CO1A 1IEBA 4IK6A 4YDKH 4NKQB 4WRLA 1QLFB 2MTPA 2XG4B 4TLTA 2BNQB 5EDXA 4FHBD 3LHPH 1HXKA 3QQ3B 4LFHD 4PJIA 5C0AE 5JPNA 1B2WH 3SDAD 3IS1X 1RJLA 3EJYC 3EH2A 3L8QA 3MV7D 2HJKA 4RX4D 5ADPH 4WGVB 1W6WA 4MDJA 3LIZA 4M5YH 4KTEH 4W4OC 4WEBL 1HNYA 1V54B 3DHUA 3KYOB 5AAWC 2OL3H 2F5BH 1F4AA 1DDTA 1UWFA 3EFFB 3CAFA 3SZKC 1CDIA 4LCWA 1CE1L 1X4XA 3P0YL 3MBWB 4L0ZA 1MFDH 5A2JH 1G9NH 2GB2A 4OZIB 4JEGB 3QPKA 2Z91A 3QUXC 2D31B 2J8UA 4ADJA 4RSVA 5EBWB 3TLRA 3GUTB 4E9WA 2EECA 2BNQE 1U8NB 1M7IA 5AYUL 5CEXA 4AYFB 3VSTA 1BZQK 3MO1A 1NAKH 3PHQA 1TJGL 4UV4L 3G08A 3MJ9A 5F7HA 6PCYA 1T7ZA 5LAXB 2YA2A 1QLEH 1UGKA 1C5CH 3MI6A 4AITA 3GT6A 3C5XA 3FCBA 2VE6A 4YIQA 2JB5H 1ZV9A 1WDAA 4CNIB 2D8KA 2IH1B 3LH8A 5KYWB 3U48A 1HYSC 1B4JL 4I9XA 4PJ9D 3SYCA 3REWB 3R7RA 3ECBA 4QEGA 2NR6A 3KXFB 2GW5A 3N0PB 5AOKA 3L3JA 2ATPA 2O5NA 1SHSA 3FO1A 3H55A 1J9TA 2IQ9L 1T7YA 5DJDB 4MBOA 3RWIA 5ID1A 4LKCB 1NANH 3QCTL 1V3MA 3O0RH 2Z0BA 1N6UA 5MENB 4G7RB 4I0PC 3HC0A 1RJYB 1D7CA 1NFDA 3EW3B 3BAYA 1A64A 5D6CB 3G9AB 1KN4H 1IBYA 3H4HA 1OP3H 2NY5C 3FMGL 4HV8A 5C0AD 4ONFL 5J6SA 3IVKA 2OSLB 3R1GH 2WIMA 1X9LA 1GW6A 4G7VH 3IK2A 4PJ7A 4MJ4A 5HHVH 4KKAD 5GRJL 1IV8A 4N4YB 3ZE2B 4D2NA 1D7BA 3BZFB 1E2WA 2CJUH 4PW3A 4P46D 3D2UB 5HI4D 1KBVA 3D0AA 2XCMC 3BWAA 3CBJB 1MFBL 3IWVA 3INUH 3VGEA 4LLYB 1KN4L 5EUOF 3C60C 1CGTA 5TJWK 4Z7WE 3C87A 1V7ML 1H3TA 3PG2A 2WKOA 1SF5A 2FUTA 2LAGB 3GBDA 1H6FA 3T65B 2G5BA 1G5GA 4DPBX 2JJTA 3ARGA 2E7DA 4HSAC 4B7IA 3SE8L 4ODWA 4HXBL 3M46A 2G2PA 1AKPA 3TNNB 3MR9B 1SXZA 2F9BT 3HIZA 3OKKA 1EFQA 3H85A 3UTTE 4M8RA 3VD1A 1IGJA 4LVHC 4RNRB 5B1AB 4I3GA 1YC8A 3AGWA 3AWEA 1CTMA 4JCLA 2XNAA 3FQNA 1MFEL 2V2WB 3IFPB 3OG6B 4GT7A 4XMKL 3UG5A 3V4PB 3I02A 1EXHA 5F3FA 4PRAA 4YZWA 5AUMA 4LMQI 4OI8A 2FL5B 4ZMWA 1S7RA 4DKFL 1QFOA 2NUPA 4H20L 2XZZA 4YXHL 4J3SA 3BVNB 3JWNH 1R24B 1YEEH 3T6QC 1BFOB 1P4LB 5AVXB 2WQWA 3A47A 1I1AC 4OBRA 1TSHA 4Y16D 3NFSL 3TIEA 4ENEC 3BPOB 2GITB 3KHOA 2IAND 4G8GB 2HJFA 1LWHA 1YEHL 3EBIA 3EJPA 4ZNEA 3AREB 4JAMB 4GQ9H 4GXFA 4HWEL 1I9JH 3B2UC 2NQDA 2QTVA 1JK8A 3GMQB 4IBTA 3W11C 2GTZB 2CDGB 1BXUA 3QJTB 4L9LA 3WJJA 3VJ6A 1OSEA 1T4KA 2WTRA 1J9SA 4LCIL 5DJXA 5I9QC 5C0FA 4K94H 1WBYA 4FC3E 1WFUA 1OE1A 3G6JE 3HNVL 4UIKL 5C3IA 5AAWA 3FZUC 1ORSB 3NCWA 5GS1C 2C4FT 4MJ6A 4MKTA 1YC7A 1MREH 1PIFA 3MREB 2VR6A 1XZ0A 3DJSA 3OJDA 2HJLB 4AC2A 2H2PD 4P2QE 4OV5A 4QHUB 2CG9X 3M88A 2VR3A 1KT2A 1PQZB 5F1IA 4K5MA 4NZUL 4ZUSB 1TUPA 4L18A 2VL4A 3N40P 2AP2A 3WE6B 1P0SE 2X87A 4ZTOH 3IDUA 3NEEA 4GO9A 1LK3H 1ONQB 3IJYB 1GC1H 4APQC 2K6ZA 1E90A 2XZQH 3B7SA 3JUYA 1YYCA 1PLGL 1F11B 3ZKXC 2VDQH 1YMMA 3SKJL 1JN6A 3VQLA 4KKPA 1TZAA 2Q7YB 1PLBA 3AG1B 5IW1B 2Z9TA 1L3NA 2ATKA 2GJ6E 3DDFA 4NHUA 1IBBA 3QPQC 3WMSA 3LRSB 1JPSH 1MH5A 1TQTA 1Y0LB 3T3PE 3V5DA 4XZUA 3WLBB 1NMCC 4GAYA 3NQIA 3D0VB 5JOFA 3QZOA 4EI0A 1G7JB 3B7RL 4GLRI 4OM0H 1T89A 5AW0B 2OFQA 3Q5TA 3WE6A 4ALAH 5JIIA 3FRPB 1U3JA 3I3DA 5BW7A 2K9UA 2OQJA 5DJ0B 4EIGB 2EAEA 5BOZG 4XMUA 2BH0A 3GLDA 1JPSL 2N56A 4M6NH 4O58H 4OLZH 4GRWB 2MOQA 1XF3A 4EXKA 4KROD 3TZVA 3GF8A 1SJXA 1CT8A 1P4UA 1PPIA 3O6LL 5IB4A 1RFDL 5I1JH 4QR7A 1A2YA 4LEEA 5IK3B 3U1SL 1IL1B 4GEJA 5F44A 3U0WL 3VXPA 4V2BA 1Z0NA 3HPJA 1GGIH 4NFDA 4B9YA 3SBWC 1GZQA 2ZOKB 4MCZB 5EPMB 5HJDA 3NJLA 3Q1EA 5F96H 3J7HA 3WNLA 4LVNC 1AKJA 4HUWA 4R83A 4UNIA 2UX7A 3VMOA 3SKOB 2VR5A 3RZWA 3US1A 1KJ2L 2AI0H 4HKZB 2GTZA 3D18A 4Y5XC 1VADA 5TE4L 3K6DA 4DAGL 3AREA 3KPRD 4UIMB 2PXYD 3P3YA 3JV5A 3ZT6A 2Y24A 5HI5C 1BM7A 2DJMA 4JFPB 5DHYA 2VR4A 2XPGA 3DVIA 5ILTH 1FZJA 4KV5F 4X0NA 3AUWB 2XXGA 3OXSB 1HAWA 4Y19A 5CFAA 4RZCB 2JSFA 3U9PL 4TMPA 4N9GB 3TH2T 5K9OB 5CSZA 5EBMA 4E9SA 5ICZB 3IPFA 4MHHG 3B7TA 4JDVB 4Y89A 2F8XC 3W0WE 1JGDB 1PYWB 1O7DE 4WENB 5EWIH 4FQJL 4TUJA 1GY2A 5JLZA 3FHQA 3ISRA 3DUHA 4ZMZA 4HUVA 1O9ZA 4ZFOA 4AEHH 1FLRH 1OPOA 3K5SA 1JZ3A 1TQBB 4GG6B 3FU7B 4ZZFA 1IM3B 2CBMA 5HP5A 4Z77A 2LT9A 2X3CA 3X1BA 1ZANH 4JG1L 1KZYA 2M1KA 1MPAH 2A1WL 3DX8A 3V6OA 5IT2H 1MNNA 2A6KB 4EDXB 3V0GA 1GGBH 4Y1TA 2GBAA 3GMNB 4HSCX 3S0PA 4CVXB 4BRJA 1AGDB 2R0WL 4GY4A 1Q1PA 3TEUA 3VH8B 3D2UA 1U33A 2P5PA 2ZXQA 2ICEA 4KRMB 4D9LH 3KPLB 3ULVD 3RA7L 4UMSA 3VFPA 2DIEA 2VDLH 1DJGA 1D5IL 1AO7D 1GJWA 2OMUA 1UTDA 2GSIB 1XIWA 1RLBA 3QYCA 1BZ7B 3QS2A 4ZG1A 2J1YA 5HHOD 5HYJE 5JW4M 2OSLA 5D2LF 3FQRA 2CNZA 3D25B 3DRQA 4HULB 4UV7L 1JTPA 4K2UL 2B4CC 2WXOA 3O8XC 2ITFA 1RJYA 2IO5A 5DF0A 5C0BA 5D7JC 1A7NL 3QJVB 2ZKHH 4JRLA 1T1YB 2GBUA 4LE8A 1JPGB 1YJDL 3L1OL 1I8IB 3IM1A 3W37A 4KK6D 1PY0A 2BWQA 1BQ5A 2KBGA 4JVUA 4OIIH 2NY0C 1JFQH 5FGBC 2J1WA 3WN5A 1G0YR 3DKHA 3ESOA 2V5RA 5EF1A 2PR9A 1IJNA 2BOCA 5E5LA 5FYLL 2EE6A 5KVDL 4HUXB 4FOMA 4H8WC 4QRTA 3HR5B 1HL4A 2FBRA 2B16A 4HIJB 1X44A 4PV9B 3VXRB 3C8HA 5JHMA 4TULL 4LSDA 4N1EA 2CA3A 1UA7A 1TTFA 1IC0A 4ZMOA 1AR2A 1ZA6B 1ZVHA 3EOBB 2X89A 3VI3B 5IOPB 3DHMA 1E4WL 2RQEA 4YJZL 4JRXD 4NM8H 3ZQ9A 2YBGA 2JJUA 5C2BL 3OKEA 1Y6KR 2F74A 1CICB 3FJTA 5C7XH 3CPLA 4UILL 15C8L 3RY6A 1ZD6A 4NP4L 2PYEE 4WI3A 1DTUA 4BDVB 1VZIA 2PNDA 3CC5A 4AJWA 3EYFA 1MVUA 2XN9E 1XFPA 4E9XA 4PVBA 1WTGT 3DGGA 3BO8A 1XGTA 1HKFA 3P4NA 5ERWB 1MJJB 3MYJA 2VZVA 3UP1A 1S6NA 2DQIH 4HMEA 3WNMA 3QPQD 4QDGA 1G7QB 1TKWA 2VIRB 2X6CA 4MTMA 1J8HB 2JF1A 2GEEA 3WDHA 5AW4B 4ENZA 3ETTA 3V7MA 2WIIB 3IS0X 1YEDB 3BPLB 2GT9B 2K70A 4DEPC 2O5XH 5D9SB 1OM3L 3SY6A 1ERNA 3V4LA 2WM0A 3FU0A 4RISH 4MD5A 4Q6YA 3L3OA 4OFIA 2R4RH 1HILA 4LCCB 3QQXA 3NSJA 4IDJL 1X5AA 3MAWA 3P4OB 5I74C 2WLZA 2V2TB 3KPSE 1F58H 4AL8C 1J8KA 3C6LC 1GGTA 5EU3B 3SGJC 5DVOA 5J13C 1FN4B 1QFWH 3ETBF 3Q8CA 2CHNA 4S2SB 3N1MC 2ZCHL 1W72B 4PJXE 2OTUB 3F7YB 1UB5A 3D52A 4EUPH 5JIKA 3IU4H 4B96A 2HT3D 5IGXH 1FUNA 4LCUB 4MXQD 3QCTH 3WO4B 2F5AH 3NYKA 4H40A 1RAMA 3RVXD 2NXZC 1IC7L 2WLJA 4Y4KC 5E2TL 1CL7H 1JDAA 5IB2B 1FBIH 1N5YL 1WHPA 3HB3D 4CDGC 4PG2A 3Q48A 1ORQB 3GM0A 3RPIA 1AD0B 1UXWA 4PJ7F 5MEPA 5H4YA 5I26A 3BPOC 4OCLC 5MEOB 3PXLA 2NY3B 1NGZA 1AMYA 1U93B 4KJWD 5CSBA 3LZNA 3LPWA 5DHMC 4LL9A 2NTFB 2WB1A 4KX7A 5B1JA 5CF3A 1YMMD 1UH4A 5J9PA 3IEAA 5E1GA 3TBYB 1AJ7H 4Z7WF 5F7UA 3F8UB 4EO5A 5J89A 2Q8BL 1KBGH 3W9EB 4UNTA 1J1PH 2F7IA 3EZJB 4L4VA 1FCGA 4AE0A 1QSEB 5HPOA 5L6YH 3MX0A 2WQAA 1AHWB 3GRWL 1BDYA 1KGXA 2NW3B 2R2HB 2CR6A 2YA1A 3IN2A 4ORZC 3ARWA 1GYAA 2E47A 1MEXL 2JWYA 4FQXD 4PWEA 4QOKB 4QGYA 3GPSA 4W93A 5MEOA 3QUGA 4FYQA 2JTYA 4JPVH 4BSJA 3LB6D 4WK2B 1TQCB 2A9BA 1MRFL 5LQBL 1HQ4B 4Z76B 4R90H 2XFGB 1OW0A 3D4ZA 5TQ2H 5IVOA 4PRDB 5DTFA 1IM9B 4RIRA 3MLVH 1G6RA 1IE5A 2NNFA 4MA8L 4WUKH 5DYOB 2Q6WA 1AGEA 3NJFA 1E65A 5E8EB 1C5CL 3M1CA 3UO1L 2CHWA 3F7YA 3ZPDA 1Q9OB 4W6WB 1OQXA 1U8LA 3L3DB 2XKUA 4QGTA 2DQFA 3N50A 4DP6X 4K5PA 2UXGA 1F1DA 1VFMA 1R6VA 3J2PA 4JLRB 3LPPA 3GMOA 5K9JL 1NCWL 1NUFA 5DI8A 1DQQB 1RURH 1SGKA 4NWTL 3QBTB 3BUBA 3QORB 5JHBA 5I1KL 3DX7B 4NQDD 1BF8A 3DX6B 1PL3A 2ZOOA 2YZ1A 3DECA 4G6FB 1N0XL 5KVGL 3MV8B 3GYRA 3EIFA 3GKWL 4GUPA 2EDMA 3OMIB 3QP3A 2WLNA 3PHOB 4UZSA 3IDNB 4JO5A 4JPWH 5CZRA 2PXYB 2K4WA 3AXIA 3T0DA 3QJHB 4GRLC 2VDPH 5ERWA 4ZUTA 1AANA 3I74A 3KEHA 5D4HA 3GSQB 3HPLA 4YGAB 2R4SH 5EULV 2IPUG 2AXGA 5SV3A 4XVJH 4JKKA 4O5LH 4S1RH 1DQDH 3UL4A 3FO0H 2Y7OA 3O2WL 3QXVA 4BDVA 1IAOA 5DFVD 1ZHNB 5MI0B 2GPZA 2OMWB 4P5TD 2XXCB 4EI6B 3WSQH 1X4YA 4A63A 5E7BA 1K4DB 1WD9A 3D3VE 1J8RA 2A83A 2Y23A 1LEKB 4M6ML 1F3JA 3JV6B 5HI4C 4R26H 2D7TL 1LMKA 4N85A 2HTKC 1MCJA 1P4IH 1FFPA 1ACYH 1OGTA 3CVBA 3GRWA 3MQIA 2K1MA 2EEFA 3M7OA 5BZXA 3P2TA 3ABGA 4JG0L 2D2OA 4WI0A 3WFCL 1IBHA 2BFVL 4C55A 2NZ9D 5EO1B 3HR5A 4QRPB 3OHXB 3BUQA 4QHMB 5C0BE 4BCYA 5J0BA 4Y5YA 2Y06L 3M86A 2AQ1A 1KFAH 1A4KA 2EEDA 2FH6A 4PJEE 3MLSH 2N0KA 2C9PA 2NZIA 1VACB 2OMTA 4U1SA 1ET8A 2RIKA 1JHKH 3X13B 4Z8FH 3CHXA 1LO0H 1ND0B 1PKQB 2F18A 3SOBL 1TF4A 2OMXA 5L9DH 4XN5A 3KW7A 4PREA 3WFHA 5GRWA 3PDGA 1I8IA 4HPOL 4HJJH 4PR5B 3B2VL 1KXQE 3ZHDA 4X80H 3AB0B 5A2CA 4DKDC 2K45A 4PJ9B 1VF5C 4S1DD 5CIPA 3CQPA 3ZQXA 4LEXH 1GC1C 5D93C 4NEHB 1TMCB 1MFDL 3PL6B 5EZIH 3PRZA 3I9GH 1MVYA 2BSCA 4KVCL 1UXMA 1I1YB 3DLQR 3QDMA 5F0JB 3MFFA 3O2VL 5DK2B 4EXPX 3H0TA 5I1LA 5D5MA 4FRWA 2UZXB 3R06B 2VMEA 4J3UA 5LBGA 5IMMA 2ICEB 3EJJX 3HZKA 2UXVA 4XN4A 3W1ZA 4CVUA 4L9LC 2XYBA 4ALAC 2IV8A 3BESR 1I8KA 4P57B 3WFZA 5CBEA 2R8SH 3WXWH 5PAZA 5HDLA 5IR1B 4AXWA 2NSMA 4LHQB 3EDEA 5J8OA 1KXTB 2NY2B 4N28A 3GBNH 3FU7A 1N70A 3HI1A 2FX8L 1WD8A 3LS5H 5KYXA 2N7BA 1OSPL 4XCEB 3EYVB 4ADIA 4IIQA 4IRZA 4P2RA 4CL7A 5EWIL 3WUZA 4RLDA 2DM7A 2GY7B 3O4OB 2VLRE 3BAKA 4WWKC 4ZFGH 5LGJB 3X2QB 3S5ZA 5TQ0L 5KVEL 2EH8H 4JY6A 2LGNA 5T1KB 1JZHA 4OD2B 3GZOA 2QSVA 3FDWA 2XPYA 1CD0A 2IV9A 3QJQB 4Z7VF 3QEQD 5I19L 4N9GA 2XPZA 5K9OA 5D71L 2UZYB 1XZWA 4PRPB 4S1SL 4YDLC 1FFRA 1OO2A 1P5UB 3IDJA 3KPSB 3LY6A 2A6DA 4YR6B 2CMRL 2W80C 4WO0A 3NJGA 3ZTDC 1V27A 1ZS2A 2H26A 4HIIB 1A3LL 3CX2A 3MUJA 1WA2X 3ZE1E 2P5EB 5TE6L 4LCWE 1OANA 3FTXA 3ZDZE 4G6MH 2G0KA 2FT7A 5ITFA 4KKAC 3ZDXE 2ZXGA 3LNFA 4JREC 4BSVB 5FPIA 5ECGA 1FIGH 2RGSA 1RUMH 4EDWH 5DMGD 4P59L 1KLFA 4S0TD 4NN5C 1J88A 1I1RA 3L7EB 3BRGC 5KZCB 3KVQA 4HUWB 5TE7L 4Q4IA 4MYPA 2B4CL 2Z35B 4Q74A 4RBPK 5BZDB 3A6BL 2ID5A 4WO4A 1P6AB 1PGRB 1BLNB 3ULSA 1TZOA 4LRIC 1AO7A 4Q7DA 2WKLA 4NO2A 3OJ2C 5IMLB 4ZD3H 1PD6A 3H4FA 4L8SA 4JKNA 2P80A 4ONOA 1F0LA 1WG3A 3KBPA 1CMOA 2YSSB 4Q2ZB 5I8EB 4JMXA 2NSXA 3TVMB 2BSSB 4NJAL 1SEBB 5ETUA 2AQRA 1RZFH 4HFUL 3MRCB 4LRIA 4LQ1A 4OZGB 3D33A 4H20H 5ENWB 5KG9A 2FQGA 2XQYK 2EC9T 4JM2F 3FQXB 3HW7A 4HEMA 4XO9A 2R69H 4XO3A 1PZCA 2YEZA 3NSYA 4IDLA 4PS8A 2CIIB 4TPRL 2CBTA 2HZHA 2HVJA 1KTDA 4FNUA 4XXDA 2DLGA 3CLFL 4OFKA 3P73A 5PCYA 3QSKB 2VDMH 2XZCH 1G9NC 4EVNB 4YWGH 5K33A 4JZOA 1YMMB 5FKAA 3RVWD 2C4FU 4E41A 4B0MB 3WFEL 3QIWA 3N55A 1DEDA 1OTSD 1YPZF 3IJYA 3O2DL 2JJWA 1NWOA 2W91A 4PGZA 5L2JA 2Z7UA 5D7IE 2OBGA 4NCC1 1V7NL 4NNXB 1EUUA 4UB0L 3RX7A 1NCDL 3SQBA 1SJHA 1OCWL 1ZY9A 3IFLH 4OW6A 1AY1L 1AVAA 2W9LA 3WO4C 4ZUSA 1KEMH 1H3WM 3B2VH 1A5FH 5FV2A 5BVPL 1ZLUK 2AABL 4N2AA 5T8IA 1MELA 1OAZH 3U4KA 1JZ2A 2LVCA 5IMLA 5KANG 4PGDB 3QRGL 3KR3L 3ARFA 2TRYA 5CCKL 2ADGB 4MAYD 5K1NA 3QJXA 5E1HB 2CDFB 2J88H 3BKJL 2BOLA 3TN0B 2X4UA 3C6EA 1R5VB 3CG8A 4WU7A 4XOCA 3Q1SH 5E03A 2ZG1A 4PTTA 5CR1A 1ED3A 1GYCA 5GGRA 2WMPB 4FXGB 3S3CB 1RUKL 1L9OA 1MCWM 4B3VA 5CGMA 1P5UC 1XF2B 2IDSA 1XR8B 3D69B 4QXTA 1KIQB 5DFTA 2BOBA 4U7MA 3VXME 4HOZA 4OLVL 5FB8B 5IY5B 1QBMH 1HIML 2X1QA 3IU3B 3TCXA 2HT2D 5ELIA 2YD6A 3WSQL 1A7PL 1YEKL 1A4JA 4U1IA 2GCYB 1R24A 4JY5H 3QW9A 3BZEA 2P5WD 3U6RB 5FA4A 2MMXA 2UZYA 1G7MA 2C1OA 2VKXA 1X5YA 1UJ3B 5HI3D 4IHBA 3WENA 1BYNA 4KX8A 4NBYB 1LK2A 4X99A 1NCCL 2BVQA 3DGCR 4X5WB 2G3MA 5ISZB 1EHKB 3TV3L 4OZFG 5AZEH 3GSWB 4DVBB 4EBQL 1YEKH 3EYVA 5D7JA 2R59A 4UQ3A 1KIQA 4K3EH 4JB9L 5FM5M 5CINL 4M1DH 1TZIA 1R3JB 1EV2E 2MQGA 1WLHA 3B83A 1UQSB 3ZE0E 4XNYL 2HH0H 4PRNA 2PETA 1OAXH 3S37L 3O6ML 2GAZA 4LVHB 4F57L 2E59A 4P57A 4HPOH 3JWOH 2BVYA 4NKIH 1JV5A 1E27A 4LLYA 1A9EB 1IBGH 2ZP8A 1HL9A 2DI8A 5K59E 2ZOUA 4IKIA 4TQEH 2QR0B 3VH8G 1X7TA 3P4MA 3QT2A 3H0TB 2B59B 1HH6B 4F9PA 4TTDD 3S6CA 3T6WA 2VYRE 1YQVH 3CSBA 2BINA 5LNGA 5DXWA 4BV1A 2ZWZA 2Y7SA 1NEUA 3OV6A 3BKCL 4J3XA 3IVKB 4RETB 4Z7QE 4LNRB 1VFOA 2WYIA 3APMA 2GY5A 3G6JF 4LKXB 4NNXA 4Q6KA 4Y0GA 5F88B 4HLEA 1PLCA 5CHNA 1F13A 1NFDB 4QRRE 1LVEA 1A7OL 2DQUH 5IHZB 4DIXA 5IQ7H 1OXYA 4AG4L 4E2OA 3ERXA 3RWCA 2BY2A 3T0XA 1UA6H 4XMPH 4JZJA 2MQCA 3ESPA 3FUIA 1BWWA 4L8SC 3WLWC 2VCOA 3B7YA 3AG4B 2A6IA 5B3NA 3WS6A 3C5JB 4Q9QL 1MRCL 3KMDA 4NFCA 5C07B 2WQSA 1CDUA 3IXTB 1Z2KA 1TYRA 4CNIA 2JKIS 5I71C 3EDKA 4GBXB 3KBHE 3UC0H 4P2QD 4B50A 1NGYB 4GKNB 5F7NC 3II2A 3SDDD 2YPVL 4FYSA 3T3PF 2YKLH 4G6KL 4KXZI 5DQ9B 5FUZL 4ATWA 3LHAA 4Y8DC 3AREC 3OHMB 3CZLA 4D8OA 4FQQA 4G42B 4G5ZH 1U8NA 2YD5A 1RFDH 3TL5A 4AM0Q 4DTGL 3BE1H 3T0BA 1QLRB 1BLNA 2K9FB 4IGBC 3ELAT 3P0YH 2GJ6D 1DSYA 3IDMA 4MXQC 4WNJA 3X12B 3KYMA 3WBDA 2H5UA 5C0AA 1WT5A 2K78A 5BJTA 4XP5L 5E8DH 5C07E 4CAGA 3THML 3L3KB 4MMZC 4PJDA 1JPTH 2AS5M 2OCFD 3NEOA 3ZW3A 5DZLA 3KYOA 2WWMC 5M7QA 4DGIH 3QWQB 2NTSP 1QFWL 3MCKA 3MBEC 3GD1C 1U8JB 1JCKA 3PF2A 4F7CB 4PJEA 4UTAA 4EI5A 4ZXBA 1YECH 4MDJB 4B5ZA 2P5EA 3VA6A 1GSMA 4N0UE 3DX0A 4A2GA 1YNTF 4ZMAT 5JPNB 3QRBA 3ULAB 4XPAH 3DYPA 5DZVA 4EZJA 3BWZA 3Q5YA 4G6JH 4TSAL 5H37H 3HUJB 4YR6A 1QLFA 4FTVA 4K9EC 5HDBF 4HVBA 1J1OH 1Q0EA 2Q3XA 5LCVA 1JYVA 4HXAL 1WCBB 3U0WH 1FVEA 1HH9A 4IU2B 3LD8B 3DETD 3GUFA 5AWNL 5IMOA 4X5QA 1LEGA 1KFAL 3RFZA 5GHWL 4H25A 4X4ZA 3QXWA 4N8VA 1JWSA 2P46B 2BS9A 1Y7VA 1BZDA 1JZ8A 1BFVL 5BOPA 5BO1H 2BZDA 2VZ1A 3IDIB 2NDFA 1PAZA 1Q9OA 2DLHA 5L6YL 4K9JA 3B1TA 2JCCE 2F8VA 3WKNA 5KYNA 3SKMB 5H2BA 1FC2D 1XCQA 1VCBC 5I1LB 5IEHB 3NIGB 1SN5A 1UD6A 3LZLA 3UAAA 2X2YA 3X11B 7FABL 4XCNA 5IB1B 2OK0L 3ATBA 2YRBA 2A7BA 2RFXB 3TA3D 2FB4H 4LGSB 2XETA 1M7DB 4P4KD 2D9CA 3NFNB 4K15A 1E3ZA 3QIUC 2Y7NA 3IGAA 1SNRA 2BP8A 1LMIA 3I6KA 3QUML 1DQVA 4I18A 3DUSB 3LIUA 5ABDE 1S7QB 1P7QB 1ZTMA 1NKOA 3A0OA 2ZG2A 2VDPL 5KTEL 1HJCA 1CLYH 1BVKA 4N6RB 1S2EA 5E24E 1FAIH 3WHXB 4KOCA 3ML9A 3II1A 5D70L 4JPKL 1MW3A 2TSAA 1KXVC 1MJ8H 5C6PB 4MD0A 1P53A 1I8AA 1SXNA 1OARH 3CZKA 4OZFH 5FUCE 3LPOA 2J8UE 1I9RH 2NOYA 3RGHA 2D2CC 5IT2L 3X13A 4AQ1A 4BD4A 5HDWA 3ZN6A 3MRFB 1ORQA 2WZPD 2Y5TA 3FQWA 3L9RB 3MCYA 3DBSA 3QXDB 2J8OA 1RVFL 2GKIA 1ZGLP 3DSNB 3L4YA 2HLEB 1J0KA 3QI9C 3O3EA 4AW7A 1SHWA 2J5LC 2WVVA 4AGPA 2B77A 4KUZL 1EJFA 4XN2A 1SDAB 2BFVH 3RDTD 2PWHA 1I3GH 1D5MA 2V5YA 1SBBA 2P48B 1V05A 3FQUB 4WI5A 1T03H 2V0AA 2Y06H 4UQAA 4TL5A 5KVDE 2VN3A 5B38A 2QFPA 3P4OA 4H7VA 1T21A 1U2YA 1E8XA 1VFAB 3F7LA 1CD1A 3IFOA 5EO0A 3QNYA 4U1LB 5DHEA 3N0AA 1XV8A 4E9LA 2WXKA 1GS7A 4G9DA 4UILH 3DYOA 3STBA 3ARDC 3HVDA 5EOTB 2NR6D 4BUQA 1WEJL 1I8LA 4UM8B 2CH8A 4JPIA 2GVYA 2EIZA 4TYUA 3NEXA 1G7QA 1TKWB 2VIRA 1J7VR 1NC4B 1QBML 4FQXC 4HS8L 1F90H 3OL2A 2YK1H 4GP5B 3WLWD 1N19A 5C0CA 3A67L 1X5XA 3UTSA 3MNDA 1XSOA 3IFNL 3QZWB 1DE4B 1CFVH 4N2FA 1ZTXH 2ITCB 3MCLH 5MP6H 1JZ6A 4OF0A 2MNWA 3MNZB 2TRHA 1EXUA 1CPUA 3T08A 1W9XA 2QLYA 1BQHG 3GRGA 1FFNB 3GS4A 3I2CL 3IFOB 4LCVA 2DWXA 2KL6A 3LKSB 2GUOA 3OAYH 1F42A 1M2OA 1V5JA 2QADB 5B38B 4LGRB 4M4RA 1H3PL 5KSUA 1R3IH 4A1RA 1OCCB 4J8QA 1TJHH 5GSRB 3UBXI 2CHXA 3STZB 3V7AG 1FG9C 3ZK0A 5HD8C 4MA1C 3BN3B 3FXIC 5JHDD 4BFRA 2DQEL 1AGEB 3TH3T 4YBLC 4LSTH 3SKNB 3CFDA 4AJVA 2WUBL 2X40A 5A1AA 5FM4A 1I85C 4PJFA 1DQIA 2CKBB 4WFGE 1BYPA 4YBQD 3L4TA 3WN5B 1MOEA 3E9UA 1NFDF 2O5XL 3VD7A 3PWJB 4ZO8A 3Q44A 2WAHA 3LYRA 4QOKA 3ZMEA 3H2WA 1XSKA 2B1HH 2A3TA 2J73A 2XXMB 3JZ7A 3QUXD 2HRLA 1FGVH 3C9NA 3OR7A 2QPSA 1YZZA 3EYUH 1QZNA 1N6QH 4N22A 4XN1A 3F83A 3JBG7 3MX0B 1MAKA 3FTUA 4GYBA 4Z6AT 4R4BA 2JKWA 4Y2DA 5J11B 1G84A 1HHJB 2QKIA 1JZIA 2Y25A 2IGLA 3CX5K 4K5NA 3UTTD 1OSPH 2JKJA 2UZPA 4U0QB 3NCEB 3EOYG 2KUTA 3X14B 1DJZA 4QRUA 4P3CL 3V4VL 3KLQA 1TR7A 5FAAA 2G3NA 2HYMA 3BHBA 5EB9A 3EF4A 1UM5L 3OPZH 2P49B 2ENPA 4XP5H 2G2RA 3NP4A 5IQOA 5CD3A 1A22B 1XCXA 3WDJA 3DPDA 2BWIA 2OZ4L 1D7FA 4BQ8A 4XO4A 5IB2A 2QZQA 4P23D 5EC2A 5DD1H 2A77L 2FEDC 5TGBA 4Z0BH 2JK5A 3ZX1A 4Z7QB 1I9EA 5H2BB 3EJRA 3MRQB 1I7UB 1OB1B 2E76C 3IJHB 4ODSL 1ZLVH 1G7PB 5EH1A 3SDDB 2WXJA 5B1BB 4UT6L 4TSBH 3BCFA 3CH1A 5FHAL 3BPNB 4JFUA 4GG6A 4X6CA 3QVAA 3HLAB 4L2LA 2VISB 2PR4L 4OCYH 4NBZB 2FYVA 5DS2A 1FV1A 5IQNA 4H25B 2ZCZA 1Y1DA 4GP8B 1ZS8B 2UWEE 1HHHB 2RCSH 4X5LA 2AEPL 3QQ4A 5DUBA 1UASA 2KPNA 3NG5A 2W0KA 4A38A 3OPUA 5FIEA 1RZKC 4M62H 4EKJA 2BIIA 2ITEA 3HS0C 2NXZB 3BEVA 2W07A 2PTUA 2FLMA 4JGMA 1UGNA 5D96C 1QI4A 2H2SC 3AM8C 3AS0A 1J8HA 1QKZL 1OAXL 3GSNA 2AJUH 1XIWD 3S37H 3BP7B 4ZPTB 5T1KD 5J56B 1WAPA 2FR4B 3JWOL 3U79A 4ZXBB 4EI5B 2BCMA 1RSFA 5I1CL 1QSVA 2QADC 4PJEB 4XX5A 1MFUA 4XPBH 2H1LM 4GRMB 1HL8A 1UUNA 4P5RA 2V3EA 5FOJA 3OAZK 3TPKA 2BVUA 5GIRA 2X4NA 4JPSA 5L4MA 1C1EL 1WGOA 2AKRA 1QSED 2PO6A 5B8CC 4MWFB 1M1XB 5C0AB 4N8UA 4Z7AA 4HK3N 15C8H 4NC1E 1FVDA 3TV3H 2A9DA 4ZMVA 2R23A 1L7IL 1RU9L 3KW8A 4HT1L 5F6IC 4XPGL 1F6AA 2D4FA 2VZUA 3UACA 2PWDA 2N59A 4JGJA 2OSXA 1E9OA 2HG0A 3TZVB 1HS6A 4NZDA 4JUTA 2VERN 1DUYB 1JRHH 2CK0H 6FABL 2XTJD 1ODAA 3JWNG 1PG7W 2QHLA 2CO6A 4KVCH 1OCWH 3KPQB 4OQ1A 2OV0A 3MROA 4FERA 2B39A 4RZKA 3CXDH 2EDEA 3JVGA 2L7UA 1ZLVK 3VD9A 2VLKD 5JW4R 5SWZB 3TF4A 1D9KC 1IGFL 4PBDA 5KWYC 4GRLB 3D08A 1HZKA 4ZQKA 2IPKA 3SQOH 4NKMA 2F54A 5HYSA 3D30A 1KIPB 3F84A 1XGUB 1KJMA 4PJ5E 1T1YA 1YMHB 1RZJC 1JN6B 1SUHA 5ANME 1S7SB