1PLGH

Evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
b'QIQLQQSGPELVRPGASVKISCKASGYTFTDYYIHWVKQRPGEGLEWIGWIYPGSGNTKYNEKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCARGGKFAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A=KAPPA=
molecule tags Immunoglobulin
publication title Evidence for the extended helical nature of polysaccharide epitopes. The 2.8 A resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2-->8)-polysialic acid.
pubmed doi rcsb
total genus 41
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1995-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1plgH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1plgH02
4LU5L 1JGEA 1FFPA 1OSZB 4OZFG 5BS0B 4HCRH 5D72H 1SYVA 1TQCC 2MQCA 4OJFL 5E4EC 1XF4B 1S7SA 2X1QA 3F7PC 4G8IA 3CVHH 3RVWD 4AQOA 1NEZG 1Y0LA 5EH1A 1YYMH 2PUQT 1EO8H 3EO1A 1XGRB 3PGDB 4AEIL 1IT9H 2XZCL 2GY7B 2R1YA 1IGYA 3QXWA 3SE9H 4FXLA 3MCG1 1SJEB 4N1EA 5INDB 2ZJSH 1MCHA 3LEYH 3MLRH 5TQ2L 1FVEB 5IROA 4RISL 5HGHB 3DX8A 1A02N 1RJZA 4NYLA 3QIWC 5HVFB 2APFA 2YPVL 3CFJB 1Q9KB 3MUHL 2Z31C 3UROR 4WFEE 5HYEA 4HV8A 4M4RA 1YY8A 4J1UA 5B38B 4OB5H 3GI8L 3U1SH 1J5OL 4LFHD 1CK0L 5KSAA 1UYWL 4WHDA 1FIGH 1JWMB 4NJAL 1NDMA 2DQTL 1HCVA 3CSBA 3VG9B 3AROA 1HDMB 2Q1EA 3T04D 1G9NC 1F8TL 4JJHA 4O51B 4I3SH 2ZSWB 4WI6A 1UKSA 3V6FB 5ESQB 3AS1A 3IXTA 4C83A 1DBML 2K7PA 1O7VA 3X3FH 2DB8A 4O9HL 1KNOA 1MLBA 3IDYC 4Y1AA 5EO0B 4U1NB 3IXAA 5KSBA 4JREC 1LK3H 2D03H 1K3ZA 3QJFA 4OZFH 5E2TH 1QPXA 2UUDK 4G6JH 4RGNE 1CDYA 2VTFA 4TUKH 4XPHH 1NCBH 5IBUG 1S3KH 4BQ9A 3SDXB 3BZFB 2RHEA 3S3JA 3PHQB 4ZMAT 1XEDA 1CYGA 3WNOA 1FG2A 3J7HA 1IL1A 1SJXA 3D0LB 4KKBC 4PLKC 3BQUB 1G6RA 2R0KH 1FBIL 1U6AL 3RWHA 4M61B 2DJ4A 1H0DB 1NEZB 2HVJA 4NRZB 4UT7L 1T03L 4ZS6D 4C57C 3OKNA 1JHTA 3O41B 1G7QB 1IC4L 4G8FA 1FORL 1B9ZA 3PQYA 3PP4H 1WT5C 4NQVA 2Z8RA 3WNLA 4MQXC 2HH0L 4P46C 1ZHBB 3RJQB 5HI5D 1FJ1A 2H1PH 5EZJA 4XVUD 1ACYL 4LHUD 3ZYIA 3LY6A 4WFGD 3HR5A 2Y1VA 1MHPL 4H88H 3MBXH 3WIIL 1OY3B 4GKNB 2IC2A 3FQXB 5F9AC 1WTLA 2C3WA 2QSQA 3I6KB 1JGLH 1ORQA 5I8EB 3VXRB 1F6FB 4GXUM 1OTSC 3V4UL 2YXFA 4C4KO 3G9VA 4QOKE 5H8DA 3ZE2E 3EDDA 5CINL 3WHE1 4NQCE 5TE7L 5BO1H 3LQMA 2NNAA 4GQ9L 1BJMA 4X6FB 4FQIH 3SKNA 1U3HC 5EC1B 1M05B 5DSCA 3CFCH 4PRIA 4WDIA 4FNLH 5DHVH 2ZG3A 5CMAA 1NFIA 5D2LA 3I3EA 2H3NA 5HHXH 1LEKA 4EI5C 1EAJA 1D9KD 4R7NB 3WCYA 1WIUA 1X6LA 3OHXA 1CLOH 2ATKA 3AXLA 4N68A 5D5MA 1UH3A 3W9EA 5TGBA 3HAEG 3EDEA 3EO0B 3WDHA 5JOPD 2C3VA 2EEAA 2A73A 3I3BA 2EH7L 1JPSL 1CDHA 4AL8H 4F9LA 4YPGA 3QDME 5BZDB 4DKFL 2NY2B 1R3KB 5C0BA 4XBEL 4L3AA 2HJKB 2YUVA 1MWAL 3ALWA 1FIEA 3HMXA 1FL5A 1ZT1A 5F96H 5IBTH 1Z3GL 3MZTA 1NGYA 4ELKB 3ME0A 2NXZB 3T1FB 1DEDA 1L9MA 3GMPA 4RWYL 4YGVA 32C2B 5E9DB 2X10A 2ZJSL 3NIGE 4P9HL 4R4BB 3B8SA 1FYTB 2R69L 1NGWB 1QYGH 5TQ2H 5MI0C 3TCXA 1XR8A 3SQOL 3NCJH 4RGND 1EEZA 5A2LH 2VL5B 3HAEB 3JV6A 1UT9A 3O3DB 2NX5D 4LSUH 1FHGA 4MNQD 2Y36L 3CX5K 5J6HA 1AO7D 5F7NC 4YZFF 5C2BH 3CU1A 1U8LB 2NXYC 4PP1C 2IWGA 3K81A 5C0DB 4ETQA 3K74B 4LNRA 1DBKH 3P9WB 5DURB 5K9QI 1KTLA 4IRJB 4ZFOB 5HGAA 5M95B 3RWDB 2XTJE 3R1GH 4PBVC 3PV7A 3VFUA 4NHCH 3CVIL 2AK1H 3S4SB 4YE4H 2WBWB 1EAPA 1S7SB 4QRQA 5DJ0A 5GGQH 5E6IA 1NDMB 4HUKB 4XC1L 2QR0B 1AGBA 3TNMA 3RDTA 1FPTH 4PP2B 3DMMD 4EUPG 5DQJB 1A6UH 5JLZA 3FRPG 1IAII 5DYOB 3IFNL 4HS8H 3DO3A 2P5EE 4XVJH 2DI8A 4P2OD 4WU7B 3ZYJA 2GSIA 4JFED 3VGFA 3UJIH 3NPSB 3DX8B 1HILB 3O9WD 4ZOEA 4FQLH 5CLTA 1A8JH 1KSRA 1Q9KA 1WWCA 2XACC 4HHAB 3GJFK 1PLGH 2ICES 4UT7H 3VXUD 5K9JH 4JKWA 4OCMC 4RMUA 3VFWB 3T1WA 1YY8B 1NDGA 2XPGA 3MMEB 3IVKB 1OTUD 4KK6C 1WWBX 4LRNH 5C08A 6FABH 4OF8A 3P4MA 4LEOB 1OP5K 3QIUD 5BRZD 1U42A 3TNNB 5B8CB 4XPBH 2OR7A 2UYLA 4HPYL 5J3HD 5HYFA 1ZEAL 4OZGA 4F57L 3Q6FB 4O51A 1XIWA 3K4ZA 2X4OA 1I9IL 2AJYH 1XGTB 4PRIE 2FATH 4JPVH 3MBXL 3WFBL 5IJVA 1JMZA 3VFSB 5DRXA 2R2HB 4L8SC 5EO0A 4TN9A 1CDCA 1ZHBA 3MO1B 3U0PB 4M1DH 1MFEH 4H1LH 4XPFH 1FNLA 1QACA 3ARPA 4CADB 3DUHA 4Y5XB 1QQDB 2G2RA 3HNSL 4XP1H 2QSCH 3GGWA 3LH2H 4NKOA 2AERT 2AJXL 5SX5K 2NXYB 4R7DA 4FFWD 1TMCB 3EGSB 3INUH 3RGVB 1NCCL 3RTQA 3TPUA 2MSPA 3VXRA 4ONGH 5K33A 2X7LA 3OBAA 2OSLB 3WEXB 1J1OH 1N5YL 3CFCL 1NEZA 4NRZA 1MLCB 3MLVL 2DKMA 5ANMB 4LLWB 5ESVB 3E6HA 2Q8BL 1NAMH 2IBZY 1I85C 5GS0H 4GRLD 5LGKA 3IFOB 3PWUB 2A2QT 1F42A 4HQQH 1YC7A 2YWYA 1F3JA 1UM6H 3ZT6A 1V7ML 4GRWE 1HQRA 1K8DA 3EJZD 1ULVA 3HI5H 1C5DA 1RZJH 3C6SA 3QUYD 1IARB 4YK4C 1AJ7L 3GMQB 1VA9A 4U0QB 4HS3B 4PREB 1NAKL 2D31B 4WY7H 5MI0B 3O4OC 1T7XA 4DGVH 2J12B 4R90H 2FRGP 1EGJH 5DFVD 3O6KL 4YDKL 4YWGH 5IMKA 3PQYE 3WUWG 3QIBA 1QKZH 2P5ED 4HWBH 3GSRB 1UZ6E 4HWNA 3T0BA 2WBJC 1KLUB 3OGOE 3QFJD 4JQXA 1SY6H 1EH9A 2EIZB 4XI5C 4XVSH 4TUJB 4XVTL 2V5YA 1U2HA 1RUPL 2OQJA 5C0BB 1M1SA 4I9WE 4PLJC 1KBGL 4Q6IA 4MA1B 2GJZB 3TYFA 3L7EB 3UCRA 1F4YH 5BMFL 2NY6C 2VDOL 1MCDA 4MNQB 3RNKB 4LFHG 1C1EL 1OQXA 5TDOA 1BQHB 2NY1D 4O2EB 4LSUL 3QNYB 2Y36H 1GC1H 2GJ6D 3KYAA 2AABL 4UUJA 3SDAD 4CMHC 3GSQB 2CGRH 5DJYA 2YK1H 4CVWA 2CDGA 3OAUL 3AC0A 4K7PX 4X80L 5HI4D 1L0XA 3MLXH 4UDTA 2AQ3A 2CIKA 3OX8A 4Q97A 3KPQA 2QQQA 3QZWG 3VRIA 2C3XA 1AQDA 2HTLC 4R2GC 4DVRL 1K6QL 4MDIA 4NHCL 4WUKL 3L5IA 3KR3L 1KB9J 4JKLA 4KJWC 4ZAKC 4I3RH 1X5LA 1BD2E 5EC2B 3D25A 4X6EB 1FQ9C 4W6XB 1X6NA 1L4IA 3QISA 4XHJD 4GKSA 4AY0A 3TV3H 1FCGA 1WISA 3BO8B 1RFDL 2B7DT 1FPTL 1U3JA 2JK5B 2X40A 2YPLE 4RFOL 2Y06L 2DDQH 2H8PB 4N0YH 1MCKA 4XBGB 2QLVB 1YA5A 2QQKL 4K3HA 4N5EC 1FZOA 2VC2H 1KCRL 1I3VA 2EKSA 4KV5E 5IFAL 3MRFA 5HI4C 3TIEB 4FFVD 2DKUA 2BK8A 1G9MH 5T3XE 4FQLL 4PRPB 3QDGE 1CXFA 3IKKA 3BMWA 4BH7B 1MFBH 3RWCB 4ZTPL 2LVCA 4XCFL 4ODVH 3VWKA 3QWQB 1OAZH 1PY4A 4Y4FB 3RWGB 2E6JA 3AY4C 2I60L 2YRPA 2R4SL 5K9OB 5A16A 5CIPB 2IPKB 3BDBA 1VEMA 1XF1A 3BKYL 4HPYH 2VUYA 1LK2B 3NFNB 4PRPD 5L0QB 5I1EL 1VFOA 4JAMA 1TVDA 4H0GA 1TENA 2WBJD 3KPMB 2VXQL 4Y16D 1HHKB 5B8CA 4PJ7E 5MEOB 5L2JB 4Y4KB 4PJ8A 4YHIA 3DBXB 5EBMB 1T0MB 4LOUD 5TDPA 4QRRE 3W9DB 1AC0A 4XPFL 3TNMB 1E6OH 5DVKA 5JLZB 2MOVA 5FGBA 4C56D 3HG1A 2IBGA 4DEPB 4UOW1 2ZUTA 1EEYB 4PJ7B 2AXGA 1HXYA 5CP7B 5H37G 1VFMA 3R8QA 5HHNB 4Z6AT 3F58H 3QXDA 5GRUH 2QKIB 1JUFB 4L4VA 1FV1A 1A3RL 4NC1E 3ZSSA 3VD4A 1XF2B 1G7HB 4R4NC 3MV7A 2WP3T 5DVNA 3SDAB 2E9WA 4G8EA 4P0DA 4JANB 5CILH 4EN3D 1J0KA 2GJ6B 4BFIA 4KPHH 5D7LE 1WC7A 2X09A 3O8XA 4ODUB 4GAFB 2RR3A 2GAZA 4PYGA 3RVXD 4R3SB 1KTDA 5FUZL 4JR9L 5B3JF 4M62H 5DJDB 1D9KB 2I27N 4OTXH 4WHCA 3CXDL 4S1RL 4K23L 5TF1L 4NPYA 3W5MA 4MWFB 3K4AA 1RMFH 1R3IH 1Z9LA 1NKOA 2HFFA 3MJ8B 4ZS7L 1N6QH 2DLTA 3DV6B 1HSBA 4YDKH 3FQWA 5I1JH 4G6ML 4HWBL 5DS8A 4Z0XA 5LBSH 4Z9KB 3QO1B 2PTTB 3JV4A 4HCRA 4JFZH 4PJEA 1UJ3B 3V4VL 1HHGA 4HUXA 4XNMA 4TPRL 5D2LF 3H3PH 3MACH 2JCCF 2A38A 5GS1C 1HZHH 5EU4A 2A74A 1SMOA 5IMKB 1ED3A 3KJ4B 1UEYA 3VXRD 5BMFH 3DJ9A 3P4OB 4KVCL 2HMIC 1C5CH 4AG4L 2QQLH 3VFGH 4LLWA 4YHYB 2HMID 2G75A 3T3PE 3BPNC 5C9KA 1Q9LA 3O9WC 3RUGB 3LPWA 3Q5YA 3HC0B 1KIUA 4ZSOA 4CNIB 1AXTH 1VHPA 3MRQA 2YK1L 2WP3O 2DYPA 2OL3A 2F53B 1HHIB 5L88H 2V7HB 3VXQA 2MCPL 1QZ1A 4O2EA 1J8HD 4EBQH 1A3LH 4PRAA 2BNRE 3BZ4B 1YECL 5IBUB 1NGZA 4WTXA 2W0PA 3BZEB 3CFKA 1MAML 5IW1B 4JKPH 5CEYB 1MJUL 4Q2ZB 5DI8A 4OCYH 3KPNA 1ZGLB 4KY1H 3V5KB 1IGML 3CGTA 2BSTA 2YD9A 3EJYC 1E27A 4Y8AA 4UT6H 4L8CB 4HFUL 2QQKH 4XMLL 2OYPA 4V1DD 2CLRB 1SJHA 1FZKA 4YLQT 1DQLL 3U46B 4B50A 4HZLB 4D9QD 5JIIA 1O7SA 4X7TA 5L0QC 1S7RA 2RJMA 1YJDH 4ISVA 3VXNA 1HEZB 3HMWH 4V1DE 3CPLA 2Z35B 3NGBB 5LQBL 5GGTH 4UIKL 2J1KA 2CRZA 4YHKL 1GHFL 5DJAB 5CIPH 2YA0A 4X4XA 1XF5A 3TIEA 3AS3A 4G8IB 2DWEA 4NC2B 1IC5H 4JPKH 4U6HB 1SBSL 1T3FB 4XXCC 3RWCA 4JPIA 5ICXB 1M6OB 5EOTB 1CN4A 4G9FE 1FZMB 4F7PB 3MLSL 3BZDA 2IPTL 5B3JE 1ZLUH 2IPUG 1TLKA 4OZ4A 5FF6A 3DVFA 4QT5B 3ZDZE 4M8QB 1T5WB 2D4FA 2DTML 4OLWH 2XTJB 4RMWA 3GJFB 4JM4H 5H2BA 2FX8L 2UUDH 4F37F 2A0LC 2Q20A 5I8OH 3L3DA 4QRPE 5HY9B 5KS9E 3UC0H 4MCYA 5CUSL 4MA8L 4U1GB 4PYHA 2AVGA 4XWGL 3BKJL 2DF3A 3CC5B 5DJ6B 3PWPE 3FTGA 5DURD 4JRWA 2LU3A 3K2MC 4GKZA 4L8BB 1UWEH 3ZHKA 4CL7A 4MGXA 5IMOA 2ARWA 3B4NA 3AAZB 4LDEB 2ZKHL 1WK0A 3PWPD 5IP4A 3PGCB 4JG1L 2J8UB 4KH2A 3CVHL 4X6DA 5GGRA 1U8QB 4FQXC 5CBAA 3U48A 3OSKA 4N5ED 4C4KT 1ZANH 3O3EB 1DUZB 3MV7B 1WAAA 3G08B 1MRFL 4KI1A 3NA9H 1NGQL 5F7EH 2DJUA 2VUOA 3RGHA 2WK2A 4BFIB 2AK4E 3KLAB 2XQYG 5F9DC 5LWYH 3WMSA 3DIFB 1FNSH 3PDOA 4P4KA 4KTDL 3PWJB 1KTDB 3DHMA 2P1YA 4OCWL 1AGFA 1WBXA 2ICWJ 2VXUL 4DQOH 2HTLD 2COQA 1LO3H 5GGSY 3OJDB 1REIA 3P3YA 4GW1A 1WUNT 2BRRL 5F3BB 3WIFB 2VLRD 2FYYA 4HAGA 2NYYC 1J0YA 3WXVL 2DYPD 1U2CA 5F7DB 1CGYA 1OT2A 4I4WB 5D96C 1EXUB 1E4XH 4MHHI 1A6TB 3QAZC 4QRRA 3R06A 3GSNB 1L0YA 1KLGA 2DMBA 4QRRD 2WUCL 1ZK9A 3MOQA 3OPZL 2QTEA 1PZ5B 3MOAL 4Z7UA 1G7PA 3O6ML 5E08L 2XXMB 5DHVB 4DFIA 1HE7A 2IANA 1EHNA 1JV5A 1QBML 2WANA 2AV1A 3P9LA 2MCPH 4UV7H 5EU7E 3F65A 2YOCA 4FQXB 4QOKB 1BVLA 3K8KA 1RPQA 5I76B 1VKXA 3NZHH 3L7FA 2Q7YA 4ZFFA 4B53A 1T5XA 2WWMC 1IFHH 4QGYA 1BECA 4CNIA 2FIKA 3IF1B 5DK0A 4BZ1H 4GRLA 2D0GA 5L2KD 2DQIH 3QRFM 4KRNA 4XP4H 1QLEL 5J0BA 5F89A 5JHLH 3X12A 5D7IB 5F7UA 4MNGA 4NFBA 1T66C 3S34H 3U4AA 5FXCH 4JPWH 3O3BA 4QHMA 5DTFA 3PGFL 1S7UA 2APBA 4X4YB 5C6PB 2FH8A 1EFXA 5DUML 4GRLC 5HYJD 1K5NB 2C3GA 5F9OH 3N1MC 3RTQC 3GK8L 3SCMA 4L3CA 2CO6B 4YUEH 4I0PA 1ADQH 4I0CC 4OLZH 2PXYB 2B0SH 4I0KA 3PNWA 3LRHA 1Q9LB 4PJIE 1T4KB 2ID5A 4UOJA 4OGZA 3HC0A 1FAKT 5E1AA 3G04A 1JPTH 3M1BA 1B90A 1DQDH 1FE8L 5GS2H 5F7MC 1HHIA 5FYKL 5HJ3A 1MIEH 3HRPA 2EDTA 1FZJA 5ACLA 2NY0B 2FNBA 4PJ9A 32C2A 5C0CD 3ZDXE 3NBNA 3SDYH 1A5FH 3ULVD 3FN0L 3GI9H 5GRVK 3KXFD 4LHJB 2VZOA 4IRSC 3OZ9L 2OJEA 1ZA6A 3FFCD 1U6AH 1EUTA 5D1XC 1KCLA 5C08D 2PR4H 2DTMH 4YDVB 3MGTA 3AY4A 2H6PB 5KSAD 1X4YA 4PGBA 3SY0A 1GGTA 4OZHA 4UB0L 2FX7L 2AJUH 4MJID 5IGXL 1JNHA 4NKMB 1U8LA 4HZLA 5EIIB 1JYVA 3C8HA 4YPJA 5I1KH 3H9HA 2HKHH 4M5ZL 1RULL 3TFKD 1OW0C 2XRAL 3PWLA 4AEFA 4H88L 1UWEL 1LO5B 3FB7B 3QA3A 1EA9C 2VR5A 4PJ8C 2ZZUT 4CVZA 3GIVB 4W6WB 4X6BA 2PO6C 4IJ3C 3V4PH 3CZFB 3BP7A 1WQVT 4YHOL 4Z95H 4D8PB 3VU2A 3VMNA 4JY6B 1RZGB 4V1DA 2J8HA 4QRTA 1YUHB 4HMCA 1TZGH 3QULA 1NAMA 1IGFL 2CR6A 5ID1B 4P5TB 3FQUA 3WD5H 5IFHL 3EOAA 1HINH 1YN7B 4XP6L 2DM7A 4P3CL 1PFCA 5DUPL 1KIPA 3S36H 1YEEL 3ARDD 3GSOB 2Z4QB 1HH9B 4WCYL 1IM3A 2NY0D 3RIFF 3B9VA 2DM2A 3WNNA 1UXWB 5J12B 4NQDE 4BSVB 5BS0D 4H1LA 1QRND 3DETD 1IBGL 1IC1A 2W07A 4OZGB 4MXQD 1KPUB 4Q7DA 3WL9B 4QRPB 4DN3H 2W9DL 2XZZA 3VFMA 1JZ3A 1CXLA 2VWEE 2E9IA 4U05A 4J4PD 1DANU 5BXFA 4ZNEE 3I75A 5DRXB 4X6DB 5GGRB 3TVMD 1D5IH 4X7EC 4N8VA 4OIBA 2GSGB 2Y07H 3MOAH 3VD9A 4LLQB 4RFNC 1NEUA 2G9HB 4HBQA 4RWYH 1GZPB 3KYNB 4QRUB 3WUWB 1N0XH 5D6CA 5L8JB 2DI7A 2DLFL 3FOMB 1JGVL 4U7SA 4D3CH 2D3VA 5ILTH 3DOSA 3NFSL 2X4PB 1TTUA 3L95B 4K2UH 4Q9QL 4GUPB 5DA0B 2VN7A 5F7YC 1U8PA 4U1NA 4NUGH 3IRPX 1CICC 1JRHH 1INDL 4JGUA 5EULV 3EFDH 4Y1AE 4FFZL 1R3JA 1SYSA 2EIBA 1MFCH 3IAPA 4E42A 4OI8A 2GHWB 4FMFA 1Q1JL 1WGOA 3D3VE 5HPOA 5C9JB 2B1AH 3C9NB 5JO5B 2HA1A 4FXKA 1PQZA 3GBLA 1YDPA 5JDSB 4GLRI 2EZ0C 2ED8A 2ZUQB 4GAGL 2MCG1 3D5OF 1I9EA 1FN4A 1I9IH 2H45A 2FHFA 2AK1L 2BXYA 1LDPH 1QHPA 2DBJA 4RZCA 2DWDB 1JHTB 4HIEA 1C7TA 4GMSH 1CGVA 2IG2L 4X99B 3RVVD 3PQYB 1PZ5A 1MCFA 1INEH 5SX4H 2W38A 1L9NA 3TA3C 3ZMRA 3ZZ1A 5C70A 2ZOLA 1S7WB 1IM9D 1NJ9B 5GQBA 1T1WB 5GS3A 1I75A 1A6ZB 3UTZB 3PNWB 4HH8A 2AKRA 5KBNC 2A6IB 1DVFA 3HKFA 4BA8A 4NRYB 4Q0XL 3PABA 2VLRB 3I02B 2JJSA 4GG8A 5E5MA 1UZ8B 3JTSB 4Y4HC 5CJBA 5M7QA 5GZOC 4MNQE 4CN4A 4PJXB 1S8DA 1UH2A 4W6YB 1ZTXH 4NFDA 4OZIE 2OZ4H 2SEBA 5F1OB 1NAML 2NQCA 5SWSA 3QDHA 4GH7B 5F8RC 5DJZA 5IGXH 4XCYA 1S7TB 1KCVH 3UYPA 5I66B 1CFSA 1OGTB 4DKEL 5CD3B 3TYGH 4KI5F 4X7SH 4MNHB 4UTBH 2VZ1A 3SE3A 4EVNA 1KJ3L 1MRCL 2OK0H 2AJYL 1S9XB 5SWQA 5A3ID 5CJXC 2OR9L 2MMXA 4LLMB 4QXTA 3OKEB 1YEKL 5FM4A 1NCDL 2BP3A 1DQQA 2BNRD 5IVOA 1MFEL 3O6KH 2UZYB 4OZIA 1MCEA 4DUWA 4NRXA 1MI5B 1ZVHA 4QXWA 3U7YL 1PYWB 5GJTL 4PRDB 4YHOH 4MB4A 4GMTL 2AV7A 5HHOB 4U1KB 4P2OA 3GO1H 4BZYA 1FRGL 3MLYL 2CKBA 3QFDB 3TA3B 4F9LC 1OWRM 4LPWA 3MRFB 4RGNC 1LMKA 1TJIL 2EE3A 3LKPA 5BJTB 1NBVL 1TCRB 2ZUQC 2GTWA 3ZYOA 4S2SA 1DBAH 1AXSA 2VDOH 1CZ8H 3PGDA 3BSZL 2Q8BH 4ZTOL 4JKMA 3V6OE 1LNUA 1HYRC 4PGBB 5E2UH 4YEFA 4UIMA 4Z8FL 1CG9A 1NAMB 2AGJL 3QNZB 4BFEA 5B3NA 1LO2H 1AGCB 1D6EA 3OKLA 5I2IA 2CGRL 2EYRA 3H9HB 4X80H 2EECA 4JHZA 3MJ9A 4PJ5E 5GRYA 2R23A 2VLMD 3IGAA 3JXAA 5HDBF 3LZFL 2Z31D 2BC4B 1RK0B 2BSSA 4L3EB 3EIFA 1ROWA 5KVGH 3LHPL 5C92A 3NIDF 5AD0B 3QA3B 4CU8A 1A64A 3AREB 5KJRL 3O0RH 4LPXA 4Z7QF 3SGDH 1T1ZB 3MLWL 5E5UB 1RZIB 3BP7B 4EI5D 7FABH 3D39A 2FL5B 4WFGE 4LNRB 4YBLC 2Y06H 4Y2DA 5BVPL 3LKNB 4F2MA 2C1PA 5EORL 4ZFOA 2AK4D 2UZXB 5IFAH 5ILTL 3QUMB 1Q72L 5JW3H 3OGCA 2X2YA 2WW8A 3G6DH 4LLQA 1OAYH 3MRCA 3QXDB 3H9ZA 4M7LT 1C1EH 5T5FH 4PIRF 5IB3B 5EU6A 3MLUL 2WMPA 4MS8D 4I18A 5LGHL 4P46B 4NQEE 4J8RA 1XIWC 3KJ6H 2VQ1B 3SDXA 1Q1JH 4NO0A 2HT4D 4PUBH 1J87A 4JO3H 3OAZK 4CDHA 2XKNB 1IL1B 4FFYL 3NCBB 4GAGH 5TE4H 4F58L 2YMXH 2AJVL 1MQKH 1J18A 3QCUH 1I8MA 1D9KA 2BNUB 5AG9A 3S88L 1NLDL 2X9YA 1DN0A 1BZ9A 1RD6A 5A3IC 2QSVA 4G9FA 1PY9A 2F54A 1BJ1H 3Q6GL 4MQXD 1JFQH 3I50L 4ORZC 1Q38A 4RFOH 4Z7WA 5CGYC 2R56L 4DZ8A 3B2VH 3KYNA 2VKXA 2EYSB 3P0YH 3KWWA 4JLRB 1CFQA 4NKDA 2KKQA 3C09C 4D0CB 2C26A 2GCYA 1OTTD 4EDWL 4ORGA 5DHYB 1WIPA 1MFBL 2ICCA 3F58L 4UBDD 4CJ1A 3BVNB 4JVWA 4Q9BA 2VB5A 1A3RH 4BH8B 2YR3A 3TO4C 2OL3L 2VITB 1MCSA 1X5GA 3QQ3B 5I71C 2YWZA 1JF5A 3HI1A 1P4LB 5IVNA 1I1AD 2LTQB 4LVNC 4OFYD 1MREH 3HI6L 1LDSA 4S11A 1CD1B 4PY7A 5T33H 4JZJC 3C8KA 4PB0L 3EYFA 3QUXD 3ARFA 2X70A 4WI3A 5GISL 3T0WA 4PJDB 4XH2A 4PRHE 5FGCE 3TN0A 4LRIA 2FIRT 3VXUA 2QHRL 3G5XB 1CFSB 5D2NC 5E99H 5CD3A 4PJBA 5JW5B 3ARQA 2DQCL 1A1OA 5LBSL 1AR1D 4JFEA 3U7YH 2QL1A 4EN3B 3ARRA 5JW4M 4HJJL 2FO4A 2A73B 3V4VH 5BVJB 3RZCA 3GO1L 4D94A 1QSFA 5T1LA 3X11B 5I1DA 4ODXA 4L9LA 5BQ7A 3L3KB 1CICD 2NY5H 3ECBA 3VFPA 3OJMB 1EBAA 4ZODA 4W4OA 3O2DL 3IDJB 3MRRA 4XWOD 5D7LB 3PABB 4HKZA 3UYRL 4W70A 2CR3A 5JNYB 5CFHA 1MUJB 4P9ML 1A7NH 4APQC 4E41B 4RFEB 1MY7A 4IHOB 3MLTB 2O26U 4RIRA 2CSPA 5E2UL 1EZVY 2EIZA 1AHWB 3K8MA 4R4BA 1A4JA 1YQVL 2H2PC 1AGEA 4XCNA 4M62L 2P8MB 4YDJA 2YSSA 4AMKL 2XIDA 4DWHA 4V2BA 3KYKH 2IH1B 1XGPB 5DK2B 4Q6IB 5DC4B 3DX7A 4X83A 4JY4A 1BD2D 4FQJH 4M00A 3EYVB 2AEQH 1KTRL 3ES6A 2HG5A 1OF2B 3DX9A 2QJDA 3LN4A 4I0PC 3QYCA 3IJSA 2VE6A 2PF6A 4G6MH 5DD3H 3WN5C 4JKPL 3IDNA 4FQ2L 4K71B 2V17H 3HC3H 4NCC2 2D7NA 3LOWA 4XB8A 4UMGA 1JK8B 1BFVH 2O5ZL 3MV11 4IOSD 1IAKB 3GHEL 3MBEC 4U1KA 4DN4L 3G5VB 1M4KA 3MRBA 4JN1L 4LASL 1FGNH 1P7QD 1A0QH 2QR0A 3ZKMD 4AG4H 5D4QA 3CX2A 3VI4F 3SGJA 1INQB 3FTGB 1CTNA 4KQ4L 3BP5B 5EZOL 1HWHB 3MBEA 1XR9A 3D6GA 4WW1A 4H5SA 4R8WL 4YO0B 3ARUA 3EYSH 3A6CH 4FZ8L 4RSVA 4HIJA 3ROLA 1J11A 5DUBA 4GOSA 5I2IB 1ZGLM 3LS4H 3ULUF 4UI2A 3L5JA 2YMXL 3RUGF 1AKJB 3GMOA 4XRCA 3UP1A 1NLDH 2IF7A 1YECH 3MLSH 4MJIA 3SO5A 2NY1B 4RNRB 5T3XD 5ADPH 5AAWA 1L0QA 1SJEA 2RCSL 4NWTL 5INDA 2Y25A 3T2NH 3QG6B 4HUWB 4OF5A 4HIHB 1FO0A 5JXAL 4NZJA 5K9OA 3PWJA 3NPZB 2MHAB 1KJ2L 4LSQH 2X6MA 2VXSL 4OGXH 2XNAB 2ARJB 1S7XA 1J12A 2EO1A 4JHWL 2V2TA 1O0VA 1XGTA 4MAYD 4O4YH 4EDWH 2XZQL 5I9QC 2FYYB 1J0IA 2PNDA 3O8XC 1P4IL 1YMHA 3KPSD 1CI5A 3NN8B 4PG2A 1AE6H 4M1GL 3F7RA 5IVZB 5L7XH 5EBMA 1CDJA 4TSCL 3ULVC 4Y5XA 5FGBC 1QSZA 5IEHB 3QFJB 2ENSA 3L3IB 4JB9L 2Y5TA 4JVPA 5DJ8B 4QCIA 1IC5L 4R7DB 1QEWA 5CKAA 1EO5A 1UXSB 4FTVD 5MP6H 3UTTA 2HFEB 2DD8H 2BCKA 4OD2A 4Y1AB 4M6OH 4LSTL 7CGTA 2EDWA 2X9WA 2VLJE 4QGTA 3VA6A 1U0QA 4F7EA 1DVFC 3BHBB 4PRID 4HAFA 3HB3C 3JWOL 2C7UB 5MENA 5FYKU 3O3AA 1GPOL 2RBLA 1FNSL 4A6YA 5C08E 4PG9B 1BBJB 1D5ZB 4P2QA 5EBLA 3RGVD 4QHKI 4OUOA 1NKRA 1Y6MR 2I26N 4DZ8B 4E0RA 2E8YA 5KVFH 4R96A 1UWGL 4OV5A 1CFNB 1T66D 1PZUB 3PWPB 4KK8C 1OL0A 3WLBB 4G8GA 4J4PC 4NBZB 2PXYC 2KPNA 1RUKH 3DXAB 5IB5B 1YN6A 2NY5L 2UWEE 3RWIA 4WI8A 4WWKC 1X5AA 1S7UB 3WHE0 1PX4A 3WDIA 3K2UH 3IFPB 1IE5A 1IZKA 4KK5D 4K3EH 3U7WL 3GIZH 1W0YT 3P11L 5FYJE 2D7QA 1CE1L 2UY6A 4Z7VB 3VFTA 4JO4H 4LHUA 3FO9B 2BNQA 4Z7OE 2C4XA 3OQ3B 4KMQA 2ATPA 4HUXB 1HHGB 1I8LA 2QBWA 1ETZB 4LEXL 2VLJB 2IAMC 4I3GA 2OCFD 5IVXF 1N59B 3QHFH 3MRKA 3V0WH 3RKDC 4M5YH 1MRFH 3I3DA 4NO3B 1RIUH 2ZCKL 1YEHH 2MQ3A 4IHOA 3VDAA 2OMNA 3GM8A 1PG7W 4G43B 1MRDL 2NY2C 3VXUB 4TRPH 4PRBB 5DMYA 2B4CH 4U1JA 4XNUL 2YD7A 1AI1H 4JHAL 4LCYA 3ARWA 5E94A 4EN3A 1NFDF 1QLEH 3QSKB 4PRIB 4WDIB 5ACZA 1EFQA 3O2WH 4L4VD 2PYFB 5D7JA 5IK3B 5F9WB 3IDXL 1Z9MA 4HIXH 3BN9C 3MBED 3WXVH 1FO0L 1KPRB 5D9SB 4YFEA 2DMCA 5C0EA 3KDMB 4ZFGL 1FC1A 3V6ZA 3AXLB 2WSKA 4LPTA 3FO0H 3IU3A 4R4FH 1OARH 3TPKA 3U2SB 2XKUA 4BUHA 4H26A 1E27B 3RIAF 4FS0A 3WNKA 4XXDB 1F13A 3BT2H 3O6MH 1SJHB 1YEFH 4NQSA 5TE6L 2JE8A 3AU1A 1QG3A 2H26A 4HXBL 4QY8B 5T1KB 3PXJA 2FHCA 4ENED 4BH7A 2WINB 4O02L 1MCRA 4KUCD 3ZSTA 1L7TH 4PRHA 3NMEA 4JY6A 2DBLL 1FL5B 3V79C 4HK0B 2EC9U 5EDXA 3RI5F 3SDYL 3PL6D 5J11C 3EBAA 4RFNB 1YNLL 3LMJL 3WSQL 4JDZA 1CXKA 4K07A 1U8IB 2IQAA 4WI7A 3VJ6A 1A2YB 5I8KL 1NCAL 5JHLL 3ULUL 4Q6YA 3PHOB 4KZDL 1I3RB 3QBTB 4K3JL 3T0AA 5JPNB 2ITCA 1MEXH 5E0QA 2YPLB 2NZ9C 3ELAT 4WEBL 5E03A 2CMRL 5F6IC 5L2JA 2FGZA 1GZQB 5F9OL 2HKHL 4N1HB 2MHAA 4ZOCA 4DK3A 4ETYA 4M1GH 1SQ2N 5E8OB 4WW2B 1PG7X 2YD1A 1MH5A 2HRPH 3V9FA 2ARJA 3WKNA 1JZ8A 4M48H 5CJOL 3BW9A 4IRJA 1B0GA 5JHDB 1OPGH 1E4KA 5I1AB 5LGJB 4QXUH 4KVNH 4KRPD 1MHEA 1U3ZA 1IQDB 2GSGA 1LP9A 1R5VB 5DRZA 2HLFC 1G7MA 2KQNA 4I5BA 3V6OA 1FV1B 2F5BH 1WTGT 2EDKA 3S35X 1BPVA 4G80B 4PJBF 3CSYA 3GI9L 3QNXB 4JANA 1RUAH 3A0OA 4X98B 5AG8A 1N6VA 4JG0L 5DYOA 4EDXB 5EWIL 4OI7A 1M7DA 4LF3B 3V5DA 2VDQL 5CEZE 1T89A 4OGYH 3BH8B 3TGXA 2A83A 2HLAB 2IH3A 3QCVH 4NN6C 3K1KC 3HE7D 1I4FB 4D9LH 1H0DA 2OX5A 5EUOF 5ITBL 1JGDB 1BGXH 2CUIA 5L6YH 5F88A 4G8FB 3LN9A 1LO4L 5MEND 1BD2B 5I17A 1F4XL 2G60L 2X1WL 3F8UB 4MXWL 3UZEA 4TVSa 1YDPB 4LU5H 2VXTH 3C5SB 1D5ZA 1A6AB 1MFDL 3QO1A 5DT1L 1LWRA 4DN3L 3ILQD 4YHNB 3GBNH 3S98A 5DQ9B 3QFJA 1Y6KR 3E8UH 3BP6A 3OF6A 3HR5B 2I07A 4QCIB 1T04A 2PTUA 5E8NA 3DRQB 1QRNE 4OLXH 3DURB 1UXSA 3DO7A 4F80A 1DLFL 4QTIL 4ZPVB 4EUPB 3FQNA 4AEIH 4HEME 5J9PA 4HPOH 3LS5H 3MC0A 2ZOLB 1R3LB 4U1SA 4WO4C 4Q9RH 3GMLB 4NN5C 3KPSE 4LLDA 3MREA 3W39B 1YEHL 2ESVB 3QI9B 4NUJA 2WBJB 1BAFH 1A1MA 3VI3E 4PBWD 4YNYB 4MS8C 4WGVB 1QBAA 1RUQL 3S36L 4WVRA 4AK1A 5C0RL 4G9DB 3OL2A 4Z7UB 4N0UE 1KEML 5IV2A 4PTTA 4R96B 4OV5B 2P7TA 3WN5B 1MLCA 3H9SB 3PUCA 3W82A 3NGBC 1ES0B 4O2FA 1C16B 1NGZB 1IAIL 1FO0H 1TFHA 4PJAE 4BK5A 1CIDA 3IETB 3EO0A 4ZFGH 5E6YA 2FIKB 1Z6JT 1CGTA 1TJGH 4OCXH 4OLYH 1H3VA 4OZGF 2FD6L 3VRJB 3LKQA 1A6VH 3DROB 2UZIH 1M7IB 4JZNA 3WV0A 2A0LD 5FO7A 3MRDB 1KPVA 2MKLC 2VLJA 3RVXC 4HXBH 4F37K 1VADB 1RQ5A 4KK9C 4D3CL 1GOGA 2X4RB 3WJJC 2W60B 5IKCB 1WSST 5FYJH 3I6GB 2Z31A 4U6XA 3DUSB 2YPLD 4RAVB 4DFHA 3SGJC 3MR9A 2H32H 3LMJH 1I3UA 3WSQH 5IMMB 4U1LA 4DZBB 2X05A 3VWJB 2YEZB 3TO2A 1OAKL 3W2DH 2B1HH 4PJ9C 1OLZA 3HZYA 2A9NH 4ODSL 4Z5RB 1KACB 2ZUUA 3GMRB 1KENL 1FFOB 2CMRH 4PJDE 2ZP0T 2AP2A 3KYOA 1S9WB 5D9SA 4PGEA 4JFFB 2IQAB 1ACYH 1H8OA 2IBZX 4NJ9L 3TO4B 5T1KD 4U1IA 5FGSA 3RWDA 4JO1H 4RCAA 3DMMA 1TZIB 1YPZF 4KKAC 1RK1B 1YEKH 1QSEA 5TQ0L 5EN2B 1CLCA 1INEL 1RJLB 4HS6A 4MJIE 1DEEA 1A7PH 3NZ8B 4DCQA 4HKBA 3CC5A 5DJ6A 4JM2F 4OD1H 4UNTA 5I0ZA 4ZD3L 4PBXA 1BM3L 2JTDA 3LKNA 1FRGH 2GITA 2D9QB 1FLRL 2PW1A 2E7BA 2ADJB 1CQYA 4JVUA 1TJIH 2PO6A 1UWXH 1U8QA 2BOBB 4PD4J 4P2QE 4HBCL 4HJGB 3MRCB 3QG7H 2EDBA 2EIDA 1WT5A 1EJ6A 3OR6A 4NQCA 1A2YA 3X3GH 3ARED 1T7VA 4LVEA 3QNXA 4XB7A 2VLKB 2OJZH 4DKEH 3TYGL 3RPKA 3TFKC 4EDXA 1B4RA 5IFJA 3CDCA 2G60H 4MXWH 3M17B 1XAUA 5EBGA 2OTPA 1AXIB 1KIQA 1OD9A 3X13A 2DI9A 5C3LD 1RZ8A 2VISA 5HHVH 3THML 3AB0C 2Q8AL 3CDYA 1B0GB 1XF3A 2DRUA 2Z4QA 5ICYA 2Q87A 2BSRA 3MLWH 1MWAH 3UPRA 4GAJL 3MRJB 1I7TB 1K4DA 2HJLB 3MJ7B 1WZMA 3VFNA 5D7IF 4ZNEA 3IKCB 2VLJD 5KSBF 3NIFE 4IRSD 5I1GH 4XT1C 1I1RA 5I16A 5ISZA 4JM2B 3DLQR 3STZB 1BIHA 3GSNA 2JIXB 3P9MB 4S10A 3U6RA 2R69H 3Q3GA 1U8NA 1K9TA 4YHPA 3EOBA 1CVSC 5FCUL 2VH5L 4WRLA 2HT2C 3ARXA 2X4UB 4LPCA 3C2AH 1CFTA 5C0RH 3O45B 4I48A 1LP9E 1T83A 3QDAA 5BRZB 3GMLA 5TJWK 4QHNB 2DQHH 5ESVA 3MTRA 3SDXF 3QUZB 4L5FH 4ZUVB 4ZO8A 4ZFFB 1LEGA 3BYTA 4PR5A 5TH2B 4PGDA 4B41A 1U8KB 3QWOB 4JY5H 4RGMC 3O6FC 1IAOA 1L6ZA 4HWBA 4DW2H 1RZ7L 2FSEA 2FJFA 4MD5B 3DWTA 3LZFH 5IB1A 2AJVH 5I74C 5IW6A 2EEDA 3QCUL 5IV2B 4PG2C 1UM4L 1VFBB 1NC4D 3ZKNC 5EPMA 1OGAA 1JBJA 4AQ1B 3TWCL 1IEAA 1AP2A 2VQTA 1H5BA 3VE0A 1M7XA 3NCFB 4NKIL 4U3HA 2XN9A 5A1AA 4WU5A 2AQ1A 2R0WH 4ZG1A 1YNTB 3DURA 2B5IC 1T6VN 4NQVB 1VACA 5CD5D 2E6QA 2N7AA 2F54E 3HZMA 3IDUA 4PV9A 4HS8L 1QSFB 5T1LB 3WIHH 1E4WH 4TUJA 4KKCC 4KJYB 1HXMB 1UJ3A 3G6DL 2CD0A 4KI5D 4HWZB 4MAYB 3GUTA 4YNYA 4HIEB 2A6DB 1UGNA 4NOBA 1ORSB 4HF5L 3VMOA 2GJZA 3TYFB 2VDLH 3BGFB 3KJ6L 5IR1B 1R0AH 3U9UA 1Q0XH 2DQFB 5SWZB 1T1WA 4XPBL 4JRXE 1QFPA 5DQDH 3L5WB 5JDJA 3HMXL 3I6LD 1FAIL 2J4WH 4RGNB 5HPMB 1JP5A 3TO2B 2AJZA 1X5HA 4RWHA 1FNGB 3S88H 4KZEH 4F9PA 3SJVE 1FYTD 1K2DB 1VPOL 3ZYZA 2ZCLH 3F7VA 1S9VB 4H8WC 3KYOB 3VXSE 3V5HA 1MPAH 4WJ5B 3DPBA 3QIUC 1FFPB 3C5ZA 2ZUYA 3E2HC 3DUUA 3OG6B 1BMGA 4YGAB 2F19H 4KDVA 4ZFZB 1QFWL 1F2QA 4LSRH 3A67L 3BMVA 1RK1A 3S8WA 1CLYH 4JFYA 5GSVA 4IEFB 3V7AG 1DQQB 4OM1H 1KC5L 4PV8B 1KJVB 2Q86B 4P2OC 5IQ7L 1N3NA 1WV7T 3TBWA 4TOYL 3T1FA 1LO0H 4MA3A 4F7MB 1PKQE 2ZUVA 3MNZA 4G3YL 3EOAB 3HI5L 4JQVC 5JW4N 3LKPB 2DWEB 1BFOA 3KHQA 3NFNA 3CFJA 3KXFA 1KN4L 3HUJE 3GSOA 4WY7L 5C0GA 3VH8G 2E7LA 2AEQL 3PL6A 4JCMA 4LCWE 5IHZB 5C0BE 3QDMB 5E8DL 1QNZH 4L9DA 3UJJL 43CAA 1ITCA 1MELA 4H1LB 1LP9F 1DE4A 1FVDA 5F72S 1KGCE 3HC4L 1VFAB 5KAQF 5F6HI 4XVSL 4KC3B 5GHWL 4UU9B 4EIGB 5D70H 2X5PA 2XT1B 3G6JB 4XCCH 3RWFA 1T0NB 3KPOA 1A3QA 1DFBH 5DR5L 3FRUA 3VG9C 4CVUA 1K4DB 4ESKA 2YD3A 3QIBD 4HJGA 3SDDB 1DBJH 5C0IA 4NQCB 3FAXA 3NIFF 5HYQB 3VW3L 3KPLA 1GC1L 1CICB 4K9EC 4RA0C 3T77A 1I1CA 3CK0H 4PP2A 4CJ0A 2R9HD 3DI2B 4F2MB 3RX7A 4AMKH 3B43A 3VFRA 4MMZC 4Y5YA 3IFLH 5DD1H 3OKMB 4FQJL 1YPZB 2EDYA 1I8KB 5JHDE 4NNPH 3RWHB 5E9DE 1MFNA 3VXRE 25C8L 5IB3A 4FOMA 1R3JB 1SYSB 4WUKH 1G7QA 2J88H 2R2BA 3EJYD 3U36A 1D5BA 3BYYA 4JQXC 4ZO9A 1V3KA 1TETH 1E4KC 5EU6E 5C08B 1EBPA 4M6AA 1W0VB 1FVCB 1GIGH 3RNQB 3SE4C 3QCTL 3ZKQD 1D9KC 4DN4H 1TVHB 5DD5H 4WGWB 1KG0B 4GXVH 1JZ7A 1CCZA 5D1ZB 3S37H 5FIEA 3U6RB 1RJYB 2DWDA 4H1LG 2GQHA 3DXAA 3WE6A 5IB5A 3V7MA 2EE2A 1A9EB 1WZKA 3D48R 3W0WB 1Q94B 3SE4A 2HN7B 5ISZD 3OR7A 5D2NB 1NC2A 4QO1A 4HF5H 1OAUL 1AQKL 1IAIM 4PTUA 1XGUB 2V2XB 3HZMB 4YK4B 4Z7VE 4YFLI 5D6DC 2AI0L 4MX7B 4NC0B 1NPUA 4ZO6A 3HPJB 3KPRB 2ICWI 4TVPL 4HWZA 4MAYA 4X4MA 5ENWA 2NNAB 2HFGH 5IJKC 5D2NE 5HYJB 1ORSA 3VFVB 5DMIH 2VO5A 3RTQB 4XC3L 1YNKL 1OSZA 4UILL 3VXQB 1BQSA 3DXAE 4R6UA 4E5XB 2CJUL 2IFGA 1NUFA 5ADPL 1WCQA 3KPTA 4TULH 3STBA 5FA3A 1VCAA 3KVQA 1BVLB 1F2XK 3E6HB 4DOHB 1BLNB 3VXOB 1P4LA 3HFML 4P46D 1Y0LB 1F3JB 5JQ6L 3KNBB 5FKPB 3W9EB 2AJZB 2X4TA 1S9XA 1HQRB 3LN5B 4PJHE 1UWGH 3LKRA 3CDGA 1N26A 3P0GB 1KJ2B 2FX9L 1V3MA 3S37X 1QFWH 3CUPA 2HWZH 1OP3H 4AM0B 2AEWA 3OKEA 5JQHC 4OFVA 4OF3A 1ZLWH 5EU3B 4IDJL 1ZS8A 1JL8A 4HEPG 2MTPA 2CRIA 2XN9E 4HIIB 4WJ5A 1PDKA 3HE7C 3N9GL 4PRDA 4RDQF 3B8YA 3KPSA 4EI5B 1BP3B 2EXYC 4P5MA 4K55A 1FIGL 5I30H 2MJWA 1G1CA 3U2SA 1DN2A 1O5DT 3QFDA 4J1UB 2Y7QB 2AK4B 2EO9A 4KJQC 3RVUD 2YA2A 1KCUL 2BNQE 4JFQA 5MHSE 3RA7L 1OAQL 4WV1B 3CXHJ 3EYUL 5D1ZC 3L7EA 4PJAF 3T8XA 3HAEA 3JV6B 4B0MM 4TUOB 1UVQB 2IALA 4WI5A 2VAAB 3ZLQC 1GGCL 1N6QL 3IXTB 1G9NL 4HJ0C 2QHLA 3QNYA 3UJJH 3F7VB 5JA9A 2L7JA 1M71A 1EEUA 3SJVB 1ZA3A 2C1OA 5GGTA 1MSPA 3Q2CA 4L4JA 1I9RL 2J6EL 5KVDL 4XNYL 3UTSB 4KK9D 2YZ8A 5IEKA 4TPRH 4YDVA 5HHPA 1P1ZB 5ICZB 3S7GA 2R0KL 5JUEL 3VXMB 1QLFB 1ZT7B 1XCQB 2W0LA 4QTHA 2VE6B 4KHXH 3Q48A 3CMOL 2H41A 4M6MH 4R4FL 1TJHL 4Y7MA 2RGSA 3VW3H 4L8BA 4AENA 2YUWA 4N9GA 2BNRB 3T09A 5B38G 1WFUA 1AXTL 2CH8A 4K9EH 1VGKA 1IQDA 5DRZB 5GRZA 1XCTA 3IDGB 4RGOH 1DBBH 3CJJA 1F6LL 1QLRA 4LNVA 5H35B 3TESA 5DRNB 2V6HA 5F1SA 1U93B 1Z9SA 1X3DA 3CSYB 1CGXA 4LLYB 2LQRA 15C8H 2FJGB 4I9WD 4MAUH 4H5SB 3QHTC 3BX7C 4Y5VB 2AS5M 2BHYA 4M03A 5FYLL 5GGSB 3T2QA 4OCYL 3PHSA 4HC1H 2YZ1A 1RURL 5BO1L 3QUMH 3DHJA 5INCA 4I13B 4HWUA 4TUKL 2ZUXA 3TC9A 1FG9C 4GS7C 1OCWL 1CQKA 4TSBL 5TDNA 3FRUB 3JWNC 1SEQH 1ZHKA 5E5RB 1OM3H 3ILQC 4YHIB 1WEJL 1EHLL 4YHKH 2VXVH 4D2NA 5CMAB 3W9DA 4XGZB 1ZLVH 2XNAA 3VFMB 1T7WA 4QHUB 4XNZB 4R0LC 1LEKB 1C12A 3DX6A 2ED7A 3SCMD 4ORGB 5J1TC 3BJ91 3OF6D 2HFGL 3RGVA 3TPUB 5CHNB 4F3FB 1OP9A 2VKWA 3LB6C 5J9PB 4X6CE 2YD4A 5I6XB 4OAWA 4Y5XC 4H0IA 1TPXC 1DP0A 1OP3K 4WHTB 5FHAL 2AQ2A 3PE9A 4P23D 4U7KA 4YC2C 1GAFH 1UJ3C 3BUYB 5IHBA 4FMKA 4QRUA 1MCPH 2Q7YB 4EN3C 1I9JL 1F58H 4ZXBB 3BXNB 4CVXB 1W0WA 5DJ2A 2XG4A 1R3KA 1S7VB 3QUYA 4PJGA 1QEWB 2OLDA 3MROB 5EO9B 1RZKH 2W0FA 5CZKA 2LU7A 4ELMF 4L8SB 2R1XA 1QYGL 5SV4A 2FR4B 5CEZH 3H9SE 3MYJA 2EDRA 3T65A 4O2CA 5JIKA 3BEVA 4YIQA 1BOYA 4WV1C 3TT1L 5HYSA 4PJAB 1KN2L 2HN7A 4UQ3B 3BPLB 4IIQA 2DQEH 2ESVE 3SOBH 3TVMA 4M48L 1XGUA 3O2VH 4FNLL 1YMME 1BX2B 1U8HA 4LSPH 2I9TA 2PXYA 2O61A 3H42H 4KTEH 1CFNA 3QRGH 4I2XA 2PTTA 3LQAH 3MUJA 4CU7A 2ORBH 1KCUH 4GKNA 2MFNA 5JMRA 4Y2DD 5FDWA 1ZHNA 1JWUB 3ULUD 4HPOL 1VADA 4G8GE 5C0CE 2YA1A 2EDQA 2Y4SA 1MUJA 2D2OA 2V7NA 3W0WD 5ABDE 1GGCH 1NJ9A 4ZYKB 2R15A 2WV3A 2KZ1B 2BDNH 1F02I 3FO9A 1GH7A 4QRPD 4YDJB 5E6IB 1JTOA 2VXUH 3PJSA 5FUCE 4I77L 1WZ1L 3QQ4B 4XVJL 4GRWH 1LO3L 2OR8A 3ETBF 4JM2C 3HLAA 1WICA 3UJIL 2ERJB 4OZHB 1U3YA 2H9GA 3VGBA 5I1HL 4LCWA 1P53A 3TBVB 5DJZB 1CS6A 2XA8L 2X4NA 4AH2B 4NT6A 3GRWH 1XZ0B 1G6VK 1E28A 5IVXA 1OAXH 4P57B 5TGBB 4DKAA 4P5TD 5ESAA 1BIIB 3V6OC 2KDGA 2AK4A 4OLXL 4UV4H 1EPFA 4QTIH 4Z7OF 3ULVE 3H2WA 3ILPB 3DECA 3ZE1F 1QBMH 5DA4A 4HDIA 4JPVL 5F6IB 1XGYL 1VESA 1BWWA 3NZHL 1K8IA 2NY4B 3FQRA 4KDTC 4OM0H 4YBLB 4MAUL 3CVIH 3V0VB 2W65A 5DJAA 5GGQL 1FVEA 1T2JA 4PJHA 4A2MA 3SJVA 4AIXA 2DQIL 4NQSB 1KIPB 2D9CA 2YPKA 5CS7A 4PLJD 5BOPA 1KOAA 2DOCA 3TM6A 2E27L 4KROC 1BVZA 1HN1A 4MJIB 4PJIB 1P1ZA 3CAFA 4XI5D 3WS3B 3QDMD 1CDUA 1UCTA 3TH3T 1UFUA 5KS9A 1FO0B 1CT8A 4LPYA 2IANE 3RFZC 1SEQL 5TDPB 2IQ9L 2ADGA 2BVTA 3B2UC 1PKQB 1EHLH 3H9SD 4YX2L 3RY6A 5EFIA 1TQCB 3GSNH 2R23B 1DLHB 3QIWB 3NABH 3DGCR 5MERB 5HI3D 3LV3B 1A9BB 4P3DA 2OMBA 2PXYD 1FE8H 2HTKD 5KSBB 3NN8A 2O5XL 1EFXD 1Z9OA 2IFFH 4NZTL 3MSPA 1FGVH 4ZD3H 1MHCA 5FYJL 3C6LA 3F6LA 1QA9B 1G7LB 4YQXL 3B3IB 2MPAL 1RIHL 5JA8B 1I9JH 2WWKT 4OD3L 3AAZA 1N64L 3HPLA 5A2IH 1IC7L 1CFTB 1G6RB 4LLUA 4M61A 3HAEH 5C07D 3EOYG 3OV6A 5F6HJ 4U1HB 3RVTC 2QSCL 4I18B 4ACPA 5C9JA 1V7NL 2AJXH 5E95B 4M5ZH 3IYLW 2XKNA 1KB5A 4EI6B 3WKMH 4HFWA 2AABH 4Z0XB 1J1OL 1JPGB 3ULUE 2W0KA 3V52L 1I8MB 4Z78B 4RZCB 4KTEL 4XNMB 1LD9B 3WJJA 5SWZD 3RWIB 5F88B 4WU5B 4PLOB 3LSOB 5D7KE 1TDQA 2CDGB 2FECI 2R0ZL 5J3HC 2XZAH 2ERJC 3KR3H 3T0EA 4Z77A 4IRSA 4I3RL 3BPCB 4Z76A 4OAWB 3VI4E 4U6VH 3MA9L 3L6FB 4MDJA 5M94B 4HH9B 1F4WL 1G7JB 2WUBL 3FFCE 3MRLA 2FBJL 3GKWH 4P3CH 3UTQA 3HE7A 4R90L 3PWNB 1NBZB 1FCCA 2VC2L 5HVGB 4KRPB 1Z5LA 5DMKB 1WZ1H 2X1PA 4L8SA 4LMQE 1QRNA 3UYOD 4UINH 1D5MB 4OKVB 3MRPA 2V7NB 3W0WE 3G5ZB 3MYJB 2V5TA 4Y16A 3ARYA 4ZPTB 5I1HH 1YYLL 3S3SA 5DGQA 4FHBD 5FO8B 3MRNB 4KAQH 1AD9A 4CAGA 2VLME 4RBPH 2Q8AH 2Y5EA 1JN6B 4GRLB 4G6AD 1MNUL 5DD6A 1U92B 4PJCE 4HS3A 4H8WH 3U46A 4YPGB 5BZDA 5I1EH 1F4HA 2Y07L 1S9VA 1KPRA 4N8CH 5JMOC 1S7RB 3WDJA 2HJKA 2JJVA 3OAUH 1PAMA 3O4LB 3V6ZB 5IJKA 1A7QL 4P2CG 2M1KA 2NXYD 3IETA 3D3VB 5HHOA 2VLLA 3QUKA 1N4XL 1MWAB 4JGMA 4WTWA 1E6OL 4K2UL 4Q9QH 1I7ZB 4L9LB 2VZVA 4KQ3H 5MEOA 2B2XL 1F3RB 3TV3L 1INDH 1TZHA 1RFDH 5F9JA 3RU8L 5DVMA 2HFTA 2F8VA 2GTZA 4PFEA 1KT2A 4MNQA 5FAAA 2W65B 2VRAA 4TVPE 12E8L 3AS2A 3T4YA 2CO7B 3QJHA 5IHLB 4Z7UF 3TBYB 3UTSE 4M8QA 4JRYE 3IU4L 1IGJB 2YBRB 4MCZB 4EXKA 2YPKB 4G42B 1U58B 3PHOA 4PJFB 3K8LA 4PJIA 3OX8B 3SDAA 2CLZA 5ESAB 5EIVA 4PLNC 2I60H 3ES6B 3I6LE 1AQDB 3SDCC 5I18H 5D1QA 3LN4B 1HI6A 4NKMA 4ODHL 2O5XH 1AGBB 3EZ8A 1FFNB 4FG6D 2IFFL 4NZTH 1A14H 2R4RH 4GKSB 1R3IL 1GGBL 2HVJB 2PW2B 2DQGL 4GRWB 3BW9B 3VCLB 1JVKA 1QFOA 3BKMH 1RIHH 4X6DF 2HRLA 1CLYL 3BDXA 3LCYA 5TFSL 1X5JA 2VZUA 4MWFA 2GSIB 2VN4A 4JGJA 5SWZE 1MHEB 2VDLL 1LE5B 1PG7L 1N64H 1HSBB 3MA7A 3LEXB 1L7IH 4M7ZC 4HXAH 5FUOH 1N8ZA 3O6FA 3O3EA 5DLML 4R0LA 1JTPA 1T20A 2UY7A 1R3HB 1CR9L 3C87A 2WZPD 1G7LA 1FL3B 1LO0L 3FT2B 1FAIH 2J4WL 1N0LA 5EUOB 3FQXA 3EFFA 4Y5YB 3NTCH 1JYNA 2Z9TA 3TO4D 3WKML 4FQPA 2Q3AA 3IDMB 3ZKXC 2DQUH 1AY1H 2ZCLL 4C55A 5C09B 4ELME 1EZVX 3MXVH 5FYJD 1FNEB 3KS0H 2QEJA 4YHZH 5GZND 1X5YA 2XWJB 5GIRB 2EH8L 2I9LA 1KB5B 3QPQD 5J7CC 3HC4H 3WFCH 2DL2A 1YEJL 4MXVF 3R4DA 1IGIH 1MJUH 3VMPA 3HCVB 4RAHA 1QA9A 1ZE3C 1DSFH 4XCCL 4KY1L 2V2TB 3K4DA 3L5HA 3IJHB 4HFUH 4MHHG 4FTVB 3CFEB 3NAAL 4WO4B 2UWEA 3I75B 2X7LB 5D96B 1I7TA 2V2XA 1AH1A 2FEDD 1HNFA 4BH8A 4UINL 3LPFA 1OOAA 1IILE 2BOCA 4F9PC 1SHMA 2Y5TB 5GGTL 5KSVA 2AW2A 5MHSD 5L2KA 1NBZA 1QBBA 2IPUK 2J6EA 4ONHB 2X4PA 1NMAH 2V2WA 5GJSL 1QFUH 1CFBA 3DTXA 2YC1B 2X70B 5GRJL 3T2OA 3FMGL 3GMQA 3QXTA 3ZE0F 3D18A 1BQHG 4E9LA 4K3DL 3RVVC 4XH2B 4WNQA 2CDFA 3FN3A 4MQTB 3FB8A 1KB9K 3UBXG 3GNML 1TETL 4BELD 3R0MA 4G6KL 3U9PL 4L3EE 3UO1H 3QWOA 1SM3L 3WFDL 4D9RD 3P30H 2VSDA 1MCLA 1H3WM 5AWNL 2YS4A 3LKOA 3QZWB 4M4PA 3BAEL 2GFBB 4AEHL 4Y5VC 4FQQB 5FB8A 3IAGC 2J3SA 1WIOA 1WCBB 3BGMA 4MB3A 2FBOJ 4X5LA 5IW3A 3T0VA 1MCQA 3PDGA 2NY4C 3MGOA 3ZKXB 4EKXA 1ORQB 2VDRL 3CK0L 1JNNH 3P4OA 3N50A 2ITDB 4X7DC 3BIAX 1H15B 4Y16B 4TVPH 4BYHA 2BNQB 12E8H 3MR9B 3MRNA 4FQCL 2JJSC 1P7QB 1GOHA 1YJDL 5K9QG 3HR6A 2NW2A 2ZKHH 2IH1A 5DMIL 3HMWL 4ZSOB 2R29H 3IU4H 5E70A 2HP4A 4UILH 1WBYB 3QIUA 1JN6A 3KPQB 1AC6A 4KI5E 2UVFA 5EZIL 5LXGH 4GAYA 1VERA 2X89D 4GBXA 3WO4C 4BSWA 4OSUH 2RAMA 3QXVA 1AFVH 1ZANL 2BHUA 4Z7NE 1JFQL 3I50H 3SE3C 1FC2D 1UQSB 3HFMH 4HUUB 4NQTA 5JQ6H 1SBSH 3KS0J 3O9WA 4OZIF 1NMBL 5DJXA 1BF2A 4G42A 3WFEL 5HPMA 1G7IB 5D5MB 1DUZA 4KHTL 1A1NB 3B2UD 2PYED 2HWZL 4OCWH 3FO2B 2WNGA 1VGEL 5J11B 4PJFF 3HZKA 3L9RB 3GHBL 1DR9A 2BRQA 2UV3A 1NLBL 2BVOB 1W72B 1GVIA 4OZIB 4HMDA 4LKCA 4OBRA 2ZWLT 3WFHA 1P9MA 4JM4L 4E41D 4RQQA 2Z35A 1EGJA 2BNRA 5GS2D 4LIQH 3S6CA 3BPOC 4FABL 4L4TA 4HKJB 5C6TL 3FQUB 5JHDD 4PRPE 5FO9B 1K4CA 1FDLH 1XF5B 5D93C 1FYTA 1I8IA 4NYLB 1JWSA 2DQDH 1NCWL 5EIQA 4I4WA 5KAQG 4U6HA 1Q0YL 4ZO7A 4K94H 4JAMB 4L29B 3VXME 4JQIL 4UQ2B 5C0CA 3JUZA 2P5WB 3KPMA 1FZMA 4YHZL 1RHHA 3HE6B 1G0YR 2DQCH 3QNZA 4HIHA 3A6BL 2BMKA 2ZOKB 3REWA 1I3GL 3ULSB 3B5GA 3B9KC 3X13B 2EYRB 4YXKL 5KVDH 5DMJB 4JFPA 5L9DL 4GRMA 4XPTL 4Z18A 4PJ5D 2P5WE 1A4KA 4NN6B 4FQXA 4QOKA 4N5UA 3HG1B 4XXCA 1H8NA 1NGQH 5F7EL 3SGDI 1XF3B 4I0PD 2BC4A 3S96B 1MCCA 3E3QC 2QADD 1A7BA 5E6IC 3EHBD 3N1GC 1LE5A 3CMOH 4R97B 2NPLX 4KK8D 2P8PA 5I19H 5I30L 3IF1A 1AGDA 4IOIA 4P9MH 3TZVA 1URLA 1J86A 1GZPA 4J3UA 5C0BD 1MFAH 5I6XC 3O6FB 2PKDA 5E1HB 2EDJA 3WO4B 3FOMA 4D9QE 1DTUA 3MYZA 2W9EH 5AZ2L 4QHUA 4QHLA 1U8NB 3PHQA 2JB6B 3HA0A 4A6YH 1YEDA 4J6RH 5LAXA 4UTAH 1HIMH 1MCWM 3DGGA 1RU9L 3DVGB 4RGOL 4WO4A 4JFEE 2ZG2A 4NM4H 1R6VA 1QFUL 4LCUA 4OT1L 4OFYA 2EXWD 1P2CB 3PWVA 5FUCC 2M8XA 2Q6WA 1G9NH 3EOTH 3F6IA 2EXWC 4JRXD 3LQZB 1UACL 3OPZH 1UH4A 2HFFB 5GGUB 4NP4H 5FECB 3TNNA 4F7CB 4K94C 5T1DH 1SM3H 3WFDH 1DL7H 1T2XA 1I1YA 5D7KD 5IT2L 5AWNH 1G9MC 3WLBA 5CJ5A 3H7LA 3HUJA 3BKCH 3O8XD 3P4NB 1EMTL 2VDML 5FK9B 3GM0A 4MQ7B 3X17A 2IGFH 3MV8D 5FKAA 1CGUA 2HKFL 3WXWH 3FHQA 4L8DA 4UB0H 5F1IA 3CFEA 1TJHH 2BVQB 1OM3L 3OJVC 4HD9A 2F54D 3U79A 1ND0B 3DETC 4XP4L 5EZLB 3RQ3A 1BJ8A 1A6ZA 3TCLA 4O58L 3GMMB 5D1ZA 5HVHC 1KCSL 5E4EB 4OLVH 2IAMB 1DBBL 1F00I 4OFDA 3WE6B 1WVZA 3FZUC 3G9AB 5I71B 3FJTA 5IB4A 4M8VA 3BQUC 3FB6A 5GS1B 1A7RH 4UDUB 3EW3B 3UAJC 1GAFL 1IGCL 1U8OB 2BERA 3HZVA 3QWRA 1EEQA 3BWAB 5T3ZD 1EO8L 3E2HB 5ANMA 1F58L 4HKXA 1AFVL 3V8OA 1NCUA 4HC1L 3SCMC 1BWMA 4Z7WE 3T3ME 4AEEA 5HGDA 5KTEL 4OGXL 4LPVA 1ZGLA 3HUJF 3S9DB 3QIUB 5DK0B 1IEBA 4HX1B 1N7ML 4RISH 3DYMA 1RZFL 3L3GA 3TN0C 4BSWB 1GJIA 4X5WA 2GFBA 1DQJA 4PY8J 5HD8C 3ZDXF 4WENB 3H9SA 4NIKB 4MYWB 5A16B 1VSCA 3BWUC 1V3JA 1IMHC 2WIMA 1C16A 1X5FA 4TSCH 3KDMA 3O9WB 4I8DA 3CLEL 4F8TA 4U31A 4Y1AD 5F3HB 1A1OB 4NJAH 4X9HA 4P2OB 2AJSL 3GMPB 4HV8B 4M9PA 5C0ND 1IBGH 1YZZA 3B9EA 1BZQK 4PJIF 4X4XB 2NW3B 5BV7L 2DD8L 2JCCB 4NQEB 3VFPB 1JHLL 4S2SB 2DIAA 4XMKL 5T1KA 1HDMA 2DQDL 1QOKA 1NUGA 3BDYH 4HCRL 3KPSB 3FQRB 2FJHB 2JB5L 3JTTA 5FEBA 4HKJA 3V0VA 1CVRA 1AO7B 4FQHB 1NCBL 4JRYB 3NFPB 1RZKL 1R5WB 4ETQB 1I3GH 3T08A 1EUUA 3OKKA 3S5LB 1A1NA 3K7UA 1S9KC 2W91A 4FG6C 3SE9L 4X5XA 5FHBH 5JPNA 2HVKB 2PYEA 2VZ3A 2WBKA 3LEYL 4NUGL 1BQLH 4GSDL 4Y19A 3ULUC 2R1WB 2XWBA 3EFDL 1I1FA 3VGAB 1MFCL 1JIBA 2YHGA 1HINL 4XP6H 4F15B 4GG6B 1RI8A 3PP4L 2OI9C 4LSPL 3MV7E 1OAXL 1UKQA 3FB5B 3D2UB 3NCYS 4RQQB 4E41E 1HWGB 3UEZA 4I3SL 4U1IB 5AZ2H 2BVPA 2N56A 3PGCA 5CJ8A 5ICZA 3EO9L 4WU7A 1TZIA 3C8DA 1LDPL 5CBAB 4F33A 4LGSB 4KXZI 4I5BB 2Y23A 1XGYH 5DS8B 1FJ1B 1FSKC 2PYEE 1MHCB 1JNLH 1PVHA 4HKBB 3SE8L 1INQA 4P9HC 4G80A 2D7TL 4NO5B 3VXPB 1UACH 3P4MB 4O9HH 3VFRB 3V5DB 1KB5H 4WEMB 5HHQB 2XZCH 4PJGE 3O2WL 1CE6B 5HSFA 3O11A 2B39A 2E27H 4U1HA 1TCMA 4FQIL 3STLA 3MLRL 3N1PC 4ZUSB 3LEVH 3NFSH 3T3MF 5I8CB 4Z7WF 3GZKA 3FO0L 2FGWH 1A6AA 4MD0B 3FO1A 2NLJA 1JPGA 1FBIH 5D71L 4OB5L 1T03H 4NSKB 3HUJB 1GRWA 3D69B 2NY7H 5DMGC 1MHPH 3ARBB 5C07B 2E3VA 2YRZA 4NDMA 5GZNC 1MLBB 2OSLA 3QPXL 2P46B 1P6AB 1ND0A 2B8OT 2H1PL 1GC1C 1NGXB 4M7LL 1ZT4A 4XCEA 3H9YA 2Q6WB 5KSBE 1DBMH 3X3FL 4HH9A 5I76A 1VKXB 4JM2A 5GJTH 4KKNA 3VXSB 1SJVA 1KFAL 4GO6B 1LK3L 2D03L 1U3HA 2F5AH 2A77L 5TE7H 1S9YB 1GGYA 1XIWD 4ISVB 1C5DB 4KU1A 1TNMA 2GK2A 5DFWH 3CPLB 4GUPA 4K3JH 2VMFA 4U0RC 3ZDZF 5GGVY 3UTTE 1ZAGA 1DBAL 4X0KA 3OKNB 4LDOB 4F7EB 1K3IA 3N06B 5I73C 2OP4L 2VDPL 4GQ9H 5DJ2B 3F5WA 3MRIA 4TTDD 4WFED 4A6YB 1P4BL 3CLEH 2X4TB 2OZ4L 1PW3A 4J4PA 1LNUB 4JFOA 4QXUL 2R0LL 5EOCH 2XQYK 4C56A 1ONQA 5I1LA 4JZJB 4P5KB 5HHXL 1IEHA 3SKMA 3RL1A 2APTA 2HH0H 5IF0A 2FDBP 2XA3A 1B6UA 5GPRA 3SQBA 3U4EA 1JZ2A 4MA7L 3RVTD 1A7OL 2XTLA 3BGAA 4MMXC 5IHUL 3SKOB 3D3VA 4YQXH 3BDYL 4XC1H 3CZJA 2VERN 5F96L 5IBTL 4J3TA 2OR9H 2BX5A 2VOTA 4XTRC 2NW3A 3UBXA 2ZUSA 5IB2B 3EKCA 4NBYB 3CNKA 4H25A 1UJTA 3ARGB 1JNJA 3QDJB 4M6NL 2HYMA 3HRZB 4HJ0D 2A6DA 2C5DC 4YHLL 3I02A 1Z3GH 3MGTB 3JTSA 5EC1A 5IOPB 1HKFA 3TEUA 3JZ7A 2C1PB 3L3GB 4PB9H 5IMOB 3M45A 1J0ZA 1YYLH 4M7JH 4PJDF 3X14B 4X6EA 1NSNL 2P8LA 3RY5A 1R5WA 2BY0A 5C2UB 4MXQC 1W8NA 3PJSB 4P4RA 4Y8DC 4HHAA 1KIRB 3DYPA 4Y4HA 4JFHE 2VQ1A 5FYLD 5IM7A 4H8WL 3L1OH 4OFIA 2H9GB 4TQEL 4N8CL 3FFCB 1MI5D 4YE4L 1HI6B 4CRPA 1DDHA 4Q9RL 1MF2H 3MA9H 5IIEB 2E9JA 1CLZH 3O4LD 1BFSA 1JNLL 3SE8H 1AD0A 5F1KC 3IU3B 5CBEA 3R1GL 3U82B 4AL8L 2BJML 4DKFH 5MEQB 2JCCE 3C60B 4JEGB 1VB9A 5JPMB 3BIKB 3O0RL 3HS0A 5L8KB 4KQ3L 2W92A 2X89A 2VDKH 5A40E 1B2WL 2NMSA 3LH2L 3ILPA 3TJHC 1JWMA 1EDQA 4IMLB 4XMPH 1LQSR 1T1XA 1AXSB 1D6VL 5DEGA 4FFVC 2DQJL 2HVKA 1RVFL 1RUMH 4LCCB 1EK3A 3BP4A 1Q72H 1WF5A 2P47B 4MJ5B 3LEVL 1CG9B 4MQSB 5SWSD 5F7KC 4PJ8B 1TVBB 2OM5A 1T0MA 1IQWH 1N5AA 4Z7NF 2GJJA 3GKZA 4QT5A 4PJHB 3MLUH 1BFOB 1F97A 5INCB 2AV1B 5LGHH 4LVHC 2VQUA 2VABA 4NWUL 3QQ3A 4KTYA 2BVPB 2NY7L 3L7FB 4PB0H 2O93L 5DJCB 5BXFB 5AEAA 5JORA 2ITCB 3SDDC 1CU4L 4I18C 3CD4A 4FFYH 2P5EA 43CAB 3VFNB 1T1ZA 5IVZA 2X9XA 4OUUA 4F57H 5IBLD 3DYOA 3EYFB 2XY1A 3RPIA 3QDGA 4ZXBD 1PKQA 2DICA 2JIXA 3P9MA 1ZLUK 1HNGA 5DJ8A 5I9QB 3Q3GB 4MNGB 4WUUE 4CMMA 3HNSH 4XP1L 4S0TD 3F7QA 1T2QH 2FWOB 2NY1C 1HOCA 2PN5A 1U8PB 3TP4A 1A6UL 3QT2A 1BZ7A 4HXAL 4ZUTB 5F70A 4WHTA 1ZWIB 3MFFA 3SCMB 1KBGH 3BD3A 2BOCB 5J56B 1KENH 3X11A 3QUZA 2ZSVB 4PRNB 2DKSA 2A6JB 4UOW0 1BEYL 2LE9A 1W0WB 5EB9A 3VGDA 5GS0L 4MSWA 5FA4A 4CN1A 3T0ED 5I8CA 1S9YA 1NCCH 4PJGB 2VDPH 2EE9A 4P23A 3RTQD 3JV0A 2A1WH 1PLGL 5K9JL 5IMLB 4JO1L 3I6KA 5CSBA 3DTXB 3QXAB 5I8EA 1I8KA 4HGWB 3UTTD 3QUZC 2R0LH 5EOCL 2ILLA 1CL7H 1EVUA 1BZ9B 4UUJB 1S5IH 4FZEL 1NAKH 4RGMB 1J05B 2R2BB 3U36B 2GT9A 3MRHB 3HI6H 5DJYB 2VLRE 4OD1L 1F45A 2CIIB 1AIFA 4NFCA 3WFCL 4UDTB 1RZJL 3RP1A 3EJZC 5DD3L 5T3XH 1LGVA 3T0XA 3OKOA 4ODWA 1KUMA 1M05A 5DSCB 3QUZD 3NH7H 1VDGA 3DX9B 3QR2A 3HE6C 1CFQB 1NFIB 1R24B 4XZUA 1DVFB 2KBGA 4Z78A 2QHRH 1A47A 1RJYA 3GHEH 1IKNC 1L7IL 5FUOL 3K0WA 3MRQB 1JWUA 4EJ1C 2M2DA 5D2NA 4YHLH 4B7IA 3E0GA 1IAKA 3WEXA 3R8BB 5C1MB 1T22A 4MXVE 3PQYD 2JIXD 4KQ4H 3VGEA 3UBXB 1S7TA 3TBSA 2WBJA 1RUPH 5KG9B 3QEQA 5F21B 4R8WH 3H0TA 2ARJQ 4YDLC 2V9TA 3RAJH 3ZHLA 3CZFA 2R4SH 3MXVL 3GSWA 3GSVA 1ZVSA 3EUUA 4GW4A 4GAYB 4TYUA 1H3XA 2PO6D 1G6RH 4NCC1 4DVRH 1OGAE 4YGVB 1LVEA 4WFFE 3K3QA 3U9PH 1BQUA 4YEEA 1U91B 2JJWA 3G5XA 1NL0L 1MF2L 4Y4KC 3VXNB 5AUMA 4QRSB 3ARGD 4TVPD 4CU6A 2JF1A 2RCSH 4P4RB 1K5NA 4K7FB 4LCCC 4Y4HB 2BY1A 2KL6A 5JOFA 5AYQA 4N0FA 5I1DB 1EGJL 4YWGL 3VWJC 3O4OB 5MEPA 2VDKL 3SPVB 4JZNB 4OQTH 2BVOA 3QDJA 3UMTA 2GTWB 2OQJB 5KSAC 2V17L 1ZS8B 1IKFL 4X6DE 2FB4H 3IDJA 3MRRB 5D7LA 1KPUA 1SY6L 5C0DA 1B88A 4L5FL 5D1XD 5IOPA 2J8UE 4ZTPH 1KCRH 3SDAC 1RVFH 3QEQE 4E41A 4LQ1A 4DAGL 4PJ7A 4OZHE 1NMAL 1FGNL 2YUXA 4U6XB 1H3PL 1YMHB 3H3BC 5F9WC 4ONFL 1IJ9A 3DVNB 4NQDB 2DLIA 1G9EA 1T1YA 3KLSA 1UM4H 3KXFB 4HWEL 5IQ9A 1QSFE 1W2KT 2NY6B 1NFDE 2NY6D 4GRWF 1UB6B 4ODVL 1KEGH 3L3IA 4ZUUB 5CZXC 5FUZH 4LQFL 3W11C 1J0HA 2MNUA 2R2EB 4XBPB 4CDGC 1MHHB 2V9QA 3CH1B 4Z7UE 4WHYH 2WIIB 3RBSA 3BKYH 5DWUL 5IIEA 1NMBH 5D1XB 4WW2A 3H6JA 4BKLB 1GPOH 2F9BT 2X4QB 5CWSB 1E4WL 4GRMB 4FQ1L 2VJXA 1K6QH 1KXVC 1QP1A 4P2RE 4NZRL 4LARH 3VXSD 5IVXE 4ODBD 1C8PA 3VFWA 2VXQH 3CCHA 2C9AA 4CW1B 3MRBB 3JV5A 2CUHA 3U83A 1T2QL 2EDEA 4WI9A 3IVKA 5C7XL 4JFZL 3V6BR 1CXEA 1ZHLA 4TNVK 5JXAH 4DGIL 2P8PB 1JNNL 4LSQL 2IJ0C 1ADQA 3WBDA 3U7AA 4DCQB 4NN7C 3AB0B 3K2UL 4P46A 1CDBA 2NCMA 4PY8I 3OXRB 4YXHL 4S1SL 3GIZL 3EZJB 4NO0B 3P11H 3VWKB 4O4YL 5FV2A 3HMXH 5JW4R 1KULA 2GITB 5C0JA 4KUZL 3BPNB 1YUHA 4MJ6B 4LIQE 2R29L 1P4IH 2PO6B 4XNZC 3RVUC 5DFTA 2HLAA 4HG4K 1NBYA 2A1WL 1WBXB 1XCTB 3CFIC 4K94L 4P2YA 3I85A 2BNUA 3LEXA 4OSUL 4JQIH 5H35A 4F7TA 2FZ3B 2CPCA 1AKJA 3GMOB 5DD0H 3QHFL 4R0LB 1R3HA 4M5YL 2VLKA 5FYKD 5CEXB 3JWDL 2ZCKH 5F97E 1FVCA 5EA0H 3RNQA 3C5SA 1HYSC 4GG8B 5E5MB 4ALAL 2FECL 4P2RA 2W9LA 1X4XA 4XPTH 4YC2B 5C86A 3OXSB 2F8OA 1P7KA 4G8GD 2I07B 4GJTB 4ZXBC 5C09A 5CEZD 4JDTH 3V6FA 4XPGL 5DHYA 1KC5H 2FWOA 3RKPA 3H3PL 5F1IB 2AXGB 5I1JL 1EJOL 1I7UA 5KW9L 4N8VB 5LG1A 2CKNA 1JV5B 4M93C 4M02A 4OCLC 3W5NA 5EZLA 1JUFA 2W9EL 2EE6A 2ESVD 3CVHA 2I5YL 4PRNA 4QXTB 1FDLL 3GB7B 4MZ3A 4G8EB 4P48A 4KK6D 1OTUC 2EC9T 1UEMA 4UTAL 4X7TB 5K59F 3GDBA 1KYOK 4W4NA 3FB6B 4OT1H 2GAZB 3BT2L 4UZGA 4AIOA 4WWKA 5CILL 4ZFOL 4YFLF 5F89B 5L88L 4JO4L 1UM5L 1E6JH 4E42B 3MV7D 4YZFE 5EOCJ 4QHMB 5I0DA 4ZUVA 5C8JA 2C7UA 3SO3C 2GT9B 3MRHA 1TCRA 4YXKH 4X4YA 3RZWA 3KNBA 5CP3A 1AIFB 5GHWH 1MAMH 3CXDH 4S1RH 1J88A 3UPAA 3DSFL 3MODH 1UADC 3LD8B 4K23H 4MD5A 4PRHB 5TF1H 3FT4A 4ODTL 3O3DA 2YC1A 4RX4D 2GUOB 1ZKAA 4RMSA 1OWWA 1U92A 2FR4A 2YN5A 4ZS7H 2P49B 3L3KA 2V5SA 1MRDH 2IGFL 1IEAB 4TRPL 1D6EB 4NC1C 4HLZG 4KGJA 2ICWB 2B4CL 1OSPL 5EU4B 5DZOA 5K59E 3RDTD 2OTWA 2FB4L 4MJ2A 1IGMH 1ED3B 3EDFA 2GYSA 4K8RH 2XOTA 2F74B 3OAYH 2LTQC 4LVNB 3ARDA 4HUVB 1I7ZA 1RZJC 2GK0B 1Y18B 4NM4L 3H7BA 4LCIH 3P73B 4ZQKB 4KVCH 4NCDA 3RUGA 4XX1E 4NOFA 4WV1A 4JG1H 5BV7C 3ZTNH 2DYPB 1T21A 4UIKH 2ED9A 4PJXA 4Y89A 4POZD 4LQFH 2DQFA 4QF1B 4WI2A 2F5BL 3GMRA 3MJGX 2ZCHH 4XBGA 5F71A 3OTTA 5SWSB 5EIIA 1S5HB 4G43A 4LAQH 5I66A 3NA9L 2ADIA 1I8LC 1HILA 5ITFA 4GXVL 5IT2H 3BESR 2NW2B 5B39A 5T3ZE 1EMTH 2DBLH 1FNGA 5HTSA 2P42B 1QPPA 1EO7A 1NDGB 1LO5A 1X4ZA 1QSEB 4JO2L 4N0FB 2CUMA 4JCLA 4CVZB 4N8PA 4EQ2A 1U36A 3IDYB 5IK3A 1DEEB 3SPVA 3VGGA 4P4KB 2VR9A 2BY3A 1ZMYA 1FFNA 2IH3B 2WWKO 4DJMA 3C5ZC 1F4XH 4UT6L 4Y5YC 1WFNA 3FB5A 2C3HA 2PW2A 1C08B 1DN0B 4YO0A 1JZ5A 1G7IA 8FABB 4P57A 4X9IA 4P59L 4KRMB 2QV2A 1D5XB 2F54B 4M7ZB 3HZKB 2AJ3A 2JJTC 1QO3A 3LIZL 1DJSA 3B9KA 1G84A 2Z0BA 1DQML 5DRNA 3KWWB 3RVWC 3G5YA 5CJOH 3AMKA 4NQED 2JB5H 1LHZA 2ZSWA 5AZEL 5HGBB 1EV2E 5GGSA 3EGSA 4IDLA 1Q9OB 2OZ4A 1HXYB 5FF6B 5DHVA 3OKLB 1KNOB 1N7MH 3VWJD 2PCPA 1RZFH 2VISB 1A6WH 4XHJC 3LPGA 3I84A 4JRXB 4L4VB 1XF2A 1FNEA 2YN3A 1JTTA 5CLWA 3ARGC 4KDTA 3BZFA 5FGCB 5F44A 3BRGC 2VDQH 4LP5A 5ECJE 2FX8H 1KJMB 4DQOL 4P2RB 3PGFH 4OZHF 1PGRB 3ARFB 3WUWA 5T3ZL 2CRYA 2J8UF 1C5BL 2D31A 1A4KB 35C8H 4UU9A 1TXKA 4U7MA 5C07E 3BRDA 3BKJH 3S96A 3KPOB 2VXTL 4QYOB 2B0SL 3VDCA 1UENA 4FP8H 5DT1H 1QVOB 5C0AD 3RZCB 2F58H 3QEGL 3CVHB 3BHBA 1V05A 2IAMD 3RY6C 3CFDA 3T77B 2WUCH 3BXNA 3MNVA 2XPGB 3MMEA 2Z93B 1J8KA 1U3HB 1PQZB 2LVEA 4KI5C 2YKLL 1KB5L 4ONHA 5E08H 3GSUB 1CGSL 2A74B 5KVMC 4R4ND 2F8XC 3HE6D 3OB0H 3OZ9H 3HNVL 2GI7A 3D18B 3DXAD 4X0KB 2PR4L 2B1HL 5JIHA 4KTDH 5C8JB 1IFHL 3GSQA 4M43L 5IJVB 1YJDC 1U8MA 5EOQH 2F53D 3IRZA 1KEMH 3EYVA 3RL2B 2OL3B 3PP3H 2H6PA 2WAHA 1KG0A 2HG5B 5DQ9A 2EDLA 2VLKD 4JLRA 2E9BA 3R06B 5I74B 1HSAB 3ARBD 4X6CF 3D25B 3K46A 4WUUB 1KELH 1A9EA 5DUMH 3DRQA 1N59A 4M7LH 1S8DB 1JGEB 4CBPA 3TO4A 4WWKB 1JK8A 2BVUA 4OIIH 3U9UB 1TJGL 4YUEL 3I2CH 5DDHA 2FD6H 3DMMB 3FB7A 3AUVA 2UZIL 3C09B 2HT2D 1SBBA 2ZCHL 4YR6A 1FNHA 5EU6D 4N90D 3NIDE 2VWEC 4PRPA 4UV7L 5HDBE 2WM0A 1GGIL 1OCWH 1T21B 3T2PA 3MZGB 4IRJD 1U8OA 4ENEC 2FO1A 3TBVA 5IBLC 2FGWL 1DUYA 4NO2A 4WCYH 4HKXB 5DTFB 4PJ5B 5LVEA 2RQ8A 2VXVL 1RJZB 5J12C 5JW5A 1XR8B 4M7KH 3GSRA 3RZCC 4KMTL 5ETUB 3ARVA 1EEZB 3OG4B 4JPWL 2H32B 3CDGB 3PIQB 3FOLB 2AXHA 1HH6B 5D72L 5EOTA 1TTFA 3S97C 4ZAKD 5CKGA 4P59H 1M7IA 2O5YH 3QPXH 4AT6B 5JOEA 2FCBA 2AXFB 3VGAC 4NJ9H 5CZVL 3G04B 3V4PL 1Q9WB 3GJFH 5GXBB 5F3HA 2NXZD 3RNKA 5IESL 5ESQA 4MA3B 3JWOC 2DS4A 4M3JA