1PM4A

Crystal structure of yersinia pseudotuberculosis-derived mitogen (ypm)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
b'IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGLSWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YPM
publication title Crystal and Solution Structures of a Superantigen from Yersinia pseudotuberculosis Reveal a Jelly-Roll Fold.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Toxin
total genus 28
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09144 YpM Yersinia pseudo-tuberculosis mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.510 Mainly Beta Sandwich Jelly Rolls Mitogen Ypm 1pm4A00
1POQA 1PM4A
chains in the Genus database with same CATH superfamily
3FLRA 1PX3A 2WT2A 1N1VA 1LHUA 5KXCA 1GZWB 2UWCA 1SCRA 1J58A 1WW7A 2IFWA 3D3AA 3V0BA 1RTVA 2BYVE 2MHFA 4Q4X3 1XB9A 3ZFEB 3WINE 4QQOA 1UW8A 4CYDA 3L2YA 5LATA 4QAWA 1S0JA 3N36A 2A6XA 4LT5A 2D97A 4AFDA 2PHXA 3O1RA 3CEWA 1AXKA 4FBFA 2ARXA 1S2BA 1PZ7A 1SPPA 2HWD1 4AEKA 1DQ2A 2V4AA 3LWCA 3APBA 2MNGA 4EROA 2ZGQA 2ZX4A 3NV3A 1W8WA 3N9MA 5FXZA 1MS0A 5FZBA 4NIIA 4WM7B 1UMZA 3H1YA 3O12A 5K0UC 3BUCA 4Z82A 1FMD1 2D3RA 2PYTA 2ZABA 4X6QB 4XQDA 3CMGA 3JB8A 3ZFGB 4YW3A 3FBMA 3O1PA 4WVMB 4D7SA 5IVVA 2A6VA 5ACA1 3EXUA 1GP4A 4OULA 1NLSA 4U2AA 1HRV2 3BTAA 2ZGSA 4HSLA 3BVCA 2ZGLA 1QHDA 4HPKA 2VOTA 3VBSC 3VBRC 3UL2A 1BK0A 3P6BA 4K1ZA 4PT6A 5A7QA 5JSOA 3PIJA 3Q8BA 1R1A1 1V6KA 1G9DA 4JGYB 3SCFA 3Q8CA 4QPIA 3VZMA 1RUG2 5FPAA 2VBDA 1RYYA 1QQP3 1S0CA 4LXLA 4QB1A 3ZSLA 4CRQA 2JG8C 1REFA 3ZXAC 4M4RA 1NUKA 3VKOA 1JTZX 2WNVC 2AUYA 3MDPA 4N53B 4TZDA 3CKHA 2VD7A 2WFPA 4RQPB 3T0AA 3RZGA 1F5FA 2PLV1 1X50A 2QKDA 3KF3A 5EWSA 1VP6A 2XJQA 5GLTA 5JZGC 4FPOB 5LRSA 2B9VA 2J1TA 4IESA 3VZJA 4DUXA 5I8TA 5C9AC 4JTOA 3G7DA 2A70A 2WNUC 3GHNA 3KT7A 5H9QA 4COWA 2CGPA 1GZWA 2YYOA 3DYMA 4M4PA 2ZZQA 3PJQA 4NHYA 3VD9A 3JBG3 2J1UA 4E8DA 5LA9A 4HKWA 2YPJA 4BXSV 4LHLA 4IE0A 4XW3A 5C6CA 2VMCA 3LSEA 4CDUC 5T50A 3I2OA 3ZYFA 3HNMA 5EP9A 4AK3A 3V65A 4FTEA 4G3YC 1O3RA 3C7FA 3SXWA 1VRH1 2BNMA 1FPN3 1SFPA 1MEC2 2QNKA 2VZVA 1RXGA 3IT8A 4KG0A 4ONUA 2R043 2XHNA 4RD7A 3U75A 1V9U2 2BGCA 3J7MA 4M0NA 4QX2A 1PVC3 4INDA 4XF4A 5IW0A 3WCRA 1Y9QA 1AL23 4Y1UA 1YCIA 3AX4A 1CPMA 3TYJA 3ZSKA 3ZR6A 4WM7A 4QQPA 1W39A 2QQWA 1W3XA 2JDUA 3WW1A 4WM8A 4CDQA 4HK9A 4D7TA 4LO8A 1FAYA 3RYKA 5FCCA 4Q4Y3 5A6XA 1RMU2 3K3NA 1PO23 3FBYA 4ISRA 4TWTA 4J1XA 4QPGB 3WNNA 1VMHA 1XNKA 1UYXA 2A3XA 2D6OX 3C2UA 4IV3C 3T2OA 1JZ2A 2TEPA 4LK6A 2VZTA 2OXBA 3RZHA 4FPLA 1E57A 4MH0E 5FZKA 4P9LA 4RR3C 5FY0A 4KQ7A 4JQTA 1GQGA 1NE6A 3MBWA 4TTGA 4JGZC 4Y20A 5E1RA 2WR9A 4MGTA 2ZHMA 1JUHA 3G6JB 1ZA7A 1UPSA 1YYNA 3WUCA 4Q26A 4L97A 1OUXA 3GJAA 3BOWA 1YO8A 4Q4V1 3KB5A 2IXHA 2MEV3 3ACLA 2G9ZA 4HT1T 4A44A 2HWD2 1GP5A 4YVWB 5EV7A 1JBCA 4URTA 5BUVA 5A3OA 4NR1A 3AFGA 5LK5A 4IUGA 1YLLA 1QH6A 2DVAA 1W0OA 3MPPG 3V0AB 1OHFA 3FUQA 1G9AA 5C71A 4E4HA 3I97A 3IPVA 2YY1A 1OOPB 2WC2A 5DDJ3 1BKZA 4PQ9A 3WUDA 1FMD2 4M0HA 4XJ8A 4FPCA 3UYJA 3VL9A 1K5JA 4GAZA 4CP0A 1GKBA 4A7ZA 2WS91 1XXNA 2FCTA 2QE3A 2E26A 3KM5A 2VUDA 4I02A 3W5MA 1OFSA 3HNYM 5ACA2 1UZ0A 5SV8A 1HJFA 4YM3A 1NA1B 3ZKUA 2JKXA 2W94A 5ABJB 5CB7A 2R32A 3AZVA 1DGRN 3I8TA 5EIYB 4IL7A 2QQLA 5JPNB 3LAGA 2J7MA 4ET7A 3KQ4B 3RZZA 1J3PA 1UU6A 3ZYHA 1YNAA 1R1A2 1ZYBA 1W8FA 1XYPA 3LIHA 3R4SA 5BNQA 4Q1PA 4QPIC 3RYRA 2QDRA 4HVQA 1KRIA 2XJRA 3DV8A 1OFNA 2WN3A 1GNZA 4AQSA 3BTXA 1POQA 4YW6A 4FXKB 4AFBA 3VB9A 1MR5A 2OW4A 4KWJA 2PLV2 2YG0A 4CCNA 4FFFA 2RMU1 1CAWB 3WF0A 4LO7A 3R0RA 2WLPA 1S2EA 3QD6A 2XKOA 2NMNA 4ZHNA 2XUMA 1WW5A 4JHZA 2CGOA 5FY7A 2C6SA 2EF6A 4R9BA 3T2QA 4DZGA 1RVF3 1JYXA 5FUPA 4K6BA 4DXTA 2C26A 4C0HA 1Q8QA 2XBO1 1UO9A 3KMHA 3ZIXA 5KC6A 2XJVA 2VMFA 1TVGA 2Y6JA 3ZFEC 4NIGA 3SCGA 5FY5A 1BK1A 2VCMA 3AC0A 4S2HA 5FY8A 4K7JA 4FOVA 2JX9A 5JMOA 3BPSA 1H2MA 1J1LA 4IGOA 4CTEA 1KS4A 1VRH2 2W52A 1UX7A 2JXAA 1VAVA 1DQ1A 3HBZA 2CGNA 1GOHA 3H50A 4XBLA 3W21A 1JZ8A 3U1XA 2W46A 3AJYA 2BOIA 4G4FA 3TEXA 5IVFA 1S1AA 2DCJA 4NHXA 4CCEA 2WLQA 3T2TA 4P5YA 5FBZA 4FAGA 1XRUA 1RUJ1 5JDBA 1VLNA 2P6HA 3AMPA 2ID4A 3IWZA 4AW7A 2VNVA 3U78A 3V0AA 3E1F1 5EPAA 2HYXA 4YW4A 1VALA 5FMOL 3WG3A 2OT7A 3DKQA 3MIGA 3ZXGA 1TZOA 2AYHA 1PM7A 4WM7C 2CV6A 3A22A 3MEPA 3VHPA 3TBDA 3ZFGC 1U5ZA 1DGRA 4OUSA 3IN9A 5F3EA 1DLCA 2W9XA 2ADEA 3VBOB 1NA1A 2YMZA 1GLHA 1XNBA 2P6CA 3BCWA 3Q8FA 4JC1A 1C1LA 2ATFA 4YZ1A 1SDDB 1UF2C 4QM8A 4SLIA 5KR7A 2YFUA 2GMEA 3ZLIA 2D44A 5HV0A 4A42A 2AGSA 3ZXLA 5BV6A 1RC6A 2VZOA 3N9LA 2WSVA 4KWLA 5LBCA 4E4DX 2HWB3 3K48A 4EN8B 5D21A 2JDMA 4JGYC 1T6BX 3HN1A 1MVQA 4Q4V2 1OF4A 2WNEA 3OB8A 4BOWA 3UKVA 1OD5A 2BV4A 3AJZA 4JZRA 5E89A 4XIOA 3ZXJA 1CR7A 5FZ6A 5EXOA 1F31A 3S7EA 3OG2A 3FLTA 3ZYIB 1LU2A 1M4WA 1H30A 1O6UA 4N53C 2GSYA 3ETQA 2VO5A 1LEDA 5KBFA 3QACA 4RQPC 2GZWA 1C3HA 2V09A 1CAWA 4LTAA 4QU2A 4R8HA 1W6MB 2FDJA 2WWUA 3SC7X 3ZYJB 1Y4WA 4FOWA 4E8CA 2PHFA 2GC3A 2W5FA 1CX1A 1NAEA 5CG9A 2HEYF 5FTTC 1TMF1 4F3JA 5F3CA 1AYN3 2WS92 4QKFA 4RHV3 3RWNA 2OX0A 4C91A 4B8EA 1QJY3 3HT2A 5HCAA 3MLLA 1VRBA 2XONA 3MZHA 2VQ0A 2JDYA 2R49A 4X8PA 3RI8A 2EIGA 4D7YA 1OA2A 4UBHA 5J1XA 1H4HA 5LZ6A 4V2WA 3NMBA 2Q8OA 2G9FA 3U10A 4F83A 3AMMA 3S5AA 1FOD1 1REEA 2Y6FA 2O0OA 4AVBA 1LGNA 4Q4W1 4FPGA 1O5UA 1ZVFA 4GJZA 1UXZA 1CGPA 4NAMA 1I3HA 1OPOA 2WQZC 5F2WA 3HBKA 4B4QA 4UI9L 1C5IA 4MGSA 3ZFFB 4P9IA 2BJSA 1WMEA 1BJQA 3H3UA 2KXLA 4MADA 4L2NA 4E2SA 1IS3A 3W20A 1Q8VA 3NV4A 3T30A 4O9EA 2DBIA 1X36A 2ET1A 2RMU2 2FDKA 1OQDA 1SLLA 2P37A 4K8FA 4ORFA 2ZS6B 5DMYA 1PZ8A 2EALA 4ISQA 3RPQA 5FP9A 3J7HA 4JV4A 4QPGC 3UV9A 2R1BA 3MLKA 2X53S 5T5LA 4U36A 2YDEA 2LALA 2XG3A 2XBO2 2LROA 5JLVA 5KHKA 4AAXA 1W8HA 4BK4A 1O8PA 2FD8A 3TAYA 5KHIA 1BEV1 4RL7A 4YM2A 1H6XA 4CCOA 1OUSA 1H2NA 1RUE3 4CP1A 2Q8EA 1KS5A 2LTNA 3AL6A 3VD7A 5L7OB 3CIHA 1MS1A 3BGAA 1LOAA 2YGMA 5ISLA 1PNFA 1IOAA 2QQVA 1HRI2 1C8M3 2R16A 2C9KA 2YC0A 3ACFA 1RUJ2 3PLQA 4NWVA 5DAVA 4XC9A 4XUPA 1UYYA 3WP3A 5I0DA 2ZEYA 5GLUA 4Y3OA 1HN1A 4W8JA 5FPBA 2VMEA 4AI3A 2BRTA 4LE4A 4QGMA 1VBD1 3ETPA 5KWRA 1W6MA 4AGGA 1OOPC 1LHNA 3I3MA 3UKNA 5FYCA 1DHKB 4ATFA 3LKJA 2H6BA 3FHQA 5A6YA 5FJHA 2XJTA 2W3JA 1NA1C 2ZBJA 4PLOA 5GALA 4MGQA 5ABJC 5C3RA 5DUVA 1YHFA 4Y1XA 3WOGA 1MS3A 3KWVA 1AVBA 5CISA 4NMIA 2W91A 2WKKA 2ZMLA 4JRAA 4Y1ZA 2FDIA 3WY6A 1NCRB 4YARA 2ZX2A 4RGKA 4XF1A 5FZOA 5FZ0A 1LTEA 1QDOA 1H2LA 3R4DB 4PCRA 4QDSA 3O1TA 4C1XA 4CEYA 3WNPA 2PTMA 3ZFFA 1ZA4A 1KFUL 2BZDA 1VBB1 2ZHLA 2ES3A 2E31A 2F4PA 3J8F1 4MHUA 1LHOA 4FO9A 1CONA 3JD71 2WSUA 4JKMA 5FZ4A 4LIUA 3ZOIA 1GOFA 4AI9A 3B69A 3BTYA 3M3IA 3KCCA 4CP2A 3U11A 1TMF2 1YI7A 3TOJA 4BYYA 2YBKA 1HQNA 1KDKA 3I7DA 2DUQA 3GBGA 1ZZ8A 2V73A 3HAGA 5FV3A 2CNAA 3GBWA 3GNEA 5DAXA 4URAA 2Y6HA 3H9AA 5AFEA 2LS6A 1ASJ3 4R4ZA 1MS9A 3PU3A 3ZN6B 5FUIA 4RFRB 3S5QA 4DIQA 4LBMA 1HJGA 2P3YA 1FOD2 1BVVA 2ZACA 4COYA 5IK5A 4Q4W2 1NXMA 1UOGA 2GH2A 5L7OA 2XB6C 3ZKYA 4HL0A 5I91A 1DQ0A 4IEYA 3NKGA 4K8RB 3C7GA 1VPHA 4CUCA 2VZRA 4DOUA 5CA6A 3KQRA 4LLOA 4A6SA 3OEAA 2QQNA 5CBLA 1SBDA 1OBNA 4XIKA 4GWMA 4H7MA 3PVNA 5JSPA 4GALA 3HOBA 5I93A 4FI9A 1HW5A 2D6MA 2VW0A 3OY8B 3D0SA 5FXVA 1ZREA 4LHSA 2W1QA 2QQOA 3PVEA 4K1YA 3TWIA 3TN92 3VBOC 2A7AA 4PIZA 1Z78A 2R071 2W87A 3K3OA 3VHRA 2IWGB 3AP6A 2RDRA 3F2ZA 2K46A 1G9FA 3K77A 3NV1A 1ZRDA 1BEV2 3AP4A 2DFCA 1CQ9A 2NZ9A 1NCRA 3VHOA 4QM9A 1GZCA 1S0DA 2Y33A 1EV13 1G6NA 4FT8A 2CYFA 5CKQA 1OH4A 5KC5A 4FQZA 4XHXA 2GDFA 4IEUA 3KD4A 1WLDA 3W59A 2ADDA 2WDBA 3GJBA 2GP3A 4N8MA 1PX4A 4X8NA 3EBRA 1XE7A 2VCCA 5L73A 4CCCA 2EXJA 2OZJA 3ZXDA 3WDTA 4DY5A 5L9VA 2JD9A 1QWRA 1WD3A 2RS53 1W2TA 1VBD2 4AR2A 1RUC3 1KDMA 4OUMA 5HI0A 2JJ6A 3VHNA 4MGIE 1JZ6A 2J1RA 4FP2A 3IDCB 4NRQA 1LHVA 2EA7A 2K2SA 2EXHA 4MGZE 5FZDA 5A33A 2HWE1 2WFF1 3LA3A 4AEJA 1XU1A 2YV8A 4B3NA 5DAPA 1UYZA 4CDWA 3KT4A 4EWDA 1RUOA 1AR81 3WNMA 2VU9A 1QDCA 1UZWA 2QQJA 2VG9A 5L9RA 5FZCA 1ENXA 2SBAA 3ZN6A 3WSOA 4E4SA 4FTBA 1LOFA 2WWJA 2XMLA 3WXPA 2Y6LA 1QU0A 4AQTA 2ZZJA 1AYM3 2JG9A 1CIWA 4META 1CZSA 3AZZA 4C0BA 4XURA 1RUH1 2PQQA 2W1SA 3UETA 4CU6A 4NJ4A 3SH5A 2VMIA 2ZAAA 1PGL1 3LDRA 1D0GA 1VBB2 4FCAA 1UY2A 3V0BB 2NP0A 3ZFFC 1UWWA 4H3WA 3J8F2 3T09A 4CUAA 5LA2A 1DGWX 2JIJA 3JD72 3T1MA 2VAUA 1AR73 4H7LA 2WYFA 3UT0A 2W1UA 1A78A 2ILMA 4BMBA 4LKEA 3WHUA 2ZPXA 3OY8A 4AI2A 4YW7A 5A3UA 2GNTA 4IV1B 1U5YA 3A21A 3BI3A 3MO4A 5FK7A 4AVVA 4BQ5A 4XHBA 4DMIA 5FWJA 3LB9A 3ZYBA 2D40A 3LCPA 2NM1A 5DZFA 5F9TA 1SG3A 3NWKA 3OJBA 4D69A 5C33A 4LLFA 2DV9A 1FV3A 5DG1A 2Q1FA 4BIFA 3VL8A 3ZXFA 3MHZA 2XDVA 4EJRA 4QHOA 1S0BA 3BKZA 4CUBA 1UCXA 1IPKA 3HNBM 3U4XA 1MACA 1YQ2A 4E9KA 3P3NA 1V00A 2VMHA 4E2QA 1QXJA 3ON7A 3IIAA 3M3CA 4I30A 5L7OC 4LQRA 5IJRA 3AMNA 5I0SA 5JI7A 4YZ2A 1H6YA 5JR2A 1QNWA 3AKTA 3WEZA 2WO3A 5LY2A 1H1MA 3NAPA 3N9QA 4HPKB 3RZJA 3H7YA 2VE1A 1U0AA 2A71A 5FYYA 1M06G 2DU0A 3OPZA 2BVVA 1EAH3 3Q8AA 1F9KA 3HD8B 3KV5A 2WJSA 3UGGA 1AR93 3H42B 4UFHA 5ANNA 2JICA 5J96B 4A2UA 1K45A 1LCLA 1O3SA 2F4LA 3H8OA 2R072 3BODA 4LA2A 2HWB1 2X09A 1HQWA 4Q0VA 1IQAA 2QUOA 4FQ4A 5DUWA 5FR3A 4A7KA 4QDRA 5T3NA 3I59A 2NQYA 4A6OA 4LEJA 4Q2FA 3O1MA 4Q8LA 4YVWC 2R061 2WNOA 3MV01 1BVP1 3C7HA 1Q8OA 2WQ8A 2WN2A 3ZO0B 5A3TA 1NCRC 3Q9OA 2XVKA 3ZMOA 4FOQA 2GU9A 3ST7A 1XYOA 3ILFA 3AM2A 4ASLA 5C4WA 1X7NA 1CJDA 3CJIB 4MXWA 1OA3A 4JHTA 2W68A 1ZRRA 2VBBA 4FPJA 3L2HA 4A3ZA 1DZRA 1YC61 4AGVA 2Q1ZB 2VBPA 2HJIA 1QMJA 5DPNA 3I49A 5F6LB 3OCPA 1LOCA 1RUNA 1QJY1 4IV1A 1WLWA 2WBKA 2CDPA 1TME3 3VZLA 5F5IA 1X9TA 3B9IA 3B5LB 2HWE2 2WFF2 3LOIA 4ZKTB 3IMNA 4Y5Z0 4UW3A 4AF9A 4OUEA 2P17A 5GLZA 3N7MA 1AR82 2JDNA 2QBXA 3MFAA 2X10A 2GC1A 1XOYA 1OURA 1MS8A 4FPEA 5F37A 2VQTA 4C8DA 2PHDA 3K4DA 4WM8B 1W9FA 1LOFC 4CDQB 1S0FA 4DEVA 3MW2A 2J42A 2XWJB 4WBBA 1GSLA 1YJLA 3GF6A 1RUH2 1HX6A 1J84A 3M8LA 4LO5B 3UKTA 5K7PA 3H7JA 3GCXA 2FCUA 4M3CF 1CZTA 5JI9A 2L9LA 4N43B 1PGL2 2H0BA 3MYXA 1NG0A 3ZPOA 4Y20B 4EWAA 1US2A 2VZPA 4SBVA 3KVBA 2VMGA 4XUQA 4L9BA 1YQ6A 4LBKA 5F39A 3ZXKA 2HWC3 3ZSJA 2ERFA 2HEVF 3RJ2X 4BXFA 3ES4A 2ZAHA 3WD5A 2WO1A 3J9SA 1XYNA 2ZHNA 3LEIA 5J48A 1HXS1 1CAUA 1I5ZA 3KV9A 4CP9B 1O3TA 4FTSA 1AR63 2DVFA 2RS31 1I5PA 3SISA 1YIFA 3N7JA 2ARAA 2RDNA 3K75B 4QKBA 4XAEA 2VM9A 4NVPA 1UOBA 1W0PA 4I3GA 1LOEA 4ZZ8A 5A3NA 3IPVB 5GZGA 5JXHA 4YG6A 1HV0A 4BLIA 1A8DA 1WWYA 4AHYA 2VC9A 1IPSA 2GALA 2HKXA 3HQRA 4FFIA 5E16A 5FP7A 4OQ8A 5LB6A 3KV6A 2QZ2A 1D4VB 3I2KA 3VN4A 1SBEA 3U37A 1RUF3 3CJIA 4YM0A 2D5HA 3VDDB 5A3PA 3CZJA 3CNAA 5FKCA 1I1EA 3ZR5A 1OQEA 1LR5A 1SCSA 1V6OA 2H6CA 2OVUA 2P3JA 3HJRA 5FUNA 1YFUA 3WF3A 4FSJA 2RR13 2WZR3 3AVSA 1ONAA 5JSRA 4CSWA 1G9BA 4OI4A 1YJKA 1LNSA 4XE9A 2MPFA 1RL3A 4CXWA 4XJZA 3RJRA 2EVXA 1L7LA 3KCXA 1VBA3 1UD1A 3SHRA 3IMMA 3RSJA 3WT3A 1HIXA 3JUUA 4OVEA 4QU1A 4MX3A 5IUQA 2ORXA 3A0NA 4DUWA 1HB1A 4XAAA 2HWB2 1XNDA 3HPNA 2AH2A 1OI6A 3M2MA 3NNGA 5BPXA 1RUI3 3W58A 4DQAA 5GZCA 1CIYA 4QT6A 1HLCA 1UN1A 2WABA 5F1RA 1OC1A 3AKSA 4FFGA 2R062 2ZGNA 5DAWA 3H3ZA 1IS6A 2VZ3A 5EJ3A 1XPWA 3AYDA 1LODA 4K9SA 4TYSA 4XMIA 1W28A 4BCUA 4GMP1 4N43A 2P4EA 4JDOA 1EY2A 1GNYA 2PFWA 3ME2A 1CX4A 1I9RA 3PUIA 4J6GA 2ZMNA 2WZEA 1MQTA 2XH6A 2V72A 1FNZA 1FNYA 1PIV3 5DN2A 2JECA 4WZCA 1QJY2 1FX5A 2EAAA 3JQWA 4JX0A 3TEWA 3UGFA 5GZFA 4AE2A 4IV1C 1ENSA 2JENA 2TBVA 3ZYPA 2CAUA 3MF6A 1D0HA 4QXHA 1KEXA 4XUTA 4CDXB 4CP9A 5J09A 1COV1 1W8UA 3HT1A 2AEYA 1UNBA 3SMHA 2Q1MA 2VUJA 5FAXA 4QX1A 5FZ7A 1UYPA 3KF5A 1ENQA 1JZ4A 1QXPA 4MO3M 1H4GA 3HIFA 1ULFA 5EQUA 4BH9A 1KITA 1YUDA 4S2DA 4WV8A 4XVHA 2XVLA 3WP6A 2W1WA 5JIUA 5JVVA 1VBE3 1WMFA 2B8MA 2RHPA 3KSCA 4ASMB 4GXLA 1L7QA 1Z7S3 1C1FA 2FDGA 1YI9A 2WINB 3VDDA 4PJYA 2QTWB 2Z42A 3H1MA 5CVRA 2PAKA 2Z4FA 1PMJX 4UXAA 3M3QA 4CEWB 4YFZA 5C7GA 1ZBE1 2D6KA 1ND2B 1YQCA 2Z2SB 3S0MA 4KL1A 4LUKA 4QMAA 1XC6A 2D43A 4QHZA 4HKLA 3WDXA 4XJUA 5C5TA 3LEGA 4GH4B 2E7TA 3KLSA 3LFMA 2BERA 5GM0A 4LHKA 4Z92B 1ST8A 3KGZA 3AKRA 1ZBA1 4ES8A 2I2SA 3H8RA 2PHWA 3OD0A 1V0AA 1HXS2 4UFMA 4LITA 1E5SA 3U14A 2RS32 3O1UA 4L92A 2Z69A 1K5MB 3O7OA 1W2OA 4I0AA 5FYMA 1D2SA 3JQXA 1JZ5A 1C5HA 4XEZA 1VBC3 3ZX7A 1PK6B 1ODMA 4IQPA 5LA1A 5DG2A 1R081 2IFRA 2K0GA 4FPFA 4RFT0 3DN7A 4XF9A 3FFQA 4I2OA 3ZM8A 4IDZA 1H9PA 3PTYA 5AC91 4EQVA 2BOJA 3LD8A 5FZEA 5FO8B 5I0RA 5FZ9A 2NYYA 2CTVA 3OBTA 3CJIC 1JI6A 4JKKA 4R4XA 3MIBA 5FMCA 2WQ4A 3ATGA 1ULPA 1POV1 3ES1A 4IGPA 4AQ2A 2DCZA 2RS11 4ARYA 1HRV3 4S2FA 5HPOA 3OGSA 2V4VA 5DZGA 4MHRA 1Y3TA 3M1HA 1B09A 1D7PM 3ILNA 2RDQA 1IGOA 3NNJA 4B1LA 4YFWA 4CDXA 1TNRA 2C5DA 5FPLA 5C3PA 4BMEA 1GQHA 4MZUA 4LK7A 4G9SB 3WF1A 3E6CC 1JYNA 4XQWA 5JUVA 3EYPA 3MICA 1AYM1 5A1LA 1C57A 1W2AX 3N7LA 4QX7A 2G4IA 5JR7B 2ZGUA 3QLQA 1G8WA 1O59A 1XSRA 4KH9A 3VKFC 1IG0A 5K8SA 4WM8C 4CDQC 1QY4A 3GBFA 3PUHA 4PDWA 1J83A 1WW6A 4CEWA 1SLIA 5D1IA 3ZVXA 1AR71 5A1AA 3OBAA 4N43C 1ND2A 2IXCA 4CU9A 3WQBA 4LBJA 1LGBA 2GAUA 2JDAA 5FYZA 2GNMA 4AI1A 3I2GA 4E2GA 4EZHA 5IAVA 4A4AA 3IB3A 1JU4A 4GB31 4XTMA 4Y24A 1CPNA 4GH4A 4S2GA 1UKRA 5FYSA 5JIAA 1ULEA 2ZGOA 4AI0A 4IGQA 3T0DA 4DRVA 1RJ8A 4HN0A 1DU3D 1JOBA 1DYOA 3FFZA 1ZNPA 3LSDA 4UBGA 4YWAA 3B7MA 1APNA 5ANQA 4IEWA 1JH5A 1COV2 1GU3A 3OGJA 4BISA 1ULDA 1K5MA 2UURA 1IKPA 3J7LA 1K3IA 4MOAA 5T54A 5T5PA 3RMYA 2J1AA 2VQAA 4I09A 3TNQA 1V9U3 4UW5A 1W6QB 2XLGA 1PK6A 4OHZA 3UESA 2A73B 1PGW1 2DCKA 2I07B 2JDKA 3D6EA 4N90A 4K20A 2Z5WA 4XMAA 2YU1A 2W47A 1AXYA 1J3RA 3WG1A 3M4FA 1VAKA 1AX0A 2EAKA 4MGYE 3AKQA 1DZTA 1RMU3 2YHJA 4HG6B 3VDDC 4OMCA 2VULA 1ZBE2 1AJKA 1SZBA 5C3QA 1ZZCA 4UT5A 2XHKA 4P08A 3ZN5A 1AR91 4DPNA 2ZJCA 1FATA 2G19A 1OSGA 4B7EA 4Y4RA 1DLLA 2YUEA 5FZOB 3C3VA 3IKWA 1MZ5A 2GP5A 4HMZA 1WA6X 4IERA 1ZBA2 4QGLA 4YG0A 4CEYB 4KWKA 2ZX0A 3BPZA 3P3PA 3GCWA 4R52A 1XNAA 1WBFA 2ZCWA 4FOYA 4QX5A 1NCQB 2WAOA 1R093 3DF0A 4O7XA 4A41A 3EB7A 1UY4A 3O14A 1YXWA 5HCFA 4GWIA 3I2FA 1R082 3SITA 1W6NB 4PBOA 1KD7A 4Q4X1 2KD7A 1S0EA 1HB3A 1NLRA 4YNIA 5FK8A 5AC92 3ILRA 5FLIA 2P34A 2SLIA 4LULA 4ZONA 1PO13 2EXKA 5JOWA 1Y7BA 3L9JT 3DL3A 2IC1A 1STMA 4ATEA 5ACA3 3ACHA 2RS12 5LY1A 4XBNA 5CNAA 1IS5A 1WLTA 3RFRA 4OYUA 1V6MA 1E5HA 2E32A 3FZ3A 1DIWA 3FMGA 4CU7A 3QBQA 4LKDA 4FP3A 3FE5A 2VXJA 2WZ8A 4Z1VA 3D4KA 1W05A 2XL9A 1CESA 2YBPA 5FY4A 5BNOA 1K42A 4PLNA 2JIGA 4JDNA 1R1A3 4PHZA 4BM8A 4CDXC 3O1VA 1KJRA 2NN8A 3VKNA 5C8CB 1WLCA 3FLPA 2D98A 5F5CA 2OUHA 5JXGA 3AYEA 1W6QA 4M3CB 1AYM2 1UMHA 4QPWA 1NKGA 2D6LX 2W2IA 5T5JA 3ZDVA 5IFPA 2HBTA 2LW8A 3WNXA 3WDWA 2RJ2A 1RJ7A 1S0GA 1XE0A 4PI0A 2BGOA 5I0TA 3RDIA 5BNNB 4QKNA 3PMSA 2PLV3 2VY0A 1NZIA 3D8CA 3H3LA 1QJX3 2DCTA 4CPBD 4J25A 4R9AA 1AR72 5FYTA 4IEPA 1WZXA 2HWC1 3C7OA 3OPWA 2C9AA 4CEWC 4BQ3A 4XBQA 2Y8KA 5A7WA 1ND3A 1ND2C 4P9JA 4MYEA 1N1YA 1PZ9A 2A5ZA 5J7MA 1QQP1 3TEYA 2OQ6A 1Q8PA 1ZRIA 1OD3A 1Q3EA 4LKFA 2X05A 4LMFA 4GB32 1JYWA 2A1XA 3OOXA 1Y9GA 4GH4C 1A3KA 1H8TB 2R30A 3RWKX 3UJQA 4OI0A 4QXBA 1DG6A 1S2KA 2CY6A 3BIWE 1UKGA 2PHLA 1WGPA 1XQNA 3FUOA 3NV2A 3VBFB 5FY9A 3FC0A 3I2HA 3OPTA 1NCQA 3TEZA 2D3SA 4JQRA 3NVCA 2E33A 3MUZ1 4PI2A 3WP5A 5CAZA 1N3PA 1K5MC 2VGDA 3TB0A 1BYHA 5FZ1A 3URFA 3AZXA 3OF1A 1PK6C 1PGW2 3HMYA 4Q0QA 5FIXA 2AR6A 3E5UA 3JBG1 4LNVA 1W6NA 4J1WA 5G04L 3HQUA 2O14A 1LEMA 1W6PB 1XJAA 4XCBA 3MFCA 3PIGA 4DB5A 5A33B 3KV4A 3WQ0A 3IDEA 4CZSA 1VJ2A 4CDWB 1V6JA 4FPHA 1X9PA 4GKYA 1UL9A 4UFJA 4E4ZA 2NLRA 1NT0A 1FPN1 5FZLA 4Q1RA 2WT0A 5T5OA 2R041 2D93A 4HOOA 1AR92 2P3IA 2A3YA 2IVIB 3E6BA 3E6DA 4CCJA 5CADA 4H55A 5FOBB 1PVC1 4Y1YA 1CAVA 2E53A 2GC0A 2B9UA 2JG9B 3I4IA 5L36A 1PNGA 1AL21 2OS2A 4AEDA 1AF9A 1XBFA 5C8CA 3B02A 4HN1A 4IE5A 1EUUA 2F17A 1ZZ7A 3S7IA 4P9YA 4NAOA 3NL1A 4M3CA 4N7IA 3RG0A 4Q4Y1 3VDCA 4NE9A 1PO21 3PJYA 1YFYA 4QX8A 1OLMA 1W90A 3MUY1 3POSA 4EN0A 4AXOA 5BNNA 2VZSA 3I2JA 1GANA 3LF7A 1W9SA 2ZEZA 4LE3A 1Y43B 4Q4X2 5CFCA 2BNNA 1SLAA 3W9AA 3LA2A 4XZUG 5A32A 4O65A 1DBNA 3WR0A 4LOTA 5IVYA 4JVAA 4Z07A 3T0BA 5FWEA 4CXXA 1Z0HA 1WCKA 4M00A 2JKBA 2MEV1 4MLOA 4NROA 3WF2A 5DAQA 3ROUA 5M0TA 1ULGA 3MIHA 4XQ4A 4LKSA 4XTPA 4NHLA 1H8TA 4RGAA 5FP8A 5LRRA 3WDVA 1O91A 1SHWB 4AI8A 3VBFA 1J59A 1OPMA 2YROA 5CYYA 2OUJA 1O5LA 3O1OA 2HEWF 2E7QA 1KFXL 5ERLA 5HBAA 1GFF2 1W3VA 1X82A 1GOGA 3NAPB 1CAXB 5FLHA 4GQ7A 1AXZA 2XLAA 2Q8DA 5FDBA 3FL7A 5H9RA 1G86A 1O8SA 2PHRA 4YW1A 4KBZA 3ZN4A 1W6PA 4WVWA 4C90A 1W9YA 2YC4A 2WL1A 1RB8G 3D5OA 1YQ8A 4ZY9A 2OIIA 2RMU3 4KU7A 2J22A 5L19A 3E5XA 2WA4A 4GD4A 5HXVA 4YGCA 3RYPA 4GWJA 4ARXA 3GZUC 2JEMA 2HWC2 1PMIA 5A7NA 5LASA 1WKYA 3I59B 2QCSB 2OKXA 1GNHA 1QQP2 1ZX5A 2BTVC 2EIDA 5IK4A 4GKXA 2TNFA 3OD4A 1WCUA 2BDRA 5C3OA 1ZRCA 2VTXJ 3OGVA 5FZGA 4F7ZA 4RGGA 5AFBA 2BQPA 1OQ1A 4YGBA 1OT5A 2YFZA 5FY1A 3B9CA 3GZEA 3HN3A 2W92A 5C4WB 4MXWB 2CSGA 2PHUA 1AZDA 1VBC1 3MI8A 4CEYC 2DUOA 4ES9A 2O8OA 1UU5A 5J37A 4AHZA 1V6IA 1NCQC 2HWF3 5K0UA 3O0XA 1H1AA 3FN9A 1HRI3 1RUD3 1LAJA 4W4ZA 5CG8A 4P5HA 1RVF1 1IG3A 1GP6A 2W39A 2QQPA 3O1SA 3JBG2 4H2AA 4IE6A 4ZXEA 2JDHA 3UNPA 4LBQD 1GR3A 2RM23 5AVPA 4QX0A 4DEQA 2GNDA 4PF1A 5K4LA 2EIBA 3AXEA 2ZX1A 3NNLA 2VW2A 3HQXA 4NRPA 3VBSA 5B4XA 4C1WA 2XKPA 4DXRA 5DDJ1 2WUHA 2FDHA 3UK9A 4LIVA 4MV2A 3POIA 1UZVA 5T52A 1FPN2 1Y9MA 5JWPA 3JB4C 3ZSEA 3PUAA 2R042 5FOJB 3B94A 1GMMA 4TLFA 1PVC2 5KXDA 3KVAA 1AL22 1JS9A 2JG8A 2E63A 2ZKNA 3CHXA 2VMDA 3ITQA 2WNVA 4DO0A 4BPZA 4PBPA 3P5BA 4PLMA 3WDUA 1L3JA 5LA0A 4D6RA 2Y6GA 4QB6A 2BFUS 4K3UA 2NPIA 4HK8A 5C8CC 3KHCA 4AQ6A 1CAXA 3WDYA 3ORJA 4Q4Y2 3WLUA 5JZGA 2VOVA 1UAIA 1PO22 4Y22B 1ZZ9A 4WZFA 3B00A 3WHTA 3RZLA 1UPIA 4XFIA 3TRSB 5DUXA 4BQ2A 2XR4A 4LHNA 1VB2A 3AB0A 3I54A 3F95A 3S30A 3GZAA 5BNNC 4K21A 2QDNA 4HBNA 4HXCA 4MSVA 3C7EA 4DS0A 1B35B 2P5BA 1CAUB 4QQ2A 4Y33A 3OGGA 1FT9A 4YYOA 4YG3A 1DZQA 1TMF3 2D7FA 3SEPA 3ZYRA 2VR4A 1IZ3A 3PL0A 2LUWA 2UY9A 1RXFA 4CUGA 5BNPB 1E5RA 2B42B 1F5JA 3LQCA 2MEV2 5GLVA 5IK7A 1US3A 5FZIA 4CXYA 1R64A 3BIEA 3AMQA 2VJXA 3WX5A 1D2QA 1K12A 3LEMA 2VNRA 3ACGA 2GH8A 3S6PA 2Q5TA 1H8TC 1BBT3 2YPDA 4UW4A 4KI5M 3NJXA 2B7YA 3CLPA 1FOD3 4BQYA 4QWNA 4QKDA 3VBFC 1CZVA 2C1FA 4NRMA 4Q4W3 3N9PA 4ITCA 5FMDA 4EN7B 3BN6A 1AYN1 4RHV1 1RHI3 5DQ0A 5IVBA 3J7NA 3JCIA 4JTNA 5A3WA 2VOKA 2ETEA 4NN0A 4GA9A 1JMUB 2VZ1A 4PQQA 5FYBA 3JU9A 3VBHB 3PTRB 3AL5A 4V2VA 3VUOA 1EPZA 2OA2A 4RR3A 4IEQA 2J1EA 2X5IB 3BALA 1ZZ6A 3D0JA 4UWDA 4AOCA 4CDWC 3U0ZA 4JGZA 3MV11 3PURA 4OI1A 4XDPA 4DFSA 3KGLA 3AKPA 3HVDA 4TSVA 4MG2A 3TN93 1W2UA 1H2KA 3USUB 2IVJA 4EV0A 5T55A 4IW3A 1QJZA 4HSJA 4KNCA 2BU9A 2W95A 2EIEA 2I74A 2VECA 4E27A 2JG9C 2VH9A 2IXJA 2W08A 4XABA 1LJ7A 1D4M3 1BEV3 1R091 4KG8A 1N3QA 3RMXA 5GZDA 1NX9A 1QJFA 4AGRA 1VBC2 4CPBA 5CZKA 3S57A 2Q30A 1W6OA 4DUVA 4HETA 4Y22A 3VDBA 2C4XA 4A3XA 2DYCA 1MQTB 4L8QA 3VBUB 1JN2P 1SBFA 3RVHA 1GZ9A 1AX1A 1RVF2 3NKTA 4BIOA 4LBLA 1PO11 4Q29A 2EICA 2N7GA 2ZOEB 1H0BA 4AVCA 1VBD3 5DZEA 5IHRA 1B35A 5HCHA 1BQPA 1HB4A 1VIWB 2YU2A 2ZGTA 1PGSA 4I01A 4AAPA 1RUE1 5DABA 5B2GB 2RJLA 5IWFA 5DDJ2 1H1IA 5BNPA 2IXKA 5CKMA 3IAQA 1TNFA 4NIAA 3LPFA 2J1SA 3GHMA 2ARCA 2RE9A 3H8UA 3J4UH 5FLJA 5H9SA 2A6WA 3JZVA 3VKLA 2YXSA 1C8M1 2WA3A 1IKQA 1T6GC 3ZPYA 1IQDC 3POBA 3KCYA 2LM3A 3AP5A 4PIYA 2DBNA 2NMOA 1F15A 1SFNA 4N9IA 3WZ1A 4EYUA 2O8QA 1QIQA 3H1WA 2E9QA 5FQ0B 3IZOA 4CCMA 1C4RA 1U12A 3NAPC 2ZGKA 1NY71 4AVAA 4M01A 1XNCA 1YFXA 2H0VA 3I3DA 1OKQA 1VBB3 5FRAA 1JYVA 4LBOA 1QJX1 4OHXA 2IUWA 3J8F3 1U5XA 1TQ5A 2KA3A 4W65A 3VBHA 5IVEA 3JD73 4W50A 4MUVA 1WD4A 3CU7A 3SKJE 1EUTA 1JW6A 4LUMA 4HVOA 1LECA 4O9GA 2Y0OA 4B4PA 3IDAA 4AFMA 2X5IA 2VXRA 3IBMA 1F4AA 5GLWA 2DTYA 5LBFA 4Z2WA 3ZFEA 1XSQA 2LRPA 4QXCA 4NIDA 2RJKA 3M70A 2D6NA 1IS4A 5A3LA 3BU0A 3DEMA 3USUA 4XDQA 1RINA 1OLRA 3WQ7A 4BE3A 1TEIA 1ZZBA 1QJU3 2ET7A 3WVJA 1JHJA 2BP6A 4B29A 2XJSA 3I2IA 3MF9A 3THPA 4KMQA 1LESA 3AYAA 4OZXA 3AZYA 4YGEA 3T1LA 3W5NA 2AACA 1PVXA 4O61A 1AX2A 4BK5A 2IXIA 2K9ZA 4LBQB 4Y5TA 3I3QA 3PU8A 5EFUA 5EYXA 2VQUA 5C4WC 4COZA 2XJPA 3PVBB 4RN5A 4XUNA 4I0BA 4XJWA 4FVVA 1ODNA 3SNMA 3GDBA 1JZ3A 2Q4SA 3DECA 1AYN2 3VBUA 2XLFA 2CDOA 1SQ4A 1REDA 4RHV2 3ZSMA 3PMEA 3RGBA 3B3QE 1A34A 3ZFGA 4GJYA 5EJZB 5GJ6A 4P9XA 4EN6B 4AHXA 3KZ4C 4UFKA 4WVMA 1W8NA 1UIJA 1T2XA 4XFGA 2PQSA 3MIEA 1ASJ1 1JYCA 3OUJA 4QQHA 5FO7B 3B93A 1W99A 5B4NA 4YGDA 2B45X 2FDFA 3LA7A 2UYBA 1UXXX 1A8MA 3QH6A 2XUEA 5D2AA 1JUIA 3N3HA 2VCBA 5LW9A 2HH9A 1BZWA 2R073 2UWBA 3DKWA 4JGYA 4LORA 4R9CA 4JDMA 4IEXA 5C8WA 1MS4A 1LHWA 2UWAA 1OF3A 4PDWB 5LWBA 4KBBA 1R092 1UY3A 1E5IA 2WWSA 2WYSA 5EYYA 5FQ0A 2XPJA 4N53A 4LJHA 4RQPA 3UGHA 2JD4A 1RGSA 3QOPA 4YVSB 2QQUA 4B4RA 2O1QA 3DPRB 3H0OA 3CJXA 1PO12 1DGLA 3POYA 3ECQA 2CWMA 5FZ3A 3PDQA 3E5QA 2JB8A 1ALYA 4XFBA 5SV5A 4BU2A 2G9GA 5FYHA 2PMWB 3ZDSA 1B35C 2XXZA 2OZ6A 1PMHX 3NSTA 2JB4A 3K4AA 4RSUA 1RUE2 3VV1A 2VNOA 3OBRA 3WCSA 2HWE3 1EV11 2WFF3 1OKOA 4B1MA 4EWEA 2E6VA 5C3SA 1BCXA 5BNPC 1HDKA 3NJVA 1AR83 3O0WA 3PNAA 1NZCA 5LBEA 1GWKA 2TUNA 2ZXQA 4DINB 2XOMA 1VMJA 1C8M2 2GN3A 5F7UA 1VMFA 2BEOA 2A75A 1WMDA 4LOSA 2VTFA 5IATA 5JCTA 2WIIB 3SQOA 4XFFA 1IHMA 2YC2A 3EHKA 2QVSB 3HWJA 3ALQA 3OEBA 4IXLA 4LBQA 5JAXA 2C24A 5LK7B 2RS51 1HV1A 1RUC1 5F8PA 3H8XA 1YEWA 1RUH3 3QCWA 5J36A 3EMRA 5FJKA 1HN0A 1GZTA 2AEZA 4QD2A 5EZWA 5JOXA 1F2NA 1GWMA 1YQ5A 2GNBA 3BTZA 1NY72 2XQXA 3PHMA 3RI9A 4CVUA 3CL1A 3EQEA 4Y26A 1HQLA 1PHMA 4TN7A 4AWDA 1QJX2 4CA9A 1ULOA 5F32A 2UU8A 3N9NA 3OTFA 4L0PA 4QQLA 4YW2A 4AEMA 2ZGRA 2BBVA 1O4TA 4QPGA 5CU1A 3VZKA 3VBHC 5FXWA 3DYPA 4HANA 1R1ZA 1RUG3 5J98B 4P9WA 3R05A 1F35A 4NHKA 2X5IC 3LFIA 2DWRA 2JDPA 3P1IA 4XFCA 2FZ1A 1WA4A 1DF0A 3RS6A 1VAMA 3VZOA 2D6PA 3K46A 3NO8A 3UJOA 2ZGMA 3Q8EA 3AP7A 2BBAA 2ARBA 2ZEXA 4UOJA 3T4HB 3OUHA 4DXSA 3RNSA 4XF3A 2VPVA 4OFGA 2GC2A 3IAPA 4YVWA 2CL2A 2HWF1 4JKLA 3VZNA 2BPA2 3WW2A 1HRI1 1RUD1 1ZM1A 2QJVA 4GMP0 3VDAA 5E8AA 4AHWA 3OSDA 4YVSA 3ZIWA 5E88A 4OHYA 1OOPA 1LULA 2RM21 2YGLA 3AMHA 3DPRA 1MQTC 3WNKA 4ZU7A 2PXJA 4KU8A 2KR2A 2VCAA 3EJKA 3VBUC 4F8AA 3SCHA 2Y64A 2BNOA 1UZYA 1BMV1 2UYAA 5TSWA 4LO4B 3RQ0A 5BNOB 4QX3A 1DFQA 1W9WA 3GALA 2ZTNA 4QGNA 4AYUA 1ASJ2 4KGGA 5ABJA 4L99A 1MEC3 2ORZA 3CZUA 4M3CE 4YZ3A 1DCSA 4IEZA 4W6YA 3GGLA 4L11A 4NWWA 4OLLA 4YW5A 2JE8A 2W0XA 5A7SA 1OLME 4P00B 3POJA 4YZ5A 4ZXKA 3HEIA 3MIDA 3T3YA 1NXD1 3LIGA 1UOJA 1JXNA 3N9OA 3CO2A 1W8OA 2CHHA 4XJ9A 4Y5SA 3KT1A 3IIIA 3POGA 1CWPA 4H14A 3AK0A 3CF6E 3VD4A 2R063 3R4UA 5APAA 1UZZA 1UOFA 2DVGA 4XZPA 5E6HA 1EAH1 1SACA 1NOVA 3DCQA 3VD5A 1X8MA 2PN5A 4CE8A 4EZ4A 3V56A 2JE9A 5A7WB 1GBGA 1ND3B 1YRZA 2B39A 2PA7A 5FYUA 5KXBA 3NJYA 1Q56A 5A80A 4Z2AA 3AZWA 4XFAA 2AZ5A 3J26N 1G7YA 3SH3A 1FI2A 1N3OA 4D0QA 1SDWA 4YPJA 1KJLA 1MZ6A 5F5QA 3SH4A 3GZTB 3AVRA 1DQ5A 5EJ1B 1JOJA 3C8XA 2J1VA 1CJPA 4XPVA 1OMIA 1CD3G 4BQ1A 1TE1B 4FAHA 3LDKA 2HWD3 5D8AB 2CAVA 4P02B 2DURA 3U4SA 1EV12 4KWUA 1WUVA 5IT6A 2GMMA 2CWSA 2ZHKA 4OZOA 1L7RA 1BBT1 2OPWA 1GYKA 5BYNA 3LOBA 4MGKE 3ASIA 3LEKA 4WVZA 1QEXA 4AL9A 3NJZA 1V6NA 4N9HA 4I0WB 3WW4A 1DQ4A 3MGUA 3AXDA 5F3IA 1FMD3 4OCTA 3DXUA 3LDBA 4CCKA 2VW1A 5CEHA 2Y26A 3THDA 2RS52 3INAA 1W06A 4GZ9A 5A6ZA 1RHI1 3PVOA 1RUC2 4A7YA 5KHJA 4YZ4A 3THTA 1QH7A 1AUYA 1EYBA 1TG7A 2YB7A 1POV0 1UMIA 1TME1 3OUIA 3PUSA 1WCSA 2P1BA 1Q8SA 2AREA 3SLIA 4FFHA 1CAVB 4IEVA 4YRDA 4UFLA 1MZEA 2KM2A 3V64A 1UU4A 3I3EA 1SFYA 4AEDB 3VBOA 3WNLA 5FFOC 5KHHA 2FCVA 1SMVA 1G9CA 3TN91 1H8VA 2XVGA 2XQRA 5FZHA 4AFCA 3LZZA 1MS5A 1YWKA 2ZX3A 1ACCA 4P14A 4MXVA 5FP3A 2UY8A 4OMDA 3WG2A 4CCDA 4GIQA 1HXS3 3E97A 3AYCA 3VLBB 2WRAA 2QQMA 2RS33 1D4M1 2XJUA 3NNMA 2BVBA 3SKVA 1LRHA 1J3QA 1JODA 2EXIA 1H9WA 3BU7A 3FHIB 3HR9A 5FYIA 3WW3A 3WNOA 2VOWA 4BQXA 5CFCB 2WZPP 4D6QA 1KGYA 4I3PA 4PDWC 2HWF2 2BWAA 2JWPA 1XE8A 3I2DA 5FZ8A 4OHVA 5F2SA 5A32B 2PHTA 4DNYA 1RUD2 2JDZA 4BWOA 4MVTA 1BHGA 5LBBA 1LENA 2VOXA 4BLJA 4PF5A 2BFUL 2YZ4A 3TNPB 1C28A 5CFDB 2DCYA 1OXCA 3MLJA 4ZS3A 2R1DA 1LU1A 1MVEA 1SLTA 1DYPA 4IEOA 2BUKA 4UYBA 4YVSC 2V5YA 2RM22 4Q5OA 1JYTA 3B01A 1AR61 3DPRC 3BB6A 1QGLA 1SLCA 1W8ZA 3RZMA 1BMV2 1WCQA 5JXJA 4W6XA 4RS5B 4Y1VA 4ZU4A 2QZ3A 4NHMA 1VRH3 4FPYA 4AG4A 3A7QA 4XXPA 1QOTA 1O4ZA 1O7FA 3POWA 4NUBA 1GUIA 1GWLA 2IXLA 3A0KA 5G05L 5CIRA 2VVDA 5JOYA 5D8AA 1DDLA 1S4CA 5IAXA 3FWEA 3POFA 5JOZA 3CBNA 4R9DA 1N47A 2BW8A 1A6CA 1S0IA 1RUF1 1C8NA 1O4YA 3NRUA 2VVEA 3QH7A 5FMBA 2DUPA 3T2PA 1NE4A 1OVPA 2DFBA 4LPLA 2R0FA 2RR11 1X33A 2WZR1 3DUIA 1VB4A 4BHPA 2PELA 2XL7A 1MPXA 4AVTA 1EAH2 1U5IA 2QQIA 4UAPA 3VD3A 5EHDA 2ENRA 2ZEWA 4FPKA 1UX6A 4D94A 1QF3A 1HKDA 4D8MA 1F8VA 5A7OA 2X29A 4W6WA 4AZZA 2B4KA 1GQPA 1KXGA 4GMP3 4LO6B 4D3WA 5LEJA 1LOGA 5A6QA 3D82A 1VBA1 1W0NA 4GWNA 2AC1A 3WV6A 5I8SA 2VL4A 2RVAA 4QPYA 2ZKLA 2P3KA 3ABZA 3K51A 5AVAA 2WAAA 5A70A 1AHSA 1RUI1 5BY5A 1SEFA 4TXWA 3N7KA 1PM4A 4Q4V3 5HCBA 2I45A 1WCDJ 4XXAA 2Q8CA 4HLTA 5FMOS 1GV9A 1QJU1 4UF0B 4XILA 3WP4A 1ZRFA 4YSFA 5K0UB 1VR3A 2E7AA 1DYKA 2FMDA 1COV3 2ZA9A 3I3BA 3U07A 4QDQA 4Y4YA 2RDSA 4NO4A 1BBT2 2OPKA 5I8YA 4JAAA 4XCAA 4NIHA 4NPLA 4Q0SA 1FXZA 1JYIA 5FPVA 3GXUA 3N4MA 1MZFA 3USSA 3X29B 1DQ6A 2GN7A 1AJOA 1UY0A 2QFEA 3MPBA 3NQHA 1PIV1 1WBLA 1RHI2 1NLQA 2WS93 3VBRB 2WT1A 2WO7A 5CFDA 1YIPA 1J1TA 3GM8A 3VBSB 4DRRA 4DXZA 4ZPIA 5GZEA 4BQWA 1WW4A 4DY3A 5FZMA 1TME2 4XDOA 4XUOA 2Y0IA 3OBZA 1LGCA 1QOOA 4WVVA 1OH3A 4QB2A 4D6SA 1ZBE3 2ZGPA 3M3EA 2Y34A 2A3WA 5F3GA 1QKQA 1NQJA 2JG8B 4RS5A 4QXKA 5BXXA 5LEKA 1UIKA 3RZKA 3WF4A 5BNOC 3ZYGA 2WNVB 3AFKA 4RA0A 2DU1A 2R0HA 2RG4A 4XYXA 2D3PA 4BJ0A 1QOSA 4LBNA 4HFSA 5HV4A 5IK8A 1ZBA3 3N35A 3MIFA 4FXGB 1VBE1 5JZGB 4JRLA 4HVRA 5KXEA 4N7UA 1Z7S1 1SLBA 5DXDA 3R6SA 3T08A 5J3UA 1D4M2 1RIRA 4AFAA 1X8EA 3LE0A 4TLGA 5L9BA 5C9AB 1F4HA 2R6QA 5GKAC 5I0UA 2VZQA 1FYUA 2WNUB 4BDVB 4BQ4A 5HXMA 4AVSA 3JXSA 2X8KA 2DDUA 3ELNA 4COUA 4XETA 1N1SA 3VGIA 2Y6KA 1ENRA 1R083 4CU8A 2PAMA 3EO6A 5A3MA 1OVSA 3CQOA 1RITA 2C0ZA 5AC93 4CDUB 4P9GA 1NQDA 1YFWA 2VNGA 4HKOA 3OYWB 1ND3C 3GYDA 3M3OA 1W2NA 2XBO3 1LKNA 5FPZA 3O0VA 1I6XA 3OGRA 1POV3 5IFTA 3A23A 1AR62 2RS13 4BA6A 4BZ4A 4K40A 2IZWA 4QHBA 4RYDA 1LB2A 5H9PA 2PAEA 5F5AA 4B7KA 4UFIA 1Q43A 2JE7A 4EE2A 2VVFA 1W03A 2DVDA 4ZS2A 4UF0A 1FV2A 3LPGA 3A4UA 1V70A 1ULCA 4YM1A 2G1MA 1P8JA 1KQRA 4XOGA 1CN1A 2WO2A 5D8AC 4Z8BA 1RUJ3 2BGPA 1VE0A 1UY1A 1XU2A 4COVA 1RUF2 3ZMNA 5F6KA 1JZ7A 4LA3A 1IPJA 3RRDA 2HBUA 4V1PA 1N1TA 3K4ZA 5A7PA 5FXXA 1BXHA 2GMPA 3WG4A 4IV3B 2B46X 4Q27A 5C70A 5FPXA 3THCA 1CVNA 1HRV1 2RR12 1QJEA 2WZR2 3KHBA 3ACIA 1NYWA 3VKMA 3IDBB 4RR3B 1W04A 2FMYA 3K2OA 3VBRA 4HZFA 4JGZB 2XWBB 2OYZA 2DTWA 3BYWA 4IE4A 5KHGA 3LGRA 4CCLA 2FBEA 2Q0AA 3T4VA 1S55A 1XNTA 5FBJA 5FZFA 1VBA2 1DP0A 1RUG1 2FQPA 3FX3A 4NOTA 4Q8KA 2VZUA 2P2KA 1JU3A 2QQKA 3FHAA 3PUQA 4UW6A 5FO9B 5FREA 5JPMB 1AL0G 1SPPB 1QNYA 2B5HA 3KS7A 4LR4A 2D5FA 4GB33 1RUI2 4AEDC 2DF7A 2FZ2A 4EN9B 5IYYA 2CU5A 4OQ9A 1QJU2 4GULA 1OA4A 5FKBA 1W6OB 5FP4A 1EPWA 1V6LA 4HONA 5JMCA 1QXRA 1O3QA 5A1FA 4PIXA 3AP9A 1BLZA 2A6YA 2V5DA 2FHRA 2ZMKA 4IE7A 3ZXEA 5IVJA 5C5UA 5C9AA 2R7EB 1UQXA 2WNUA 4NPRA 3BOPA 1URXA 4A45A 5DUUA 3CDZB 5FYVA 2OQ7A 4Q0PA 4YLZA 5CFCC 5CKNA 5K9YA 2HYKA 1Q5OA 2RV9A 1JHNA 3FJSA 1PIV2 2VUCA 4IETA 4Q0UA 3MW3A 5FPUA 5JXIA 4CDUA 3OYWA 2Y38A 4ASKA 2E51A 1WMXA 5CFDC 4X6RB 5LCWL 4ZZ5A 2YBSA 2Z79A 3ENRA 2A6ZA 2VTXA 4OI2A 1HB2A 2HLEA 3NW4A 2BWCA 1GICA 1MEC1 2VUAA 3POEA 4QPIB 4XJAA 1LOBA 3IM0A 1V9U1 2Y60A 4XF0A 4RS5C 3DXTA 3O5SA 2DVBA 4KGQA 3DGTA 3DYOA 4OHWA 4BB3A 5IVCA 3MW4A 1W9TA 2F6BA 1VBE2 4XFHA 1EP0A 4ZU5A 3SEEA 3M7AA 3WQ1A 2XGXA 1Z7S2 1W8TA 2AENA 4JCKA 1JOPA 3NNFA 1RMU1 4XACA 1OLQA 5FZAA 4IV3A 1DGWA 4NPMA
chains in the Genus database with same CATH topology
1POQA 1PM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POQ A;  1PM4 A; 
#chains in the Genus database with same CATH topology
 3FLR A;  1PX3 A;  2WT2 A;  1N1V A;  1LHU A;  5KXC A;  1GZW B;  2UWC A;  1SCR A;  1J58 A;  1WW7 A;  2IFW A;  3D3A A;  3V0B A;  1RTV A;  2BYV E;  2MHF A;  4Q4X 3;  1XB9 A;  3ZFE B;  3WIN E;  4QQO A;  1UW8 A;  4CYD A;  3L2Y A;  5LAT A;  4QAW A;  1S0J A;  3N36 A;  2A6X A;  4LT5 A;  2D97 A;  4AFD A;  2PHX A;  3O1R A;  3CEW A;  1AXK A;  4FBF A;  2ARX A;  1S2B A;  1PZ7 A;  1SPP A;  2HWD 1;  4AEK A;  1DQ2 A;  2V4A A;  3LWC A;  3APB A;  2MNG A;  4ERO A;  2ZGQ A;  2ZX4 A;  3NV3 A;  1W8W A;  3N9M A;  5FXZ A;  1MS0 A;  5FZB A;  4NII A;  4WM7 B;  1UMZ A;  3H1Y A;  3O12 A;  5K0U C;  3BUC A;  4Z82 A;  1FMD 1;  2D3R A;  2PYT A;  2ZAB A;  4X6Q B;  4XQD A;  3CMG A;  3JB8 A;  3ZFG B;  4YW3 A;  3FBM A;  3O1P A;  4WVM B;  4D7S A;  5IVV A;  2A6V A;  5ACA 1;  3EXU A;  1GP4 A;  4OUL A;  1NLS A;  4U2A A;  1HRV 2;  3BTA A;  2ZGS A;  4HSL A;  3BVC A;  2ZGL A;  1QHD A;  4HPK A;  2VOT A;  3VBS C;  3VBR C;  3UL2 A;  1BK0 A;  3P6B A;  4K1Z A;  4PT6 A;  5A7Q A;  5JSO A;  3PIJ A;  3Q8B A;  1R1A 1;  1V6K A;  1G9D A;  4JGY B;  3SCF A;  3Q8C A;  4QPI A;  3VZM A;  1RUG 2;  5FPA A;  2VBD A;  1RYY A;  1QQP 3;  1S0C A;  4LXL A;  4QB1 A;  3ZSL A;  4CRQ A;  2JG8 C;  1REF A;  3ZXA C;  4M4R A;  1NUK A;  3VKO A;  1JTZ X;  2WNV C;  2AUY A;  3MDP A;  4N53 B;  4TZD A;  3CKH A;  2VD7 A;  2WFP A;  4RQP B;  3T0A A;  3RZG A;  1F5F A;  2PLV 1;  1X50 A;  2QKD A;  3KF3 A;  5EWS A;  1VP6 A;  2XJQ A;  5GLT A;  5JZG C;  4FPO B;  5LRS A;  2B9V A;  2J1T A;  4IES A;  3VZJ A;  4DUX A;  5I8T A;  5C9A C;  4JTO A;  3G7D A;  2A70 A;  2WNU C;  3GHN A;  3KT7 A;  5H9Q A;  4COW A;  2CGP A;  1GZW A;  2YYO A;  3DYM A;  4M4P A;  2ZZQ A;  3PJQ A;  4NHY A;  3VD9 A;  3JBG 3;  2J1U A;  4E8D A;  5LA9 A;  4HKW A;  2YPJ A;  4BXS V;  4LHL A;  4IE0 A;  4XW3 A;  5C6C A;  2VMC A;  3LSE A;  4CDU C;  5T50 A;  3I2O A;  3ZYF A;  3HNM A;  5EP9 A;  4AK3 A;  3V65 A;  4FTE A;  4G3Y C;  1O3R A;  3C7F A;  3SXW A;  1VRH 1;  2BNM A;  1FPN 3;  1SFP A;  1MEC 2;  2QNK A;  2VZV A;  1RXG A;  3IT8 A;  4KG0 A;  4ONU A;  2R04 3;  2XHN A;  4RD7 A;  3U75 A;  1V9U 2;  2BGC A;  3J7M A;  4M0N A;  4QX2 A;  1PVC 3;  4IND A;  4XF4 A;  5IW0 A;  3WCR A;  1Y9Q A;  1AL2 3;  4Y1U A;  1YCI A;  3AX4 A;  1CPM A;  3TYJ A;  3ZSK A;  3ZR6 A;  4WM7 A;  4QQP A;  1W39 A;  2QQW A;  1W3X A;  2JDU A;  3WW1 A;  4WM8 A;  4CDQ A;  4HK9 A;  4D7T A;  4LO8 A;  1FAY A;  3RYK A;  5FCC A;  4Q4Y 3;  5A6X A;  1RMU 2;  3K3N A;  1PO2 3;  3FBY A;  4ISR A;  4TWT A;  4J1X A;  4QPG B;  3WNN A;  1VMH A;  1XNK A;  1UYX A;  2A3X A;  2D6O X;  3C2U A;  4IV3 C;  3T2O A;  1JZ2 A;  2TEP A;  4LK6 A;  2VZT A;  2OXB A;  3RZH A;  4FPL A;  1E57 A;  4MH0 E;  5FZK A;  4P9L A;  4RR3 C;  5FY0 A;  4KQ7 A;  4JQT A;  1GQG A;  1NE6 A;  3MBW A;  4TTG A;  4JGZ C;  4Y20 A;  5E1R A;  2WR9 A;  4MGT A;  2ZHM A;  1JUH A;  3G6J B;  1ZA7 A;  1UPS A;  1YYN A;  3WUC A;  4Q26 A;  4L97 A;  1OUX A;  3GJA A;  3BOW A;  1YO8 A;  4Q4V 1;  3KB5 A;  2IXH A;  2MEV 3;  3ACL A;  2G9Z A;  4HT1 T;  4A44 A;  2HWD 2;  1GP5 A;  4YVW B;  5EV7 A;  1JBC A;  4URT A;  5BUV A;  5A3O A;  4NR1 A;  3AFG A;  5LK5 A;  4IUG A;  1YLL A;  1QH6 A;  2DVA A;  1W0O A;  3MPP G;  3V0A B;  1OHF A;  3FUQ A;  1G9A A;  5C71 A;  4E4H A;  3I97 A;  3IPV A;  2YY1 A;  1OOP B;  2WC2 A;  5DDJ 3;  1BKZ A;  4PQ9 A;  3WUD A;  1FMD 2;  4M0H A;  4XJ8 A;  4FPC A;  3UYJ A;  3VL9 A;  1K5J A;  4GAZ A;  4CP0 A;  1GKB A;  4A7Z A;  2WS9 1;  1XXN A;  2FCT A;  2QE3 A;  2E26 A;  3KM5 A;  2VUD A;  4I02 A;  3W5M A;  1OFS A;  3HNY M;  5ACA 2;  1UZ0 A;  5SV8 A;  1HJF A;  4YM3 A;  1NA1 B;  3ZKU A;  2JKX A;  2W94 A;  5ABJ B;  5CB7 A;  2R32 A;  3AZV A;  1DGR N;  3I8T A;  5EIY B;  4IL7 A;  2QQL A;  5JPN B;  3LAG A;  2J7M A;  4ET7 A;  3KQ4 B;  3RZZ A;  1J3P A;  1UU6 A;  3ZYH A;  1YNA A;  1R1A 2;  1ZYB A;  1W8F A;  1XYP A;  3LIH A;  3R4S A;  5BNQ A;  4Q1P A;  4QPI C;  3RYR A;  2QDR A;  4HVQ A;  1KRI A;  2XJR A;  3DV8 A;  1OFN A;  2WN3 A;  1GNZ A;  4AQS A;  3BTX A;  1POQ A;  4YW6 A;  4FXK B;  4AFB A;  3VB9 A;  1MR5 A;  2OW4 A;  4KWJ A;  2PLV 2;  2YG0 A;  4CCN A;  4FFF A;  2RMU 1;  1CAW B;  3WF0 A;  4LO7 A;  3R0R A;  2WLP A;  1S2E A;  3QD6 A;  2XKO A;  2NMN A;  4ZHN A;  2XUM A;  1WW5 A;  4JHZ A;  2CGO A;  5FY7 A;  2C6S A;  2EF6 A;  4R9B A;  3T2Q A;  4DZG A;  1RVF 3;  1JYX A;  5FUP A;  4K6B A;  4DXT A;  2C26 A;  4C0H A;  1Q8Q A;  2XBO 1;  1UO9 A;  3KMH A;  3ZIX A;  5KC6 A;  2XJV A;  2VMF A;  1TVG A;  2Y6J A;  3ZFE C;  4NIG A;  3SCG A;  5FY5 A;  1BK1 A;  2VCM A;  3AC0 A;  4S2H A;  5FY8 A;  4K7J A;  4FOV A;  2JX9 A;  5JMO A;  3BPS A;  1H2M A;  1J1L A;  4IGO A;  4CTE A;  1KS4 A;  1VRH 2;  2W52 A;  1UX7 A;  2JXA A;  1VAV A;  1DQ1 A;  3HBZ A;  2CGN A;  1GOH A;  3H50 A;  4XBL A;  3W21 A;  1JZ8 A;  3U1X A;  2W46 A;  3AJY A;  2BOI A;  4G4F A;  3TEX A;  5IVF A;  1S1A A;  2DCJ A;  4NHX A;  4CCE A;  2WLQ A;  3T2T A;  4P5Y A;  5FBZ A;  4FAG A;  1XRU A;  1RUJ 1;  5JDB A;  1VLN A;  2P6H A;  3AMP A;  2ID4 A;  3IWZ A;  4AW7 A;  2VNV A;  3U78 A;  3V0A A;  3E1F 1;  5EPA A;  2HYX A;  4YW4 A;  1VAL A;  5FMO L;  3WG3 A;  2OT7 A;  3DKQ A;  3MIG A;  3ZXG A;  1TZO A;  2AYH A;  1PM7 A;  4WM7 C;  2CV6 A;  3A22 A;  3MEP A;  3VHP A;  3TBD A;  3ZFG C;  1U5Z A;  1DGR A;  4OUS A;  3IN9 A;  5F3E A;  1DLC A;  2W9X A;  2ADE A;  3VBO B;  1NA1 A;  2YMZ A;  1GLH A;  1XNB A;  2P6C A;  3BCW A;  3Q8F A;  4JC1 A;  1C1L A;  2ATF A;  4YZ1 A;  1SDD B;  1UF2 C;  4QM8 A;  4SLI A;  5KR7 A;  2YFU A;  2GME A;  3ZLI A;  2D44 A;  5HV0 A;  4A42 A;  2AGS A;  3ZXL A;  5BV6 A;  1RC6 A;  2VZO A;  3N9L A;  2WSV A;  4KWL A;  5LBC A;  4E4D X;  2HWB 3;  3K48 A;  4EN8 B;  5D21 A;  2JDM A;  4JGY C;  1T6B X;  3HN1 A;  1MVQ A;  4Q4V 2;  1OF4 A;  2WNE A;  3OB8 A;  4BOW A;  3UKV A;  1OD5 A;  2BV4 A;  3AJZ A;  4JZR A;  5E89 A;  4XIO A;  3ZXJ A;  1CR7 A;  5FZ6 A;  5EXO A;  1F31 A;  3S7E A;  3OG2 A;  3FLT A;  3ZYI B;  1LU2 A;  1M4W A;  1H30 A;  1O6U A;  4N53 C;  2GSY A;  3ETQ A;  2VO5 A;  1LED A;  5KBF A;  3QAC A;  4RQP C;  2GZW A;  1C3H A;  2V09 A;  1CAW A;  4LTA A;  4QU2 A;  4R8H A;  1W6M B;  2FDJ A;  2WWU A;  3SC7 X;  3ZYJ B;  1Y4W A;  4FOW A;  4E8C A;  2PHF A;  2GC3 A;  2W5F A;  1CX1 A;  1NAE A;  5CG9 A;  2HEY F;  5FTT C;  1TMF 1;  4F3J A;  5F3C A;  1AYN 3;  2WS9 2;  4QKF A;  4RHV 3;  3RWN A;  2OX0 A;  4C91 A;  4B8E A;  1QJY 3;  3HT2 A;  5HCA A;  3MLL A;  1VRB A;  2XON A;  3MZH A;  2VQ0 A;  2JDY A;  2R49 A;  4X8P A;  3RI8 A;  2EIG A;  4D7Y A;  1OA2 A;  4UBH A;  5J1X A;  1H4H A;  5LZ6 A;  4V2W A;  3NMB A;  2Q8O A;  2G9F A;  3U10 A;  4F83 A;  3AMM A;  3S5A A;  1FOD 1;  1REE A;  2Y6F A;  2O0O A;  4AVB A;  1LGN A;  4Q4W 1;  4FPG A;  1O5U A;  1ZVF A;  4GJZ A;  1UXZ A;  1CGP A;  4NAM A;  1I3H A;  1OPO A;  2WQZ C;  5F2W A;  3HBK A;  4B4Q A;  4UI9 L;  1C5I A;  4MGS A;  3ZFF B;  4P9I A;  2BJS A;  1WME A;  1BJQ A;  3H3U A;  2KXL A;  4MAD A;  4L2N A;  4E2S A;  1IS3 A;  3W20 A;  1Q8V A;  3NV4 A;  3T30 A;  4O9E A;  2DBI A;  1X36 A;  2ET1 A;  2RMU 2;  2FDK A;  1OQD A;  1SLL A;  2P37 A;  4K8F A;  4ORF A;  2ZS6 B;  5DMY A;  1PZ8 A;  2EAL A;  4ISQ A;  3RPQ A;  5FP9 A;  3J7H A;  4JV4 A;  4QPG C;  3UV9 A;  2R1B A;  3MLK A;  2X53 S;  5T5L A;  4U36 A;  2YDE A;  2LAL A;  2XG3 A;  2XBO 2;  2LRO A;  5JLV A;  5KHK A;  4AAX A;  1W8H A;  4BK4 A;  1O8P A;  2FD8 A;  3TAY A;  5KHI A;  1BEV 1;  4RL7 A;  4YM2 A;  1H6X A;  4CCO A;  1OUS A;  1H2N A;  1RUE 3;  4CP1 A;  2Q8E A;  1KS5 A;  2LTN A;  3AL6 A;  3VD7 A;  5L7O B;  3CIH A;  1MS1 A;  3BGA A;  1LOA A;  2YGM A;  5ISL A;  1PNF A;  1IOA A;  2QQV A;  1HRI 2;  1C8M 3;  2R16 A;  2C9K A;  2YC0 A;  3ACF A;  1RUJ 2;  3PLQ A;  4NWV A;  5DAV A;  4XC9 A;  4XUP A;  1UYY A;  3WP3 A;  5I0D A;  2ZEY A;  5GLU A;  4Y3O A;  1HN1 A;  4W8J A;  5FPB A;  2VME A;  4AI3 A;  2BRT A;  4LE4 A;  4QGM A;  1VBD 1;  3ETP A;  5KWR A;  1W6M A;  4AGG A;  1OOP C;  1LHN A;  3I3M A;  3UKN A;  5FYC A;  1DHK B;  4ATF A;  3LKJ A;  2H6B A;  3FHQ A;  5A6Y A;  5FJH A;  2XJT A;  2W3J A;  1NA1 C;  2ZBJ A;  4PLO A;  5GAL A;  4MGQ A;  5ABJ C;  5C3R A;  5DUV A;  1YHF A;  4Y1X A;  3WOG A;  1MS3 A;  3KWV A;  1AVB A;  5CIS A;  4NMI A;  2W91 A;  2WKK A;  2ZML A;  4JRA A;  4Y1Z A;  2FDI A;  3WY6 A;  1NCR B;  4YAR A;  2ZX2 A;  4RGK A;  4XF1 A;  5FZO A;  5FZ0 A;  1LTE A;  1QDO A;  1H2L A;  3R4D B;  4PCR A;  4QDS A;  3O1T A;  4C1X A;  4CEY A;  3WNP A;  2PTM A;  3ZFF A;  1ZA4 A;  1KFU L;  2BZD A;  1VBB 1;  2ZHL A;  2ES3 A;  2E31 A;  2F4P A;  3J8F 1;  4MHU A;  1LHO A;  4FO9 A;  1CON A;  3JD7 1;  2WSU A;  4JKM A;  5FZ4 A;  4LIU A;  3ZOI A;  1GOF A;  4AI9 A;  3B69 A;  3BTY A;  3M3I A;  3KCC A;  4CP2 A;  3U11 A;  1TMF 2;  1YI7 A;  3TOJ A;  4BYY A;  2YBK A;  1HQN A;  1KDK A;  3I7D A;  2DUQ A;  3GBG A;  1ZZ8 A;  2V73 A;  3HAG A;  5FV3 A;  2CNA A;  3GBW A;  3GNE A;  5DAX A;  4URA A;  2Y6H A;  3H9A A;  5AFE A;  2LS6 A;  1ASJ 3;  4R4Z A;  1MS9 A;  3PU3 A;  3ZN6 B;  5FUI A;  4RFR B;  3S5Q A;  4DIQ A;  4LBM A;  1HJG A;  2P3Y A;  1FOD 2;  1BVV A;  2ZAC A;  4COY A;  5IK5 A;  4Q4W 2;  1NXM A;  1UOG A;  2GH2 A;  5L7O A;  2XB6 C;  3ZKY A;  4HL0 A;  5I91 A;  1DQ0 A;  4IEY A;  3NKG A;  4K8R B;  3C7G A;  1VPH A;  4CUC A;  2VZR A;  4DOU A;  5CA6 A;  3KQR A;  4LLO A;  4A6S A;  3OEA A;  2QQN A;  5CBL A;  1SBD A;  1OBN A;  4XIK A;  4GWM A;  4H7M A;  3PVN A;  5JSP A;  4GAL A;  3HOB A;  5I93 A;  4FI9 A;  1HW5 A;  2D6M A;  2VW0 A;  3OY8 B;  3D0S A;  5FXV A;  1ZRE A;  4LHS A;  2W1Q A;  2QQO A;  3PVE A;  4K1Y A;  3TWI A;  3TN9 2;  3VBO C;  2A7A A;  4PIZ A;  1Z78 A;  2R07 1;  2W87 A;  3K3O A;  3VHR A;  2IWG B;  3AP6 A;  2RDR A;  3F2Z A;  2K46 A;  1G9F A;  3K77 A;  3NV1 A;  1ZRD A;  1BEV 2;  3AP4 A;  2DFC A;  1CQ9 A;  2NZ9 A;  1NCR A;  3VHO A;  4QM9 A;  1GZC A;  1S0D A;  2Y33 A;  1EV1 3;  1G6N A;  4FT8 A;  2CYF A;  5CKQ A;  1OH4 A;  5KC5 A;  4FQZ A;  4XHX A;  2GDF A;  4IEU A;  3KD4 A;  1WLD A;  3W59 A;  2ADD A;  2WDB A;  3GJB A;  2GP3 A;  4N8M A;  1PX4 A;  4X8N A;  3EBR A;  1XE7 A;  2VCC A;  5L73 A;  4CCC A;  2EXJ A;  2OZJ A;  3ZXD A;  3WDT A;  4DY5 A;  5L9V A;  2JD9 A;  1QWR A;  1WD3 A;  2RS5 3;  1W2T A;  1VBD 2;  4AR2 A;  1RUC 3;  1KDM A;  4OUM A;  5HI0 A;  2JJ6 A;  3VHN A;  4MGI E;  1JZ6 A;  2J1R A;  4FP2 A;  3IDC B;  4NRQ A;  1LHV A;  2EA7 A;  2K2S A;  2EXH A;  4MGZ E;  5FZD A;  5A33 A;  2HWE 1;  2WFF 1;  3LA3 A;  4AEJ A;  1XU1 A;  2YV8 A;  4B3N A;  5DAP A;  1UYZ A;  4CDW A;  3KT4 A;  4EWD A;  1RUO A;  1AR8 1;  3WNM A;  2VU9 A;  1QDC A;  1UZW A;  2QQJ A;  2VG9 A;  5L9R A;  5FZC A;  1ENX A;  2SBA A;  3ZN6 A;  3WSO A;  4E4S A;  4FTB A;  1LOF A;  2WWJ A;  2XML A;  3WXP A;  2Y6L A;  1QU0 A;  4AQT A;  2ZZJ A;  1AYM 3;  2JG9 A;  1CIW A;  4MET A;  1CZS A;  3AZZ A;  4C0B A;  4XUR A;  1RUH 1;  2PQQ A;  2W1S A;  3UET A;  4CU6 A;  4NJ4 A;  3SH5 A;  2VMI A;  2ZAA A;  1PGL 1;  3LDR A;  1D0G A;  1VBB 2;  4FCA A;  1UY2 A;  3V0B B;  2NP0 A;  3ZFF C;  1UWW A;  4H3W A;  3J8F 2;  3T09 A;  4CUA A;  5LA2 A;  1DGW X;  2JIJ A;  3JD7 2;  3T1M A;  2VAU A;  1AR7 3;  4H7L A;  2WYF A;  3UT0 A;  2W1U A;  1A78 A;  2ILM A;  4BMB A;  4LKE A;  3WHU A;  2ZPX A;  3OY8 A;  4AI2 A;  4YW7 A;  5A3U A;  2GNT A;  4IV1 B;  1U5Y A;  3A21 A;  3BI3 A;  3MO4 A;  5FK7 A;  4AVV A;  4BQ5 A;  4XHB A;  4DMI A;  5FWJ A;  3LB9 A;  3ZYB A;  2D40 A;  3LCP A;  2NM1 A;  5DZF A;  5F9T A;  1SG3 A;  3NWK A;  3OJB A;  4D69 A;  5C33 A;  4LLF A;  2DV9 A;  1FV3 A;  5DG1 A;  2Q1F A;  4BIF A;  3VL8 A;  3ZXF A;  3MHZ A;  2XDV A;  4EJR A;  4QHO A;  1S0B A;  3BKZ A;  4CUB A;  1UCX A;  1IPK A;  3HNB M;  3U4X A;  1MAC A;  1YQ2 A;  4E9K A;  3P3N A;  1V00 A;  2VMH A;  4E2Q A;  1QXJ A;  3ON7 A;  3IIA A;  3M3C A;  4I30 A;  5L7O C;  4LQR A;  5IJR A;  3AMN A;  5I0S A;  5JI7 A;  4YZ2 A;  1H6Y A;  5JR2 A;  1QNW A;  3AKT A;  3WEZ A;  2WO3 A;  5LY2 A;  1H1M A;  3NAP A;  3N9Q A;  4HPK B;  3RZJ A;  3H7Y A;  2VE1 A;  1U0A A;  2A71 A;  5FYY A;  1M06 G;  2DU0 A;  3OPZ A;  2BVV A;  1EAH 3;  3Q8A A;  1F9K A;  3HD8 B;  3KV5 A;  2WJS A;  3UGG A;  1AR9 3;  3H42 B;  4UFH A;  5ANN A;  2JIC A;  5J96 B;  4A2U A;  1K45 A;  1LCL A;  1O3S A;  2F4L A;  3H8O A;  2R07 2;  3BOD A;  4LA2 A;  2HWB 1;  2X09 A;  1HQW A;  4Q0V A;  1IQA A;  2QUO A;  4FQ4 A;  5DUW A;  5FR3 A;  4A7K A;  4QDR A;  5T3N A;  3I59 A;  2NQY A;  4A6O A;  4LEJ A;  4Q2F A;  3O1M A;  4Q8L A;  4YVW C;  2R06 1;  2WNO A;  3MV0 1;  1BVP 1;  3C7H A;  1Q8O A;  2WQ8 A;  2WN2 A;  3ZO0 B;  5A3T A;  1NCR C;  3Q9O A;  2XVK A;  3ZMO A;  4FOQ A;  2GU9 A;  3ST7 A;  1XYO A;  3ILF A;  3AM2 A;  4ASL A;  5C4W A;  1X7N A;  1CJD A;  3CJI B;  4MXW A;  1OA3 A;  4JHT A;  2W68 A;  1ZRR A;  2VBB A;  4FPJ A;  3L2H A;  4A3Z A;  1DZR A;  1YC6 1;  4AGV A;  2Q1Z B;  2VBP A;  2HJI A;  1QMJ A;  5DPN A;  3I49 A;  5F6L B;  3OCP A;  1LOC A;  1RUN A;  1QJY 1;  4IV1 A;  1WLW A;  2WBK A;  2CDP A;  1TME 3;  3VZL A;  5F5I A;  1X9T A;  3B9I A;  3B5L B;  2HWE 2;  2WFF 2;  3LOI A;  4ZKT B;  3IMN A;  4Y5Z 0;  4UW3 A;  4AF9 A;  4OUE A;  2P17 A;  5GLZ A;  3N7M A;  1AR8 2;  2JDN A;  2QBX A;  3MFA A;  2X10 A;  2GC1 A;  1XOY A;  1OUR A;  1MS8 A;  4FPE A;  5F37 A;  2VQT A;  4C8D A;  2PHD A;  3K4D A;  4WM8 B;  1W9F A;  1LOF C;  4CDQ B;  1S0F A;  4DEV A;  3MW2 A;  2J42 A;  2XWJ B;  4WBB A;  1GSL A;  1YJL A;  3GF6 A;  1RUH 2;  1HX6 A;  1J84 A;  3M8L A;  4LO5 B;  3UKT A;  5K7P A;  3H7J A;  3GCX A;  2FCU A;  4M3C F;  1CZT A;  5JI9 A;  2L9L A;  4N43 B;  1PGL 2;  2H0B A;  3MYX A;  1NG0 A;  3ZPO A;  4Y20 B;  4EWA A;  1US2 A;  2VZP A;  4SBV A;  3KVB A;  2VMG A;  4XUQ A;  4L9B A;  1YQ6 A;  4LBK A;  5F39 A;  3ZXK A;  2HWC 3;  3ZSJ A;  2ERF A;  2HEV F;  3RJ2 X;  4BXF A;  3ES4 A;  2ZAH A;  3WD5 A;  2WO1 A;  3J9S A;  1XYN A;  2ZHN A;  3LEI A;  5J48 A;  1HXS 1;  1CAU A;  1I5Z A;  3KV9 A;  4CP9 B;  1O3T A;  4FTS A;  1AR6 3;  2DVF A;  2RS3 1;  1I5P A;  3SIS A;  1YIF A;  3N7J A;  2ARA A;  2RDN A;  3K75 B;  4QKB A;  4XAE A;  2VM9 A;  4NVP A;  1UOB A;  1W0P A;  4I3G A;  1LOE A;  4ZZ8 A;  5A3N A;  3IPV B;  5GZG A;  5JXH A;  4YG6 A;  1HV0 A;  4BLI A;  1A8D A;  1WWY A;  4AHY A;  2VC9 A;  1IPS A;  2GAL A;  2HKX A;  3HQR A;  4FFI A;  5E16 A;  5FP7 A;  4OQ8 A;  5LB6 A;  3KV6 A;  2QZ2 A;  1D4V B;  3I2K A;  3VN4 A;  1SBE A;  3U37 A;  1RUF 3;  3CJI A;  4YM0 A;  2D5H A;  3VDD B;  5A3P A;  3CZJ A;  3CNA A;  5FKC A;  1I1E A;  3ZR5 A;  1OQE A;  1LR5 A;  1SCS A;  1V6O A;  2H6C A;  2OVU A;  2P3J A;  3HJR A;  5FUN A;  1YFU A;  3WF3 A;  4FSJ A;  2RR1 3;  2WZR 3;  3AVS A;  1ONA A;  5JSR A;  4CSW A;  1G9B A;  4OI4 A;  1YJK A;  1LNS A;  4XE9 A;  2MPF A;  1RL3 A;  4CXW A;  4XJZ A;  3RJR A;  2EVX A;  1L7L A;  3KCX A;  1VBA 3;  1UD1 A;  3SHR A;  3IMM A;  3RSJ A;  3WT3 A;  1HIX A;  3JUU A;  4OVE A;  4QU1 A;  4MX3 A;  5IUQ A;  2ORX A;  3A0N A;  4DUW A;  1HB1 A;  4XAA A;  2HWB 2;  1XND A;  3HPN A;  2AH2 A;  1OI6 A;  3M2M A;  3NNG A;  5BPX A;  1RUI 3;  3W58 A;  4DQA A;  5GZC A;  1CIY A;  4QT6 A;  1HLC A;  1UN1 A;  2WAB A;  5F1R A;  1OC1 A;  3AKS A;  4FFG A;  2R06 2;  2ZGN A;  5DAW A;  3H3Z A;  1IS6 A;  2VZ3 A;  5EJ3 A;  1XPW A;  3AYD A;  1LOD A;  4K9S A;  4TYS A;  4XMI A;  1W28 A;  4BCU A;  4GMP 1;  4N43 A;  2P4E A;  4JDO A;  1EY2 A;  1GNY A;  2PFW A;  3ME2 A;  1CX4 A;  1I9R A;  3PUI A;  4J6G A;  2ZMN A;  2WZE A;  1MQT A;  2XH6 A;  2V72 A;  1FNZ A;  1FNY A;  1PIV 3;  5DN2 A;  2JEC A;  4WZC A;  1QJY 2;  1FX5 A;  2EAA A;  3JQW A;  4JX0 A;  3TEW A;  3UGF A;  5GZF A;  4AE2 A;  4IV1 C;  1ENS A;  2JEN A;  2TBV A;  3ZYP A;  2CAU A;  3MF6 A;  1D0H A;  4QXH A;  1KEX A;  4XUT A;  4CDX B;  4CP9 A;  5J09 A;  1COV 1;  1W8U A;  3HT1 A;  2AEY A;  1UNB A;  3SMH A;  2Q1M A;  2VUJ A;  5FAX A;  4QX1 A;  5FZ7 A;  1UYP A;  3KF5 A;  1ENQ A;  1JZ4 A;  1QXP A;  4MO3 M;  1H4G A;  3HIF A;  1ULF A;  5EQU A;  4BH9 A;  1KIT A;  1YUD A;  4S2D A;  4WV8 A;  4XVH A;  2XVL A;  3WP6 A;  2W1W A;  5JIU A;  5JVV A;  1VBE 3;  1WMF A;  2B8M A;  2RHP A;  3KSC A;  4ASM B;  4GXL A;  1L7Q A;  1Z7S 3;  1C1F A;  2FDG A;  1YI9 A;  2WIN B;  3VDD A;  4PJY A;  2QTW B;  2Z42 A;  3H1M A;  5CVR A;  2PAK A;  2Z4F A;  1PMJ X;  4UXA A;  3M3Q A;  4CEW B;  4YFZ A;  5C7G A;  1ZBE 1;  2D6K A;  1ND2 B;  1YQC A;  2Z2S B;  3S0M A;  4KL1 A;  4LUK A;  4QMA A;  1XC6 A;  2D43 A;  4QHZ A;  4HKL A;  3WDX A;  4XJU A;  5C5T A;  3LEG A;  4GH4 B;  2E7T A;  3KLS A;  3LFM A;  2BER A;  5GM0 A;  4LHK A;  4Z92 B;  1ST8 A;  3KGZ A;  3AKR A;  1ZBA 1;  4ES8 A;  2I2S A;  3H8R A;  2PHW A;  3OD0 A;  1V0A A;  1HXS 2;  4UFM A;  4LIT A;  1E5S A;  3U14 A;  2RS3 2;  3O1U A;  4L92 A;  2Z69 A;  1K5M B;  3O7O A;  1W2O A;  4I0A A;  5FYM A;  1D2S A;  3JQX A;  1JZ5 A;  1C5H A;  4XEZ A;  1VBC 3;  3ZX7 A;  1PK6 B;  1ODM A;  4IQP A;  5LA1 A;  5DG2 A;  1R08 1;  2IFR A;  2K0G A;  4FPF A;  4RFT 0;  3DN7 A;  4XF9 A;  3FFQ A;  4I2O A;  3ZM8 A;  4IDZ A;  1H9P A;  3PTY A;  5AC9 1;  4EQV A;  2BOJ A;  3LD8 A;  5FZE A;  5FO8 B;  5I0R A;  5FZ9 A;  2NYY A;  2CTV A;  3OBT A;  3CJI C;  1JI6 A;  4JKK A;  4R4X A;  3MIB A;  5FMC A;  2WQ4 A;  3ATG A;  1ULP A;  1POV 1;  3ES1 A;  4IGP A;  4AQ2 A;  2DCZ A;  2RS1 1;  4ARY A;  1HRV 3;  4S2F A;  5HPO A;  3OGS A;  2V4V A;  5DZG A;  4MHR A;  1Y3T A;  3M1H A;  1B09 A;  1D7P M;  3ILN A;  2RDQ A;  1IGO A;  3NNJ A;  4B1L A;  4YFW A;  4CDX A;  1TNR A;  2C5D A;  5FPL A;  5C3P A;  4BME A;  1GQH A;  4MZU A;  4LK7 A;  4G9S B;  3WF1 A;  3E6C C;  1JYN A;  4XQW A;  5JUV A;  3EYP A;  3MIC A;  1AYM 1;  5A1L A;  1C57 A;  1W2A X;  3N7L A;  4QX7 A;  2G4I A;  5JR7 B;  2ZGU A;  3QLQ A;  1G8W A;  1O59 A;  1XSR A;  4KH9 A;  3VKF C;  1IG0 A;  5K8S A;  4WM8 C;  4CDQ C;  1QY4 A;  3GBF A;  3PUH A;  4PDW A;  1J83 A;  1WW6 A;  4CEW A;  1SLI A;  5D1I A;  3ZVX A;  1AR7 1;  5A1A A;  3OBA A;  4N43 C;  1ND2 A;  2IXC A;  4CU9 A;  3WQB A;  4LBJ A;  1LGB A;  2GAU A;  2JDA A;  5FYZ A;  2GNM A;  4AI1 A;  3I2G A;  4E2G A;  4EZH A;  5IAV A;  4A4A A;  3IB3 A;  1JU4 A;  4GB3 1;  4XTM A;  4Y24 A;  1CPN A;  4GH4 A;  4S2G A;  1UKR A;  5FYS A;  5JIA A;  1ULE A;  2ZGO A;  4AI0 A;  4IGQ A;  3T0D A;  4DRV A;  1RJ8 A;  4HN0 A;  1DU3 D;  1JOB A;  1DYO A;  3FFZ A;  1ZNP A;  3LSD A;  4UBG A;  4YWA A;  3B7M A;  1APN A;  5ANQ A;  4IEW A;  1JH5 A;  1COV 2;  1GU3 A;  3OGJ A;  4BIS A;  1ULD A;  1K5M A;  2UUR A;  1IKP A;  3J7L A;  1K3I A;  4MOA A;  5T54 A;  5T5P A;  3RMY A;  2J1A A;  2VQA A;  4I09 A;  3TNQ A;  1V9U 3;  4UW5 A;  1W6Q B;  2XLG A;  1PK6 A;  4OHZ A;  3UES A;  2A73 B;  1PGW 1;  2DCK A;  2I07 B;  2JDK A;  3D6E A;  4N90 A;  4K20 A;  2Z5W A;  4XMA A;  2YU1 A;  2W47 A;  1AXY A;  1J3R A;  3WG1 A;  3M4F A;  1VAK A;  1AX0 A;  2EAK A;  4MGY E;  3AKQ A;  1DZT A;  1RMU 3;  2YHJ A;  4HG6 B;  3VDD C;  4OMC A;  2VUL A;  1ZBE 2;  1AJK A;  1SZB A;  5C3Q A;  1ZZC A;  4UT5 A;  2XHK A;  4P08 A;  3ZN5 A;  1AR9 1;  4DPN A;  2ZJC A;  1FAT A;  2G19 A;  1OSG A;  4B7E A;  4Y4R A;  1DLL A;  2YUE A;  5FZO B;  3C3V A;  3IKW A;  1MZ5 A;  2GP5 A;  4HMZ A;  1WA6 X;  4IER A;  1ZBA 2;  4QGL A;  4YG0 A;  4CEY B;  4KWK A;  2ZX0 A;  3BPZ A;  3P3P A;  3GCW A;  4R52 A;  1XNA A;  1WBF A;  2ZCW A;  4FOY A;  4QX5 A;  1NCQ B;  2WAO A;  1R09 3;  3DF0 A;  4O7X A;  4A41 A;  3EB7 A;  1UY4 A;  3O14 A;  1YXW A;  5HCF A;  4GWI A;  3I2F A;  1R08 2;  3SIT A;  1W6N B;  4PBO A;  1KD7 A;  4Q4X 1;  2KD7 A;  1S0E A;  1HB3 A;  1NLR A;  4YNI A;  5FK8 A;  5AC9 2;  3ILR A;  5FLI A;  2P34 A;  2SLI A;  4LUL A;  4ZON A;  1PO1 3;  2EXK A;  5JOW A;  1Y7B A;  3L9J T;  3DL3 A;  2IC1 A;  1STM A;  4ATE A;  5ACA 3;  3ACH A;  2RS1 2;  5LY1 A;  4XBN A;  5CNA A;  1IS5 A;  1WLT A;  3RFR A;  4OYU A;  1V6M A;  1E5H A;  2E32 A;  3FZ3 A;  1DIW A;  3FMG A;  4CU7 A;  3QBQ A;  4LKD A;  4FP3 A;  3FE5 A;  2VXJ A;  2WZ8 A;  4Z1V A;  3D4K A;  1W05 A;  2XL9 A;  1CES A;  2YBP A;  5FY4 A;  5BNO A;  1K42 A;  4PLN A;  2JIG A;  4JDN A;  1R1A 3;  4PHZ A;  4BM8 A;  4CDX C;  3O1V A;  1KJR A;  2NN8 A;  3VKN A;  5C8C B;  1WLC A;  3FLP A;  2D98 A;  5F5C A;  2OUH A;  5JXG A;  3AYE A;  1W6Q A;  4M3C B;  1AYM 2;  1UMH A;  4QPW A;  1NKG A;  2D6L X;  2W2I A;  5T5J A;  3ZDV A;  5IFP A;  2HBT A;  2LW8 A;  3WNX A;  3WDW A;  2RJ2 A;  1RJ7 A;  1S0G A;  1XE0 A;  4PI0 A;  2BGO A;  5I0T A;  3RDI A;  5BNN B;  4QKN A;  3PMS A;  2PLV 3;  2VY0 A;  1NZI A;  3D8C A;  3H3L A;  1QJX 3;  2DCT A;  4CPB D;  4J25 A;  4R9A A;  1AR7 2;  5FYT A;  4IEP A;  1WZX A;  2HWC 1;  3C7O A;  3OPW A;  2C9A A;  4CEW C;  4BQ3 A;  4XBQ A;  2Y8K A;  5A7W A;  1ND3 A;  1ND2 C;  4P9J A;  4MYE A;  1N1Y A;  1PZ9 A;  2A5Z A;  5J7M A;  1QQP 1;  3TEY A;  2OQ6 A;  1Q8P A;  1ZRI A;  1OD3 A;  1Q3E A;  4LKF A;  2X05 A;  4LMF A;  4GB3 2;  1JYW A;  2A1X A;  3OOX A;  1Y9G A;  4GH4 C;  1A3K A;  1H8T B;  2R30 A;  3RWK X;  3UJQ A;  4OI0 A;  4QXB A;  1DG6 A;  1S2K A;  2CY6 A;  3BIW E;  1UKG A;  2PHL A;  1WGP A;  1XQN A;  3FUO A;  3NV2 A;  3VBF B;  5FY9 A;  3FC0 A;  3I2H A;  3OPT A;  1NCQ A;  3TEZ A;  2D3S A;  4JQR A;  3NVC A;  2E33 A;  3MUZ 1;  4PI2 A;  3WP5 A;  5CAZ A;  1N3P A;  1K5M C;  2VGD A;  3TB0 A;  1BYH A;  5FZ1 A;  3URF A;  3AZX A;  3OF1 A;  1PK6 C;  1PGW 2;  3HMY A;  4Q0Q A;  5FIX A;  2AR6 A;  3E5U A;  3JBG 1;  4LNV A;  1W6N A;  4J1W A;  5G04 L;  3HQU A;  2O14 A;  1LEM A;  1W6P B;  1XJA A;  4XCB A;  3MFC A;  3PIG A;  4DB5 A;  5A33 B;  3KV4 A;  3WQ0 A;  3IDE A;  4CZS A;  1VJ2 A;  4CDW B;  1V6J A;  4FPH A;  1X9P A;  4GKY A;  1UL9 A;  4UFJ A;  4E4Z A;  2NLR A;  1NT0 A;  1FPN 1;  5FZL A;  4Q1R A;  2WT0 A;  5T5O A;  2R04 1;  2D93 A;  4HOO A;  1AR9 2;  2P3I A;  2A3Y A;  2IVI B;  3E6B A;  3E6D A;  4CCJ A;  5CAD A;  4H55 A;  5FOB B;  1PVC 1;  4Y1Y A;  1CAV A;  2E53 A;  2GC0 A;  2B9U A;  2JG9 B;  3I4I A;  5L36 A;  1PNG A;  1AL2 1;  2OS2 A;  4AED A;  1AF9 A;  1XBF A;  5C8C A;  3B02 A;  4HN1 A;  4IE5 A;  1EUU A;  2F17 A;  1ZZ7 A;  3S7I A;  4P9Y A;  4NAO A;  3NL1 A;  4M3C A;  4N7I A;  3RG0 A;  4Q4Y 1;  3VDC A;  4NE9 A;  1PO2 1;  3PJY A;  1YFY A;  4QX8 A;  1OLM A;  1W90 A;  3MUY 1;  3POS A;  4EN0 A;  4AXO A;  5BNN A;  2VZS A;  3I2J A;  1GAN A;  3LF7 A;  1W9S A;  2ZEZ A;  4LE3 A;  1Y43 B;  4Q4X 2;  5CFC A;  2BNN A;  1SLA A;  3W9A A;  3LA2 A;  4XZU G;  5A32 A;  4O65 A;  1DBN A;  3WR0 A;  4LOT A;  5IVY A;  4JVA A;  4Z07 A;  3T0B A;  5FWE A;  4CXX A;  1Z0H A;  1WCK A;  4M00 A;  2JKB A;  2MEV 1;  4MLO A;  4NRO A;  3WF2 A;  5DAQ A;  3ROU A;  5M0T A;  1ULG A;  3MIH A;  4XQ4 A;  4LKS A;  4XTP A;  4NHL A;  1H8T A;  4RGA A;  5FP8 A;  5LRR A;  3WDV A;  1O91 A;  1SHW B;  4AI8 A;  3VBF A;  1J59 A;  1OPM A;  2YRO A;  5CYY A;  2OUJ A;  1O5L A;  3O1O A;  2HEW F;  2E7Q A;  1KFX L;  5ERL A;  5HBA A;  1GFF 2;  1W3V A;  1X82 A;  1GOG A;  3NAP B;  1CAX B;  5FLH A;  4GQ7 A;  1AXZ A;  2XLA A;  2Q8D A;  5FDB A;  3FL7 A;  5H9R A;  1G86 A;  1O8S A;  2PHR A;  4YW1 A;  4KBZ A;  3ZN4 A;  1W6P A;  4WVW A;  4C90 A;  1W9Y A;  2YC4 A;  2WL1 A;  1RB8 G;  3D5O A;  1YQ8 A;  4ZY9 A;  2OII A;  2RMU 3;  4KU7 A;  2J22 A;  5L19 A;  3E5X A;  2WA4 A;  4GD4 A;  5HXV A;  4YGC A;  3RYP A;  4GWJ A;  4ARX A;  3GZU C;  2JEM A;  2HWC 2;  1PMI A;  5A7N A;  5LAS A;  1WKY A;  3I59 B;  2QCS B;  2OKX A;  1GNH A;  1QQP 2;  1ZX5 A;  2BTV C;  2EID A;  5IK4 A;  4GKX A;  2TNF A;  3OD4 A;  1WCU A;  2BDR A;  5C3O A;  1ZRC A;  2VTX J;  3OGV A;  5FZG A;  4F7Z A;  4RGG A;  5AFB A;  2BQP A;  1OQ1 A;  4YGB A;  1OT5 A;  2YFZ A;  5FY1 A;  3B9C A;  3GZE A;  3HN3 A;  2W92 A;  5C4W B;  4MXW B;  2CSG A;  2PHU A;  1AZD A;  1VBC 1;  3MI8 A;  4CEY C;  2DUO A;  4ES9 A;  2O8O A;  1UU5 A;  5J37 A;  4AHZ A;  1V6I A;  1NCQ C;  2HWF 3;  5K0U A;  3O0X A;  1H1A A;  3FN9 A;  1HRI 3;  1RUD 3;  1LAJ A;  4W4Z A;  5CG8 A;  4P5H A;  1RVF 1;  1IG3 A;  1GP6 A;  2W39 A;  2QQP A;  3O1S A;  3JBG 2;  4H2A A;  4IE6 A;  4ZXE A;  2JDH A;  3UNP A;  4LBQ D;  1GR3 A;  2RM2 3;  5AVP A;  4QX0 A;  4DEQ A;  2GND A;  4PF1 A;  5K4L A;  2EIB A;  3AXE A;  2ZX1 A;  3NNL A;  2VW2 A;  3HQX A;  4NRP A;  3VBS A;  5B4X A;  4C1W A;  2XKP A;  4DXR A;  5DDJ 1;  2WUH A;  2FDH A;  3UK9 A;  4LIV A;  4MV2 A;  3POI A;  1UZV A;  5T52 A;  1FPN 2;  1Y9M A;  5JWP A;  3JB4 C;  3ZSE A;  3PUA A;  2R04 2;  5FOJ B;  3B94 A;  1GMM A;  4TLF A;  1PVC 2;  5KXD A;  3KVA A;  1AL2 2;  1JS9 A;  2JG8 A;  2E63 A;  2ZKN A;  3CHX A;  2VMD A;  3ITQ A;  2WNV A;  4DO0 A;  4BPZ A;  4PBP A;  3P5B A;  4PLM A;  3WDU A;  1L3J A;  5LA0 A;  4D6R A;  2Y6G A;  4QB6 A;  2BFU S;  4K3U A;  2NPI A;  4HK8 A;  5C8C C;  3KHC A;  4AQ6 A;  1CAX A;  3WDY A;  3ORJ A;  4Q4Y 2;  3WLU A;  5JZG A;  2VOV A;  1UAI A;  1PO2 2;  4Y22 B;  1ZZ9 A;  4WZF A;  3B00 A;  3WHT A;  3RZL A;  1UPI A;  4XFI A;  3TRS B;  5DUX A;  4BQ2 A;  2XR4 A;  4LHN A;  1VB2 A;  3AB0 A;  3I54 A;  3F95 A;  3S30 A;  3GZA A;  5BNN C;  4K21 A;  2QDN A;  4HBN A;  4HXC A;  4MSV A;  3C7E A;  4DS0 A;  1B35 B;  2P5B A;  1CAU B;  4QQ2 A;  4Y33 A;  3OGG A;  1FT9 A;  4YYO A;  4YG3 A;  1DZQ A;  1TMF 3;  2D7F A;  3SEP A;  3ZYR A;  2VR4 A;  1IZ3 A;  3PL0 A;  2LUW A;  2UY9 A;  1RXF A;  4CUG A;  5BNP B;  1E5R A;  2B42 B;  1F5J A;  3LQC A;  2MEV 2;  5GLV A;  5IK7 A;  1US3 A;  5FZI A;  4CXY A;  1R64 A;  3BIE A;  3AMQ A;  2VJX A;  3WX5 A;  1D2Q A;  1K12 A;  3LEM A;  2VNR A;  3ACG A;  2GH8 A;  3S6P A;  2Q5T A;  1H8T C;  1BBT 3;  2YPD A;  4UW4 A;  4KI5 M;  3NJX A;  2B7Y A;  3CLP A;  1FOD 3;  4BQY A;  4QWN A;  4QKD A;  3VBF C;  1CZV A;  2C1F A;  4NRM A;  4Q4W 3;  3N9P A;  4ITC A;  5FMD A;  4EN7 B;  3BN6 A;  1AYN 1;  4RHV 1;  1RHI 3;  5DQ0 A;  5IVB A;  3J7N A;  3JCI A;  4JTN A;  5A3W A;  2VOK A;  2ETE A;  4NN0 A;  4GA9 A;  1JMU B;  2VZ1 A;  4PQQ A;  5FYB A;  3JU9 A;  3VBH B;  3PTR B;  3AL5 A;  4V2V A;  3VUO A;  1EPZ A;  2OA2 A;  4RR3 A;  4IEQ A;  2J1E A;  2X5I B;  3BAL A;  1ZZ6 A;  3D0J A;  4UWD A;  4AOC A;  4CDW C;  3U0Z A;  4JGZ A;  3MV1 1;  3PUR A;  4OI1 A;  4XDP A;  4DFS A;  3KGL A;  3AKP A;  3HVD A;  4TSV A;  4MG2 A;  3TN9 3;  1W2U A;  1H2K A;  3USU B;  2IVJ A;  4EV0 A;  5T55 A;  4IW3 A;  1QJZ A;  4HSJ A;  4KNC A;  2BU9 A;  2W95 A;  2EIE A;  2I74 A;  2VEC A;  4E27 A;  2JG9 C;  2VH9 A;  2IXJ A;  2W08 A;  4XAB A;  1LJ7 A;  1D4M 3;  1BEV 3;  1R09 1;  4KG8 A;  1N3Q A;  3RMX A;  5GZD A;  1NX9 A;  1QJF A;  4AGR A;  1VBC 2;  4CPB A;  5CZK A;  3S57 A;  2Q30 A;  1W6O A;  4DUV A;  4HET A;  4Y22 A;  3VDB A;  2C4X A;  4A3X A;  2DYC A;  1MQT B;  4L8Q A;  3VBU B;  1JN2 P;  1SBF A;  3RVH A;  1GZ9 A;  1AX1 A;  1RVF 2;  3NKT A;  4BIO A;  4LBL A;  1PO1 1;  4Q29 A;  2EIC A;  2N7G A;  2ZOE B;  1H0B A;  4AVC A;  1VBD 3;  5DZE A;  5IHR A;  1B35 A;  5HCH A;  1BQP A;  1HB4 A;  1VIW B;  2YU2 A;  2ZGT A;  1PGS A;  4I01 A;  4AAP A;  1RUE 1;  5DAB A;  5B2G B;  2RJL A;  5IWF A;  5DDJ 2;  1H1I A;  5BNP A;  2IXK A;  5CKM A;  3IAQ A;  1TNF A;  4NIA A;  3LPF A;  2J1S A;  3GHM A;  2ARC A;  2RE9 A;  3H8U A;  3J4U H;  5FLJ A;  5H9S A;  2A6W A;  3JZV A;  3VKL A;  2YXS A;  1C8M 1;  2WA3 A;  1IKQ A;  1T6G C;  3ZPY A;  1IQD C;  3POB A;  3KCY A;  2LM3 A;  3AP5 A;  4PIY A;  2DBN A;  2NMO A;  1F15 A;  1SFN A;  4N9I A;  3WZ1 A;  4EYU A;  2O8Q A;  1QIQ A;  3H1W A;  2E9Q A;  5FQ0 B;  3IZO A;  4CCM A;  1C4R A;  1U12 A;  3NAP C;  2ZGK A;  1NY7 1;  4AVA A;  4M01 A;  1XNC A;  1YFX A;  2H0V A;  3I3D A;  1OKQ A;  1VBB 3;  5FRA A;  1JYV A;  4LBO A;  1QJX 1;  4OHX A;  2IUW A;  3J8F 3;  1U5X A;  1TQ5 A;  2KA3 A;  4W65 A;  3VBH A;  5IVE A;  3JD7 3;  4W50 A;  4MUV A;  1WD4 A;  3CU7 A;  3SKJ E;  1EUT A;  1JW6 A;  4LUM A;  4HVO A;  1LEC A;  4O9G A;  2Y0O A;  4B4P A;  3IDA A;  4AFM A;  2X5I A;  2VXR A;  3IBM A;  1F4A A;  5GLW A;  2DTY A;  5LBF A;  4Z2W A;  3ZFE A;  1XSQ A;  2LRP A;  4QXC A;  4NID A;  2RJK A;  3M70 A;  2D6N A;  1IS4 A;  5A3L A;  3BU0 A;  3DEM A;  3USU A;  4XDQ A;  1RIN A;  1OLR A;  3WQ7 A;  4BE3 A;  1TEI A;  1ZZB A;  1QJU 3;  2ET7 A;  3WVJ A;  1JHJ A;  2BP6 A;  4B29 A;  2XJS A;  3I2I A;  3MF9 A;  3THP A;  4KMQ A;  1LES A;  3AYA A;  4OZX A;  3AZY A;  4YGE A;  3T1L A;  3W5N A;  2AAC A;  1PVX A;  4O61 A;  1AX2 A;  4BK5 A;  2IXI A;  2K9Z A;  4LBQ B;  4Y5T A;  3I3Q A;  3PU8 A;  5EFU A;  5EYX A;  2VQU A;  5C4W C;  4COZ A;  2XJP A;  3PVB B;  4RN5 A;  4XUN A;  4I0B A;  4XJW A;  4FVV A;  1ODN A;  3SNM A;  3GDB A;  1JZ3 A;  2Q4S A;  3DEC A;  1AYN 2;  3VBU A;  2XLF A;  2CDO A;  1SQ4 A;  1RED A;  4RHV 2;  3ZSM A;  3PME A;  3RGB A;  3B3Q E;  1A34 A;  3ZFG A;  4GJY A;  5EJZ B;  5GJ6 A;  4P9X A;  4EN6 B;  4AHX A;  3KZ4 C;  4UFK A;  4WVM A;  1W8N A;  1UIJ A;  1T2X A;  4XFG A;  2PQS A;  3MIE A;  1ASJ 1;  1JYC A;  3OUJ A;  4QQH A;  5FO7 B;  3B93 A;  1W99 A;  5B4N A;  4YGD A;  2B45 X;  2FDF A;  3LA7 A;  2UYB A;  1UXX X;  1A8M A;  3QH6 A;  2XUE A;  5D2A A;  1JUI A;  3N3H A;  2VCB A;  5LW9 A;  2HH9 A;  1BZW A;  2R07 3;  2UWB A;  3DKW A;  4JGY A;  4LOR A;  4R9C A;  4JDM A;  4IEX A;  5C8W A;  1MS4 A;  1LHW A;  2UWA A;  1OF3 A;  4PDW B;  5LWB A;  4KBB A;  1R09 2;  1UY3 A;  1E5I A;  2WWS A;  2WYS A;  5EYY A;  5FQ0 A;  2XPJ A;  4N53 A;  4LJH A;  4RQP A;  3UGH A;  2JD4 A;  1RGS A;  3QOP A;  4YVS B;  2QQU A;  4B4R A;  2O1Q A;  3DPR B;  3H0O A;  3CJX A;  1PO1 2;  1DGL A;  3POY A;  3ECQ A;  2CWM A;  5FZ3 A;  3PDQ A;  3E5Q A;  2JB8 A;  1ALY A;  4XFB A;  5SV5 A;  4BU2 A;  2G9G A;  5FYH A;  2PMW B;  3ZDS A;  1B35 C;  2XXZ A;  2OZ6 A;  1PMH X;  3NST A;  2JB4 A;  3K4A A;  4RSU A;  1RUE 2;  3VV1 A;  2VNO A;  3OBR A;  3WCS A;  2HWE 3;  1EV1 1;  2WFF 3;  1OKO A;  4B1M A;  4EWE A;  2E6V A;  5C3S A;  1BCX A;  5BNP C;  1HDK A;  3NJV A;  1AR8 3;  3O0W A;  3PNA A;  1NZC A;  5LBE A;  1GWK A;  2TUN A;  2ZXQ A;  4DIN B;  2XOM A;  1VMJ A;  1C8M 2;  2GN3 A;  5F7U A;  1VMF A;  2BEO A;  2A75 A;  1WMD A;  4LOS A;  2VTF A;  5IAT A;  5JCT A;  2WII B;  3SQO A;  4XFF A;  1IHM A;  2YC2 A;  3EHK A;  2QVS B;  3HWJ A;  3ALQ A;  3OEB A;  4IXL A;  4LBQ A;  5JAX A;  2C24 A;  5LK7 B;  2RS5 1;  1HV1 A;  1RUC 1;  5F8P A;  3H8X A;  1YEW A;  1RUH 3;  3QCW A;  5J36 A;  3EMR A;  5FJK A;  1HN0 A;  1GZT A;  2AEZ A;  4QD2 A;  5EZW A;  5JOX A;  1F2N A;  1GWM A;  1YQ5 A;  2GNB A;  3BTZ A;  1NY7 2;  2XQX A;  3PHM A;  3RI9 A;  4CVU A;  3CL1 A;  3EQE A;  4Y26 A;  1HQL A;  1PHM A;  4TN7 A;  4AWD A;  1QJX 2;  4CA9 A;  1ULO A;  5F32 A;  2UU8 A;  3N9N A;  3OTF A;  4L0P A;  4QQL A;  4YW2 A;  4AEM A;  2ZGR A;  2BBV A;  1O4T A;  4QPG A;  5CU1 A;  3VZK A;  3VBH C;  5FXW A;  3DYP A;  4HAN A;  1R1Z A;  1RUG 3;  5J98 B;  4P9W A;  3R05 A;  1F35 A;  4NHK A;  2X5I C;  3LFI A;  2DWR A;  2JDP A;  3P1I A;  4XFC A;  2FZ1 A;  1WA4 A;  1DF0 A;  3RS6 A;  1VAM A;  3VZO A;  2D6P A;  3K46 A;  3NO8 A;  3UJO A;  2ZGM A;  3Q8E A;  3AP7 A;  2BBA A;  2ARB A;  2ZEX A;  4UOJ A;  3T4H B;  3OUH A;  4DXS A;  3RNS A;  4XF3 A;  2VPV A;  4OFG A;  2GC2 A;  3IAP A;  4YVW A;  2CL2 A;  2HWF 1;  4JKL A;  3VZN A;  2BPA 2;  3WW2 A;  1HRI 1;  1RUD 1;  1ZM1 A;  2QJV A;  4GMP 0;  3VDA A;  5E8A A;  4AHW A;  3OSD A;  4YVS A;  3ZIW A;  5E88 A;  4OHY A;  1OOP A;  1LUL A;  2RM2 1;  2YGL A;  3AMH A;  3DPR A;  1MQT C;  3WNK A;  4ZU7 A;  2PXJ A;  4KU8 A;  2KR2 A;  2VCA A;  3EJK A;  3VBU C;  4F8A A;  3SCH A;  2Y64 A;  2BNO A;  1UZY A;  1BMV 1;  2UYA A;  5TSW A;  4LO4 B;  3RQ0 A;  5BNO B;  4QX3 A;  1DFQ A;  1W9W A;  3GAL A;  2ZTN A;  4QGN A;  4AYU A;  1ASJ 2;  4KGG A;  5ABJ A;  4L99 A;  1MEC 3;  2ORZ A;  3CZU A;  4M3C E;  4YZ3 A;  1DCS A;  4IEZ A;  4W6Y A;  3GGL A;  4L11 A;  4NWW A;  4OLL A;  4YW5 A;  2JE8 A;  2W0X A;  5A7S A;  1OLM E;  4P00 B;  3POJ A;  4YZ5 A;  4ZXK A;  3HEI A;  3MID A;  3T3Y A;  1NXD 1;  3LIG A;  1UOJ A;  1JXN A;  3N9O A;  3CO2 A;  1W8O A;  2CHH A;  4XJ9 A;  4Y5S A;  3KT1 A;  3III A;  3POG A;  1CWP A;  4H14 A;  3AK0 A;  3CF6 E;  3VD4 A;  2R06 3;  3R4U A;  5APA A;  1UZZ A;  1UOF A;  2DVG A;  4XZP A;  5E6H A;  1EAH 1;  1SAC A;  1NOV A;  3DCQ A;  3VD5 A;  1X8M A;  2PN5 A;  4CE8 A;  4EZ4 A;  3V56 A;  2JE9 A;  5A7W B;  1GBG A;  1ND3 B;  1YRZ A;  2B39 A;  2PA7 A;  5FYU A;  5KXB A;  3NJY A;  1Q56 A;  5A80 A;  4Z2A A;  3AZW A;  4XFA A;  2AZ5 A;  3J26 N;  1G7Y A;  3SH3 A;  1FI2 A;  1N3O A;  4D0Q A;  1SDW A;  4YPJ A;  1KJL A;  1MZ6 A;  5F5Q A;  3SH4 A;  3GZT B;  3AVR A;  1DQ5 A;  5EJ1 B;  1JOJ A;  3C8X A;  2J1V A;  1CJP A;  4XPV A;  1OMI A;  1CD3 G;  4BQ1 A;  1TE1 B;  4FAH A;  3LDK A;  2HWD 3;  5D8A B;  2CAV A;  4P02 B;  2DUR A;  3U4S A;  1EV1 2;  4KWU A;  1WUV A;  5IT6 A;  2GMM A;  2CWS A;  2ZHK A;  4OZO A;  1L7R A;  1BBT 1;  2OPW A;  1GYK A;  5BYN A;  3LOB A;  4MGK E;  3ASI A;  3LEK A;  4WVZ A;  1QEX A;  4AL9 A;  3NJZ A;  1V6N A;  4N9H A;  4I0W B;  3WW4 A;  1DQ4 A;  3MGU A;  3AXD A;  5F3I A;  1FMD 3;  4OCT A;  3DXU A;  3LDB A;  4CCK A;  2VW1 A;  5CEH A;  2Y26 A;  3THD A;  2RS5 2;  3INA A;  1W06 A;  4GZ9 A;  5A6Z A;  1RHI 1;  3PVO A;  1RUC 2;  4A7Y A;  5KHJ A;  4YZ4 A;  3THT A;  1QH7 A;  1AUY A;  1EYB A;  1TG7 A;  2YB7 A;  1POV 0;  1UMI A;  1TME 1;  3OUI A;  3PUS A;  1WCS A;  2P1B A;  1Q8S A;  2ARE A;  3SLI A;  4FFH A;  1CAV B;  4IEV A;  4YRD A;  4UFL A;  1MZE A;  2KM2 A;  3V64 A;  1UU4 A;  3I3E A;  1SFY A;  4AED B;  3VBO A;  3WNL A;  5FFO C;  5KHH A;  2FCV A;  1SMV A;  1G9C A;  3TN9 1;  1H8V A;  2XVG A;  2XQR A;  5FZH A;  4AFC A;  3LZZ A;  1MS5 A;  1YWK A;  2ZX3 A;  1ACC A;  4P14 A;  4MXV A;  5FP3 A;  2UY8 A;  4OMD A;  3WG2 A;  4CCD A;  4GIQ A;  1HXS 3;  3E97 A;  3AYC A;  3VLB B;  2WRA A;  2QQM A;  2RS3 3;  1D4M 1;  2XJU A;  3NNM A;  2BVB A;  3SKV A;  1LRH A;  1J3Q A;  1JOD A;  2EXI A;  1H9W A;  3BU7 A;  3FHI B;  3HR9 A;  5FYI A;  3WW3 A;  3WNO A;  2VOW A;  4BQX A;  5CFC B;  2WZP P;  4D6Q A;  1KGY A;  4I3P A;  4PDW C;  2HWF 2;  2BWA A;  2JWP A;  1XE8 A;  3I2D A;  5FZ8 A;  4OHV A;  5F2S A;  5A32 B;  2PHT A;  4DNY A;  1RUD 2;  2JDZ A;  4BWO A;  4MVT A;  1BHG A;  5LBB A;  1LEN A;  2VOX A;  4BLJ A;  4PF5 A;  2BFU L;  2YZ4 A;  3TNP B;  1C28 A;  5CFD B;  2DCY A;  1OXC A;  3MLJ A;  4ZS3 A;  2R1D A;  1LU1 A;  1MVE A;  1SLT A;  1DYP A;  4IEO A;  2BUK A;  4UYB A;  4YVS C;  2V5Y A;  2RM2 2;  4Q5O A;  1JYT A;  3B01 A;  1AR6 1;  3DPR C;  3BB6 A;  1QGL A;  1SLC A;  1W8Z A;  3RZM A;  1BMV 2;  1WCQ A;  5JXJ A;  4W6X A;  4RS5 B;  4Y1V A;  4ZU4 A;  2QZ3 A;  4NHM A;  1VRH 3;  4FPY A;  4AG4 A;  3A7Q A;  4XXP A;  1QOT A;  1O4Z A;  1O7F A;  3POW A;  4NUB A;  1GUI A;  1GWL A;  2IXL A;  3A0K A;  5G05 L;  5CIR A;  2VVD A;  5JOY A;  5D8A A;  1DDL A;  1S4C A;  5IAX A;  3FWE A;  3POF A;  5JOZ A;  3CBN A;  4R9D A;  1N47 A;  2BW8 A;  1A6C A;  1S0I A;  1RUF 1;  1C8N A;  1O4Y A;  3NRU A;  2VVE A;  3QH7 A;  5FMB A;  2DUP A;  3T2P A;  1NE4 A;  1OVP A;  2DFB A;  4LPL A;  2R0F A;  2RR1 1;  1X33 A;  2WZR 1;  3DUI A;  1VB4 A;  4BHP A;  2PEL A;  2XL7 A;  1MPX A;  4AVT A;  1EAH 2;  1U5I A;  2QQI A;  4UAP A;  3VD3 A;  5EHD A;  2ENR A;  2ZEW A;  4FPK A;  1UX6 A;  4D94 A;  1QF3 A;  1HKD A;  4D8M A;  1F8V A;  5A7O A;  2X29 A;  4W6W A;  4AZZ A;  2B4K A;  1GQP A;  1KXG A;  4GMP 3;  4LO6 B;  4D3W A;  5LEJ A;  1LOG A;  5A6Q A;  3D82 A;  1VBA 1;  1W0N A;  4GWN A;  2AC1 A;  3WV6 A;  5I8S A;  2VL4 A;  2RVA A;  4QPY A;  2ZKL A;  2P3K A;  3ABZ A;  3K51 A;  5AVA A;  2WAA A;  5A70 A;  1AHS A;  1RUI 1;  5BY5 A;  1SEF A;  4TXW A;  3N7K A;  1PM4 A;  4Q4V 3;  5HCB A;  2I45 A;  1WCD J;  4XXA A;  2Q8C A;  4HLT A;  5FMO S;  1GV9 A;  1QJU 1;  4UF0 B;  4XIL A;  3WP4 A;  1ZRF A;  4YSF A;  5K0U B;  1VR3 A;  2E7A A;  1DYK A;  2FMD A;  1COV 3;  2ZA9 A;  3I3B A;  3U07 A;  4QDQ A;  4Y4Y A;  2RDS A;  4NO4 A;  1BBT 2;  2OPK A;  5I8Y A;  4JAA A;  4XCA A;  4NIH A;  4NPL A;  4Q0S A;  1FXZ A;  1JYI A;  5FPV A;  3GXU A;  3N4M A;  1MZF A;  3USS A;  3X29 B;  1DQ6 A;  2GN7 A;  1AJO A;  1UY0 A;  2QFE A;  3MPB A;  3NQH A;  1PIV 1;  1WBL A;  1RHI 2;  1NLQ A;  2WS9 3;  3VBR B;  2WT1 A;  2WO7 A;  5CFD A;  1YIP A;  1J1T A;  3GM8 A;  3VBS B;  4DRR A;  4DXZ A;  4ZPI A;  5GZE A;  4BQW A;  1WW4 A;  4DY3 A;  5FZM A;  1TME 2;  4XDO A;  4XUO A;  2Y0I A;  3OBZ A;  1LGC A;  1QOO A;  4WVV A;  1OH3 A;  4QB2 A;  4D6S A;  1ZBE 3;  2ZGP A;  3M3E A;  2Y34 A;  2A3W A;  5F3G A;  1QKQ A;  1NQJ A;  2JG8 B;  4RS5 A;  4QXK A;  5BXX A;  5LEK A;  1UIK A;  3RZK A;  3WF4 A;  5BNO C;  3ZYG A;  2WNV B;  3AFK A;  4RA0 A;  2DU1 A;  2R0H A;  2RG4 A;  4XYX A;  2D3P A;  4BJ0 A;  1QOS A;  4LBN A;  4HFS A;  5HV4 A;  5IK8 A;  1ZBA 3;  3N35 A;  3MIF A;  4FXG B;  1VBE 1;  5JZG B;  4JRL A;  4HVR A;  5KXE A;  4N7U A;  1Z7S 1;  1SLB A;  5DXD A;  3R6S A;  3T08 A;  5J3U A;  1D4M 2;  1RIR A;  4AFA A;  1X8E A;  3LE0 A;  4TLG A;  5L9B A;  5C9A B;  1F4H A;  2R6Q A;  5GKA C;  5I0U A;  2VZQ A;  1FYU A;  2WNU B;  4BDV B;  4BQ4 A;  5HXM A;  4AVS A;  3JXS A;  2X8K A;  2DDU A;  3ELN A;  4COU A;  4XET A;  1N1S A;  3VGI A;  2Y6K A;  1ENR A;  1R08 3;  4CU8 A;  2PAM A;  3EO6 A;  5A3M A;  1OVS A;  3CQO A;  1RIT A;  2C0Z A;  5AC9 3;  4CDU B;  4P9G A;  1NQD A;  1YFW A;  2VNG A;  4HKO A;  3OYW B;  1ND3 C;  3GYD A;  3M3O A;  1W2N A;  2XBO 3;  1LKN A;  5FPZ A;  3O0V A;  1I6X A;  3OGR A;  1POV 3;  5IFT A;  3A23 A;  1AR6 2;  2RS1 3;  4BA6 A;  4BZ4 A;  4K40 A;  2IZW A;  4QHB A;  4RYD A;  1LB2 A;  5H9P A;  2PAE A;  5F5A A;  4B7K A;  4UFI A;  1Q43 A;  2JE7 A;  4EE2 A;  2VVF A;  1W03 A;  2DVD A;  4ZS2 A;  4UF0 A;  1FV2 A;  3LPG A;  3A4U A;  1V70 A;  1ULC A;  4YM1 A;  2G1M A;  1P8J A;  1KQR A;  4XOG A;  1CN1 A;  2WO2 A;  5D8A C;  4Z8B A;  1RUJ 3;  2BGP A;  1VE0 A;  1UY1 A;  1XU2 A;  4COV A;  1RUF 2;  3ZMN A;  5F6K A;  1JZ7 A;  4LA3 A;  1IPJ A;  3RRD A;  2HBU A;  4V1P A;  1N1T A;  3K4Z A;  5A7P A;  5FXX A;  1BXH A;  2GMP A;  3WG4 A;  4IV3 B;  2B46 X;  4Q27 A;  5C70 A;  5FPX A;  3THC A;  1CVN A;  1HRV 1;  2RR1 2;  1QJE A;  2WZR 2;  3KHB A;  3ACI A;  1NYW A;  3VKM A;  3IDB B;  4RR3 B;  1W04 A;  2FMY A;  3K2O A;  3VBR A;  4HZF A;  4JGZ B;  2XWB B;  2OYZ A;  2DTW A;  3BYW A;  4IE4 A;  5KHG A;  3LGR A;  4CCL A;  2FBE A;  2Q0A A;  3T4V A;  1S55 A;  1XNT A;  5FBJ A;  5FZF A;  1VBA 2;  1DP0 A;  1RUG 1;  2FQP A;  3FX3 A;  4NOT A;  4Q8K A;  2VZU A;  2P2K A;  1JU3 A;  2QQK A;  3FHA A;  3PUQ A;  4UW6 A;  5FO9 B;  5FRE A;  5JPM B;  1AL0 G;  1SPP B;  1QNY A;  2B5H A;  3KS7 A;  4LR4 A;  2D5F A;  4GB3 3;  1RUI 2;  4AED C;  2DF7 A;  2FZ2 A;  4EN9 B;  5IYY A;  2CU5 A;  4OQ9 A;  1QJU 2;  4GUL A;  1OA4 A;  5FKB A;  1W6O B;  5FP4 A;  1EPW A;  1V6L A;  4HON A;  5JMC A;  1QXR A;  1O3Q A;  5A1F A;  4PIX A;  3AP9 A;  1BLZ A;  2A6Y A;  2V5D A;  2FHR A;  2ZMK A;  4IE7 A;  3ZXE A;  5IVJ A;  5C5U A;  5C9A A;  2R7E B;  1UQX A;  2WNU A;  4NPR A;  3BOP A;  1URX A;  4A45 A;  5DUU A;  3CDZ B;  5FYV A;  2OQ7 A;  4Q0P A;  4YLZ A;  5CFC C;  5CKN A;  5K9Y A;  2HYK A;  1Q5O A;  2RV9 A;  1JHN A;  3FJS A;  1PIV 2;  2VUC A;  4IET A;  4Q0U A;  3MW3 A;  5FPU A;  5JXI A;  4CDU A;  3OYW A;  2Y38 A;  4ASK A;  2E51 A;  1WMX A;  5CFD C;  4X6R B;  5LCW L;  4ZZ5 A;  2YBS A;  2Z79 A;  3ENR A;  2A6Z A;  2VTX A;  4OI2 A;  1HB2 A;  2HLE A;  3NW4 A;  2BWC A;  1GIC A;  1MEC 1;  2VUA A;  3POE A;  4QPI B;  4XJA A;  1LOB A;  3IM0 A;  1V9U 1;  2Y60 A;  4XF0 A;  4RS5 C;  3DXT A;  3O5S A;  2DVB A;  4KGQ A;  3DGT A;  3DYO A;  4OHW A;  4BB3 A;  5IVC A;  3MW4 A;  1W9T A;  2F6B A;  1VBE 2;  4XFH A;  1EP0 A;  4ZU5 A;  3SEE A;  3M7A A;  3WQ1 A;  2XGX A;  1Z7S 2;  1W8T A;  2AEN A;  4JCK A;  1JOP A;  3NNF A;  1RMU 1;  4XAC A;  1OLQ A;  5FZA A;  4IV3 A;  1DGW A;  4NPM A; 
#chains in the Genus database with same CATH homology
 1POQ A;  1PM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...