1PM4A

Crystal structure of yersinia pseudotuberculosis-derived mitogen (ypm)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGLSWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YPM
publication title Crystal and Solution Structures of a Superantigen from Yersinia pseudotuberculosis Reveal a Jelly-Roll Fold.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Toxin
total genus 28
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09144 YpM Yersinia pseudo-tuberculosis mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.510 Mainly Beta Sandwich Jelly Rolls Mitogen Ypm 1pm4A00
1POQA 1PM4A
chains in the Genus database with same CATH superfamily
1NXD1 1KDMA 3NV1A 3WF4A 2HEWF 2Y6FA 1AR62 4JGYA 3BI3A 3UETA 3IKWA 3S6PA 2IWGB 2AEYA 3LEGA 1CR7A 1S0FA 2RM21 3DF0A 3X29B 2VCMA 1NE4A 5DAPA 3N3HA 5IVCA 3I4IA 2LW8A 2VZSA 5F6KA 3PUHA 3UKTA 3ETPA 4LOTA 3ZX7A 1ENSA 5GLWA 4NIHA 2VZPA 4BXSV 3L9JT 2NPIA 2JKBA 4I01A 3O7OA 2D3PA 5D2AA 2YPJA 4Y24A 1QJY1 2IFRA 4IDZA 1N3OA 4MGIE 4QPYA 3AZXA 2B7YA 4JZRA 3CMGA 2UWAA 5JZGC 2CSGA 2WNEA 5IWFA 3FZ3A 5BNNC 3K48A 1RUI1 2CHHA 3APBA 1AYN1 3BOWA 1W06A 1X9TA 1O4ZA 1W6NB 3PVNA 5LA2A 4QDSA 3Q8BA 3UGHA 1US2A 2B9UA 2XJVA 4H7MA 5CNAA 5CG8A 3GCWA 4TYSA 5FRAA 5FXZA 3RGBA 1UX6A 3WY6A 4KWLA 4AOCA 3SCGA 4B7KA 3ZOIA 4K21A 4RQPB 4GALA 4XUOA 3PIGA 4U36A 1RXFA 2VZ3A 4YM2A 4COUA 1H4HA 2BERA 3ZVXA 5IHRA 4Y1ZA 5DG1A 4LUMA 3TN93 4IGQA 1NYWA 1UW8A 2ZEYA 1MVQA 3HBKA 1FMD2 5FV3A 3ZSEA 4BXFA 4AEDC 1COV3 2I74A 1OUXA 2PLV3 2RR13 1V6IA 2Y0IA 3ATGA 4KWUA 2C9AA 2JIJA 2R32A 2RS11 3N9OA 4Q2FA 4XBQA 2DDUA 4Y1YA 5FWJA 1IKPA 5JWPA 5JXIA 3VBHC 2QNKA 1V70A 3MEPA 5LBFA 1S4CA 1TE1B 2J1UA 4YVSA 3WUDA 1HRI1 3ZXKA 4QPIA 4BA6A 1LRHA 4LLOA 3J4UH 4LK7A 2YROA 1RUF1 3AMHA 1GSLA 2BGCA 3AZWA 1PO12 4KL1A 4XF0A 3IMNA 4WZFA 4LHKA 3SC7X 5IAVA 1Q3EA 1YJKA 2B46X 4OCTA 2G4IA 3CLPA 5A3OA 3HD8B 2A3XA 3PUAA 3MW2A 4JHTA 4MHRA 1CPNA 1N3PA 5A7WB 2XQRA 2VH9A 5IVVA 5JSPA 2X5IA 4YZ5A 1RUD3 2ILMA 3N35A 4IEXA 3WG1A 1AR61 5LW9A 5M0TA 5LBCA 5IK7A 1Z7S3 1ZZ8A 1EP0A 4K40A 3B01A 5F7UA 2H6CA 3EO6A 3ZXFA 4HETA 4PF5A 1K5MB 1PVC1 1X82A 3C2UA 1GFF2 2R061 4NVPA 3RZLA 2JG9C 3ON7A 1G7YA 4RR3B 3VB9A 2D6LX 2HBTA 4PI2A 3N9NA 3P6BA 1OQDA 3CO2A 4A7ZA 3ZYFA 3VD7A 1JODA 1LOAA 5FZ9A 5I8YA 4BYYA 1CZTA 4QGNA 1VIWB 2VBBA 1LHOA 4CDXB 3HN1A 1Z0HA 1ND2A 5DPNA 5JR7B 1MEC3 3FJSA 3DXTA 2P5BA 1UKGA 2VE1A 4UOJA 5CFDA 4Y20B 2VOVA 2VUDA 1E5IA 3M4FA 1X8MA 1BCXA 3ETQA 3JB8A 1YFWA 4IEVA 4Q0QA 1O59A 4QXCA 1V6JA 2QQKA 2BVVA 5FZLA 4CA9A 4IEUA 1UL9A 3ZKYA 4CP9A 4YZ3A 1UYYA 4Y4RA 5K8SA 1VAMA 3MIEA 1XQNA 3ZFEC 4RS5C 2VZUA 1RMU2 3M2MA 5FZ3A 5FZCA 1OSGA 3T4VA 4FI9A 2PN5A 4M4RA 5FBZA 5JPNB 5EWSA 1DBNA 5F5IA 5HV4A 5JLVA 1Q8QA 1UWWA 2JXAA 4J6GA 4IL7A 4AXOA 4C91A 4ATEA 5I0RA 1FMD1 1UYXA 3OY8A 1G6NA 4TWTA 1TEIA 2X8KA 3WNLA 1PIV2 1QJEA 5BNQA 3AYEA 1E57A 2WS92 5C9AC 2DVBA 1VBB3 4XFAA 3IPVA 2DVGA 4DPNA 1VBE1 1B35B 1PGW1 4C0HA 1JZ5A 1UU6A 1OQ1A 4CU6A 2Y33A 2JDNA 3H50A 2PXJA 1UZZA 4JKLA 5AC91 1BMV1 1PO11 1RVF2 3B3QE 1MVEA 3WNPA 1SZBA 5CFCC 4FPLA 4JTNA 4LPLA 4OHYA 3E5QA 3EBRA 3M3CA 3WP6A 4UI9L 1WW4A 4CEYB 3MGUA 2OUJA 3VBOC 4DIQA 2QQMA 4EROA 1I1EA 4GWMA 3WG2A 4YW5A 5C70A 2FD8A 1NLQA 2NP0A 5FPLA 3ALQA 1ZYBA 4META 4S2DA 3KSCA 1AR72 3PVBB 4IEQA 1DGWX 1W6MB 2F4LA 2VVDA 3VL9A 4RSUA 1W0PA 1TMF1 1YNAA 1A6CA 4KWKA 3KHCA 4IQPA 1JXNA 2VGDA 4XIOA 1ZZBA 4XZUG 4J25A 5DUVA 3KB5A 3ZSJA 4WVMA 3I3QA 4MLOA 3HEIA 2D3RA 4Z92B 1JMUB 3NNGA 1J1TA 4BQYA 2DYCA 4B4QA 1N1YA 1BBT2 1CAWA 4XW3A 3PVEA 1PO22 1XB9A 2CU5A 2IVJA 2VCAA 2WLQA 4KBZA 5BNPA 1S0CA 1ENRA 2WQ8A 3VBSA 4E2SA 3AP6A 1CD3G 5A3TA 4UW3A 2FDJA 2QQLA 3WP3A 1SPPB 5FPAA 1DGWA 3OD0A 3ZR5A 2ETEA 1QH6A 2QDRA 1CIYA 2EXKA 1Q56A 3VZOA 4EZ4A 1WCKA 1ULEA 1JN2P 2VL4A 5DUXA 2EVXA 3SH3A 4QKFA 4PBPA 5FYTA 2WN3A 1SEFA 1O4TA 4AVBA 1UN1A 4GIQA 1WMXA 1OXCA 1RUH3 1C5IA 2JB8A 4XETA 4YVWA 1JW6A 3MIBA 4UFLA 5FQ0B 3P3PA 4F83A 2P3IA 3C3VA 4I02A 1XXNA 1UPSA 2FZ1A 4L97A 4MGSA 1R1A3 2YBPA 2WDBA 4JV4A 3ZSKA 2R1BA 1FOD2 2NM1A 1MS4A 4OHVA 3T0BA 2RVAA 4FTEA 5FO8B 2ZMLA 1GICA 3A21A 2WAOA 2O0OA 3KWVA 5ABJB 3ACLA 4AI9A 2Y0OA 4DUWA 1PIV1 5DDJ3 1A78A 5IK4A 1K5MC 1W2AX 2WS91 3GDBA 2V72A 3LKJA 1U5IA 4P9JA 1CIWA 2H6BA 3NVCA 2HWC1 4Q5OA 4QHBA 3K4DA 5FCCA 3H8RA 1RUOA 3AB0A 1AR82 2Q8CA 4A44A 4CP2A 1Q8OA 4ZHNA 3MV11 1QJZA 5E8AA 4KU8A 2EXHA 3BVCA 3BTZA 2AR6A 3LDRA 5ACA3 3V0BB 3AKTA 1WLTA 2R49A 1DP0A 2EICA 3R05A 4ET7A 2RS52 1R091 5EXOA 2JWPA 5KHIA 5D8AC 2VUAA 2GMPA 4WM7C 1CAXB 5FPZA 3V65A 2A6ZA 3POSA 5CB7A 5JOWA 1DQ4A 3MICA 3OPTA 3THCA 1QJX2 3L2HA 4OZXA 4PT6A 2ES3A 5C4WA 4EN7B 1WCSA 2W91A 3PUIA 2VD7A 1AR71 2PHFA 2XJTA 4PQ9A 3BTYA 3HIFA 5LZ6A 3ZM8A 2IXKA 3CZJA 3WEZA 1CAVB 1OURA 3WDWA 3IIAA 2JIGA 4MGKE 4IV1B 4JC1A 3BUCA 4YSFA 3GJBA 2ZGUA 4CU7A 1V9U1 3T2OA 3K3OA 3I59A 5FLIA 1POV3 1ZZ9A 2BWCA 1AXZA 2ZX1A 3GBFA 3PJQA 3W59A 1PO21 4CP0A 4JCKA 4DXRA 5FOJB 1F5FA 4LA2A 5JIUA 1VLNA 1FV2A 1NOVA 3T0AA 2Q1FA 1VBC2 2RJ2A 3POGA 2VOKA 4PIYA 5KXCA 5BNOC 1W8TA 2FDKA 1B35C 2AUYA 1BEV1 3QBQA 4CUAA 5FDBA 4ORFA 2WUHA 1W6OB 2VM9A 2WFF3 3KF3A 4CU9A 1IQDC 1SFPA 2LUWA 3FHIB 4FT8A 1OF4A 3RI9A 4CXXA 3JBG2 1VMJA 5H9SA 4CPBA 4Q4V2 1DYKA 1VRBA 5C3RA 4P9WA 1NLSA 1OPOA 2W92A 3WDUA 2XOMA 4LK6A 1RL3A 4AG4A 4C90A 4CEYC 3H8XA 3AFKA 2YPDA 2W68A 1O7FA 2HWF2 1FOD1 5DAXA 1LODA 3WX5A 3VKMA 1UY4A 1LESA 1RUE3 1QOTA 1AJKA 1HX6A 2E53A 2VVEA 3RNSA 1RTVA 4KU7A 4Y5TA 2IUWA 2VCCA 5FPVA 5HCFA 1VMHA 2XJRA 4KI5M 1JOPA 4ZU4A 3ES1A 4LXLA 1H8VA 2PQSA 1RUC3 1OKOA 4NMIA 4AQ2A 1WCQA 1MZ6A 1OA4A 5FYIA 3VKNA 1DGRA 2GSYA 4CDWB 1AR81 1S2EA 2ZMNA 4LO5B 2R072 4IUGA 1GZTA 4E8CA 5K0UB 4FCAA 3U4XA 1AR93 3GYDA 3JUUA 1AYM2 1NCQB 1SDWA 5DUUA 5FZDA 3USUB 2HWE3 2RDSA 2ZZQA 3AXEA 1CPMA 3PTRB 1ZBE1 1IG0A 3BB6A 3R6SA 2CTVA 1REDA 2WWUA 1JBCA 2D5FA 2RS51 2GH2A 3KVAA 5AVAA 3WF0A 1D2QA 4N8MA 4FPCA 1D2SA 4H14A 3OEAA 4GMP3 5F3GA 1GOGA 1W8ZA 3J8F3 2XVLA 3D6EA 4RL7A 3T08A 3INAA 3KV4A 4NE9A 5JI7A 4OQ8A 2VOWA 2PHLA 4Q0UA 1RUJ1 1QQP1 1IS5A 2XPJA 4SLIA 2GDFA 3VUOA 2BNOA 2HH9A 5J36A 1S0JA 3PURA 3DV8A 1EAH2 3AL6A 1MZEA 1NY72 2JG8B 3MIGA 1GV9A 1Z78A 2VCBA 3NNLA 1POQA 2XKOA 4HKOA 4DUVA 2DUOA 4IGOA 5LCWL 5BPXA 5ABJC 3H7YA 5LY2A 2B39A 3O1MA 4Q4W1 4CEWB 4UBHA 4GZ9A 3U78A 4BK4A 2WBKA 1VBC1 4SBVA 2BOIA 3LDBA 5DQ0A 5FY4A 1QHDA 1H1IA 3U4SA 2VZVA 5I8SA 4M3CA 4HOOA 2ZGRA 3LAGA 5FY7A 3LSEA 4HN0A 1VMFA 4CCCA 2BBAA 5EPAA 3WP4A 3VV1A 4MVTA 3URFA 3JBG1 1YQCA 1H8TA 4AE2A 4Q4V1 1X7NA 4XIKA 3POIA 3RMXA 2A6XA 1UOBA 4Y22B 4AQTA 3TNPB 5JOZA 1UXZA 2IXHA 4LBQD 2HWF1 4MOAA 4OI2A 2ZGQA 2JDZA 2B42B 2GP3A 3OBZA 3E1F1 1LCLA 4NHMA 4LBQB 2Y6JA 3FN9A 1JHJA 3VHPA 4V2VA 4XILA 4XDPA 5A33B 1LGNA 1O3QA 1UOJA 2PTMA 2Y64A 5HCHA 4IEOA 1WWYA 3B5LB 4LULA 5FFOC 1OMIA 2J1SA 2QUOA 2WZ8A 3SH5A 3OJBA 2J1RA 3C7GA 3CIHA 2ADEA 2KXLA 2R071 4QX2A 3AP5A 4S2GA 2O8QA 3PU3A 1AYM1 2WT2A 5GM0A 5KXDA 2HEVF 2OA2A 5J09A 4PBOA 2YGMA 4MADA 1RC6A 5IVEA 2JG9A 1NA1A 2FCUA 2JE7A 4DMIA 5J48A 2ARAA 1OOPB 3FWEA 5L7OA 1HRV1 1FNYA 3NO8A 2Q8DA 4C8DA 3VD9A 1EV12 5A6QA 5LEKA 5C8WA 3GZUC 2PHTA 3N7LA 2WNVB 4Y5SA 4YARA 4ZZ5A 3I3DA 3RI8A 1A8MA 1OA2A 3WW3A 3KV9A 3MUY1 5F3IA 4C1WA 1QIQA 2QE3A 2LROA 4UBGA 1EYBA 2ET7A 1GZWA 3QCWA 4XBNA 2E7TA 2OZJA 2E32A 1HXS1 2VZTA 1E5SA 3AX4A 5FZOA 2JE9A 3ZXGA 1QOOA 4FP3A 4PLNA 1CVNA 5C8CB 1VJ2A 2XVKA 4P5HA 1QXRA 1C1FA 4JVAA 4FOYA 4XURA 2JE8A 3WR0A 4FSJA 5E16A 3THPA 1EAH1 1CJPA 2G9GA 3RPQA 2DVFA 2WA3A 2YBSA 5FYZA 3S30A 4E4ZA 2D6MA 2IXIA 4K1ZA 1PVXA 1K5JA 4LHLA 4FPJA 3THDA 3SH4A 3UT0A 3VZKA 5IFPA 5GKAC 1KRIA 3A23A 3JD72 1WLCA 1CX1A 2JKXA 2P17A 4P9IA 2XMLA 3I8TA 4RGGA 3PDQA 3VBRB 4AFCA 4CXYA 3ILFA 5L19A 1UPIA 4GXLA 4ITCA 2EXIA 1J59A 4CDWC 3KF5A 2RV9A 3O0XA 1OVPA 3I2KA 4IE6A 3HNYM 1F31A 2J1EA 4O61A 1W9WA 1C28A 3WNNA 3UJQA 1QH7A 2PHRA 1PK6B 4N7UA 1ODMA 1ULGA 5A70A 3I49A 3HOBA 2WR9A 2J7MA 3VN4A 3BGAA 2VVFA 4GB33 1NQJA 3MLKA 5T5PA 4AAPA 4ZZ8A 1IQAA 1CQ9A 2K9ZA 2KD7A 4JGZC 1W8FA 4Z07A 2X53S 3VD3A 4CSWA 1TZOA 3D0JA 3ZSMA 3AYCA 4AI8A 1JYCA 1EPWA 2CY6A 5CKQA 4N9IA 4LHSA 5JOXA 1ND3A 4FTSA 1JOBA 1YO8A 5KHHA 1DQ2A 3OG2A 3LIHA 4P9GA 1ZRDA 2ZHNA 3LA2A 5JI9A 1PZ8A 3JQXA 1W6NA 5FUNA 1O5LA 1C3HA 4XDQA 5D1IA 5F5AA 1EUUA 3AKPA 5LBBA 3LA3A 1QJU2 3R0RA 3RMYA 1RMU3 1CAUB 1QGLA 2HWD1 4IEZA 1ULCA 3WCRA 4DB5A 4RQPA 2DU1A 3WZ1A 1DCSA 3WW1A 4DFSA 5SV5A 1P8JA 4FPGA 4HVQA 1GMMA 2CAVA 3PL0A 5JZGB 1EV11 2BTVC 2VXRA 2V4VA 3BPSA 3UESA 2WL1A 2VTXA 4MXWB 1IHMA 2KR2A 4W6YA 1WW7A 4YRDA 3RDIA 5BNNB 2XBO3 4D69A 3T2PA 3VBUB 2W52A 1ST8A 2P4EA 3A0NA 3MIHA 1HB4A 4GKXA 2CNAA 2ZAAA 4BU2A 1V6NA 1HN0A 2B4KA 3A22A 1J1LA 2D7FA 4BQ1A 3LPFA 3MUZ1 4OZOA 4Q1RA 4D7TA 3LSDA 3GHNA 1AZDA 2ZGLA 3DKWA 3OGJA 1RVF3 2WKKA 5JAXA 1VP6A 1Q43A 2WNOA 4UF0B 1V6LA 5E88A 5GLUA 3T2TA 3U37A 3W21A 1ONAA 3VDDC 1GU3A 3U07A 2WZPP 2JDHA 2VJXA 3ZPOA 1O3RA 4CCMA 5KC5A 2Q1ZB 2RM22 5FZGA 5A32B 5A7WA 1BK0A 3O1PA 4N43C 4LBMA 4OUSA 3ZFEB 2NMOA 4D7SA 4QXHA 2ZGPA 4UXAA 1G9CA 1NZCA 4X6RB 3VBHB 1WW6A 2D3SA 2ZMKA 3RG0A 1KXGA 4XFHA 3MZHA 3GBGA 1K5MA 2AH2A 2CGNA 4AFBA 3ZSLA 4RR3A 1UOGA 1RHI1 2IC1A 3IM0A 4QXKA 4X8PA 4YYOA 1JYVA 2JICA 3OCPA 4DY3A 1PMHX 2YUEA 1BBT3 5CKMA 1PNFA 1T6GC 4LIVA 2PHUA 4IE4A 5I0UA 4K3UA 1AYN2 1LOGA 2ADDA 2RS32 4CDXA 5DZGA 2X10A 3GZEA 1ZM1A 2VQ0A 3TAYA 4Y20A 1QJFA 3KVBA 4EN6B 5GLVA 5CBLA 1HN1A 4QKDA 2GC0A 5IK5A 5KHKA 1HQWA 4M3CF 3IWZA 5IVYA 3K77A 2YFZA 2PQQA 3FFZA 1QJU1 4KQ7A 3UJOA 4XC9A 1F5JA 3W20A 4C0BA 1BVP1 1H9WA 4Z8BA 4C1XA 1W8WA 2ZBJA 1IZ3A 1PZ7A 2ZX0A 5T52A 3WSOA 3VBRC 4YG3A 1JYTA 2RS12 5FZAA 2ARXA 1CN1A 3SNMA 3BKZA 3I7DA 4D3WA 2VZRA 4HXCA 2LM3A 3G7DA 1HRI2 4M3CE 2R043 5LA1A 5FXVA 4FXKB 3OBAA 3TEWA 2LALA 4RS5B 1OI6A 5BYNA 1UD1A 2CAUA 2NLRA 4XMAA 5FO7B 1GYKA 3T09A 2YC0A 5FK8A 3PMSA 5LWBA 1S0BA 2YYOA 4Q4X1 3FBYA 2AC1A 5JVVA 4MYEA 4UFHA 4QAWA 2YDEA 2XKPA 3QH6A 4XUQA 3GNEA 3EMRA 2YZ4A 3MV01 4LEJA 4CEYA 4GWNA 4D6RA 5HXMA 1QJX3 1DG6A 3CL1A 1W6PB 1X8EA 4JKKA 1PVC2 5C9AB 1MS0A 2ORZA 2R062 5JDBA 3LEIA 1ASJ3 3NAPC 2CGPA 3BU0A 2D43A 1V6OA 2XHKA 4OVEA 4XJZA 2TUNA 1W6MA 2ZGMA 4BLIA 5T5LA 4EWEA 2EAAA 4NHKA 2XL9A 5FY5A 1LR5A 1WD4A 2BGPA 2DV9A 4TN7A 3VBFA 2ID4A 1AJOA 4CVUA 2W87A 4BB3A 5CFCB 2VO5A 4HPKB 2DTYA 3GALA 4XFGA 2DCYA 3WW2A 3IZOA 3NJXA 2XDVA 5C3PA 1R082 3S7IA 3VBOB 1F15A 1SACA 4I30A 3NJYA 3CHXA 2HJIA 2RS31 3ZXJA 2YU2A 2YC4A 1XBFA 4LA3A 3RZJA 3TEYA 4XCAA 3H0OA 4LBOA 2A70A 1ZA4A 4BPZA 1SPPA 1W2UA 2W0XA 4KG0A 5FP3A 3T4HB 2C26A 3AJZA 4NIDA 1YI9A 4EN9B 4HKLA 1YFXA 3NKTA 3TEXA 1JYWA 1KEXA 2XVGA 4H2AA 3VZJA 4NHYA 1ZREA 3WCSA 5L9RA 5FQ0A 2ENRA 2YG0A 2VXJA 3QACA 4BQ3A 3O1RA 4QGMA 1IPSA 2FBEA 3JB4C 1GKBA 4Q8LA 1DZTA 1H9PA 1SLTA 4ISQA 3OPZA 5AFBA 4Z1VA 3ZN6B 2IVIB 1REEA 3ACHA 4ES9A 1UYZA 1DQ6A 1VBE2 3KD4A 5ABJA 1AL21 1FX5A 3WDVA 4BQXA 1PGW2 4KBBA 1LOFC 1QEXA 3KV5A 4JKMA 4NHXA 3TB0A 3ZN4A 4AEKA 5JCTA 1NX9A 1W6QB 1KQRA 2P6CA 4LBJA 1W05A 5AC92 1RJ8A 5BV6A 1BMV2 1WD3A 2VZQA 1UMHA 4YGDA 5G05L 4XYXA 4CUBA 5FP8A 3ST7A 1KJRA 3MYXA 4YG6A 4HKWA 4UFMA 2EIDA 1X9PA 2VR4A 1SLIA 3V0BA 2DF7A 2RHPA 4XFIA 2ZZJA 4BHPA 1BKZA 2QDNA 1UMZA 2GNBA 2R30A 1N3QA 1W28A 5E6HA 1GP4A 1CAXA 2RG4A 1IGOA 2W5FA 4JDOA 5A7NA 5LB6A 3VHRA 3VKLA 1TMF2 5IFTA 5I0DA 3PTYA 4R4XA 3OGVA 2J1TA 1WW5A 5FMOS 2UU8A 4XVHA 4CE8A 4LKFA 5F9TA 4B1MA 1VBD1 3NV2A 4I0AA 2EIEA 1U12A 4WBBA 3WLUA 1CAVA 4A6SA 3ZFFC 4COVA 2C24A 4D6QA 4IV1A 4LLFA 5D8AB 1JUIA 3WDYA 4UW4A 4WM7B 3WHUA 1R081 1TVGA 3BTAA 4FBFA 1YHFA 1PNGA 4AAXA 2ZCWA 2GMEA 5AFEA 2CL2A 3BCWA 4RHV3 2DCKA 2VNVA 4XACA 2BP6A 4MGQA 1IG3A 3EXUA 4W50A 4XZPA 3ZYRA 2D6OX 1BVVA 2CDOA 3M8LA 4WVZA 2IXLA 1W9FA 3HNMA 1AVBA 3DECA 1W6OA 4XEZA 2CYFA 4COZA 1HDKA 4Q0VA 5I8TA 2WZR1 3AP9A 3IDCB 5CU1A 5JMOA 5HI0A 5IVJA 2D97A 3DN7A 3ZYHA 2ERFA 2B8MA 3ZN5A 1YQ6A 2GN7A 4ARYA 4KG8A 1LTEA 2BNNA 4HBNA 3AZZA 5LASA 2VMFA 3PUQA 4LKDA 4NN0A 4QM8A 1BYHA 5FYMA 2VG9A 5F39A 4AI1A 1ZRCA 2HWC2 4CRQA 5BNOB 2PFWA 3LFIA 5CVRA 4QDRA 5JIAA 5GZFA 3V64A 3MF9A 1YJLA 1D4M3 4Y1VA 4YW7A 3VHOA 1HJGA 1G86A 1I5ZA 1A3KA 2BQPA 3WQ7A 5HBAA 1VB2A 1F4AA 1V6KA 2V09A 4QU2A 4EWDA 5K0UA 1R092 4FO9A 3WVJA 3USUA 1NCQA 2VOXA 4XF9A 1Y9QA 1TNFA 2HWB3 1OVSA 3W5NA 2PAMA 2Y26A 4LUKA 1I6XA 1WCDJ 2QCSB 4FQ4A 4QMAA 5FR3A 2JDYA 1JU3A 1WBLA 3LPGA 1TME3 3IIIA 4ZS2A 4M4PA 4F8AA 1H2MA 4PDWC 5T55A 5FP7A 4CUCA 3R4UA 1C1LA 4Q4Y1 1J3QA 1MS5A 2XGXA 1UOFA 4JX0A 3WV6A 5HCAA 3LEMA 1X50A 3N9MA 1QY4A 4JHZA 2WYSA 1NKGA 4QX5A 4XFBA 4QT6A 4BH9A 3WOGA 3MFAA 1GQGA 5CISA 4JGYB 1V9U2 3AFGA 1BXHA 4Q0SA 1RGSA 2VECA 2A5ZA 3BIEA 4H7LA 3ZIXA 3Q9OA 3PHMA 2ET1A 2IFWA 2JG8A 2XJPA 2JD9A 4WM8C 3ZFGA 4G4FA 4QQ2A 3CJIC 4BWOA 4UFJA 3MDPA 3JD73 1S55A 1BEV2 3RRDA 3I3MA 1HQNA 4CEWA 1MQTC 2OVUA 3MPPG 3NL1A 4NR1A 5FMCA 2JDUA 3NJZA 1W99A 1RUNA 3HMYA 4HK8A 1FPN3 5A3UA 3AZVA 4PLMA 3IB3A 2WZEA 2XJUA 5CIRA 1MS3A 4YW6A 2OT7A 4YW1A 2DURA 1QKQA 4BM8A 1N1TA 3TRSB 1PX4A 5L9BA 4N53C 1N1SA 2VC9A 3FHAA 2VU9A 1W03A 2E31A 4OYUA 5FZIA 3PU8A 3VDCA 3SCHA 5C3SA 2O1QA 4Y22A 1UF2C 4K8RB 4H55A 4L99A 5DABA 4AHXA 3QH7A 4LBQA 2ZHLA 3FE5A 3ILNA 4IV3B 4BQ2A 4FAGA 4E4SA 4LTAA 4RFT0 3FLRA 3OUHA 1CZSA 2ZACA 3DPRC 2FDIA 3MLJA 5A33A 1A8DA 3FL7A 2RMU3 2G19A 4O9GA 3TOJA 1ZBE2 3VD5A 3HPNA 2W3JA 4E2GA 4MG2A 3J9SA 1ZRFA 1SHWB 4BISA 4QHOA 4WV8A 3SXWA 1XC6A 5DMYA 1GWKA 3RYRA 3ILRA 3NQHA 2F17A 1ZBA3 1RB8G 3KCCA 4YG0A 3UV9A 2VMIA 1DLCA 4J1XA 1OOPA 3VZLA 4QKNA 4OMCA 5I0TA 1GBGA 1RUJ2 4CDUB 2I07B 4KH9A 2MEV2 2WNVA 3SCFA 1QQP2 5C3QA 4GH4A 4MGZE 5T50A 1J58A 2JJ6A 2W1SA 2WNUC 3CBNA 2V4AA 3LWCA 4ONUA 4YM0A 5FZ7A 5LBEA 4DY5A 4YLZA 5J3UA 1GNHA 2A3WA 1R64A 4XF3A 5FMOL 1HLCA 2OZ6A 3N9PA 3ZR6A 5C8CA 1PM4A 2D98A 1IPJA 2GALA 3P1IA 5FUIA 2WO3A 3TWIA 5A80A 1W8OA 2XHNA 1RUG3 3MIDA 4BE3A 5JMCA 4KNCA 4LBKA 4XJ9A 2EIBA 3B93A 1U5ZA 1YQ2A 4Q4W2 2ATFA 4YPJA 4CDQC 2NMNA 3KM5A 1V0AA 1H0BA 1GWMA 2W46A 5IAXA 4XUTA 4BMEA 3WP5A 1VRH1 1XU2A 1C8M1 4A4AA 2HYXA 2RM23 4DRRA 1HB3A 4A45A 4OI0A 5FYSA 3VBRA 2AZ5A 1YCIA 3Q8AA 1NCRC 1VBA1 3A4UA 3WQ0A 2P2KA 4IETA 3GGLA 1OF3A 5F8PA 2ZGOA 2OQ7A 2BPA2 1PK6A 4Y5Z0 1QJY3 3U11A 3WF3A 4QX8A 2W1WA 3HN3A 3V56A 4N90A 3DUIA 5FXXA 3ZDVA 4HONA 3E6CC 2P3YA 2ARCA 3C8XA 1RUI3 5C7GA 1AYN3 1R1ZA 1XOYA 5A7QA 1AXYA 4MXVA 3UKVA 2RJKA 4N7IA 4NRMA 2PMWB 5EYYA 5KXEA 1DU3D 1DQ1A 2A6WA 3UKNA 4FXGB 1AF9A 4JGYC 2W95A 3ZXEA 4CCKA 1O3SA 2O8OA 3GCXA 2TBVA 3QD6A 5EZWA 3PJYA 1COV2 2RR12 3H1MA 4QPGB 3ZYJB 4AL9A 2NQYA 3M7AA 1HRV2 3MHZA 3B9CA 2QQIA 3K4AA 1B09A 1CAUA 3PNAA 4JGZB 3RZMA 2CDPA 2Q0AA 3A0KA 3GBWA 3TEZA 1G9BA 2JDPA 2BZDA 3VKFC 2VMHA 4QQOA 5HV0A 4D7YA 2RS13 5FO9B 5F2WA 5JZGA 4OHXA 3AC0A 2V5YA 2MEV1 1HXS2 2BVBA 3UGFA 4MXWA 3EJKA 5BNNA 4HN1A 2AGSA 5FLJA 4ES8A 1OKQA 3VBUA 4YNIA 1ODNA 1SFYA 1HRI3 2SLIA 2OPWA 4RGAA 3NRUA 1RUF3 4FPOB 2TNFA 3GHMA 4B3NA 5IYYA 1IPKA 5FY1A 4DS0A 1JI6A 4ASKA 5J1XA 1Y7BA 5FZHA 2C9KA 4PJYA 4YW2A 3S7EA 2E51A 1M4WA 1XE0A 4LKEA 3K4ZA 1FNZA 1H2LA 2BDRA 3B9IA 4KGGA 4BIFA 5C5TA 1WA6X 4XHXA 1H1MA 3I97A 3K3NA 4IV3C 5C33A 2Q8OA 1AR63 4LHNA 2WQ4A 3S5AA 1I3HA 2TEPA 1W0OA 1XPWA 2Y6LA 5FY0A 5A6YA 1DQ0A 2ZPXA 4YGEA 1PVC3 5A32A 2UY8A 4AEDA 2R063 2DTWA 3ZFEA 5GZEA 2GNMA 4F7ZA 2RDQA 4P02B 4B1LA 2ZX3A 1RIRA 5JPMB 5KC6A 3VBHA 1MEC2 3GM8A 5HCBA 1O4YA 3ABZA 1LOFA 1KFXL 2ZX2A 3ECQA 4A6OA 2R16A 4E2QA 5LK5A 4A3ZA 4AVCA 5J37A 4YVSC 5LATA 3PMEA 4AVSA 4YM3A 1JS9A 4NIIA 3VHNA 3NV4A 3VGIA 4DO0A 1PHMA 1K12A 3VDDB 1C4RA 3CDZB 4P14A 3IBMA 3UL2A 4CDUC 3R4SA 1XNAA 2VULA 3IDEA 1BZWA 2XH6A 2ZKLA 3MO4A 4IW3A 4N43B 4XQDA 1GOFA 1DDLA 2A1XA 1GZCA 2X5IC 4XQWA 5ISLA 2J42A 1K3IA 3WQ1A 4URAA 2J1AA 3VDBA 4I09A 3TN91 3D4KA 2W2IA 4LIUA 3WDTA 1JTZX 5L9VA 1O6UA 1JYNA 3WXPA 4AZZA 2K0GA 2HWD2 2PHWA 1XYNA 3RJ2X 3AL5A 4P9YA 5JSOA 3E5XA 1COV1 1WMFA 2RR11 2PLV1 4INDA 4BOWA 2FZ2A 4ASMB 1VBB2 2JDAA 2A73B 1DFQA 3U75A 1YFUA 4GD4A 1FMD3 1SCSA 4YFWA 2AEZA 2LTNA 4HG6B 4A7KA 4QM9A 2B45X 3OB8A 5GLZA 4UFKA 3BPZA 1WA4A 1PM7A 4GAZA 3RZKA 2D93A 1ND2C 2QTWB 1VBE3 2JENA 2GC1A 2XB6C 3G6JB 1ENQA 5CFDC 3K46A 2Y6HA 4LOSA 1S0GA 3U10A 1K45A 1UX7A 1GWLA 2YGLA 5AC93 3OUIA 1GR3A 1RUD1 1BJQA 1F4HA 1GP6A 1PO13 1VAVA 1AX2A 2ORXA 3CJXA 3I2GA 1JZ4A 1Z7S1 1TNRA 3D8CA 4RS5A 3I2DA 2YU1A 5BUVA 1PGL2 4NO4A 4HVOA 5FREA 2DVDA 2OXBA 4QX0A 2AYHA 3RYPA 3O1VA 5EJ3A 2VW0A 1W8NA 2A7AA 4P9XA 4UWDA 3M70A 1ZZCA 3LB9A 1TMF3 2FHRA 2XG3A 1OLMA 3POFA 2ZKNA 5JUVA 1W6PA 5FP9A 2ZHMA 3WQBA 4BJ0A 1SLCA 5C9AA 3ZKUA 3FLTA 3N9LA 3KGZA 5A3LA 1MEC1 1GQHA 1RHI2 1LOCA 4QPGC 1OHFA 2BW8A 5J96B 1V00A 3TYJA 3ZYPA 4XXPA 5FPXA 3WINE 3DYPA 1IKQA 2QJVA 2VZ1A 2WINB 4S2HA 1BLZA 4QQHA 1OBNA 2Q30A 2Y6KA 5CFCA 2VTFA 4L2NA 4HPKA 5T54A 1D0GA 2PA7A 1QWRA 1UO9A 3KT7A 5F3EA 3JZVA 4PIZA 3LQCA 5GALA 2VMEA 3NNJA 3J7LA 4MSVA 3VBOA 3O1SA 1YC61 1Y4WA 3RQ0A 2QQWA 2OS2A 2SBAA 3NAPB 1R1A2 2MPFA 2BU9A 1FV3A 2R0FA 3A7QA 3EB7A 4NIAA 5FPUA 2QQNA 1L7RA 1XJAA 5B4XA 4CCDA 3AKRA 2A6VA 4MV2A 5JXJA 4E9KA 2GH8A 2UY9A 1LKNA 4B29A 3LEKA 5FPBA 4Y33A 4GWIA 3ENRA 4JRAA 1N1VA 2IXJA 1VBB1 5FMBA 2Y34A 4LE3A 3PLQA 3KS7A 1Q5OA 3POEA 4URTA 4K1YA 1QF3A 5J7MA 2W39A 2VUCA 2RJLA 4R4ZA 1AXKA 1PIV3 4RGKA 4XQ4A 4AI0A 3O1TA 4QB2A 3P3NA 2WS93 2ZAHA 2HWC3 1OH3A 3VBSC 3ZN6A 4CCLA 4CU8A 1LEMA 2BWAA 2VPVA 2ZOEB 5DZEA 1V6MA 2WO7A 5L73A 1LOEA 2VQAA 4Y1XA 3ACFA 4YWAA 4BMBA 4Q4X2 1RYYA 2GAUA 1ZA7A 1R093 2VW1A 5GZDA 1PGL1 1QMJA 3D0SA 2Y60A 3OYWB 4M00A 4XDOA 4YVWC 2UURA 1S0EA 5BY5A 3DEMA 3WF2A 4K7JA 4JDMA 5APAA 3JXSA 1XYOA 1UIJA 2E33A 1AR73 2BJSA 2X09A 3FX3A 4AGVA 4AFMA 4AI2A 2DVAA 3AVRA 3HWJA 3QLQA 1JYXA 1IOAA 3IT8A 3ZDSA 4AFDA 4RD7A 4Q29A 1O91A 1OQEA 1UYPA 3ZMNA 1POV0 2DBNA 2JB4A 3T1MA 1Y43B 4XBLA 1L7QA 4YZ1A 4XAEA 3H1YA 1V9U3 4PI0A 1AX0A 2QKDA 3RFRA 1DIWA 3MLLA 5FYHA 1NZIA 3VDAA 1G9AA 1PO23 1O8PA 4RA0A 4DNYA 1H8TB 1VB4A 3PVOA 2NZ9A 5A6ZA 2XJQA 5JXGA 2D44A 3H3ZA 3POBA 4XOGA 5D8AA 4WM7A 4COYA 1RUH1 2W94A 5AVPA 2VZOA 3AP4A 4KMQA 1BEV3 4DEVA 5ERLA 3KT4A 3N7KA 3U0ZA 4IE5A 4AHZA 2DBIA 2RDRA 1KJLA 1R1A1 3ZXAC 5C4WC 4QGLA 3WUCA 5HPOA 3C7EA 1LNSA 2XLGA 5FJKA 4DEQA 1RUE2 4OI1A 4E4DX 1JHNA 4CCEA 5DDJ1 4CYDA 2CGOA 1OD5A 1GP5A 1FOD3 2WA4A 1RUC2 2H0BA 2YXSA 1UXXX 3LFMA 4PHZA 3ZFFB 2WIIB 2YV8A 2BEOA 5FZ1A 4LMFA 2V73A 1HIXA 4LKSA 4PLOA 1G9DA 1AR92 1AL22 4QQPA 4ZU5A 3DL3A 2HWE2 3VKOA 2P1BA 5ACA1 3K51A 1T6BX 1QXPA 2FMDA 4QB6A 2VY0A 4QB1A 1XE7A 3I2IA 4QWNA 5HXVA 3OEBA 3WNOA 3H9AA 1AR83 2QFEA 2YHJA 5T5OA 3VZNA 2CWSA 4UYBA 4CP1A 4CUGA 5BNOA 1B35A 1CX4A 1DF0A 5LRRA 1MS9A 4MGYE 3RZGA 1ZBE3 2B5HA 3B69A 4G9SB 4TSVA 3O12A 4XTPA 4W8JA 1XU1A 1NLRA 4BZ4A 3V0AB 2RS53 1LHUA 3NMBA 4GMP0 4AGRA 3USSA 2UWBA 1HQLA 1LOBA 4RYDA 1GOHA 3HQUA 4WVWA 4YZ4A 1PZ9A 3EHKA 3ZIWA 1LU1A 2XUEA 3AM2A 4TLFA 4MGTA 1HJFA 3SITA 1VE0A 2R7EB 4ZPIA 3RYKA 2R6QA 1OH4A 1RUJ3 4AR2A 5CZKA 2NYYA 3HQRA 1QQP3 1POV1 1SG3A 1VPHA 3POWA 3SQOA 3HNBM 4BCUA 1VBD2 3KLSA 3R4DB 4LJHA 3FLPA 2WWSA 1W04A 4Y4YA 4HSJA 4LITA 5FY9A 1W3VA 5KWRA 5A3MA 1MS1A 4XHBA 2VBPA 2ZA9A 4OI4A 3FMGA 4L92A 4XE9A 3H1WA 4GJZA 1FATA 3MBWA 3AZYA 3UYJA 1LHWA 3Q8CA 1OT5A 4R52A 2WFF1 2EIGA 4Q4W3 1QNWA 4HT1T 3S57A 1NAEA 1VBC3 4PDWB 3BTXA 1DHKB 1QDOA 4XABA 5C5UA 5EIYB 3LOBA 4JQRA 2P34A 1OLRA 3KCYA 2V5DA 1J84A 3I2HA 5FKBA 5A1FA 1LULA 2Q1MA 1W3XA 1S0IA 1OLQA 3H42B 3MW3A 2IXCA 3WT3A 1URXA 3WF1A 3KQ4B 4BQWA 3JBG3 4HFSA 4TTGA 3AXDA 2WSVA 2WRAA 1D4VB 2WZR2 2Y6GA 1RUE1 3GJAA 1ND3B 1LHVA 4Q4V3 1JZ6A 4LO7A 1QXJA 1F35A 1JUHA 3SKVA 4IERA 1SCRA 2ZJCA 1H4GA 4YGBA 2HWF3 1RUC1 5FZ8A 1Y3TA 4WM8B 3POJA 4KWJA 4D94A 3CJIB 2PHDA 1ENXA 1WKYA 1HW5A 2VQUA 5FZ6A 1AR91 5F5CA 5A1LA 2HWE1 4M01A 4JAAA 1MQTB 4IXLA 3TNQA 1GANA 4FPEA 4IV3A 5EJ1B 1SLBA 3POYA 3SKJE 2BV4A 1YWKA 2R073 4M0HA 3HQXA 3ZXDA 1OLME 3M3QA 1AYM3 3LZZA 2I2SA 2ZXQA 4MHUA 4UW6A 1ALYA 3PIJA 2R1DA 2C1FA 2Z42A 1U5XA 4GMP1 3J8F1 4N53B 2FDGA 1AX1A 3HT1A 3LD8A 4GJYA 4HLTA 5KHJA 3M3OA 1OFSA 4DXTA 4LT5A 1H8TC 4CXWA 1HRV3 5LRSA 3M1HA 5CAZA 2GC3A 1F2NA 4AVVA 2DCZA 4Q4Y2 1D7PM 1Y9GA 2VMDA 3FUOA 2EA7A 1JZ7A 2UWCA 1E5HA 3T3YA 1EPZA 3CU7A 4QXBA 1X36A 4B7EA 3DPRB 3UNPA 1HXS3 4CDUA 4JQTA 4V2WA 1H2KA 4FOVA 1QNYA 3JQWA 1OFNA 1UY0A 1EAH3 5F37A 2A6YA 2WN2A 2ZS6B 3BALA 2F6BA 4XTMA 1XE8A 2BUKA 2VNGA 4AEJA 1I5PA 3D3AA 4W4ZA 3LF7A 4QQLA 1SQ4A 4ATFA 1NXMA 3N7JA 4HSLA 5IATA 1NA1C 3ZO0B 2GMMA 2ARBA 5L7OC 1YRZA 5E89A 5EV7A 1SFNA 2ZEWA 4GB32 3MW4A 5CA6A 2AENA 1WBFA 1DQ5A 5A3WA 4UAPA 1YI7A 2WNUB 2XONA 1LECA 4EN0A 4FVVA 3J7HA 4NPMA 4DUXA 4JTOA 1ZRIA 2Q5TA 2IZWA 2NN8A 4ZY9A 2AACA 4A3XA 3EQEA 3HAGA 4D6SA 5A7PA 2FCTA 3H8UA 1VALA 3NNFA 1PGSA 2ZEZA 2WABA 1DGLA 4CTEA 5FLHA 4OHWA 4CDQB 3DKQA 3N9QA 1GLHA 4ZKTB 5FTTC 2E9QA 3ELNA 3KV6A 3BOPA 3O5SA 5TSWA 2J1VA 1UMIA 4M0NA 1SBDA 5F1RA 4MX3A 4K20A 5T3NA 1C57A 1NCRB 3OSDA 2C4XA 5LA9A 1FI2A 4RN5A 4ZXEA 4CDWA 2XJSA 2EALA 2D40A 4AYUA 2OX0A 2HWD3 3ASIA 5DAWA 2D5HA 4P5YA 2BFUS 2HLEA 3K75B 1K42A 3IDBB 2XBO2 5A1AA 3SEPA 5CG9A 4QPGA 4P00B 3DYOA 1EV13 4EN8B 3HT2A 4XPVA 5ANNA 4I2OA 4JGZA 5IW0A 4NPLA 4W6XA 4L8QA 2OPKA 4PIXA 1UZ0A 5FXWA 4A41A 3IDAA 4Z2AA 2WFPA 5FZBA 4AK3A 4B8EA 2BOJA 4XXAA 1GZ9A 3KCXA 1ND3C 2H0VA 5LK7B 3N36A 4L0PA 2FDHA 2HEYF 1YEWA 4Q8KA 2WO2A 2VTXJ 4FAHA 1REFA 3GF6A 3NKGA 3NNMA 1QOSA 2I45A 3GZTB 2KM2A 1N47A 1OPMA 3H3UA 4R9AA 3NW4A 2WJSA 1W9TA 2JX9A 1LB2A 2LS6A 4FTBA 5B2GB 5LY1A 1IS6A 5LA0A 1MPXA 4LO8A 1VRH2 1C8M2 3DGTA 4P08A 4FPYA 4RQPC 2W08A 3VBFB 3P5BA 4OHZA 3RWNA 2CWMA 1XNTA 1UIKA 4RFRB 1VBA2 2JEMA 1FXZA 4HK9A 4GB31 4X8NA 4NWVA 2A75A 3NSTA 4JDNA 4FP2A 1C8NA 3RS6A 4BDVB 2ZGTA 1XRUA 1WMDA 1RHI3 4EV0A 4UW5A 5FK7A 2AREA 1RJ7A 5DXDA 5EQUA 2W1UA 2YB7A 3NJVA 4NWWA 2J22A 2PAKA 1RITA 4XJWA 5GZGA 4XFCA 1Q8PA 2EXJA 3O0WA 1X33A 3RZZA 4BK5A 4IEPA 3LDKA 1UZVA 3FBMA 4NAMA 3T30A 3O1OA 3RSJA 1ZRRA 5A7OA 3VDDA 3C7FA 1RMU1 4Y1UA 1M06G 3K2OA 4I3GA 4N43A 4EQVA 3WDXA 5IT6A 2XWJB 3ACGA 1UU5A 4Q27A 4I0WB 4GWJA 2X05A 1QJU3 5I0SA 5I93A 5BXXA 1NUKA 1ULPA 3ES4A 4ZONA 4UT5A 5A7SA 2XBO1 3E5UA 3JCIA 1XSRA 4YVSB 1XNDA 4QPIB 3T0DA 5LEJA 4RR3C 4NPRA 2R042 2JDMA 3I2FA 1OC1A 3J26N 2WT0A 4OMDA 5K7PA 2MHFA 1D0HA 3ORJA 1C5HA 1RVF1 2GNTA 1UY2A 2X5IB 3TBDA 2WLPA 4CDXC 5FYCA 2YY1A 1DZQA 2DUPA 2YMZA 3OGRA 5H9QA 2YC2A 1KDKA 5FZMA 3AK0A 1H1AA 1J3RA 3WD5A 4Q4X3 3THTA 2D6KA 4FOWA 5FUPA 3QOPA 5FOBB 1ASJ2 4GULA 4LQRA 5ANQA 2WYFA 2RE9A 1G8WA 1W90A 3D82A 4ZS3A 4EZHA 2EF6A 4FQZA 2X29A 5CYYA 1XNKA 4NOTA 1S0DA 3AJYA 4BIOA 2ZHKA 4XJUA 2GN3A 3OOXA 1YYNA 2VNRA 1EUTA 2W1QA 2XLFA 3HBZA 4YGCA 1KS4A 1ND2B 3ACIA 4PQQA 2Y8KA 4XJAA 1O8SA 3NV3A 5FJHA 1MS8A 5G04L 2Z79A 1UU4A 2P3KA 5CFDB 1BBT1 4NROA 4ZU7A 4QPWA 3L2YA 2QQOA 4BQ5A 1W2TA 3UK9A 3ZYGA 3I54A 5JXHA 1WZXA 3B94A 3MF6A 5A6XA 4O9EA 3AMQA 2BBVA 1SBFA 4Q0PA 2Q8EA 4CP9B 1SBEA 5H9RA 5F32A 3Q8FA 3WHTA 1L3JA 2G9FA 4R9DA 3LGRA 4MO3M 5FKCA 3J7NA 1AL0G 4QX1A 2BNMA 1STMA 2RS33 4XCBA 3WNXA 1UKRA 1TQ5A 1VR3A 4HZFA 4WVVA 4CCNA 5DAQA 1UY3A 5FWEA 1WUVA 2F4PA 2YBKA 3O14A 4HL0A 3TN92 3OY8B 1HB2A 5GZCA 4UFIA 5FBJA 3SISA 2XR4A 2OKXA 1ACCA 2Z69A 3NAPA 3VLBB 1HB1A 5L36A 5C71A 4ARXA 3AMPA 1Q8VA 2K2SA 2PLV2 2P6HA 3IPVB 2GU9A 4R9CA 4W6WA 2OYZA 4R9BA 3NWKA 1T2XA 1OUSA 2BFUL 4ISRA 4K6BA 4EJRA 1JYIA 1UCXA 2ZTNA 3C7OA 3E97A 5D21A 3VBUC 2UYAA 1W8UA 4CZSA 5FYBA 4EE2A 5B4NA 3LOIA 3ZLIA 3VBFC 2R041 2BRTA 4LBNA 4AHWA 4D0QA 2DUQA 2E7QA 4LE4A 3S5QA 3M3EA 1VAKA 1AL23 4J1WA 4DRVA 1ULOA 3AP7A 3IAPA 3KZ4C 5FZ4A 4PF1A 3RJRA 2VBDA 2VNOA 4NHLA 3T1LA 3S0MA 4S2FA 3HVDA 1KS5A 1RUD2 5IK8A 3AVSA 3BODA 1IS4A 1TG7A 2PYTA 3MI8A 5IJRA 3RZHA 2K46A 1YXWA 2QZ3A 2Z4FA 3E6BA 3KHBA 1Z7S2 2QVSB 1LGCA 3OBTA 3JU9A 2XL7A 1QJX1 4IGPA 2DFBA 3H3LA 4GA9A 3OF1A 4QKBA 2C6SA 1SLLA 3LCPA 4WVMB 1ASJ1 3E6DA 4I0BA 4AF9A 4AGGA 4UF0A 4AWDA 1W9SA 2DU0A 2WQZC 3OYWA 4GQ7A 1PMIA 3BN6A 3OUJA 2E6VA 2C5DA 3M3IA 4Q1PA 1CONA 1CAWB 2QQJA 3BIWE 3I3BA 3IAQA 4O7XA 5BNPB 1S1AA 4IESA 3FHQA 3AKQA 3VBSB 2D6PA 1KGYA 2JDKA 1BQPA 3ZFGB 3AYAA 3I3EA 4D8MA 4P9LA 1A34A 4LO4B 5JOYA 5A3PA 1JU4A 1NT0A 1VBD3 4K8FA 4AHYA 1W39A 3CZUA 4IEWA 1UZYA 3F2ZA 4OUMA 1CESA 2LRPA 1W8HA 4QPIC 4RHV2 1SMVA 1H6XA 3H7JA 2HYKA 1RINA 4XF1A 4R8HA 1R083 1DZRA 1H6YA 4YVWB 4B4PA 1S2KA 2VMCA 1W9YA 2G9ZA 2OQ6A 5H9PA 4E27A 1US3A 4QU1A 4E4HA 4LO6B 4AVAA 2XUMA 4O65A 5DZFA 3WNMA 5T5JA 1ZZ7A 4WZCA 3W58A 4TLGA 3I2OA 2XLAA 4AI3A 1DLLA 2ZEXA 1KITA 4G3YC 3AYDA 4LBLA 5DAVA 2YFUA 2WZR3 3HR9A 4AW7A 4QX3A 1Q8SA 3EYPA 5C3OA 1DGRN 2WAAA 1CGPA 1BHGA 4H3WA 1D4M2 4FFFA 1LEDA 3ZFFA 3CQOA 1WLWA 5FP4A 5IVBA 2RDNA 4X6QB 4I3PA 4Z82A 2VAUA 3W9AA 4IV1C 4XUNA 1IS3A 5F3CA 2ZGKA 1AUYA 5C6CA 4A7YA 4IE7A 2HWB2 4F3JA 1U5YA 4E8DA 1ZVFA 5C4WB 1JZ2A 3ROUA 1YIFA 5F2SA 4FPKA 4L9BA 1TME2 4U2AA 4CCJA 1RXGA 4XFFA 2DCTA 3U14A 3B7MA 4AQ6A 1GQPA 4OQ9A 4GH4B 1OA3A 1YQ5A 3WW4A 1XNCA 4YZ2A 1YIPA 1QU0A 4FFIA 3CEWA 3V0AA 4AVTA 2E63A 4AFAA 1AHSA 3ME2A 4YFZA 5FZ0A 4NRPA 1YFYA 3O0VA 5J98B 4OUEA 1XYPA 4DXZA 4KGQA 4Q4Y3 3I59B 1KFUL 5FYYA 3ITQA 1CWPA 1KD7A 4NRQA 3AMMA 3FUQA 1QDCA 1E5RA 4XF4A 1NY71 4PCRA 1APNA 3RWKX 3Q8EA 3ZYIB 3UGGA 4NUBA 2A71A 2ZABA 4FFHA 3I2JA 5KXBA 4QD2A 2R0HA 2UYBA 2ZX4A 4RHV1 3SEEA 4OLLA 2VUJA 2QQVA 3FFQA 4CPBD 4NIGA 2DCJA 1FYUA 2JD4A 1FPN2 5DN2A 4NJ4A 5K0UC 1YUDA 2N7GA 1RUH2 4HVRA 2JECA 4XUPA 1NCQC 1JH5A 2PHXA 3KQRA 1BK1A 1FT9A 3RVHA 3SHRA 3LE0A 4PDWA 4XAAA 1PX3A 4L11A 2KA3A 4B4RA 4DOUA 3OGGA 1LAJA 2ZGSA 1CJDA 3OPWA 5DDJ2 2Q4SA 2XQXA 2HBUA 3MFCA 2W9XA 1YQ8A 4JRLA 4YW3A 4FOQA 1MACA 3PUSA 4HMZA 4LORA 5FZEA 3O1UA 4COWA 4DINB 1D4M1 3KMHA 4Y3OA 5E1RA 1GUIA 5EYXA 4W65A 1O3TA 3LIGA 2RMU2 3KT1A 2BGOA 2OIIA 5ACA2 5BNPC 4WM8A 3H8OA 1H2NA 1UAIA 2PAEA 2QBXA 2JG8C 3CJIA 3WG3A 2Z2SB 1EY2A 1GNYA 5FY8A 3ZFGC 2A3YA 4N9HA 4XJ8A 1FAYA 4Q26A 5K9YA 2CV6A 3W5MA 1U0AA 1UZWA 2HWB1 4QHZA 5CKNA 2P3JA 5FAXA 3U1XA 1MQTA 4NAOA 1W6QA 2WT1A 4QX7A 1ZBA2 4CEWC 4LNVA 1TME1 1XNBA 3DYMA 1J3PA 3OGSA 2W47A 5DG2A 5JSRA 5F5QA 1UY1A 3ZYBA 1CZVA 2C0ZA 4QDQA 5CADA 3HJRA 3CNAA 4N53A 5EP9A 1JZ3A 2VW2A 5F6LB 3N4MA 4GKYA 1LENA 1S2BA 3FC0A 1NE6A 3C7HA 2WC2A 4BQ4A 3MIFA 1ZZ6A 1NG0A 5FYUA 4EWAA 1RUG2 2DWRA 1SDDB 1F9KA 1WCUA 3LA7A 3WG4A 2Z5WA 3DPRA 3WNKA 2FQPA 5JR2A 5CEHA 2WWJA 4M3CB 3VL8A 4YW4A 1W2NA 2HKXA 2FCVA 3CKHA 3N7MA 1UQXA 3JD71 4Z2WA 4MZUA 4Y26A 3BYWA 2PELA 4AEDB 2WFF2 1WGPA 5FZFA 1SLAA 4A2UA 2GZWA 1ULFA 3B00A 1DYOA 4MUVA 1I9RA 1F8VA 1FPN1 4DQAA 5DUWA 5K4LA 4IEYA 1VRH3 1Y9MA 1C8M3 1MZFA 2GC2A 2FDFA 1HV1A 1J83A 1G9FA 1HV0A 2VMGA 3OBRA 3SMHA 5FZKA 3D5OA 1ZX5A 5GJ6A 1QJY2 5SV8A 1VBA3 5A3NA 4MH0E 1OOPC 2E7AA 5IVFA 2BYVE 1YLLA 2P37A 1LGBA 1MR5A 4FFGA 2EAKA 2GP5A 3BU7A 3GZAA 2WNVC 3J7MA 4GH4C 2WNUA 1RUI2 2VQTA 4XMIA 1NQDA 1OD3A 1HKDA 3ZPYA 2WSUA 2OW4A 4HANA 2MNGA 1H30A 4OULA 3AKSA 4IE0A 1L7LA 4FPFA 5C8CC 5GLTA 3ZMOA 3CF6E 2RMU1 5KHGA 1W0NA 2Y38A 1GNZA 2D6NA 4OFGA 5FMDA 4CDQA 1PMJX 1O5UA 2L9LA 4A42A 2JG9B 1NA1B 4BLJA 2G1MA 2ZGNA 5EJZB 5L7OB 1LJ7A 3GXUA 1LHNA 1DYPA 2QZ2A 4FPHA 1MZ5A 3AMNA 4TXWA 1JOJA 2B9VA 2QQUA 2XWBB 2DFCA 5FIXA 5FYVA 3ZXLA 1ZBA1 4LR4A 4DXSA 3J8F2 4AEMA 2VOTA 3IMMA 1GZWB 1NCRA 1UNBA 1ZNPA 4ASLA 4V1PA 4AQSA 3VZMA 1W2OA 5FZOB 3DXUA 3SLIA 3T2QA 4ZXKA 2GNDA 3F95A 4DZGA 1ULDA 2O14A 1WLDA 4K9SA 5EHDA 5I91A 5IUQA 5EFUA 3B02A 1PK6C 2FMYA 2XXZA 3OTFA 1RUF2 3DCQA 3MPBA 2MEV3 4YM1A 1JZ8A 2QQPA 5KBFA 5KR7A 1RUG1 4TZDA 1LU2A 2WO1A 2E26A 4CCOA 3VD4A 3OD4A 1XSQA 2OUHA 1WMEA 3IN9A 4EYUA 3KGLA
chains in the Genus database with same CATH topology
1POQA 1PM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POQ A;  1PM4 A; 
#chains in the Genus database with same CATH topology
 1NXD 1;  1KDM A;  3NV1 A;  3WF4 A;  2HEW F;  2Y6F A;  1AR6 2;  4JGY A;  3BI3 A;  3UET A;  3IKW A;  3S6P A;  2IWG B;  2AEY A;  3LEG A;  1CR7 A;  1S0F A;  2RM2 1;  3DF0 A;  3X29 B;  2VCM A;  1NE4 A;  5DAP A;  3N3H A;  5IVC A;  3I4I A;  2LW8 A;  2VZS A;  5F6K A;  3PUH A;  3UKT A;  3ETP A;  4LOT A;  3ZX7 A;  1ENS A;  5GLW A;  4NIH A;  2VZP A;  4BXS V;  3L9J T;  2NPI A;  2JKB A;  4I01 A;  3O7O A;  2D3P A;  5D2A A;  2YPJ A;  4Y24 A;  1QJY 1;  2IFR A;  4IDZ A;  1N3O A;  4MGI E;  4QPY A;  3AZX A;  2B7Y A;  4JZR A;  3CMG A;  2UWA A;  5JZG C;  2CSG A;  2WNE A;  5IWF A;  3FZ3 A;  5BNN C;  3K48 A;  1RUI 1;  2CHH A;  3APB A;  1AYN 1;  3BOW A;  1W06 A;  1X9T A;  1O4Z A;  1W6N B;  3PVN A;  5LA2 A;  4QDS A;  3Q8B A;  3UGH A;  1US2 A;  2B9U A;  2XJV A;  4H7M A;  5CNA A;  5CG8 A;  3GCW A;  4TYS A;  5FRA A;  5FXZ A;  3RGB A;  1UX6 A;  3WY6 A;  4KWL A;  4AOC A;  3SCG A;  4B7K A;  3ZOI A;  4K21 A;  4RQP B;  4GAL A;  4XUO A;  3PIG A;  4U36 A;  1RXF A;  2VZ3 A;  4YM2 A;  4COU A;  1H4H A;  2BER A;  3ZVX A;  5IHR A;  4Y1Z A;  5DG1 A;  4LUM A;  3TN9 3;  4IGQ A;  1NYW A;  1UW8 A;  2ZEY A;  1MVQ A;  3HBK A;  1FMD 2;  5FV3 A;  3ZSE A;  4BXF A;  4AED C;  1COV 3;  2I74 A;  1OUX A;  2PLV 3;  2RR1 3;  1V6I A;  2Y0I A;  3ATG A;  4KWU A;  2C9A A;  2JIJ A;  2R32 A;  2RS1 1;  3N9O A;  4Q2F A;  4XBQ A;  2DDU A;  4Y1Y A;  5FWJ A;  1IKP A;  5JWP A;  5JXI A;  3VBH C;  2QNK A;  1V70 A;  3MEP A;  5LBF A;  1S4C A;  1TE1 B;  2J1U A;  4YVS A;  3WUD A;  1HRI 1;  3ZXK A;  4QPI A;  4BA6 A;  1LRH A;  4LLO A;  3J4U H;  4LK7 A;  2YRO A;  1RUF 1;  3AMH A;  1GSL A;  2BGC A;  3AZW A;  1PO1 2;  4KL1 A;  4XF0 A;  3IMN A;  4WZF A;  4LHK A;  3SC7 X;  5IAV A;  1Q3E A;  1YJK A;  2B46 X;  4OCT A;  2G4I A;  3CLP A;  5A3O A;  3HD8 B;  2A3X A;  3PUA A;  3MW2 A;  4JHT A;  4MHR A;  1CPN A;  1N3P A;  5A7W B;  2XQR A;  2VH9 A;  5IVV A;  5JSP A;  2X5I A;  4YZ5 A;  1RUD 3;  2ILM A;  3N35 A;  4IEX A;  3WG1 A;  1AR6 1;  5LW9 A;  5M0T A;  5LBC A;  5IK7 A;  1Z7S 3;  1ZZ8 A;  1EP0 A;  4K40 A;  3B01 A;  5F7U A;  2H6C A;  3EO6 A;  3ZXF A;  4HET A;  4PF5 A;  1K5M B;  1PVC 1;  1X82 A;  3C2U A;  1GFF 2;  2R06 1;  4NVP A;  3RZL A;  2JG9 C;  3ON7 A;  1G7Y A;  4RR3 B;  3VB9 A;  2D6L X;  2HBT A;  4PI2 A;  3N9N A;  3P6B A;  1OQD A;  3CO2 A;  4A7Z A;  3ZYF A;  3VD7 A;  1JOD A;  1LOA A;  5FZ9 A;  5I8Y A;  4BYY A;  1CZT A;  4QGN A;  1VIW B;  2VBB A;  1LHO A;  4CDX B;  3HN1 A;  1Z0H A;  1ND2 A;  5DPN A;  5JR7 B;  1MEC 3;  3FJS A;  3DXT A;  2P5B A;  1UKG A;  2VE1 A;  4UOJ A;  5CFD A;  4Y20 B;  2VOV A;  2VUD A;  1E5I A;  3M4F A;  1X8M A;  1BCX A;  3ETQ A;  3JB8 A;  1YFW A;  4IEV A;  4Q0Q A;  1O59 A;  4QXC A;  1V6J A;  2QQK A;  2BVV A;  5FZL A;  4CA9 A;  4IEU A;  1UL9 A;  3ZKY A;  4CP9 A;  4YZ3 A;  1UYY A;  4Y4R A;  5K8S A;  1VAM A;  3MIE A;  1XQN A;  3ZFE C;  4RS5 C;  2VZU A;  1RMU 2;  3M2M A;  5FZ3 A;  5FZC A;  1OSG A;  3T4V A;  4FI9 A;  2PN5 A;  4M4R A;  5FBZ A;  5JPN B;  5EWS A;  1DBN A;  5F5I A;  5HV4 A;  5JLV A;  1Q8Q A;  1UWW A;  2JXA A;  4J6G A;  4IL7 A;  4AXO A;  4C91 A;  4ATE A;  5I0R A;  1FMD 1;  1UYX A;  3OY8 A;  1G6N A;  4TWT A;  1TEI A;  2X8K A;  3WNL A;  1PIV 2;  1QJE A;  5BNQ A;  3AYE A;  1E57 A;  2WS9 2;  5C9A C;  2DVB A;  1VBB 3;  4XFA A;  3IPV A;  2DVG A;  4DPN A;  1VBE 1;  1B35 B;  1PGW 1;  4C0H A;  1JZ5 A;  1UU6 A;  1OQ1 A;  4CU6 A;  2Y33 A;  2JDN A;  3H50 A;  2PXJ A;  1UZZ A;  4JKL A;  5AC9 1;  1BMV 1;  1PO1 1;  1RVF 2;  3B3Q E;  1MVE A;  3WNP A;  1SZB A;  5CFC C;  4FPL A;  4JTN A;  4LPL A;  4OHY A;  3E5Q A;  3EBR A;  3M3C A;  3WP6 A;  4UI9 L;  1WW4 A;  4CEY B;  3MGU A;  2OUJ A;  3VBO C;  4DIQ A;  2QQM A;  4ERO A;  1I1E A;  4GWM A;  3WG2 A;  4YW5 A;  5C70 A;  2FD8 A;  1NLQ A;  2NP0 A;  5FPL A;  3ALQ A;  1ZYB A;  4MET A;  4S2D A;  3KSC A;  1AR7 2;  3PVB B;  4IEQ A;  1DGW X;  1W6M B;  2F4L A;  2VVD A;  3VL9 A;  4RSU A;  1W0P A;  1TMF 1;  1YNA A;  1A6C A;  4KWK A;  3KHC A;  4IQP A;  1JXN A;  2VGD A;  4XIO A;  1ZZB A;  4XZU G;  4J25 A;  5DUV A;  3KB5 A;  3ZSJ A;  4WVM A;  3I3Q A;  4MLO A;  3HEI A;  2D3R A;  4Z92 B;  1JMU B;  3NNG A;  1J1T A;  4BQY A;  2DYC A;  4B4Q A;  1N1Y A;  1BBT 2;  1CAW A;  4XW3 A;  3PVE A;  1PO2 2;  1XB9 A;  2CU5 A;  2IVJ A;  2VCA A;  2WLQ A;  4KBZ A;  5BNP A;  1S0C A;  1ENR A;  2WQ8 A;  3VBS A;  4E2S A;  3AP6 A;  1CD3 G;  5A3T A;  4UW3 A;  2FDJ A;  2QQL A;  3WP3 A;  1SPP B;  5FPA A;  1DGW A;  3OD0 A;  3ZR5 A;  2ETE A;  1QH6 A;  2QDR A;  1CIY A;  2EXK A;  1Q56 A;  3VZO A;  4EZ4 A;  1WCK A;  1ULE A;  1JN2 P;  2VL4 A;  5DUX A;  2EVX A;  3SH3 A;  4QKF A;  4PBP A;  5FYT A;  2WN3 A;  1SEF A;  1O4T A;  4AVB A;  1UN1 A;  4GIQ A;  1WMX A;  1OXC A;  1RUH 3;  1C5I A;  2JB8 A;  4XET A;  4YVW A;  1JW6 A;  3MIB A;  4UFL A;  5FQ0 B;  3P3P A;  4F83 A;  2P3I A;  3C3V A;  4I02 A;  1XXN A;  1UPS A;  2FZ1 A;  4L97 A;  4MGS A;  1R1A 3;  2YBP A;  2WDB A;  4JV4 A;  3ZSK A;  2R1B A;  1FOD 2;  2NM1 A;  1MS4 A;  4OHV A;  3T0B A;  2RVA A;  4FTE A;  5FO8 B;  2ZML A;  1GIC A;  3A21 A;  2WAO A;  2O0O A;  3KWV A;  5ABJ B;  3ACL A;  4AI9 A;  2Y0O A;  4DUW A;  1PIV 1;  5DDJ 3;  1A78 A;  5IK4 A;  1K5M C;  1W2A X;  2WS9 1;  3GDB A;  2V72 A;  3LKJ A;  1U5I A;  4P9J A;  1CIW A;  2H6B A;  3NVC A;  2HWC 1;  4Q5O A;  4QHB A;  3K4D A;  5FCC A;  3H8R A;  1RUO A;  3AB0 A;  1AR8 2;  2Q8C A;  4A44 A;  4CP2 A;  1Q8O A;  4ZHN A;  3MV1 1;  1QJZ A;  5E8A A;  4KU8 A;  2EXH A;  3BVC A;  3BTZ A;  2AR6 A;  3LDR A;  5ACA 3;  3V0B B;  3AKT A;  1WLT A;  2R49 A;  1DP0 A;  2EIC A;  3R05 A;  4ET7 A;  2RS5 2;  1R09 1;  5EXO A;  2JWP A;  5KHI A;  5D8A C;  2VUA A;  2GMP A;  4WM7 C;  1CAX B;  5FPZ A;  3V65 A;  2A6Z A;  3POS A;  5CB7 A;  5JOW A;  1DQ4 A;  3MIC A;  3OPT A;  3THC A;  1QJX 2;  3L2H A;  4OZX A;  4PT6 A;  2ES3 A;  5C4W A;  4EN7 B;  1WCS A;  2W91 A;  3PUI A;  2VD7 A;  1AR7 1;  2PHF A;  2XJT A;  4PQ9 A;  3BTY A;  3HIF A;  5LZ6 A;  3ZM8 A;  2IXK A;  3CZJ A;  3WEZ A;  1CAV B;  1OUR A;  3WDW A;  3IIA A;  2JIG A;  4MGK E;  4IV1 B;  4JC1 A;  3BUC A;  4YSF A;  3GJB A;  2ZGU A;  4CU7 A;  1V9U 1;  3T2O A;  3K3O A;  3I59 A;  5FLI A;  1POV 3;  1ZZ9 A;  2BWC A;  1AXZ A;  2ZX1 A;  3GBF A;  3PJQ A;  3W59 A;  1PO2 1;  4CP0 A;  4JCK A;  4DXR A;  5FOJ B;  1F5F A;  4LA2 A;  5JIU A;  1VLN A;  1FV2 A;  1NOV A;  3T0A A;  2Q1F A;  1VBC 2;  2RJ2 A;  3POG A;  2VOK A;  4PIY A;  5KXC A;  5BNO C;  1W8T A;  2FDK A;  1B35 C;  2AUY A;  1BEV 1;  3QBQ A;  4CUA A;  5FDB A;  4ORF A;  2WUH A;  1W6O B;  2VM9 A;  2WFF 3;  3KF3 A;  4CU9 A;  1IQD C;  1SFP A;  2LUW A;  3FHI B;  4FT8 A;  1OF4 A;  3RI9 A;  4CXX A;  3JBG 2;  1VMJ A;  5H9S A;  4CPB A;  4Q4V 2;  1DYK A;  1VRB A;  5C3R A;  4P9W A;  1NLS A;  1OPO A;  2W92 A;  3WDU A;  2XOM A;  4LK6 A;  1RL3 A;  4AG4 A;  4C90 A;  4CEY C;  3H8X A;  3AFK A;  2YPD A;  2W68 A;  1O7F A;  2HWF 2;  1FOD 1;  5DAX A;  1LOD A;  3WX5 A;  3VKM A;  1UY4 A;  1LES A;  1RUE 3;  1QOT A;  1AJK A;  1HX6 A;  2E53 A;  2VVE A;  3RNS A;  1RTV A;  4KU7 A;  4Y5T A;  2IUW A;  2VCC A;  5FPV A;  5HCF A;  1VMH A;  2XJR A;  4KI5 M;  1JOP A;  4ZU4 A;  3ES1 A;  4LXL A;  1H8V A;  2PQS A;  1RUC 3;  1OKO A;  4NMI A;  4AQ2 A;  1WCQ A;  1MZ6 A;  1OA4 A;  5FYI A;  3VKN A;  1DGR A;  2GSY A;  4CDW B;  1AR8 1;  1S2E A;  2ZMN A;  4LO5 B;  2R07 2;  4IUG A;  1GZT A;  4E8C A;  5K0U B;  4FCA A;  3U4X A;  1AR9 3;  3GYD A;  3JUU A;  1AYM 2;  1NCQ B;  1SDW A;  5DUU A;  5FZD A;  3USU B;  2HWE 3;  2RDS A;  2ZZQ A;  3AXE A;  1CPM A;  3PTR B;  1ZBE 1;  1IG0 A;  3BB6 A;  3R6S A;  2CTV A;  1RED A;  2WWU A;  1JBC A;  2D5F A;  2RS5 1;  2GH2 A;  3KVA A;  5AVA A;  3WF0 A;  1D2Q A;  4N8M A;  4FPC A;  1D2S A;  4H14 A;  3OEA A;  4GMP 3;  5F3G A;  1GOG A;  1W8Z A;  3J8F 3;  2XVL A;  3D6E A;  4RL7 A;  3T08 A;  3INA A;  3KV4 A;  4NE9 A;  5JI7 A;  4OQ8 A;  2VOW A;  2PHL A;  4Q0U A;  1RUJ 1;  1QQP 1;  1IS5 A;  2XPJ A;  4SLI A;  2GDF A;  3VUO A;  2BNO A;  2HH9 A;  5J36 A;  1S0J A;  3PUR A;  3DV8 A;  1EAH 2;  3AL6 A;  1MZE A;  1NY7 2;  2JG8 B;  3MIG A;  1GV9 A;  1Z78 A;  2VCB A;  3NNL A;  1POQ A;  2XKO A;  4HKO A;  4DUV A;  2DUO A;  4IGO A;  5LCW L;  5BPX A;  5ABJ C;  3H7Y A;  5LY2 A;  2B39 A;  3O1M A;  4Q4W 1;  4CEW B;  4UBH A;  4GZ9 A;  3U78 A;  4BK4 A;  2WBK A;  1VBC 1;  4SBV A;  2BOI A;  3LDB A;  5DQ0 A;  5FY4 A;  1QHD A;  1H1I A;  3U4S A;  2VZV A;  5I8S A;  4M3C A;  4HOO A;  2ZGR A;  3LAG A;  5FY7 A;  3LSE A;  4HN0 A;  1VMF A;  4CCC A;  2BBA A;  5EPA A;  3WP4 A;  3VV1 A;  4MVT A;  3URF A;  3JBG 1;  1YQC A;  1H8T A;  4AE2 A;  4Q4V 1;  1X7N A;  4XIK A;  3POI A;  3RMX A;  2A6X A;  1UOB A;  4Y22 B;  4AQT A;  3TNP B;  5JOZ A;  1UXZ A;  2IXH A;  4LBQ D;  2HWF 1;  4MOA A;  4OI2 A;  2ZGQ A;  2JDZ A;  2B42 B;  2GP3 A;  3OBZ A;  3E1F 1;  1LCL A;  4NHM A;  4LBQ B;  2Y6J A;  3FN9 A;  1JHJ A;  3VHP A;  4V2V A;  4XIL A;  4XDP A;  5A33 B;  1LGN A;  1O3Q A;  1UOJ A;  2PTM A;  2Y64 A;  5HCH A;  4IEO A;  1WWY A;  3B5L B;  4LUL A;  5FFO C;  1OMI A;  2J1S A;  2QUO A;  2WZ8 A;  3SH5 A;  3OJB A;  2J1R A;  3C7G A;  3CIH A;  2ADE A;  2KXL A;  2R07 1;  4QX2 A;  3AP5 A;  4S2G A;  2O8Q A;  3PU3 A;  1AYM 1;  2WT2 A;  5GM0 A;  5KXD A;  2HEV F;  2OA2 A;  5J09 A;  4PBO A;  2YGM A;  4MAD A;  1RC6 A;  5IVE A;  2JG9 A;  1NA1 A;  2FCU A;  2JE7 A;  4DMI A;  5J48 A;  2ARA A;  1OOP B;  3FWE A;  5L7O A;  1HRV 1;  1FNY A;  3NO8 A;  2Q8D A;  4C8D A;  3VD9 A;  1EV1 2;  5A6Q A;  5LEK A;  5C8W A;  3GZU C;  2PHT A;  3N7L A;  2WNV B;  4Y5S A;  4YAR A;  4ZZ5 A;  3I3D A;  3RI8 A;  1A8M A;  1OA2 A;  3WW3 A;  3KV9 A;  3MUY 1;  5F3I A;  4C1W A;  1QIQ A;  2QE3 A;  2LRO A;  4UBG A;  1EYB A;  2ET7 A;  1GZW A;  3QCW A;  4XBN A;  2E7T A;  2OZJ A;  2E32 A;  1HXS 1;  2VZT A;  1E5S A;  3AX4 A;  5FZO A;  2JE9 A;  3ZXG A;  1QOO A;  4FP3 A;  4PLN A;  1CVN A;  5C8C B;  1VJ2 A;  2XVK A;  4P5H A;  1QXR A;  1C1F A;  4JVA A;  4FOY A;  4XUR A;  2JE8 A;  3WR0 A;  4FSJ A;  5E16 A;  3THP A;  1EAH 1;  1CJP A;  2G9G A;  3RPQ A;  2DVF A;  2WA3 A;  2YBS A;  5FYZ A;  3S30 A;  4E4Z A;  2D6M A;  2IXI A;  4K1Z A;  1PVX A;  1K5J A;  4LHL A;  4FPJ A;  3THD A;  3SH4 A;  3UT0 A;  3VZK A;  5IFP A;  5GKA C;  1KRI A;  3A23 A;  3JD7 2;  1WLC A;  1CX1 A;  2JKX A;  2P17 A;  4P9I A;  2XML A;  3I8T A;  4RGG A;  3PDQ A;  3VBR B;  4AFC A;  4CXY A;  3ILF A;  5L19 A;  1UPI A;  4GXL A;  4ITC A;  2EXI A;  1J59 A;  4CDW C;  3KF5 A;  2RV9 A;  3O0X A;  1OVP A;  3I2K A;  4IE6 A;  3HNY M;  1F31 A;  2J1E A;  4O61 A;  1W9W A;  1C28 A;  3WNN A;  3UJQ A;  1QH7 A;  2PHR A;  1PK6 B;  4N7U A;  1ODM A;  1ULG A;  5A70 A;  3I49 A;  3HOB A;  2WR9 A;  2J7M A;  3VN4 A;  3BGA A;  2VVF A;  4GB3 3;  1NQJ A;  3MLK A;  5T5P A;  4AAP A;  4ZZ8 A;  1IQA A;  1CQ9 A;  2K9Z A;  2KD7 A;  4JGZ C;  1W8F A;  4Z07 A;  2X53 S;  3VD3 A;  4CSW A;  1TZO A;  3D0J A;  3ZSM A;  3AYC A;  4AI8 A;  1JYC A;  1EPW A;  2CY6 A;  5CKQ A;  4N9I A;  4LHS A;  5JOX A;  1ND3 A;  4FTS A;  1JOB A;  1YO8 A;  5KHH A;  1DQ2 A;  3OG2 A;  3LIH A;  4P9G A;  1ZRD A;  2ZHN A;  3LA2 A;  5JI9 A;  1PZ8 A;  3JQX A;  1W6N A;  5FUN A;  1O5L A;  1C3H A;  4XDQ A;  5D1I A;  5F5A A;  1EUU A;  3AKP A;  5LBB A;  3LA3 A;  1QJU 2;  3R0R A;  3RMY A;  1RMU 3;  1CAU B;  1QGL A;  2HWD 1;  4IEZ A;  1ULC A;  3WCR A;  4DB5 A;  4RQP A;  2DU1 A;  3WZ1 A;  1DCS A;  3WW1 A;  4DFS A;  5SV5 A;  1P8J A;  4FPG A;  4HVQ A;  1GMM A;  2CAV A;  3PL0 A;  5JZG B;  1EV1 1;  2BTV C;  2VXR A;  2V4V A;  3BPS A;  3UES A;  2WL1 A;  2VTX A;  4MXW B;  1IHM A;  2KR2 A;  4W6Y A;  1WW7 A;  4YRD A;  3RDI A;  5BNN B;  2XBO 3;  4D69 A;  3T2P A;  3VBU B;  2W52 A;  1ST8 A;  2P4E A;  3A0N A;  3MIH A;  1HB4 A;  4GKX A;  2CNA A;  2ZAA A;  4BU2 A;  1V6N A;  1HN0 A;  2B4K A;  3A22 A;  1J1L A;  2D7F A;  4BQ1 A;  3LPF A;  3MUZ 1;  4OZO A;  4Q1R A;  4D7T A;  3LSD A;  3GHN A;  1AZD A;  2ZGL A;  3DKW A;  3OGJ A;  1RVF 3;  2WKK A;  5JAX A;  1VP6 A;  1Q43 A;  2WNO A;  4UF0 B;  1V6L A;  5E88 A;  5GLU A;  3T2T A;  3U37 A;  3W21 A;  1ONA A;  3VDD C;  1GU3 A;  3U07 A;  2WZP P;  2JDH A;  2VJX A;  3ZPO A;  1O3R A;  4CCM A;  5KC5 A;  2Q1Z B;  2RM2 2;  5FZG A;  5A32 B;  5A7W A;  1BK0 A;  3O1P A;  4N43 C;  4LBM A;  4OUS A;  3ZFE B;  2NMO A;  4D7S A;  4QXH A;  2ZGP A;  4UXA A;  1G9C A;  1NZC A;  4X6R B;  3VBH B;  1WW6 A;  2D3S A;  2ZMK A;  3RG0 A;  1KXG A;  4XFH A;  3MZH A;  3GBG A;  1K5M A;  2AH2 A;  2CGN A;  4AFB A;  3ZSL A;  4RR3 A;  1UOG A;  1RHI 1;  2IC1 A;  3IM0 A;  4QXK A;  4X8P A;  4YYO A;  1JYV A;  2JIC A;  3OCP A;  4DY3 A;  1PMH X;  2YUE A;  1BBT 3;  5CKM A;  1PNF A;  1T6G C;  4LIV A;  2PHU A;  4IE4 A;  5I0U A;  4K3U A;  1AYN 2;  1LOG A;  2ADD A;  2RS3 2;  4CDX A;  5DZG A;  2X10 A;  3GZE A;  1ZM1 A;  2VQ0 A;  3TAY A;  4Y20 A;  1QJF A;  3KVB A;  4EN6 B;  5GLV A;  5CBL A;  1HN1 A;  4QKD A;  2GC0 A;  5IK5 A;  5KHK A;  1HQW A;  4M3C F;  3IWZ A;  5IVY A;  3K77 A;  2YFZ A;  2PQQ A;  3FFZ A;  1QJU 1;  4KQ7 A;  3UJO A;  4XC9 A;  1F5J A;  3W20 A;  4C0B A;  1BVP 1;  1H9W A;  4Z8B A;  4C1X A;  1W8W A;  2ZBJ A;  1IZ3 A;  1PZ7 A;  2ZX0 A;  5T52 A;  3WSO A;  3VBR C;  4YG3 A;  1JYT A;  2RS1 2;  5FZA A;  2ARX A;  1CN1 A;  3SNM A;  3BKZ A;  3I7D A;  4D3W A;  2VZR A;  4HXC A;  2LM3 A;  3G7D A;  1HRI 2;  4M3C E;  2R04 3;  5LA1 A;  5FXV A;  4FXK B;  3OBA A;  3TEW A;  2LAL A;  4RS5 B;  1OI6 A;  5BYN A;  1UD1 A;  2CAU A;  2NLR A;  4XMA A;  5FO7 B;  1GYK A;  3T09 A;  2YC0 A;  5FK8 A;  3PMS A;  5LWB A;  1S0B A;  2YYO A;  4Q4X 1;  3FBY A;  2AC1 A;  5JVV A;  4MYE A;  4UFH A;  4QAW A;  2YDE A;  2XKP A;  3QH6 A;  4XUQ A;  3GNE A;  3EMR A;  2YZ4 A;  3MV0 1;  4LEJ A;  4CEY A;  4GWN A;  4D6R A;  5HXM A;  1QJX 3;  1DG6 A;  3CL1 A;  1W6P B;  1X8E A;  4JKK A;  1PVC 2;  5C9A B;  1MS0 A;  2ORZ A;  2R06 2;  5JDB A;  3LEI A;  1ASJ 3;  3NAP C;  2CGP A;  3BU0 A;  2D43 A;  1V6O A;  2XHK A;  4OVE A;  4XJZ A;  2TUN A;  1W6M A;  2ZGM A;  4BLI A;  5T5L A;  4EWE A;  2EAA A;  4NHK A;  2XL9 A;  5FY5 A;  1LR5 A;  1WD4 A;  2BGP A;  2DV9 A;  4TN7 A;  3VBF A;  2ID4 A;  1AJO A;  4CVU A;  2W87 A;  4BB3 A;  5CFC B;  2VO5 A;  4HPK B;  2DTY A;  3GAL A;  4XFG A;  2DCY A;  3WW2 A;  3IZO A;  3NJX A;  2XDV A;  5C3P A;  1R08 2;  3S7I A;  3VBO B;  1F15 A;  1SAC A;  4I30 A;  3NJY A;  3CHX A;  2HJI A;  2RS3 1;  3ZXJ A;  2YU2 A;  2YC4 A;  1XBF A;  4LA3 A;  3RZJ A;  3TEY A;  4XCA A;  3H0O A;  4LBO A;  2A70 A;  1ZA4 A;  4BPZ A;  1SPP A;  1W2U A;  2W0X A;  4KG0 A;  5FP3 A;  3T4H B;  2C26 A;  3AJZ A;  4NID A;  1YI9 A;  4EN9 B;  4HKL A;  1YFX A;  3NKT A;  3TEX A;  1JYW A;  1KEX A;  2XVG A;  4H2A A;  3VZJ A;  4NHY A;  1ZRE A;  3WCS A;  5L9R A;  5FQ0 A;  2ENR A;  2YG0 A;  2VXJ A;  3QAC A;  4BQ3 A;  3O1R A;  4QGM A;  1IPS A;  2FBE A;  3JB4 C;  1GKB A;  4Q8L A;  1DZT A;  1H9P A;  1SLT A;  4ISQ A;  3OPZ A;  5AFB A;  4Z1V A;  3ZN6 B;  2IVI B;  1REE A;  3ACH A;  4ES9 A;  1UYZ A;  1DQ6 A;  1VBE 2;  3KD4 A;  5ABJ A;  1AL2 1;  1FX5 A;  3WDV A;  4BQX A;  1PGW 2;  4KBB A;  1LOF C;  1QEX A;  3KV5 A;  4JKM A;  4NHX A;  3TB0 A;  3ZN4 A;  4AEK A;  5JCT A;  1NX9 A;  1W6Q B;  1KQR A;  2P6C A;  4LBJ A;  1W05 A;  5AC9 2;  1RJ8 A;  5BV6 A;  1BMV 2;  1WD3 A;  2VZQ A;  1UMH A;  4YGD A;  5G05 L;  4XYX A;  4CUB A;  5FP8 A;  3ST7 A;  1KJR A;  3MYX A;  4YG6 A;  4HKW A;  4UFM A;  2EID A;  1X9P A;  2VR4 A;  1SLI A;  3V0B A;  2DF7 A;  2RHP A;  4XFI A;  2ZZJ A;  4BHP A;  1BKZ A;  2QDN A;  1UMZ A;  2GNB A;  2R30 A;  1N3Q A;  1W28 A;  5E6H A;  1GP4 A;  1CAX A;  2RG4 A;  1IGO A;  2W5F A;  4JDO A;  5A7N A;  5LB6 A;  3VHR A;  3VKL A;  1TMF 2;  5IFT A;  5I0D A;  3PTY A;  4R4X A;  3OGV A;  2J1T A;  1WW5 A;  5FMO S;  2UU8 A;  4XVH A;  4CE8 A;  4LKF A;  5F9T A;  4B1M A;  1VBD 1;  3NV2 A;  4I0A A;  2EIE A;  1U12 A;  4WBB A;  3WLU A;  1CAV A;  4A6S A;  3ZFF C;  4COV A;  2C24 A;  4D6Q A;  4IV1 A;  4LLF A;  5D8A B;  1JUI A;  3WDY A;  4UW4 A;  4WM7 B;  3WHU A;  1R08 1;  1TVG A;  3BTA A;  4FBF A;  1YHF A;  1PNG A;  4AAX A;  2ZCW A;  2GME A;  5AFE A;  2CL2 A;  3BCW A;  4RHV 3;  2DCK A;  2VNV A;  4XAC A;  2BP6 A;  4MGQ A;  1IG3 A;  3EXU A;  4W50 A;  4XZP A;  3ZYR A;  2D6O X;  1BVV A;  2CDO A;  3M8L A;  4WVZ A;  2IXL A;  1W9F A;  3HNM A;  1AVB A;  3DEC A;  1W6O A;  4XEZ A;  2CYF A;  4COZ A;  1HDK A;  4Q0V A;  5I8T A;  2WZR 1;  3AP9 A;  3IDC B;  5CU1 A;  5JMO A;  5HI0 A;  5IVJ A;  2D97 A;  3DN7 A;  3ZYH A;  2ERF A;  2B8M A;  3ZN5 A;  1YQ6 A;  2GN7 A;  4ARY A;  4KG8 A;  1LTE A;  2BNN A;  4HBN A;  3AZZ A;  5LAS A;  2VMF A;  3PUQ A;  4LKD A;  4NN0 A;  4QM8 A;  1BYH A;  5FYM A;  2VG9 A;  5F39 A;  4AI1 A;  1ZRC A;  2HWC 2;  4CRQ A;  5BNO B;  2PFW A;  3LFI A;  5CVR A;  4QDR A;  5JIA A;  5GZF A;  3V64 A;  3MF9 A;  1YJL A;  1D4M 3;  4Y1V A;  4YW7 A;  3VHO A;  1HJG A;  1G86 A;  1I5Z A;  1A3K A;  2BQP A;  3WQ7 A;  5HBA A;  1VB2 A;  1F4A A;  1V6K A;  2V09 A;  4QU2 A;  4EWD A;  5K0U A;  1R09 2;  4FO9 A;  3WVJ A;  3USU A;  1NCQ A;  2VOX A;  4XF9 A;  1Y9Q A;  1TNF A;  2HWB 3;  1OVS A;  3W5N A;  2PAM A;  2Y26 A;  4LUK A;  1I6X A;  1WCD J;  2QCS B;  4FQ4 A;  4QMA A;  5FR3 A;  2JDY A;  1JU3 A;  1WBL A;  3LPG A;  1TME 3;  3III A;  4ZS2 A;  4M4P A;  4F8A A;  1H2M A;  4PDW C;  5T55 A;  5FP7 A;  4CUC A;  3R4U A;  1C1L A;  4Q4Y 1;  1J3Q A;  1MS5 A;  2XGX A;  1UOF A;  4JX0 A;  3WV6 A;  5HCA A;  3LEM A;  1X50 A;  3N9M A;  1QY4 A;  4JHZ A;  2WYS A;  1NKG A;  4QX5 A;  4XFB A;  4QT6 A;  4BH9 A;  3WOG A;  3MFA A;  1GQG A;  5CIS A;  4JGY B;  1V9U 2;  3AFG A;  1BXH A;  4Q0S A;  1RGS A;  2VEC A;  2A5Z A;  3BIE A;  4H7L A;  3ZIX A;  3Q9O A;  3PHM A;  2ET1 A;  2IFW A;  2JG8 A;  2XJP A;  2JD9 A;  4WM8 C;  3ZFG A;  4G4F A;  4QQ2 A;  3CJI C;  4BWO A;  4UFJ A;  3MDP A;  3JD7 3;  1S55 A;  1BEV 2;  3RRD A;  3I3M A;  1HQN A;  4CEW A;  1MQT C;  2OVU A;  3MPP G;  3NL1 A;  4NR1 A;  5FMC A;  2JDU A;  3NJZ A;  1W99 A;  1RUN A;  3HMY A;  4HK8 A;  1FPN 3;  5A3U A;  3AZV A;  4PLM A;  3IB3 A;  2WZE A;  2XJU A;  5CIR A;  1MS3 A;  4YW6 A;  2OT7 A;  4YW1 A;  2DUR A;  1QKQ A;  4BM8 A;  1N1T A;  3TRS B;  1PX4 A;  5L9B A;  4N53 C;  1N1S A;  2VC9 A;  3FHA A;  2VU9 A;  1W03 A;  2E31 A;  4OYU A;  5FZI A;  3PU8 A;  3VDC A;  3SCH A;  5C3S A;  2O1Q A;  4Y22 A;  1UF2 C;  4K8R B;  4H55 A;  4L99 A;  5DAB A;  4AHX A;  3QH7 A;  4LBQ A;  2ZHL A;  3FE5 A;  3ILN A;  4IV3 B;  4BQ2 A;  4FAG A;  4E4S A;  4LTA A;  4RFT 0;  3FLR A;  3OUH A;  1CZS A;  2ZAC A;  3DPR C;  2FDI A;  3MLJ A;  5A33 A;  1A8D A;  3FL7 A;  2RMU 3;  2G19 A;  4O9G A;  3TOJ A;  1ZBE 2;  3VD5 A;  3HPN A;  2W3J A;  4E2G A;  4MG2 A;  3J9S A;  1ZRF A;  1SHW B;  4BIS A;  4QHO A;  4WV8 A;  3SXW A;  1XC6 A;  5DMY A;  1GWK A;  3RYR A;  3ILR A;  3NQH A;  2F17 A;  1ZBA 3;  1RB8 G;  3KCC A;  4YG0 A;  3UV9 A;  2VMI A;  1DLC A;  4J1X A;  1OOP A;  3VZL A;  4QKN A;  4OMC A;  5I0T A;  1GBG A;  1RUJ 2;  4CDU B;  2I07 B;  4KH9 A;  2MEV 2;  2WNV A;  3SCF A;  1QQP 2;  5C3Q A;  4GH4 A;  4MGZ E;  5T50 A;  1J58 A;  2JJ6 A;  2W1S A;  2WNU C;  3CBN A;  2V4A A;  3LWC A;  4ONU A;  4YM0 A;  5FZ7 A;  5LBE A;  4DY5 A;  4YLZ A;  5J3U A;  1GNH A;  2A3W A;  1R64 A;  4XF3 A;  5FMO L;  1HLC A;  2OZ6 A;  3N9P A;  3ZR6 A;  5C8C A;  1PM4 A;  2D98 A;  1IPJ A;  2GAL A;  3P1I A;  5FUI A;  2WO3 A;  3TWI A;  5A80 A;  1W8O A;  2XHN A;  1RUG 3;  3MID A;  4BE3 A;  5JMC A;  4KNC A;  4LBK A;  4XJ9 A;  2EIB A;  3B93 A;  1U5Z A;  1YQ2 A;  4Q4W 2;  2ATF A;  4YPJ A;  4CDQ C;  2NMN A;  3KM5 A;  1V0A A;  1H0B A;  1GWM A;  2W46 A;  5IAX A;  4XUT A;  4BME A;  3WP5 A;  1VRH 1;  1XU2 A;  1C8M 1;  4A4A A;  2HYX A;  2RM2 3;  4DRR A;  1HB3 A;  4A45 A;  4OI0 A;  5FYS A;  3VBR A;  2AZ5 A;  1YCI A;  3Q8A A;  1NCR C;  1VBA 1;  3A4U A;  3WQ0 A;  2P2K A;  4IET A;  3GGL A;  1OF3 A;  5F8P A;  2ZGO A;  2OQ7 A;  2BPA 2;  1PK6 A;  4Y5Z 0;  1QJY 3;  3U11 A;  3WF3 A;  4QX8 A;  2W1W A;  3HN3 A;  3V56 A;  4N90 A;  3DUI A;  5FXX A;  3ZDV A;  4HON A;  3E6C C;  2P3Y A;  2ARC A;  3C8X A;  1RUI 3;  5C7G A;  1AYN 3;  1R1Z A;  1XOY A;  5A7Q A;  1AXY A;  4MXV A;  3UKV A;  2RJK A;  4N7I A;  4NRM A;  2PMW B;  5EYY A;  5KXE A;  1DU3 D;  1DQ1 A;  2A6W A;  3UKN A;  4FXG B;  1AF9 A;  4JGY C;  2W95 A;  3ZXE A;  4CCK A;  1O3S A;  2O8O A;  3GCX A;  2TBV A;  3QD6 A;  5EZW A;  3PJY A;  1COV 2;  2RR1 2;  3H1M A;  4QPG B;  3ZYJ B;  4AL9 A;  2NQY A;  3M7A A;  1HRV 2;  3MHZ A;  3B9C A;  2QQI A;  3K4A A;  1B09 A;  1CAU A;  3PNA A;  4JGZ B;  3RZM A;  2CDP A;  2Q0A A;  3A0K A;  3GBW A;  3TEZ A;  1G9B A;  2JDP A;  2BZD A;  3VKF C;  2VMH A;  4QQO A;  5HV0 A;  4D7Y A;  2RS1 3;  5FO9 B;  5F2W A;  5JZG A;  4OHX A;  3AC0 A;  2V5Y A;  2MEV 1;  1HXS 2;  2BVB A;  3UGF A;  4MXW A;  3EJK A;  5BNN A;  4HN1 A;  2AGS A;  5FLJ A;  4ES8 A;  1OKQ A;  3VBU A;  4YNI A;  1ODN A;  1SFY A;  1HRI 3;  2SLI A;  2OPW A;  4RGA A;  3NRU A;  1RUF 3;  4FPO B;  2TNF A;  3GHM A;  4B3N A;  5IYY A;  1IPK A;  5FY1 A;  4DS0 A;  1JI6 A;  4ASK A;  5J1X A;  1Y7B A;  5FZH A;  2C9K A;  4PJY A;  4YW2 A;  3S7E A;  2E51 A;  1M4W A;  1XE0 A;  4LKE A;  3K4Z A;  1FNZ A;  1H2L A;  2BDR A;  3B9I A;  4KGG A;  4BIF A;  5C5T A;  1WA6 X;  4XHX A;  1H1M A;  3I97 A;  3K3N A;  4IV3 C;  5C33 A;  2Q8O A;  1AR6 3;  4LHN A;  2WQ4 A;  3S5A A;  1I3H A;  2TEP A;  1W0O A;  1XPW A;  2Y6L A;  5FY0 A;  5A6Y A;  1DQ0 A;  2ZPX A;  4YGE A;  1PVC 3;  5A32 A;  2UY8 A;  4AED A;  2R06 3;  2DTW A;  3ZFE A;  5GZE A;  2GNM A;  4F7Z A;  2RDQ A;  4P02 B;  4B1L A;  2ZX3 A;  1RIR A;  5JPM B;  5KC6 A;  3VBH A;  1MEC 2;  3GM8 A;  5HCB A;  1O4Y A;  3ABZ A;  1LOF A;  1KFX L;  2ZX2 A;  3ECQ A;  4A6O A;  2R16 A;  4E2Q A;  5LK5 A;  4A3Z A;  4AVC A;  5J37 A;  4YVS C;  5LAT A;  3PME A;  4AVS A;  4YM3 A;  1JS9 A;  4NII A;  3VHN A;  3NV4 A;  3VGI A;  4DO0 A;  1PHM A;  1K12 A;  3VDD B;  1C4R A;  3CDZ B;  4P14 A;  3IBM A;  3UL2 A;  4CDU C;  3R4S A;  1XNA A;  2VUL A;  3IDE A;  1BZW A;  2XH6 A;  2ZKL A;  3MO4 A;  4IW3 A;  4N43 B;  4XQD A;  1GOF A;  1DDL A;  2A1X A;  1GZC A;  2X5I C;  4XQW A;  5ISL A;  2J42 A;  1K3I A;  3WQ1 A;  4URA A;  2J1A A;  3VDB A;  4I09 A;  3TN9 1;  3D4K A;  2W2I A;  4LIU A;  3WDT A;  1JTZ X;  5L9V A;  1O6U A;  1JYN A;  3WXP A;  4AZZ A;  2K0G A;  2HWD 2;  2PHW A;  1XYN A;  3RJ2 X;  3AL5 A;  4P9Y A;  5JSO A;  3E5X A;  1COV 1;  1WMF A;  2RR1 1;  2PLV 1;  4IND A;  4BOW A;  2FZ2 A;  4ASM B;  1VBB 2;  2JDA A;  2A73 B;  1DFQ A;  3U75 A;  1YFU A;  4GD4 A;  1FMD 3;  1SCS A;  4YFW A;  2AEZ A;  2LTN A;  4HG6 B;  4A7K A;  4QM9 A;  2B45 X;  3OB8 A;  5GLZ A;  4UFK A;  3BPZ A;  1WA4 A;  1PM7 A;  4GAZ A;  3RZK A;  2D93 A;  1ND2 C;  2QTW B;  1VBE 3;  2JEN A;  2GC1 A;  2XB6 C;  3G6J B;  1ENQ A;  5CFD C;  3K46 A;  2Y6H A;  4LOS A;  1S0G A;  3U10 A;  1K45 A;  1UX7 A;  1GWL A;  2YGL A;  5AC9 3;  3OUI A;  1GR3 A;  1RUD 1;  1BJQ A;  1F4H A;  1GP6 A;  1PO1 3;  1VAV A;  1AX2 A;  2ORX A;  3CJX A;  3I2G A;  1JZ4 A;  1Z7S 1;  1TNR A;  3D8C A;  4RS5 A;  3I2D A;  2YU1 A;  5BUV A;  1PGL 2;  4NO4 A;  4HVO A;  5FRE A;  2DVD A;  2OXB A;  4QX0 A;  2AYH A;  3RYP A;  3O1V A;  5EJ3 A;  2VW0 A;  1W8N A;  2A7A A;  4P9X A;  4UWD A;  3M70 A;  1ZZC A;  3LB9 A;  1TMF 3;  2FHR A;  2XG3 A;  1OLM A;  3POF A;  2ZKN A;  5JUV A;  1W6P A;  5FP9 A;  2ZHM A;  3WQB A;  4BJ0 A;  1SLC A;  5C9A A;  3ZKU A;  3FLT A;  3N9L A;  3KGZ A;  5A3L A;  1MEC 1;  1GQH A;  1RHI 2;  1LOC A;  4QPG C;  1OHF A;  2BW8 A;  5J96 B;  1V00 A;  3TYJ A;  3ZYP A;  4XXP A;  5FPX A;  3WIN E;  3DYP A;  1IKQ A;  2QJV A;  2VZ1 A;  2WIN B;  4S2H A;  1BLZ A;  4QQH A;  1OBN A;  2Q30 A;  2Y6K A;  5CFC A;  2VTF A;  4L2N A;  4HPK A;  5T54 A;  1D0G A;  2PA7 A;  1QWR A;  1UO9 A;  3KT7 A;  5F3E A;  3JZV A;  4PIZ A;  3LQC A;  5GAL A;  2VME A;  3NNJ A;  3J7L A;  4MSV A;  3VBO A;  3O1S A;  1YC6 1;  1Y4W A;  3RQ0 A;  2QQW A;  2OS2 A;  2SBA A;  3NAP B;  1R1A 2;  2MPF A;  2BU9 A;  1FV3 A;  2R0F A;  3A7Q A;  3EB7 A;  4NIA A;  5FPU A;  2QQN A;  1L7R A;  1XJA A;  5B4X A;  4CCD A;  3AKR A;  2A6V A;  4MV2 A;  5JXJ A;  4E9K A;  2GH8 A;  2UY9 A;  1LKN A;  4B29 A;  3LEK A;  5FPB A;  4Y33 A;  4GWI A;  3ENR A;  4JRA A;  1N1V A;  2IXJ A;  1VBB 1;  5FMB A;  2Y34 A;  4LE3 A;  3PLQ A;  3KS7 A;  1Q5O A;  3POE A;  4URT A;  4K1Y A;  1QF3 A;  5J7M A;  2W39 A;  2VUC A;  2RJL A;  4R4Z A;  1AXK A;  1PIV 3;  4RGK A;  4XQ4 A;  4AI0 A;  3O1T A;  4QB2 A;  3P3N A;  2WS9 3;  2ZAH A;  2HWC 3;  1OH3 A;  3VBS C;  3ZN6 A;  4CCL A;  4CU8 A;  1LEM A;  2BWA A;  2VPV A;  2ZOE B;  5DZE A;  1V6M A;  2WO7 A;  5L73 A;  1LOE A;  2VQA A;  4Y1X A;  3ACF A;  4YWA A;  4BMB A;  4Q4X 2;  1RYY A;  2GAU A;  1ZA7 A;  1R09 3;  2VW1 A;  5GZD A;  1PGL 1;  1QMJ A;  3D0S A;  2Y60 A;  3OYW B;  4M00 A;  4XDO A;  4YVW C;  2UUR A;  1S0E A;  5BY5 A;  3DEM A;  3WF2 A;  4K7J A;  4JDM A;  5APA A;  3JXS A;  1XYO A;  1UIJ A;  2E33 A;  1AR7 3;  2BJS A;  2X09 A;  3FX3 A;  4AGV A;  4AFM A;  4AI2 A;  2DVA A;  3AVR A;  3HWJ A;  3QLQ A;  1JYX A;  1IOA A;  3IT8 A;  3ZDS A;  4AFD A;  4RD7 A;  4Q29 A;  1O91 A;  1OQE A;  1UYP A;  3ZMN A;  1POV 0;  2DBN A;  2JB4 A;  3T1M A;  1Y43 B;  4XBL A;  1L7Q A;  4YZ1 A;  4XAE A;  3H1Y A;  1V9U 3;  4PI0 A;  1AX0 A;  2QKD A;  3RFR A;  1DIW A;  3MLL A;  5FYH A;  1NZI A;  3VDA A;  1G9A A;  1PO2 3;  1O8P A;  4RA0 A;  4DNY A;  1H8T B;  1VB4 A;  3PVO A;  2NZ9 A;  5A6Z A;  2XJQ A;  5JXG A;  2D44 A;  3H3Z A;  3POB A;  4XOG A;  5D8A A;  4WM7 A;  4COY A;  1RUH 1;  2W94 A;  5AVP A;  2VZO A;  3AP4 A;  4KMQ A;  1BEV 3;  4DEV A;  5ERL A;  3KT4 A;  3N7K A;  3U0Z A;  4IE5 A;  4AHZ A;  2DBI A;  2RDR A;  1KJL A;  1R1A 1;  3ZXA C;  5C4W C;  4QGL A;  3WUC A;  5HPO A;  3C7E A;  1LNS A;  2XLG A;  5FJK A;  4DEQ A;  1RUE 2;  4OI1 A;  4E4D X;  1JHN A;  4CCE A;  5DDJ 1;  4CYD A;  2CGO A;  1OD5 A;  1GP5 A;  1FOD 3;  2WA4 A;  1RUC 2;  2H0B A;  2YXS A;  1UXX X;  3LFM A;  4PHZ A;  3ZFF B;  2WII B;  2YV8 A;  2BEO A;  5FZ1 A;  4LMF A;  2V73 A;  1HIX A;  4LKS A;  4PLO A;  1G9D A;  1AR9 2;  1AL2 2;  4QQP A;  4ZU5 A;  3DL3 A;  2HWE 2;  3VKO A;  2P1B A;  5ACA 1;  3K51 A;  1T6B X;  1QXP A;  2FMD A;  4QB6 A;  2VY0 A;  4QB1 A;  1XE7 A;  3I2I A;  4QWN A;  5HXV A;  3OEB A;  3WNO A;  3H9A A;  1AR8 3;  2QFE A;  2YHJ A;  5T5O A;  3VZN A;  2CWS A;  4UYB A;  4CP1 A;  4CUG A;  5BNO A;  1B35 A;  1CX4 A;  1DF0 A;  5LRR A;  1MS9 A;  4MGY E;  3RZG A;  1ZBE 3;  2B5H A;  3B69 A;  4G9S B;  4TSV A;  3O12 A;  4XTP A;  4W8J A;  1XU1 A;  1NLR A;  4BZ4 A;  3V0A B;  2RS5 3;  1LHU A;  3NMB A;  4GMP 0;  4AGR A;  3USS A;  2UWB A;  1HQL A;  1LOB A;  4RYD A;  1GOH A;  3HQU A;  4WVW A;  4YZ4 A;  1PZ9 A;  3EHK A;  3ZIW A;  1LU1 A;  2XUE A;  3AM2 A;  4TLF A;  4MGT A;  1HJF A;  3SIT A;  1VE0 A;  2R7E B;  4ZPI A;  3RYK A;  2R6Q A;  1OH4 A;  1RUJ 3;  4AR2 A;  5CZK A;  2NYY A;  3HQR A;  1QQP 3;  1POV 1;  1SG3 A;  1VPH A;  3POW A;  3SQO A;  3HNB M;  4BCU A;  1VBD 2;  3KLS A;  3R4D B;  4LJH A;  3FLP A;  2WWS A;  1W04 A;  4Y4Y A;  4HSJ A;  4LIT A;  5FY9 A;  1W3V A;  5KWR A;  5A3M A;  1MS1 A;  4XHB A;  2VBP A;  2ZA9 A;  4OI4 A;  3FMG A;  4L92 A;  4XE9 A;  3H1W A;  4GJZ A;  1FAT A;  3MBW A;  3AZY A;  3UYJ A;  1LHW A;  3Q8C A;  1OT5 A;  4R52 A;  2WFF 1;  2EIG A;  4Q4W 3;  1QNW A;  4HT1 T;  3S57 A;  1NAE A;  1VBC 3;  4PDW B;  3BTX A;  1DHK B;  1QDO A;  4XAB A;  5C5U A;  5EIY B;  3LOB A;  4JQR A;  2P34 A;  1OLR A;  3KCY A;  2V5D A;  1J84 A;  3I2H A;  5FKB A;  5A1F A;  1LUL A;  2Q1M A;  1W3X A;  1S0I A;  1OLQ A;  3H42 B;  3MW3 A;  2IXC A;  3WT3 A;  1URX A;  3WF1 A;  3KQ4 B;  4BQW A;  3JBG 3;  4HFS A;  4TTG A;  3AXD A;  2WSV A;  2WRA A;  1D4V B;  2WZR 2;  2Y6G A;  1RUE 1;  3GJA A;  1ND3 B;  1LHV A;  4Q4V 3;  1JZ6 A;  4LO7 A;  1QXJ A;  1F35 A;  1JUH A;  3SKV A;  4IER A;  1SCR A;  2ZJC A;  1H4G A;  4YGB A;  2HWF 3;  1RUC 1;  5FZ8 A;  1Y3T A;  4WM8 B;  3POJ A;  4KWJ A;  4D94 A;  3CJI B;  2PHD A;  1ENX A;  1WKY A;  1HW5 A;  2VQU A;  5FZ6 A;  1AR9 1;  5F5C A;  5A1L A;  2HWE 1;  4M01 A;  4JAA A;  1MQT B;  4IXL A;  3TNQ A;  1GAN A;  4FPE A;  4IV3 A;  5EJ1 B;  1SLB A;  3POY A;  3SKJ E;  2BV4 A;  1YWK A;  2R07 3;  4M0H A;  3HQX A;  3ZXD A;  1OLM E;  3M3Q A;  1AYM 3;  3LZZ A;  2I2S A;  2ZXQ A;  4MHU A;  4UW6 A;  1ALY A;  3PIJ A;  2R1D A;  2C1F A;  2Z42 A;  1U5X A;  4GMP 1;  3J8F 1;  4N53 B;  2FDG A;  1AX1 A;  3HT1 A;  3LD8 A;  4GJY A;  4HLT A;  5KHJ A;  3M3O A;  1OFS A;  4DXT A;  4LT5 A;  1H8T C;  4CXW A;  1HRV 3;  5LRS A;  3M1H A;  5CAZ A;  2GC3 A;  1F2N A;  4AVV A;  2DCZ A;  4Q4Y 2;  1D7P M;  1Y9G A;  2VMD A;  3FUO A;  2EA7 A;  1JZ7 A;  2UWC A;  1E5H A;  3T3Y A;  1EPZ A;  3CU7 A;  4QXB A;  1X36 A;  4B7E A;  3DPR B;  3UNP A;  1HXS 3;  4CDU A;  4JQT A;  4V2W A;  1H2K A;  4FOV A;  1QNY A;  3JQW A;  1OFN A;  1UY0 A;  1EAH 3;  5F37 A;  2A6Y A;  2WN2 A;  2ZS6 B;  3BAL A;  2F6B A;  4XTM A;  1XE8 A;  2BUK A;  2VNG A;  4AEJ A;  1I5P A;  3D3A A;  4W4Z A;  3LF7 A;  4QQL A;  1SQ4 A;  4ATF A;  1NXM A;  3N7J A;  4HSL A;  5IAT A;  1NA1 C;  3ZO0 B;  2GMM A;  2ARB A;  5L7O C;  1YRZ A;  5E89 A;  5EV7 A;  1SFN A;  2ZEW A;  4GB3 2;  3MW4 A;  5CA6 A;  2AEN A;  1WBF A;  1DQ5 A;  5A3W A;  4UAP A;  1YI7 A;  2WNU B;  2XON A;  1LEC A;  4EN0 A;  4FVV A;  3J7H A;  4NPM A;  4DUX A;  4JTO A;  1ZRI A;  2Q5T A;  2IZW A;  2NN8 A;  4ZY9 A;  2AAC A;  4A3X A;  3EQE A;  3HAG A;  4D6S A;  5A7P A;  2FCT A;  3H8U A;  1VAL A;  3NNF A;  1PGS A;  2ZEZ A;  2WAB A;  1DGL A;  4CTE A;  5FLH A;  4OHW A;  4CDQ B;  3DKQ A;  3N9Q A;  1GLH A;  4ZKT B;  5FTT C;  2E9Q A;  3ELN A;  3KV6 A;  3BOP A;  3O5S A;  5TSW A;  2J1V A;  1UMI A;  4M0N A;  1SBD A;  5F1R A;  4MX3 A;  4K20 A;  5T3N A;  1C57 A;  1NCR B;  3OSD A;  2C4X A;  5LA9 A;  1FI2 A;  4RN5 A;  4ZXE A;  4CDW A;  2XJS A;  2EAL A;  2D40 A;  4AYU A;  2OX0 A;  2HWD 3;  3ASI A;  5DAW A;  2D5H A;  4P5Y A;  2BFU S;  2HLE A;  3K75 B;  1K42 A;  3IDB B;  2XBO 2;  5A1A A;  3SEP A;  5CG9 A;  4QPG A;  4P00 B;  3DYO A;  1EV1 3;  4EN8 B;  3HT2 A;  4XPV A;  5ANN A;  4I2O A;  4JGZ A;  5IW0 A;  4NPL A;  4W6X A;  4L8Q A;  2OPK A;  4PIX A;  1UZ0 A;  5FXW A;  4A41 A;  3IDA A;  4Z2A A;  2WFP A;  5FZB A;  4AK3 A;  4B8E A;  2BOJ A;  4XXA A;  1GZ9 A;  3KCX A;  1ND3 C;  2H0V A;  5LK7 B;  3N36 A;  4L0P A;  2FDH A;  2HEY F;  1YEW A;  4Q8K A;  2WO2 A;  2VTX J;  4FAH A;  1REF A;  3GF6 A;  3NKG A;  3NNM A;  1QOS A;  2I45 A;  3GZT B;  2KM2 A;  1N47 A;  1OPM A;  3H3U A;  4R9A A;  3NW4 A;  2WJS A;  1W9T A;  2JX9 A;  1LB2 A;  2LS6 A;  4FTB A;  5B2G B;  5LY1 A;  1IS6 A;  5LA0 A;  1MPX A;  4LO8 A;  1VRH 2;  1C8M 2;  3DGT A;  4P08 A;  4FPY A;  4RQP C;  2W08 A;  3VBF B;  3P5B A;  4OHZ A;  3RWN A;  2CWM A;  1XNT A;  1UIK A;  4RFR B;  1VBA 2;  2JEM A;  1FXZ A;  4HK9 A;  4GB3 1;  4X8N A;  4NWV A;  2A75 A;  3NST A;  4JDN A;  4FP2 A;  1C8N A;  3RS6 A;  4BDV B;  2ZGT A;  1XRU A;  1WMD A;  1RHI 3;  4EV0 A;  4UW5 A;  5FK7 A;  2ARE A;  1RJ7 A;  5DXD A;  5EQU A;  2W1U A;  2YB7 A;  3NJV A;  4NWW A;  2J22 A;  2PAK A;  1RIT A;  4XJW A;  5GZG A;  4XFC A;  1Q8P A;  2EXJ A;  3O0W A;  1X33 A;  3RZZ A;  4BK5 A;  4IEP A;  3LDK A;  1UZV A;  3FBM A;  4NAM A;  3T30 A;  3O1O A;  3RSJ A;  1ZRR A;  5A7O A;  3VDD A;  3C7F A;  1RMU 1;  4Y1U A;  1M06 G;  3K2O A;  4I3G A;  4N43 A;  4EQV A;  3WDX A;  5IT6 A;  2XWJ B;  3ACG A;  1UU5 A;  4Q27 A;  4I0W B;  4GWJ A;  2X05 A;  1QJU 3;  5I0S A;  5I93 A;  5BXX A;  1NUK A;  1ULP A;  3ES4 A;  4ZON A;  4UT5 A;  5A7S A;  2XBO 1;  3E5U A;  3JCI A;  1XSR A;  4YVS B;  1XND A;  4QPI B;  3T0D A;  5LEJ A;  4RR3 C;  4NPR A;  2R04 2;  2JDM A;  3I2F A;  1OC1 A;  3J26 N;  2WT0 A;  4OMD A;  5K7P A;  2MHF A;  1D0H A;  3ORJ A;  1C5H A;  1RVF 1;  2GNT A;  1UY2 A;  2X5I B;  3TBD A;  2WLP A;  4CDX C;  5FYC A;  2YY1 A;  1DZQ A;  2DUP A;  2YMZ A;  3OGR A;  5H9Q A;  2YC2 A;  1KDK A;  5FZM A;  3AK0 A;  1H1A A;  1J3R A;  3WD5 A;  4Q4X 3;  3THT A;  2D6K A;  4FOW A;  5FUP A;  3QOP A;  5FOB B;  1ASJ 2;  4GUL A;  4LQR A;  5ANQ A;  2WYF A;  2RE9 A;  1G8W A;  1W90 A;  3D82 A;  4ZS3 A;  4EZH A;  2EF6 A;  4FQZ A;  2X29 A;  5CYY A;  1XNK A;  4NOT A;  1S0D A;  3AJY A;  4BIO A;  2ZHK A;  4XJU A;  2GN3 A;  3OOX A;  1YYN A;  2VNR A;  1EUT A;  2W1Q A;  2XLF A;  3HBZ A;  4YGC A;  1KS4 A;  1ND2 B;  3ACI A;  4PQQ A;  2Y8K A;  4XJA A;  1O8S A;  3NV3 A;  5FJH A;  1MS8 A;  5G04 L;  2Z79 A;  1UU4 A;  2P3K A;  5CFD B;  1BBT 1;  4NRO A;  4ZU7 A;  4QPW A;  3L2Y A;  2QQO A;  4BQ5 A;  1W2T A;  3UK9 A;  3ZYG A;  3I54 A;  5JXH A;  1WZX A;  3B94 A;  3MF6 A;  5A6X A;  4O9E A;  3AMQ A;  2BBV A;  1SBF A;  4Q0P A;  2Q8E A;  4CP9 B;  1SBE A;  5H9R A;  5F32 A;  3Q8F A;  3WHT A;  1L3J A;  2G9F A;  4R9D A;  3LGR A;  4MO3 M;  5FKC A;  3J7N A;  1AL0 G;  4QX1 A;  2BNM A;  1STM A;  2RS3 3;  4XCB A;  3WNX A;  1UKR A;  1TQ5 A;  1VR3 A;  4HZF A;  4WVV A;  4CCN A;  5DAQ A;  1UY3 A;  5FWE A;  1WUV A;  2F4P A;  2YBK A;  3O14 A;  4HL0 A;  3TN9 2;  3OY8 B;  1HB2 A;  5GZC A;  4UFI A;  5FBJ A;  3SIS A;  2XR4 A;  2OKX A;  1ACC A;  2Z69 A;  3NAP A;  3VLB B;  1HB1 A;  5L36 A;  5C71 A;  4ARX A;  3AMP A;  1Q8V A;  2K2S A;  2PLV 2;  2P6H A;  3IPV B;  2GU9 A;  4R9C A;  4W6W A;  2OYZ A;  4R9B A;  3NWK A;  1T2X A;  1OUS A;  2BFU L;  4ISR A;  4K6B A;  4EJR A;  1JYI A;  1UCX A;  2ZTN A;  3C7O A;  3E97 A;  5D21 A;  3VBU C;  2UYA A;  1W8U A;  4CZS A;  5FYB A;  4EE2 A;  5B4N A;  3LOI A;  3ZLI A;  3VBF C;  2R04 1;  2BRT A;  4LBN A;  4AHW A;  4D0Q A;  2DUQ A;  2E7Q A;  4LE4 A;  3S5Q A;  3M3E A;  1VAK A;  1AL2 3;  4J1W A;  4DRV A;  1ULO A;  3AP7 A;  3IAP A;  3KZ4 C;  5FZ4 A;  4PF1 A;  3RJR A;  2VBD A;  2VNO A;  4NHL A;  3T1L A;  3S0M A;  4S2F A;  3HVD A;  1KS5 A;  1RUD 2;  5IK8 A;  3AVS A;  3BOD A;  1IS4 A;  1TG7 A;  2PYT A;  3MI8 A;  5IJR A;  3RZH A;  2K46 A;  1YXW A;  2QZ3 A;  2Z4F A;  3E6B A;  3KHB A;  1Z7S 2;  2QVS B;  1LGC A;  3OBT A;  3JU9 A;  2XL7 A;  1QJX 1;  4IGP A;  2DFB A;  3H3L A;  4GA9 A;  3OF1 A;  4QKB A;  2C6S A;  1SLL A;  3LCP A;  4WVM B;  1ASJ 1;  3E6D A;  4I0B A;  4AF9 A;  4AGG A;  4UF0 A;  4AWD A;  1W9S A;  2DU0 A;  2WQZ C;  3OYW A;  4GQ7 A;  1PMI A;  3BN6 A;  3OUJ A;  2E6V A;  2C5D A;  3M3I A;  4Q1P A;  1CON A;  1CAW B;  2QQJ A;  3BIW E;  3I3B A;  3IAQ A;  4O7X A;  5BNP B;  1S1A A;  4IES A;  3FHQ A;  3AKQ A;  3VBS B;  2D6P A;  1KGY A;  2JDK A;  1BQP A;  3ZFG B;  3AYA A;  3I3E A;  4D8M A;  4P9L A;  1A34 A;  4LO4 B;  5JOY A;  5A3P A;  1JU4 A;  1NT0 A;  1VBD 3;  4K8F A;  4AHY A;  1W39 A;  3CZU A;  4IEW A;  1UZY A;  3F2Z A;  4OUM A;  1CES A;  2LRP A;  1W8H A;  4QPI C;  4RHV 2;  1SMV A;  1H6X A;  3H7J A;  2HYK A;  1RIN A;  4XF1 A;  4R8H A;  1R08 3;  1DZR A;  1H6Y A;  4YVW B;  4B4P A;  1S2K A;  2VMC A;  1W9Y A;  2G9Z A;  2OQ6 A;  5H9P A;  4E27 A;  1US3 A;  4QU1 A;  4E4H A;  4LO6 B;  4AVA A;  2XUM A;  4O65 A;  5DZF A;  3WNM A;  5T5J A;  1ZZ7 A;  4WZC A;  3W58 A;  4TLG A;  3I2O A;  2XLA A;  4AI3 A;  1DLL A;  2ZEX A;  1KIT A;  4G3Y C;  3AYD A;  4LBL A;  5DAV A;  2YFU A;  2WZR 3;  3HR9 A;  4AW7 A;  4QX3 A;  1Q8S A;  3EYP A;  5C3O A;  1DGR N;  2WAA A;  1CGP A;  1BHG A;  4H3W A;  1D4M 2;  4FFF A;  1LED A;  3ZFF A;  3CQO A;  1WLW A;  5FP4 A;  5IVB A;  2RDN A;  4X6Q B;  4I3P A;  4Z82 A;  2VAU A;  3W9A A;  4IV1 C;  4XUN A;  1IS3 A;  5F3C A;  2ZGK A;  1AUY A;  5C6C A;  4A7Y A;  4IE7 A;  2HWB 2;  4F3J A;  1U5Y A;  4E8D A;  1ZVF A;  5C4W B;  1JZ2 A;  3ROU A;  1YIF A;  5F2S A;  4FPK A;  4L9B A;  1TME 2;  4U2A A;  4CCJ A;  1RXG A;  4XFF A;  2DCT A;  3U14 A;  3B7M A;  4AQ6 A;  1GQP A;  4OQ9 A;  4GH4 B;  1OA3 A;  1YQ5 A;  3WW4 A;  1XNC A;  4YZ2 A;  1YIP A;  1QU0 A;  4FFI A;  3CEW A;  3V0A A;  4AVT A;  2E63 A;  4AFA A;  1AHS A;  3ME2 A;  4YFZ A;  5FZ0 A;  4NRP A;  1YFY A;  3O0V A;  5J98 B;  4OUE A;  1XYP A;  4DXZ A;  4KGQ A;  4Q4Y 3;  3I59 B;  1KFU L;  5FYY A;  3ITQ A;  1CWP A;  1KD7 A;  4NRQ A;  3AMM A;  3FUQ A;  1QDC A;  1E5R A;  4XF4 A;  1NY7 1;  4PCR A;  1APN A;  3RWK X;  3Q8E A;  3ZYI B;  3UGG A;  4NUB A;  2A71 A;  2ZAB A;  4FFH A;  3I2J A;  5KXB A;  4QD2 A;  2R0H A;  2UYB A;  2ZX4 A;  4RHV 1;  3SEE A;  4OLL A;  2VUJ A;  2QQV A;  3FFQ A;  4CPB D;  4NIG A;  2DCJ A;  1FYU A;  2JD4 A;  1FPN 2;  5DN2 A;  4NJ4 A;  5K0U C;  1YUD A;  2N7G A;  1RUH 2;  4HVR A;  2JEC A;  4XUP A;  1NCQ C;  1JH5 A;  2PHX A;  3KQR A;  1BK1 A;  1FT9 A;  3RVH A;  3SHR A;  3LE0 A;  4PDW A;  4XAA A;  1PX3 A;  4L11 A;  2KA3 A;  4B4R A;  4DOU A;  3OGG A;  1LAJ A;  2ZGS A;  1CJD A;  3OPW A;  5DDJ 2;  2Q4S A;  2XQX A;  2HBU A;  3MFC A;  2W9X A;  1YQ8 A;  4JRL A;  4YW3 A;  4FOQ A;  1MAC A;  3PUS A;  4HMZ A;  4LOR A;  5FZE A;  3O1U A;  4COW A;  4DIN B;  1D4M 1;  3KMH A;  4Y3O A;  5E1R A;  1GUI A;  5EYX A;  4W65 A;  1O3T A;  3LIG A;  2RMU 2;  3KT1 A;  2BGO A;  2OII A;  5ACA 2;  5BNP C;  4WM8 A;  3H8O A;  1H2N A;  1UAI A;  2PAE A;  2QBX A;  2JG8 C;  3CJI A;  3WG3 A;  2Z2S B;  1EY2 A;  1GNY A;  5FY8 A;  3ZFG C;  2A3Y A;  4N9H A;  4XJ8 A;  1FAY A;  4Q26 A;  5K9Y A;  2CV6 A;  3W5M A;  1U0A A;  1UZW A;  2HWB 1;  4QHZ A;  5CKN A;  2P3J A;  5FAX A;  3U1X A;  1MQT A;  4NAO A;  1W6Q A;  2WT1 A;  4QX7 A;  1ZBA 2;  4CEW C;  4LNV A;  1TME 1;  1XNB A;  3DYM A;  1J3P A;  3OGS A;  2W47 A;  5DG2 A;  5JSR A;  5F5Q A;  1UY1 A;  3ZYB A;  1CZV A;  2C0Z A;  4QDQ A;  5CAD A;  3HJR A;  3CNA A;  4N53 A;  5EP9 A;  1JZ3 A;  2VW2 A;  5F6L B;  3N4M A;  4GKY A;  1LEN A;  1S2B A;  3FC0 A;  1NE6 A;  3C7H A;  2WC2 A;  4BQ4 A;  3MIF A;  1ZZ6 A;  1NG0 A;  5FYU A;  4EWA A;  1RUG 2;  2DWR A;  1SDD B;  1F9K A;  1WCU A;  3LA7 A;  3WG4 A;  2Z5W A;  3DPR A;  3WNK A;  2FQP A;  5JR2 A;  5CEH A;  2WWJ A;  4M3C B;  3VL8 A;  4YW4 A;  1W2N A;  2HKX A;  2FCV A;  3CKH A;  3N7M A;  1UQX A;  3JD7 1;  4Z2W A;  4MZU A;  4Y26 A;  3BYW A;  2PEL A;  4AED B;  2WFF 2;  1WGP A;  5FZF A;  1SLA A;  4A2U A;  2GZW A;  1ULF A;  3B00 A;  1DYO A;  4MUV A;  1I9R A;  1F8V A;  1FPN 1;  4DQA A;  5DUW A;  5K4L A;  4IEY A;  1VRH 3;  1Y9M A;  1C8M 3;  1MZF A;  2GC2 A;  2FDF A;  1HV1 A;  1J83 A;  1G9F A;  1HV0 A;  2VMG A;  3OBR A;  3SMH A;  5FZK A;  3D5O A;  1ZX5 A;  5GJ6 A;  1QJY 2;  5SV8 A;  1VBA 3;  5A3N A;  4MH0 E;  1OOP C;  2E7A A;  5IVF A;  2BYV E;  1YLL A;  2P37 A;  1LGB A;  1MR5 A;  4FFG A;  2EAK A;  2GP5 A;  3BU7 A;  3GZA A;  2WNV C;  3J7M A;  4GH4 C;  2WNU A;  1RUI 2;  2VQT A;  4XMI A;  1NQD A;  1OD3 A;  1HKD A;  3ZPY A;  2WSU A;  2OW4 A;  4HAN A;  2MNG A;  1H30 A;  4OUL A;  3AKS A;  4IE0 A;  1L7L A;  4FPF A;  5C8C C;  5GLT A;  3ZMO A;  3CF6 E;  2RMU 1;  5KHG A;  1W0N A;  2Y38 A;  1GNZ A;  2D6N A;  4OFG A;  5FMD A;  4CDQ A;  1PMJ X;  1O5U A;  2L9L A;  4A42 A;  2JG9 B;  1NA1 B;  4BLJ A;  2G1M A;  2ZGN A;  5EJZ B;  5L7O B;  1LJ7 A;  3GXU A;  1LHN A;  1DYP A;  2QZ2 A;  4FPH A;  1MZ5 A;  3AMN A;  4TXW A;  1JOJ A;  2B9V A;  2QQU A;  2XWB B;  2DFC A;  5FIX A;  5FYV A;  3ZXL A;  1ZBA 1;  4LR4 A;  4DXS A;  3J8F 2;  4AEM A;  2VOT A;  3IMM A;  1GZW B;  1NCR A;  1UNB A;  1ZNP A;  4ASL A;  4V1P A;  4AQS A;  3VZM A;  1W2O A;  5FZO B;  3DXU A;  3SLI A;  3T2Q A;  4ZXK A;  2GND A;  3F95 A;  4DZG A;  1ULD A;  2O14 A;  1WLD A;  4K9S A;  5EHD A;  5I91 A;  5IUQ A;  5EFU A;  3B02 A;  1PK6 C;  2FMY A;  2XXZ A;  3OTF A;  1RUF 2;  3DCQ A;  3MPB A;  2MEV 3;  4YM1 A;  1JZ8 A;  2QQP A;  5KBF A;  5KR7 A;  1RUG 1;  4TZD A;  1LU2 A;  2WO1 A;  2E26 A;  4CCO A;  3VD4 A;  3OD4 A;  1XSQ A;  2OUH A;  1WME A;  3IN9 A;  4EYU A;  3KGL A; 
#chains in the Genus database with same CATH homology
 1POQ A;  1PM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...