1PM4A

Crystal structure of yersinia pseudotuberculosis-derived mitogen (ypm)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
b'IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGLSWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and Solution Structures of a Superantigen from Yersinia pseudotuberculosis Reveal a Jelly-Roll Fold.
pubmed doi rcsb
molecule keywords YPM
source organism Yersinia pseudotuberculosis
molecule tags Toxin
total genus 28
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09144 YpM Yersinia pseudo-tuberculosis mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.510 Mainly Beta Sandwich Jelly Rolls Mitogen Ypm 1pm4A00
1PM4A 1POQA
chains in the Genus database with same CATH superfamily
1YQ2A 4TXWA 2BNOA 4MXVA 4CP0A 1FOD1 4Y4RA 2XJPA 1WW6A 2EXKA 5FWJA 1CN1A 3WX5A 4XF9A 4AVCA 2JG9B 3ROUA 1TZOA 5A3PA 1FNZA 1E57A 1EY2A 1Y9QA 3FZ3A 3N7LA 5FY4A 5HBAA 3B5LB 1DGLA 5FZKA 1DGWX 1IQDC 4X8NA 3GHMA 4RQPC 2GMPA 3Q8EA 4IE6A 1ZRFA 2VM9A 4FP2A 2MEV1 1W8OA 4LMFA 2G9ZA 3V0AA 3POBA 5JOYA 3RJ2X 1VAKA 4HXCA 1ULEA 5FZOA 3I59A 3WCRA 4BIFA 3TN91 3WDTA 4ZPIA 1O91A 5FUPA 2VZSA 1N3QA 4AEMA 4W6YA 1U5XA 4DUXA 2R071 2GP5A 2G1MA 1IS3A 1RJ7A 3B3QE 1SPPB 3HNMA 5LY1A 3MV11 4GWJA 5CFCA 3I97A 1W05A 1IPKA 2R1BA 2W08A 2YDEA 4OHXA 1OQ1A 2NLRA 2DFBA 2WO3A 2E7AA 4B7KA 4Y4YA 4LA2A 1CX1A 1IQAA 2D6KA 3CDZB 3IT8A 4YRDA 2WFF1 3ILNA 4JCKA 4M4PA 2ZOEB 1RUG1 3OY8A 3OUIA 4O9GA 1CR7A 2RM22 4BZ4A 3ST7A 1DZRA 3LSDA 4IERA 5FYBA 3I3BA 4KG0A 5CKNA 1H6XA 4LK7A 5A3OA 5IVYA 4COZA 1GZTA 5C3QA 1BMV2 1QJY3 2J1EA 2OZ6A 3GCWA 4CP9A 3CNAA 1AR93 4BHPA 5AVAA 5JVVA 1J3QA 4DPNA 4HBNA 4WV8A 5JOWA 5F39A 1DZQA 3LEIA 2YB7A 1W39A 3EXUA 5F2SA 5L19A 5L7OA 2R063 1U5YA 3JZVA 5IVBA 4LK6A 2WN3A 3PURA 2VL4A 2YC4A 4OULA 5F3EA 4Z2AA 1UYYA 1XJAA 2AGSA 2J1AA 4BQ4A 1DGWA 1LEMA 4RHV1 1JZ8A 2B45X 4Q2FA 1MVQA 4WVMA 2AZ5A 3GBGA 4QMAA 1YQ5A 2LALA 4I02A 4R4XA 2ZBJA 4JGZC 4K40A 2W52A 5F9TA 3JUUA 4DUVA 3N7MA 2A6WA 4B7EA 3VD9A 1PGW1 5JCTA 4Q5OA 1PO22 4L97A 4LE4A 3BODA 3EHKA 4QGMA 4YVSC 1VBD1 1H2MA 5FO8B 3M2MA 4AEKA 3GGLA 2VNGA 4Q8LA 3SXWA 2WNEA 5JOZA 1MACA 3O1PA 1MS3A 3KWVA 3NVCA 1O3QA 1PM7A 2WL1A 5CFDA 4Y24A 3BB6A 1UPIA 2BVVA 5I8YA 5FY7A 1RUF1 2DCTA 4Q4V3 3VHNA 3BPZA 1AX0A 4ASMB 1AX1A 1N3OA 4EROA 1UAIA 1MS5A 1O4ZA 5E8AA 3NJXA 3H9AA 4ISQA 3U14A 2OVUA 4TTGA 3GZTB 4D7SA 4IE5A 5FCCA 1WW7A 2FDKA 3DECA 4MGKE 1GOHA 4NPLA 5EJ1B 2DWRA 1NA1A 3RQ0A 3FBMA 1SLAA 4JDMA 2J42A 4NE9A 1D4M3 3WDXA 3PVEA 3H7JA 4LOSA 4AF9A 5IT6A 2BOJA 3BOPA 2ZZJA 2D97A 4GH4A 4MH0E 5T5JA 2WDBA 4COVA 2D98A 3LA7A 3VZMA 3BTYA 1RHI2 2O14A 1QHDA 3RMXA 3T1LA 3MIGA 4QQ2A 4U2AA 3VKOA 5CFCB 5FPXA 3BTXA 2CGOA 4Y20A 2VNOA 5DZFA 1RUJ2 4FOVA 5GZFA 4GXLA 4KL1A 4QX3A 5LA2A 5GM0A 3T2OA 5LRSA 2PN5A 3WG3A 2D3PA 3HQRA 2D6LX 2ET7A 5A6XA 1OBNA 2HH9A 3OY8B 5DQ0A 3RYRA 4EZ4A 1APNA 2WS92 3DXUA 1UZYA 5C5UA 4ORFA 2GH8A 2IXKA 1XSQA 3WNLA 3ZN6A 2NPIA 3AZYA 3KHCA 4CXYA 3LSEA 4O9EA 3GXUA 1UZVA 3VBOB 2YC0A 2ZABA 1V9U3 1VRH3 5F1RA 3MDPA 5J98B 3SHRA 2F17A 2YBKA 4XYXA 2P3YA 4CU6A 1CAVA 4W50A 1JS9A 1J1TA 4N8MA 4AYUA 5BUVA 4FFGA 2ZMLA 4UFKA 1OF3A 3AP6A 3WVJA 4UFMA 3VBSC 1DQ2A 1O8SA 2NMNA 4WZCA 3ZLIA 1JZ5A 3ACGA 4NVPA 4BMBA 4UBHA 2BFUL 1GOFA 2AUYA 4BWOA 1UY2A 1Y43B 3PUAA 5JXIA 1VAMA 1LAJA 2FHRA 3KVAA 1PMHX 5AFEA 2YUEA 2QJVA 4IDZA 4RN5A 5FMOS 5FXVA 1KD7A 4CSWA 3N3HA 1P8JA 1XNBA 3OTFA 4S2DA 1JU3A 3C7HA 3LEMA 3M3EA 5IVCA 4HT1T 2PHRA 2YHJA 4L92A 4Y3OA 5CFDB 1WCQA 4P9YA 3Q9OA 4INDA 1GUIA 5FZAA 3QH7A 4XFHA 5HPOA 5KXCA 3O1VA 1QH7A 1HJGA 4YG0A 5FPBA 2GC1A 2IWGB 3RYKA 4NWVA 4TWTA 3BIEA 2XJVA 1ULOA 2PLV2 5L7OC 1BBT3 3EO6A 5C33A 5L36A 2ZX4A 3ZSJA 5SV8A 4NRPA 2Y6GA 2EXHA 1GICA 1C57A 1NA1B 4GJYA 3WXPA 4FOQA 1SG3A 3J7NA 2TUNA 5L9BA 1W6NB 3BIWE 2UURA 1REEA 4AHYA 4K6BA 1UN1A 3VD7A 2AEZA 3E6DA 3WV6A 4CUAA 2ERFA 2UWCA 4XXAA 4D6RA 1MQTA 1RTVA 3HWJA 1RITA 4CDWA 2DYCA 1J83A 1ZZ7A 2JDYA 4Y20B 2FZ2A 1NKGA 3WNPA 4YZ3A 3W20A 2HWC1 4BOWA 2B5HA 4B4QA 3P3NA 1RUE2 5F5CA 1QJY1 3KZ4C 2BERA 1S0GA 5F2WA 1AR91 5DUXA 2A6XA 3U4SA 3ZMNA 1UU5A 2W3JA 1O5UA 2D93A 2WZ8A 3MLJA 1CIYA 1ND3A 3ZN6B 4UFHA 4LPLA 2ZKNA 1PVXA 5FZLA 1QDCA 4N43B 1YI7A 1CPMA 1PIV1 3HT2A 3ORJA 4FQ4A 4XILA 2IXHA 3I2DA 1LRHA 2J1SA 1BYHA 2QNKA 2O8QA 1YFWA 3RJRA 3RDIA 3FBYA 4GH4C 1UWWA 1S2EA 3WUCA 2EIEA 5FKBA 1QJU3 1GP6A 5BNPA 2EAAA 1EV13 2YPJA 3LF7A 5I0UA 1QXJA 5ABJB 2MNGA 3K51A 2VW0A 2GH2A 1PVC2 2QQOA 3AXDA 1GP5A 3WLUA 3MLLA 4BM8A 2UU8A 4AVTA 3T08A 1KJRA 1BVP1 1X9TA 4LLOA 5FXWA 3U07A 4QPGA 5FXXA 3NV4A 2Y6KA 3IIIA 4EN7B 1E5HA 4EN8B 4Q4V1 3HR9A 5JWPA 2R7EB 1GFF2 3MV01 2RDQA 3GF6A 1QJFA 4XEZA 3MIBA 3WOGA 1UOGA 2QKDA 2RV9A 2VNRA 4OHYA 3J9SA 4YW3A 4XUNA 2TEPA 2XJUA 3NO8A 4Q1PA 5J36A 5FZFA 3JQWA 1OH3A 1RINA 1HX6A 3AB0A 4M0HA 4XTPA 5B4XA 1D4M1 2BGOA 1I1EA 1R082 1DGRA 3S0MA 2HEWF 3NRUA 4HZFA 4NROA 1JN2P 2B9UA 2VMEA 2WQZC 3APBA 1ZZCA 3POSA 4B3NA 2DV9A 3O12A 3RWNA 2O1QA 1WZXA 2VUDA 3Q8FA 5A1LA 2QZ3A 5T54A 1XNDA 3ACLA 1JYCA 4W6WA 4XF0A 2BQPA 4JAAA 3AJYA 3I2HA 3L2HA 4ASLA 1AL23 4E27A 2QQMA 4A7YA 3AMMA 1R64A 1OOPC 3H3UA 4ZU4A 2WUHA 2PHTA 3SISA 3F95A 5K7PA 1X9PA 2QUOA 1DLCA 2K46A 1WMEA 4FT8A 1BJQA 1FPN2 3I3DA 1G86A 1MQTB 3N7JA 4YG3A 5EP9A 3WW3A 4CDWB 1W99A 4XJ8A 4NHMA 2IXCA 3H8XA 4UF0A 5LB6A 1NYWA 3MO4A 2RDNA 4AGRA 4QU2A 1JMUB 1A8MA 3QD6A 2Y60A 5ANQA 1MS8A 1VRH1 2ZGLA 3GZEA 2VMIA 1AUYA 2FCUA 5DMYA 1XE7A 2VZVA 1HB3A 4RS5C 1W9SA 2W1UA 3WQ0A 4V1PA 3POFA 4LITA 4MX3A 4Y5SA 5A3MA 3V0BB 1O8PA 4FPLA 2CSGA 5EYYA 2B8MA 4NR1A 3QOPA 1W2UA 2VCBA 4NRMA 1G9FA 1DYPA 2RMU2 3VBFA 4YM1A 4NOTA 2A73B 1RXGA 3GBFA 5HCBA 2YPDA 1VBB3 2HWD1 4ONUA 3T0BA 3D6EA 4GMP0 3AK0A 5C4WA 4F7ZA 4TYSA 3WT3A 1GQGA 2JE9A 4FXKB 5F7UA 5DN2A 3Q8AA 1UF2C 3VDBA 1E5SA 1JYIA 3TNPB 4WVVA 4R4ZA 4JV4A 1Q5OA 2OUJA 2WZR2 1PO23 2HYXA 2Y6LA 4UFJA 3ZKUA 4CXWA 3IMMA 3ZYIB 3L2YA 4EN6B 4E9KA 4QPIA 2GNDA 2ORZA 4JKMA 2BNNA 3AMNA 3LZZA 3RVHA 3BKZA 1ND3C 1QQP2 4M3CE 4PDWC 1H1MA 2PAMA 4QKBA 1BBT1 4QX7A 1TME2 1QJZA 1POV3 4OLLA 3HOBA 5LBEA 1QIQA 5IWFA 1W2TA 5B2GB 1OA3A 2Y33A 3RYPA 1VB2A 4L9BA 2G4IA 4LQRA 3MIDA 3TWIA 1D2SA 3SH3A 4YFWA 2ZGNA 3B02A 3ZDVA 4IXLA 4LE3A 1KQRA 1SCSA 5BNPC 5JDBA 2DBNA 4MXWA 1YIFA 4QQPA 2A6VA 2PHUA 2C9AA 3W59A 2LRPA 4XUPA 3NW4A 3LPFA 5FBZA 4S2GA 1HXS1 1OLRA 4QPGC 1ODMA 1QF3A 1I5ZA 2R043 1RHI3 4TLGA 1KXGA 2BZDA 5FZCA 3ZFEB 1VBC2 1BKZA 3H50A 1N1TA 1PX3A 1RUJ3 4XUOA 4AHZA 3NQHA 4AEDB 1KDKA 3IAQA 1FNYA 2BNMA 3B7MA 3OEBA 3URFA 2TNFA 3CMGA 4D94A 1W2OA 1S2BA 1O3SA 1RUC2 2HWE2 2RR12 3H1WA 2VCMA 3VKFC 3HQUA 1RUH2 1CJPA 3HEIA 1UIJA 2D7FA 1VP6A 2WO7A 4BPZA 4CEYC 2YU2A 2KD7A 1RXFA 3S5QA 4DINB 5L9RA 3BI3A 4FTSA 1OVPA 1EV11 3G6JB 1DQ6A 4XMIA 5A33A 4DEQA 3NJVA 1XYNA 1Y4WA 4AE2A 1SFPA 1AR72 5I0DA 1NX9A 3E5XA 4TSVA 3VBFB 4JHTA 2J7MA 1WGPA 4WZFA 5BNNA 1OA2A 1J3PA 4UW4A 1SHWB 1VBE2 3HMYA 4LUMA 1UU6A 1XQNA 1XNCA 3OB8A 4C8DA 3N9MA 2VOKA 4N9HA 2E9QA 3MF6A 3RI9A 3O1MA 3MGUA 4ASKA 3UK9A 1UX7A 3VBHA 5HCHA 2Q1MA 1AXKA 4R8HA 4G4FA 1W6PA 3AMHA 4LTAA 1VAVA 4KI5M 4LORA 5CKQA 2OKXA 1HIXA 3WQ1A 5LK5A 3VZNA 4D3WA 2W92A 4QPYA 4HOOA 4A7KA 1AX2A 1AL0G 1MZEA 3MICA 4MZUA 5C71A 2XJQA 4Q4Y3 5ACA2 3VBUA 4SLIA 5A7SA 2NN8A 4GB32 2PLV3 4HKWA 3FN9A 1AR63 1W2NA 5CKMA 1F35A 3VBFC 4BDVB 4HVQA 2GMMA 3ZIWA 4B8EA 2JDUA 4I0AA 1IZ3A 2VMCA 3R4UA 3OGRA 3NNJA 1CESA 4CCMA 2D43A 2P5BA 3DKWA 4CVUA 4LHKA 5C4WC 5T5OA 4MYEA 5H9PA 3X29B 3IWZA 5J48A 3ITQA 1SLTA 4A7ZA 2VBPA 1UW8A 1OUXA 2HBUA 3O0WA 3ZVXA 3ZXLA 2ZPXA 4CDUA 1UX6A 2XMLA 4QPIC 4NIIA 3NNMA 4XAEA 4QB2A 1QJEA 3CJIA 1BMV1 4KWJA 5HV0A 3VZJA 5JAXA 1NE6A 1Q8PA 2WWUA 3AM2A 3T0AA 5KXEA 1V6KA 3SITA 3OYWA 3MW3A 2CAUA 3HAGA 3PIGA 3HT1A 3SC7X 4HKOA 3BU0A 5EYXA 2EIBA 2GAUA 3AZZA 1XU1A 3KF3A 4CDQC 4FBFA 2Q0AA 5IK5A 2VH9A 1OKOA 2EXJA 3JU9A 2PAEA 1Y9MA 1W9TA 1SFYA 3DF0A 2CL2A 3USUA 4JKLA 5FIXA 2Y6FA 1JOJA 4I01A 4N53B 5KC5A 2WFF3 1AJOA 5I8TA 4AFCA 4EZHA 5LEJA 1H9WA 1GR3A 2WA3A 2VTXA 3W58A 4GKXA 3MIFA 3VDAA 4A6OA 1PO21 4CEWA 5BNOA 3K75B 3GALA 1W9WA 4M3CF 4AHWA 2PA7A 3NJYA 1HV1A 2CWSA 4KG8A 1JYTA 3IB3A 1POV1 1XSRA 1W3VA 3VKLA 3ENRA 1W6PB 4MLOA 1XYOA 2J1UA 1VMHA 2VZQA 3LA2A 2FDJA 1GWLA 1QOTA 2OPWA 2XR4A 4FFHA 2DBIA 4FOWA 4NPRA 3SNMA 2Y8KA 3C7EA 4QGNA 3U75A 4LBQD 2D3SA 3W9AA 3M70A 2A70A 2JG9A 3VBUB 1R083 1WMDA 2BWCA 4FPYA 4XUQA 1ASJ2 3IKWA 2XONA 3LA3A 2IUWA 5J37A 1STMA 3WNXA 2X53S 5BNNC 1OLME 2ZEZA 5FP4A 1REDA 1RHI1 5C9AA 4W65A 3N36A 1UIKA 2LW8A 4YGEA 3AXEA 3JCIA 1C1LA 1CZSA 4L0PA 1ZBA3 2VE1A 3FJSA 1RUJ1 4IEOA 1RUF3 2C24A 4Q0UA 1J1LA 2QFEA 3VBHC 1U5IA 1GZWA 1XC6A 5JIUA 2VBDA 2ZJCA 4P9LA 3FL7A 5I0TA 3DYMA 4AI3A 4I30A 1JI6A 3RZMA 4MADA 4CDUB 4S2FA 3RG0A 2FDGA 1W2AX 4YM0A 2DUOA 3VL9A 1OD5A 1SPPA 3AL6A 5C3RA 2C0ZA 3I2OA 3BCWA 5DPNA 3O14A 1W6QA 2DTWA 1X82A 1CZVA 2A3XA 1LEDA 3FX3A 3NNLA 3DN7A 4WM7C 4DOUA 1RL3A 1PK6A 2VUAA 3T1MA 1KITA 4PBPA 2RS32 3DKQA 4Z82A 4D69A 3AYCA 4YSFA 1MVEA 1WMFA 5D8AB 1OUSA 1X36A 2QQLA 5A7OA 4DY3A 5A7PA 3TRSB 2X29A 2VW1A 1PO12 2B9VA 5F6KA 2FCVA 3R0RA 4PQ9A 5C5TA 3FUQA 4MG2A 3GYDA 3EBRA 5GLVA 3FFZA 4R9CA 1XOYA 2W95A 3LD8A 3USUB 4D6QA 5T5LA 5EIYB 2BV4A 2VW2A 4O65A 4RR3B 3IN9A 3OEAA 3LGRA 4IV1A 4YW7A 1ZVFA 2YGLA 3N35A 4WVZA 2NMOA 4XDQA 1SZBA 1N1SA 4H7MA 4CEWB 1UYXA 2PFWA 4YLZA 5FYSA 1Y9GA 5I0RA 3CJIC 1O3RA 3BTAA 4GWMA 1V00A 1TVGA 4LIUA 2GSYA 2VOVA 4KH9A 2E31A 4JX0A 2DTYA 4QM9A 4AQSA 3LIHA 1DHKB 2Z69A 5ISLA 1XBFA 4IEYA 3VUOA 1YQCA 2V5YA 1DU3D 4TN7A 2GALA 1N47A 1R092 2WBKA 3WDVA 1QQP3 2ZGTA 2PLV1 5T52A 3WQBA 2R32A 4FQZA 3WQ7A 1AR61 1TME3 2ET1A 1HJFA 3GCXA 4XXPA 1MZFA 1MEC3 4UW5A 2W2IA 1DG6A 2NZ9A 4YM3A 2V5DA 2G9FA 4FPHA 4GD4A 2PELA 2VVDA 2WO1A 3ELNA 3I49A 2O0OA 2EICA 2EVXA 2WIIB 2DCKA 3UYJA 4XMAA 4CXXA 4CUCA 1ZBE2 4HK9A 1ZX5A 4EWAA 1W06A 4NO4A 2RDRA 4COWA 2ZX2A 5BNOC 5C9AB 5JR7B 2XVGA 1C8NA 4LHLA 1ZZBA 1BEV2 1VLNA 4K1YA 3A22A 4IV3A 4Q27A 3K77A 4NIDA 5DAWA 3B9CA 1B35A 1RVF2 1LOAA 3K3NA 1GZWB 5JUVA 3H8RA 2BFUS 2VG9A 4X6QB 5IAVA 5C3PA 3ZIXA 3MW2A 5LWBA 3PVBB 4Z2WA 1WA4A 3AL5A 4CCDA 1BQPA 2RS53 4Q29A 3N9QA 2A3YA 2RE9A 3AFKA 5FP9A 1W6QB 3ZXDA 4K20A 5LW9A 5H9SA 1E5RA 3PDQA 4JQTA 5GLWA 1PK6B 4LUKA 2CV6A 3MI8A 1RUC3 4GA9A 5C3OA 5JSPA 2HWE3 2RR13 3ACIA 2FBEA 2JG9C 1YNAA 1RUH3 4WVWA 4BK5A 4DFSA 4I0WB 5T55A 1JZ6A 2DVDA 3VDDB 4J1XA 5AC92 4PF1A 1EYBA 4FPFA 3AMPA 3M3OA 3ZFFB 4UFLA 1WD3A 1K42A 2YY1A 2A71A 3WHTA 5IYYA 5C9AC 2V73A 4YYOA 1J59A 1NCQB 1ULDA 2HWC3 3QCWA 1AR73 2E7TA 5APAA 2C1FA 2VVFA 3VBOA 3KHBA 4IV1B 5HXMA 1GMMA 1VBE3 4BMEA 1ZNPA 4AAPA 1GWKA 2ZGSA 4PIXA 1KRIA 1PM4A 4AVSA 1CX4A 4GWNA 3L9JT 4AW7A 3GHNA 3OUHA 2R0FA 1DZTA 1PIV3 1COV2 2WLPA 4JGYA 1LB2A 2P34A 3VV1A 3U78A 2H6BA 1BCXA 1UZWA 2ZA9A 3AP4A 2RG4A 2GDFA 4KWUA 4LKDA 2Y64A 1EPWA 2QQJA 1D0GA 4XBQA 4XF4A 4YG6A 1OT5A 5FMBA 3SMHA 3JBG2 2UWAA 5C70A 4DXRA 1R081 1XE0A 1N3PA 4XFBA 4XPVA 4KBZA 4MHRA 4QKNA 5FYHA 1GQPA 3GDBA 3I2JA 3LDBA 5AFBA 1SLIA 5CADA 3WG4A 4I09A 1PGL2 3J7MA 3KV4A 1CQ9A 1QGLA 2I74A 2P6CA 1D0HA 3T3YA 4XFAA 5ACA3 5BYNA 1C8M3 2P3IA 1NZIA 3I8TA 1VRBA 3NNFA 3ZXFA 5FQ0B 1YIPA 1ZBA1 2VCAA 1H0BA 5A7NA 3VZLA 2MPFA 3E5UA 4A42A 2BUKA 3FHAA 2WFPA 4X8PA 1G9BA 2YZ4A 3IIAA 3M3QA 1FPN1 1UKGA 4AGVA 2BBVA 2Z42A 4QD2A 3O7OA 4GALA 1SBEA 4IV3B 4MVTA 3M3IA 4NUBA 2XL7A 1C3HA 1B35B 1DCSA 3AP9A 1H8TA 2Q30A 3IMNA 3F2ZA 1LOFA 3WW1A 2VBBA 5IW0A 1IPJA 1W6NA 1SBFA 2I2SA 4NJ4A 2X5IA 3SKJE 3VKMA 5FPZA 5A7QA 3WNOA 3EJKA 2A3WA 4URAA 5JZGB 2W46A 2R49A 1J58A 1AZDA 1LHNA 4NRQA 4HPKA 3K3OA 5D2AA 4YZ1A 4PLNA 5L9VA 2WQ8A 1US2A 2XHNA 2P4EA 4GMP1 1YUDA 5DUWA 4YM2A 1RYYA 2RMU1 4OI0A 4XETA 2HEVF 2ORXA 1V6NA 4IGOA 2PMWB 2FDIA 1K5MB 4DQAA 1OLMA 4AQ2A 3H1MA 1TG7A 4IV3C 3OGSA 5FOBB 4N43A 4PQQA 4KQ7A 4XJ9A 1YQ6A 2DVBA 2VXJA 2A6YA 2CHHA 2GU9A 3HN1A 1WLWA 4LKSA 4BXFA 3THCA 2WZR1 2UY9A 3TBDA 5F5QA 5FYCA 1U0AA 4BK4A 1QQP1 3Q8CA 4L11A 5CFCC 1IPSA 1HB2A 1TME1 4JGYB 3C7FA 4PI0A 5KBFA 5ABJA 1MEC1 2XVKA 3SH5A 4LEJA 3NAPB 4Y1UA 5LASA 5CYYA 4IEXA 4Z8BA 3FHIB 2WRAA 4K3UA 2PTMA 5FV3A 2HWD3 1O5LA 4DB5A 1K12A 1FMD2 3QACA 2CGNA 3BALA 2GZWA 5FKCA 2YV8A 2WQ4A 5FBJA 2CGPA 4LBNA 4HONA 4NAOA 1ZRRA 1AJKA 1QXRA 4OZOA 2E33A 3NKGA 2KA3A 4P5HA 4UYBA 2Y26A 3VBOC 1IKQA 4AFDA 3PUIA 5EJZB 2ZAHA 1HRI2 5JI9A 2XJTA 4HVRA 3TEYA 1VBC1 1SMVA 3LCPA 2RS51 4ET7A 4P9IA 1Z7S2 3FE5A 2P1BA 2PHDA 2UWBA 1M06G 4LO4B 2PXJA 4LJHA 1H8TB 1UY4A 1ZA4A 5F3GA 5IK4A 4BYYA 1RUC1 1V6IA 2HWE1 2RR11 1S0BA 4QWNA 4CZSA 3NL1A 2X5IB 1RUH1 1VMFA 2Y6JA 3AVRA 5FTTC 4FPJA 5FYUA 1LOCA 2RS33 1RUOA 4IUGA 4IEWA 3O1OA 3JD72 4HPKB 4JZRA 5IK8A 2N7GA 3IPVA 1HXS3 1F31A 2BDRA 2F6BA 2JICA 4JC1A 5A3TA 5CFDC 1AR71 5FZ6A 1A78A 1FOD2 5FZIA 1QOOA 3POYA 3VHPA 4GJZA 1HDKA 5J1XA 4H7LA 3SH4A 3AKSA 3ZO0B 3RZGA 5JIAA 1OI6A 1VBE1 4YW6A 2EXIA 5KHKA 3UKNA 5DABA 1YWKA 2P3KA 5BNQA 1KJLA 2DUQA 2QQUA 2YG0A 5EV7A 4AVVA 2ARAA 4YARA 3POIA 4AWDA 3KV6A 5A6YA 1NA1C 5LY2A 4LKEA 4KWKA 1W0NA 3S6PA 4XHXA 3V0BA 2MEV2 4PF5A 5FFOC 5FZMA 1PMIA 4IEUA 2VGDA 3FHQA 4FOYA 4TLFA 4XBNA 1ZM1A 2OX0A 5EQUA 3LKJA 2ZX0A 2E63A 4UXAA 2YFZA 2PYTA 5GZCA 2H0VA 1ENQA 1IS4A 2BRTA 2P6HA 4K9SA 3TN92 4NN0A 4XW3A 1W9YA 4YWAA 3VGIA 4E4DX 3PUHA 2B42B 2FDHA 4OQ9A 2A7AA 2W94A 3BUCA 1R093 3V56A 5ACA1 2CYFA 4LA3A 3ASIA 1G9DA 3LAGA 1C8M1 1F5JA 1YQ8A 3HQXA 2DDUA 2V09A 1WUVA 1X8MA 1RUD2 2G9GA 2GNTA 3IDBB 4X6RB 4XF1A 3NMBA 4Q4W2 3UJOA 5FP8A 4QHOA 3J7LA 1YCIA 1C5HA 4CP1A 5FK8A 4N43C 4LOTA 1JBCA 1S55A 1ZBE3 2B7YA 2HJIA 5BXXA 5A1FA 5JI7A 1AR82 5LCWL 1SLLA 1T6BX 2YC2A 1LHUA 1S0FA 1OSGA 2ZGOA 3NV1A 3NSTA 1BEV3 1D4VB 4XQDA 3DL3A 3LQCA 4ZS2A 5GLZA 2LS6A 2ZHLA 1FT9A 5ABJC 4GIQA 1TMF2 4N90A 4XOGA 4EWEA 2VZUA 5FZEA 3J8F2 5F3CA 4QDQA 4HFSA 3H1YA 3WZ1A 2D5HA 1F15A 1IOAA 2WSVA 4KU7A 3ZXGA 2YROA 1RC6A 1XU2A 2JD9A 4JVAA 4OVEA 1YJKA 3ZFEA 1G8WA 3A4UA 3OBZA 2QTWB 1W8TA 1H1IA 1ND2B 4AEDA 1KGYA 1JXNA 2WAOA 3IPVB 1XNKA 4XZUG 4MHUA 1OFSA 2QCSB 5FZ4A 2RM23 1ZRDA 5FUNA 3KM5A 4P02B 4LT5A 3B69A 3QBQA 3N9PA 3U0ZA 1VMJA 3WNMA 1SBDA 2JJ6A 3MIEA 2CAVA 4K8RB 4NIAA 3LOBA 4QDRA 4ARYA 1I6XA 1OXCA 1GOGA 2ZHMA 5A80A 3PLQA 4CPBA 5C7GA 2L9LA 2W5FA 2X05A 3CF6E 3KB5A 5DAPA 3M7AA 3ZX7A 1F5FA 2VQAA 1VE0A 2R1DA 4QGLA 5GZDA 1LOEA 3U11A 4BQ2A 4ITCA 4FTEA 4YFZA 1UOFA 2QQIA 2DURA 1SLCA 2HWB2 4E2GA 4LLFA 1CZTA 3VBRA 2RDSA 1ZREA 1COV3 1EUUA 1GP4A 1N1VA 2JG8B 4Q0VA 2PAKA 1UKRA 5FRAA 3TAYA 4DS0A 5K9YA 2GNBA 4UW6A 4Z1VA 5A1AA 1MQTC 3MLKA 1DGRN 1NQDA 4CDWC 4DUWA 1UQXA 3WG2A 1OPOA 2JDAA 2JDZA 2Z2SB 3HNYM 1OMIA 2W47A 1ASJ1 2ARXA 4XJWA 1K45A 1CAXA 4Z07A 5LEKA 4HLTA 3TNQA 4EYUA 3SCGA 5JXGA 5FYVA 1W8NA 2WNUB 5EWSA 2ZMNA 4ZONA 3U1XA 3MZHA 5DDJ2 1R1A2 2XGXA 5FZ0A 5FYTA 3WR0A 2JX9A 5CAZA 4CCLA 4AVAA 3ABZA 3LDRA 5GLTA 2DCJA 3ZFGA 4NHXA 2WZEA 1AYN2 4DO0A 2YBSA 3ILFA 2VZPA 2XLAA 4XJUA 3S7EA 1J84A 3AFGA 3LB9A 2ZGRA 4LO8A 4UAPA 3WY6A 1S0JA 1CVNA 2V72A 3OGJA 3O0XA 3OPWA 1K3IA 2WJSA 4XUTA 2D44A 5JPMB 2A6ZA 2RS31 3KCYA 2HWF2 3OBRA 1QMJA 2CDPA 1NT0A 1LENA 5F8PA 5FZ9A 1CJDA 1XPWA 4C0BA 4C91A 4F3JA 4OHZA 2DF7A 2TBVA 4NIHA 1V6OA 4CDXB 2NYYA 5G04L 1W6MA 1S0CA 2ARBA 2BYVE 5DUVA 1PHMA 1PO11 5FYYA 3ZN5A 4BQ3A 4RL7A 4P14A 5FPAA 3FLTA 3T2PA 1KEXA 3B9IA 3CLPA 4QX1A 4BCUA 2DVFA 1MS1A 3IAPA 2JENA 2QQKA 3VD3A 1HN0A 3DPRA 3WNNA 5F5AA 4M0NA 3EQEA 4IW3A 5CVRA 3U10A 2WS93 1M4WA 3B00A 2WN2A 3MBWA 3WUDA 3SLIA 3WDWA 2W1QA 2I45A 1GSLA 1E5IA 1HQLA 1YLLA 4SBVA 3SCFA 4FPEA 4UI9L 3ETPA 3U4XA 2OXBA 4FPKA 4MSVA 5BY5A 5DAXA 4AVBA 4HSLA 2OS2A 3A7QA 1QXPA 2SBAA 4G3YC 4N53A 2UY8A 5LBBA 2PQSA 5IK7A 1R091 3GM8A 5T3NA 5KWRA 1JYXA 3VBRB 3PHMA 3E5QA 4QQOA 4ZZ5A 2IXLA 4HANA 4JKKA 3ZFEC 2Q5TA 3VZKA 5FZHA 1NAEA 2A75A 4OHWA 4HVOA 4QM8A 3LEGA 3PUSA 4UT5A 3I4IA 4FI9A 5FMCA 4AEDC 5FMDA 1SDWA 5DG1A 1LGBA 1GLHA 3V64A 3KV9A 4B1LA 1CAXB 1W8ZA 3OD0A 4QX2A 1ZBE1 1FMD3 4XACA 3FUOA 4XHBA 4IETA 2W87A 4CU7A 4AG4A 2VC9A 1H4GA 4OQ8A 1BEV1 1NLRA 4IEVA 4RFT0 4ATFA 4OUMA 5D1IA 4UBGA 3BOWA 3ZFGB 4IESA 3QLQA 5F37A 1HRI3 4I3PA 2R062 1YXWA 2QQVA 3NWKA 1NXMA 2VAUA 1EUTA 1GV9A 3ZM8A 4LBOA 3H42B 1Z7S3 4PI2A 5FYIA 3N9NA 2WNVB 4DEVA 2ADDA 3ZXJA 4IGQA 5FY0A 1UZ0A 5A70A 3RZLA 1DBNA 3MUZ1 2CY6A 1O3TA 2VOWA 2BEOA 2ZCWA 1ONAA 5F3IA 1RUNA 3AMQA 4QPWA 4U36A 2XKOA 4FVVA 4OZXA 3D8CA 1W03A 1W6MB 3RSJA 2RM21 5G05L 1UD1A 1JUHA 3BGAA 3JD73 5HI0A 4N9IA 4O61A 1D7PM 1G7YA 3BU7A 2HYKA 2IVJA 4LR4A 3RGBA 4AR2A 2ILMA 4H2AA 2WINB 3T4VA 2AR6A 1RUE3 4Q4V2 3DPRB 3ZFGC 4D7YA 3JQXA 3J7HA 5FY8A 1SFNA 5A6ZA 5D8AA 3O1SA 1LESA 4IE0A 1HQWA 2RJLA 4A2UA 1S4CA 2D5FA 5TSWA 5A3NA 2ZS6B 3JB8A 1OURA 2C5DA 4XURA 5FY5A 1YEWA 1H1AA 2YXSA 1HQNA 2ZGKA 2VOTA 4BA6A 5A32B 4WM8B 4CE8A 2P37A 4OUSA 4COYA 1UY3A 1COV1 2CNAA 2CTVA 2OZJA 2BU9A 3VKNA 1F8VA 3DGTA 3T30A 5C3SA 1LU1A 1W8FA 2ZACA 4ARXA 2OW4A 1IHMA 1CONA 2VR4A 1GWMA 2ZGMA 4KU8A 4RR3A 5E89A 3J26N 1XNAA 4AI2A 1L7LA 3HD8B 5K0UA 2WABA 4RFRB 3D5OA 3KSCA 4MOAA 4NPMA 5I8SA 1VPHA 4YVWB 1ULCA 2NP0A 2YBPA 1IGOA 1PGL1 1PVC3 4YPJA 5IFPA 2LM3A 5DZGA 4IL7A 2QVSB 4AI0A 4AQTA 1PZ9A 3Q8BA 4FXGB 4W4ZA 2VUCA 4DXSA 3LEKA 2XVLA 3AVSA 1F9KA 3OSDA 4EWDA 3B01A 2H6CA 5FJHA 4FTBA 2Z5WA 4OYUA 2D40A 2XB6C 1JTZX 1XE8A 5J7MA 3WF2A 1RMU2 3POJA 1QNYA 4A6SA 4J1WA 1A8DA 2ENRA 5CISA 1QDOA 3RMYA 1C28A 1V9U2 4N7IA 2Y6HA 3UJQA 4XTMA 1MS0A 1AR83 3PU3A 4A41A 4BH9A 1UY0A 3HVDA 2FDFA 1F2NA 3PVNA 4JDOA 4N53C 2GC3A 3POEA 5FOJB 1ALYA 3VDCA 3ZSMA 1QOSA 3ZMOA 3JB4C 2R30A 5LZ6A 3LE0A 1PZ8A 2XQXA 1AF9A 5IJRA 1TMF3 3CIHA 3DEMA 5H9RA 1K5JA 3WW2A 1EPZA 1JW6A 2PHWA 5CEHA 2XXZA 2NM1A 1G9AA 4W6XA 1GYKA 1WKYA 1GZCA 3R4DB 1W0OA 5AVPA 4GKYA 2IFWA 4DNYA 1FPN3 2QZ2A 2WS91 4LBKA 4CUGA 4EJRA 4CCNA 1G6NA 3OJBA 3PL0A 3WP5A 1GNYA 1FXZA 3A0KA 2B4KA 3PNAA 1NUKA 1YRZA 2Y0IA 3I3EA 3OBTA 5H9QA 2HLEA 2VZOA 2JDNA 4YZ2A 4AZZA 2F4PA 3VBUC 3N9OA 1BBT2 1X7NA 5FPLA 3UETA 3ZN4A 4P00B 3ZSKA 3MPBA 1GU3A 3VDDA 2EIDA 2RHPA 5CIRA 5KHJA 2C9KA 3ZFFA 1QU0A 2BBAA 2YU1A 2ZXQA 3WF3A 2JKXA 3HPNA 4K7JA 1NCQA 1LHVA 1BLZA 3GJBA 4GMP3 1O4TA 1S0IA 4MV2A 4NHLA 3POGA 1MPXA 1DYKA 2RMU3 1UYPA 4Y26A 5LK7B 1H4HA 1Q8SA 1QNWA 2BTVC 2I07B 2R16A 1H30A 5LBFA 5K0UB 2E53A 2PHFA 4BXSV 4YGCA 3DUIA 4CDUC 3IDAA 1Q8OA 4HN1A 3KGLA 1FMD1 5CB7A 2VTXJ 2XBO2 4R9BA 1PMJX 5IFTA 2AYHA 3E6CC 1Q3EA 1AVBA 1KS5A 2IFRA 3VD5A 5FYMA 2J22A 1W28A 2E51A 1NCRB 5EXOA 2R0HA 3EB7A 2ZTNA 3MFCA 3DV8A 2WZR3 1V6JA 4YW4A 4BQ5A 4QT6A 5D8AC 3S57A 3KF5A 1YHFA 5JR2A 1LGCA 1HRI1 5LRRA 5FAXA 3IBMA 1IKPA 3W5MA 5DDJ3 4FAHA 1DQ1A 1KS4A 2VZ3A 3WSOA 3M3CA 2QQNA 1Z7S1 4R9DA 1LU2A 4DIQA 2Y38A 1QH6A 1SQ4A 4RQPB 3FLPA 3H3ZA 4XE9A 4HG6B 2KR2A 1TEIA 1WW5A 1L3JA 4QKDA 5FQ0A 2RJKA 4RR3C 2RVAA 2DVAA 4IEPA 5GKAC 2B39A 3N7KA 2XH6A 3ACHA 4JTOA 1QJU2 2JD4A 4UWDA 2XUMA 1B09A 3G7DA 3P3PA 1AYM2 5F32A 4CEWC 4BQWA 3A0NA 2HWF3 3AKQA 2A5ZA 3JD71 2YMZA 1GNHA 3M8LA 2K0GA 2VO5A 2WC2A 2MHFA 3RFRA 3VB9A 1Y7BA 4XQWA 5FDBA 4HETA 5I91A 1RUE1 3CZUA 5K8SA 3N4MA 2VU9A 4OHVA 3ZXEA 5FY1A 4XCAA 1VBC3 3I2GA 2FMDA 1L7QA 3HIFA 1ZYBA 3OGGA 3SCHA 5A3WA 5GALA 2XLGA 1HN1A 3THPA 1DQ4A 1NLQA 3MIHA 2VMGA 4ZY9A 5T50A 5JZGA 2J1VA 1UOBA 1TNFA 5FZDA 3ZR6A 2P17A 1UYZA 3RPQA 4NWWA 4J6GA 4M4RA 4O7XA 4CU9A 1X8EA 5BNPB 1GQHA 1RGSA 3CQOA 1PNFA 3P6BA 4Q4X2 4XIOA 3C7GA 1QY4A 5IHRA 1XRUA 1BZWA 5CG9A 3CU7A 4QX5A 1K5MA 3S7IA 3LPGA 3USSA 4KNCA 2QBXA 4IGPA 4DZGA 1PVC1 1AL22 3ZPOA 2HEYF 2WT1A 1KFXL 2JEMA 3EYPA 4M3CB 3VBSA 1RUD1 3A23A 1UL9A 5KHGA 2IVIB 3ZYRA 4CCEA 2HBTA 2WO2A 1QWRA 4JGZB 4PT6A 2WWJA 4Q4W1 1EAH2 2JKBA 4LXLA 3I2KA 3HN3A 3WG1A 1JHJA 1LODA 2WT2A 3CBNA 4RGAA 1PK6C 5ERLA 5FZ7A 2ZAAA 3ZOIA 2A1XA 4YVSB 3NAPA 3CL1A 1AR81 2V4AA 1PX4A 4RYDA 5HV4A 2QQPA 1UMHA 4H14A 1ZZ6A 4AK3A 4B4RA 3VDDC 2C26A 4BQ1A 4Y1YA 3D0JA 1QJX2 2K2SA 5EHDA 3ZFFC 1NOVA 4IEZA 4E4ZA 2C6SA 4NIGA 1TNRA 3ZYBA 1NCQC 2LTNA 1WLTA 4QX0A 4N7UA 3UGFA 3AKPA 4GB33 1TMF1 2WAAA 1W8UA 1NXD1 3PMEA 2W9XA 3ILRA 1T2XA 5FLIA 1JU4A 3MPPG 3J8F1 3OOXA 4IV1C 1FATA 1UNBA 1VBB2 5EFUA 2W91A 5DUUA 2E7QA 3IZOA 1NY72 1ZZ8A 1Q8VA 4P5YA 4ZS3A 1LNSA 2VMDA 2VZ1A 4YNIA 1W04A 3KLSA 1JZ3A 2RS12 4KWLA 1HB4A 2FZ1A 4I2OA 3R05A 4I0BA 1C4RA 4CCJA 4CUBA 3BTZA 2OQ6A 1N1YA 2QQWA 2WZPP 4K1ZA 1S1AA 4EQVA 3NJZA 2ZEYA 5J96B 2WKKA 4QQLA 1Q56A 2WSUA 2LUWA 1YJLA 1UOJA 2X8KA 1DF0A 4MUVA 2K9ZA 3KT1A 2ZEXA 1LECA 5FREA 1L7RA 3AP5A 3M1HA 2HWB1 1HLCA 1POV0 4AFMA 1W90A 3V0AB 3O1TA 3UNPA 1BXHA 3I2IA 3CHXA 3CEWA 3VHOA 5FZOB 1UO9A 3I59B 2BOIA 2BPA2 1WLDA 1NQJA 2VPVA 1V70A 4YZ5A 1RUI2 2CWMA 3HJRA 4FPCA 1FI2A 5C6CA 1V0AA 5JMOA 2W0XA 1B35C 4Q0SA 2R042 4XFFA 3T0DA 1CIWA 2VD7A 3C2UA 3VBSB 2DU0A 3AKTA 5C8CA 2Q1FA 4FSJA 3WNKA 2P2KA 3I54A 5A7WA 3DXTA 3LOIA 4XJAA 5IVJA 3T09A 2RJ2A 5A3LA 3D82A 5JZGC 3ETQA 2PQQA 5DDJ1 3ACFA 1R1A1 4Y5TA 2Q8CA 4CCCA 4EN9B 2XDVA 1ZA7A 1C5IA 3AYAA 3MFAA 3ZSEA 1UZZA 1H2KA 4ZZ8A 4XFGA 3BN6A 3D3AA 4ZU5A 1AYN1 5BV6A 4QHBA 3ZYFA 1RMU3 3AP7A 4OFGA 5BPXA 4CP9B 3WP4A 4FPGA 2VNVA 4PBOA 1K5MC 1IG0A 4KMQA 1ZRIA 2JE8A 5GZGA 2XLFA 2HWF1 3A21A 5L7OB 1ASJ3 4CU8A 1JYVA 4AEJA 1OH4A 3AKRA 2ZMKA 4XFIA 1POQA 5CNAA 2ARCA 1W9FA 4AL9A 1WBFA 4XFCA 2GN3A 1O6UA 4AI8A 3ZDSA 4D6SA 4E4HA 2GN7A 4WVMB 1LCLA 5FUIA 2Q4SA 4LIVA 1Y3TA 4K21A 2C4XA 1Z78A 3OGVA 1OOPA 3SEEA 4JGYC 2JECA 3NV3A 3T4HB 4IQPA 2DUPA 1QKQA 3LIGA 4FP3A 3KV5A 3NAPC 4AI9A 1OF4A 3KT4A 1ZRCA 1OA4A 2FMYA 3KCXA 4NHYA 3CJXA 1LULA 1OQEA 3AX4A 5EPAA 3TEWA 1BK1A 3T2TA 4LO7A 4Q0QA 4HSJA 4OI1A 4Q4Y2 1HRV2 3TOJA 1YC61 2O8OA 1LHOA 3GNEA 1ND2A 3OPTA 2QDNA 5JSOA 4QHZA 1VBA2 5FZBA 1AR62 4AI1A 1AHSA 1VB4A 4RS5A 4XCBA 5CA6A 3O1UA 4J25A 1ENSA 4PJYA 3PMSA 1FAYA 1PO13 2GP3A 4RSUA 4A45A 4YGDA 4CYDA 1VIWB 2VUJA 4EN0A 3H0OA 3OG2A 3KQRA 2OQ7A 3RZHA 1SDDB 3WHUA 2F4LA 2Z79A 2B46X 3WW4A 3ON7A 1G9CA 1YI9A 1WMXA 4GH4B 4ZXKA 4DXTA 4QU1A 1UY1A 4OMCA 4AFAA 1FV3A 3SKVA 4GWIA 1H8TC 3OF1A 1LOFC 4NHKA 5C8CB 2XBO3 1WW4A 3LWCA 2VQUA 4CA9A 2X5IC 5FP3A 5DAQA 4BISA 1DLLA 5A7WB 1WCSA 4Q0PA 4JDNA 2JG8A 2VCCA 4UFIA 1H2NA 1HW5A 4C90A 3B94A 1DP0A 2R072 2XOMA 1C1FA 5F5IA 3KGZA 2GC0A 1CD3G 3VL8A 4PDWA 4GB31 5I0SA 2R061 4ZHNA 5CG8A 2ZGUA 1R1ZA 3KS7A 2WNOA 4LHSA 1PGSA 1I5PA 4PIYA 1W3XA 1W6OA 3EMRA 1ST8A 4LHNA 4PHZA 2WNUA 5GLUA 1H6YA 1UU4A 2ZGPA 3OPZA 1CAVB 2WFF2 2KXLA 3THTA 1RUG2 4DXZA 3WF4A 1ULGA 3GBWA 2JB4A 3HBZA 5A3UA 1AYM3 5EZWA 3SQOA 5C8CC 3KCCA 5LA9A 5T5PA 1S0EA 3OD4A 2SLIA 5JXHA 1OOPB 3H8UA 1RVF3 4Y1XA 4A44A 1BK0A 5IVFA 1IG3A 4KGQA 4PLOA 4AGGA 2YFUA 1V6LA 1LGNA 1FV2A 4IE7A 2ZKLA 4OCTA 3RWKX 1XNTA 1XXNA 3IDCB 4CTEA 2FCTA 4MO3M 4AQ6A 4XVHA 1WD4A 3WP6A 1OKQA 4CDXA 5J09A 4RHV2 4CCOA 4Y33A 4JQRA 5FY9A 4ATEA 1VALA 4NMIA 1LTEA 2Z4FA 5FYZA 4P9GA 5FP7A 4C1WA 1LOGA 4CCKA 5JPNB 2VJXA 1PGW2 3VD4A 2CU5A 4CEYA 4Q4X3 4R9AA 1IS5A 4RS5B 3O0VA 5AC93 4P9XA 2IZWA 5KHIA 1VBD2 4H55A 4JTNA 5LA0A 4KBBA 4I3GA 2D6PA 3INAA 4YW1A 2VOXA 1ULFA 1ZBA2 1LOBA 3HNBM 1RUF2 2WWSA 1JOBA 3C8XA 4OUEA 3WINE 5GJ6A 4NAMA 3QH6A 4HMZA 3VZOA 2FD8A 2EIGA 4GAZA 3POWA 5D21A 5FLHA 4FPOB 3VLBB 2EALA 2VQ0A 2EF6A 1EAH3 3P5BA 3DYOA 1RMU1 4A3XA 3LDKA 2W68A 1ULPA 1SCRA 4M01A 5HCAA 5IVVA 2Q8DA 1V9U1 5C8WA 4MGTA 2VULA 3HBKA 4XJZA 4QDSA 1DQ5A 1ND2C 1H2LA 2ATFA 3JBG3 5JLVA 1F4HA 5FMOL 1ND3B 4PDWB 1UXZA 3NV2A 3OCPA 3LFIA 1QJX3 4XZPA 2Y34A 3R4SA 2ID4A 4HN0A 2P3JA 1W6OB 1A34A 1BVVA 4LO6B 2UYBA 2XJRA 2EAKA 4URTA 4F8AA 1FX5A 2Q8OA 4BE3A 4AAXA 1DDLA 1XB9A 2ZEWA 4FFIA 3UGHA 4BQXA 5JSRA 2DCZA 3ME2A 3TB0A 3UT0A 1UPSA 4L2NA 4M00A 3RZZA 1ENXA 1DQ0A 3AZXA 3NNGA 1OFNA 4W8JA 5FZ3A 4JRLA 4BU2A 4RD7A 2OUHA 5B4NA 4META 5CBLA 1HKDA 2W39A 4HK8A 3RZJA 4BLJA 3FFQA 1MZ5A 4V2VA 3ZXKA 2JG8C 3O5SA 4QPGB 4B1MA 4YW5A 4LBQA 2RS13 1W8HA 2JDPA 2WNVA 2J1TA 2OPKA 1H8VA 2VZRA 2ZX1A 4P9JA 5HCFA 1GANA 3ATGA 2PHXA 1A6CA 3OBAA 5FJKA 4LBLA 4BLIA 1DYOA 3AJZA 1MEC2 3TEXA 2WNUC 4A4AA 2JIJA 4LBJA 4PCRA 4CDQA 3GJAA 2CDOA 3WDUA 4CEYB 4XC9A 4IEQA 1U12A 4HKLA 4DRVA 4GQ7A 1W0PA 2JWPA 4Y1VA 4B29A 4BB3A 2JE7A 3IDEA 2XBO1 1RUI3 1QEXA 2DU1A 2ZHNA 3V65A 1JH5A 2JDKA 4AFBA 4WM8A 5A32A 2J1RA 2VY0A 4QB6A 4DRRA 3KD4A 1A3KA 5L73A 3AZWA 2RS52 1YFUA 2ES3A 1U5ZA 4MGSA 3UKVA 2W1SA 2Y0OA 3M4FA 3ZSLA 1MZ6A 4LBMA 4CDXC 4FFFA 3FLRA 1OQDA 4EE2A 1JOPA 2E32A 4UF0B 2DFCA 4YVWA 1JODA 1NG0A 3MEPA 1LR5A 1LKNA 2JDMA 1GBGA 1NE4A 3RI8A 2IC1A 1SACA 3JXSA 3MHZA 5F6LB 4QXCA 4WBBA 3T2QA 2JIGA 2WT0A 4GZ9A 4E2SA 1AXYA 3E97A 4K8FA 3THDA 1PNGA 1HV0A 2PHLA 3N9LA 3I3QA 4YW2A 1YFXA 1US3A 1QJU1 2AREA 5E1RA 1CPNA 3RRDA 2OYZA 1EP0A 2BW8A 3UKTA 1AYM1 2HWC2 2ETEA 3MW4A 4D8MA 2YYOA 5FLJA 1QJY2 1JYNA 3R6SA 2BGCA 3KVBA 1UCXA 4E4SA 1RIRA 1AXZA 5FZGA 1AR92 1O59A 3I2FA 2HKXA 4QAWA 3H8OA 1RVF1 5FXZA 5IUQA 4MGYE 2JB8A 1T6GC 4H3WA 4L8QA 3ZKYA 5C4WB 1UXXX 4Q8KA 4DMIA 2WYSA 3VBRC 1V6MA 1PIV2 2AC1A 2XL9A 3H7YA 2FQPA 3E1F1 5FWEA 4C0HA 1O7FA 2VXRA 3LFMA 3PUQA 4LBQB 4QQHA 3PVOA 4LO5B 1WWYA 1CAWA 5ANNA 1YYNA 4QPIB 4E8CA 2VVEA 1CAUA 2XQRA 4WM7A 1PZ7A 3UGGA 4E2QA 4Q4X1 3SEPA 1YFYA 2OT7A 5AC91 1Q8QA 3FC0A 4XAAA 1HRV3 2AH2A 4AOCA 3GZUC 1C8M2 1LJ7A 1VBA3 4OI2A 3ES4A 1I9RA 1NZCA 5FPVA 1URXA 3ZYGA 1AL21 4A3ZA 4BJ0A 3BVCA 4CDQB 5FO7B 4Z92B 2VECA 1FOD3 2VMFA 5IATA 4F83A 4S2HA 1OLQA 3E6BA 2VQTA 4MXWB 1WBLA 2BJSA 1ZZ9A 3GZAA 5M0TA 1UMZA 3AYEA 5KR7A 3AYDA 4HL0A 4ZU7A 1EAH1 4QB1A 1KFUL 5I93A 2VTFA 2WNVC 1D4M2 4YZ4A 2MEV3 3K4AA 1ACCA 1OHFA 4Y5Z0 2JXAA 2VZTA 3K48A 2ZZQA 1MS4A 1F4AA 3ALQA 3JBG1 1Q43A 5DG2A 3D4KA 4LNVA 2IXIA 4L99A 1X50A 4JHZA 3TN93 3B93A 4CPBD 3S5AA 1QJX1 1JHNA 3BPSA 3MF9A 4COUA 2E6VA 4RGKA 3ZYPA 1OC1A 2R073 3DYPA 3BYWA 4GULA 4DY5A 3I3MA 3PTYA 4R52A 1OVSA 3WCSA 4OMDA 1I3HA 1BHGA 5FZ1A 4V2WA 3FMGA 5FZ8A 2VMHA 3MYXA 1NCRA 3PIJA 5E88A 3C3VA 4Q26A 3DPRC 5EJ3A 1RUD3 4Q1RA 1OPMA 2QE3A 3C7OA 4B4PA 4ES8A 5E6HA 2BGPA 1WCKA 4RGGA 1VBB1 5A33B 1D2QA 4Q4W3 3NKTA 3UESA 4EV0A 1NY71 4ZXEA 4Y22A 1WCUA 1RUG3 3WF1A 2ADEA 2XJSA 4FO9A 4WM8C 2ZGQA 5BNNB 1JUIA 2XWJB 1VRH2 4RQPA 4MGZE 2RS11 5KXDA 5LBCA 4QX8A 2WA4A 3ZPYA 4ZKTB 2NQYA 2WLQA 5JOXA 1TQ5A 2OIIA 3VBHB 3K2OA 4QXBA 2GMEA 1JYWA 1J3RA 4YVWC 1RJ8A 3WF0A 3TEZA 1RB8G 1DIWA 1TE1B 2XG3A 2UYAA 3IM0A 4JRAA 4QXKA 2YGMA 5HXVA 1CAWB 3VN4A 3WDYA 4QXHA 2BP6A 1CAUB 1YO8A 4P08A 3RS6A 4C1XA 3J8F3 1IS6A 4AHXA 1ENRA 4WM7B 3TYJA 3WEZA 2HWD2 2BVBA 4RHV3 1S2KA 1JZ7A 3KT7A 2WYFA 1XYPA 1WCDJ 2EA7A 3O1RA 2KM2A 4IE4A 3OUJA 2D6MA 2XUEA 1W8WA 1RUI1 2JDHA 3WD5A 4FAGA 1VBD3 1S0DA 3K4ZA 2R041 2X09A 4XIKA 2BWAA 5E16A 1Z0HA 2GNMA 3RNSA 4AXOA 4KGGA 3H3LA 5FPUA 2E26A 1X33A 3CZJA 4ISRA 4XQ4A 5FO9B 3W5NA 1SLBA 5GZEA 3FWEA 4D7TA 5FK7A 4PLMA 1JZ2A 1LHWA 4XABA 2LROA 5K4LA 3VHRA 4CRQA 5FR3A 1VJ2A 3PJQA 2Q8EA 1HB1A 2IXJA 1UMIA 1ODNA 2DCYA 2QDRA 2W1WA 5JXJA 2HWB3 2AENA 2ZX3A 4LKFA 3S30A 3UL2A 2D3RA 2XWBB 3AZVA 3CJIB 3PTRB 1GKBA 3ZXAC 4M3CA 4ES9A 3KMHA 1O4YA 2DVGA 5KHHA 1DFQA 1REFA 5DZEA 3OYWB 2AACA 1NLSA 3K4DA 3KQ4B 1GNZA 1HXS2 3MUY1 4JGZA 4E8DA 4Y1ZA 1GZ9A 4LULA 4YGBA 2D6OX 4QKFA 3P1IA 1H9PA 3AC0A 4YVSA 4XF3A 3ZYHA 1CGPA 5DXDA 1WA6X 1VR3A 1MS9A 2WR9A 3K46A 3U37A 4UOJA 5LATA 2OA2A 2G19A 4G9SB 4XDOA 3RZKA 1WLCA 1R1A3 1JZ4A 1SEFA 4Y22B 5CU1A 2D6NA 3DCQA 3UV9A 3WP3A 5KC6A 4PIZA 3ES1A 3W21A 3ZYJB 2GC2A 3I7DA 1AYN3 5KXBA 5BNOB 1FYUA 4RA0A 3PJYA 4UW3A 2X10A 4BIOA 4CP2A 2R6QA 1CWPA 5LA1A 3CKHA 4P9WA 3ECQA 5SV5A 5IAXA 2Q1ZB 4MGIE 4OI4A 5DAVA 5K0UC 3D0SA 4BQYA 1EV12 4TZDA 4FCAA 3PU8A 4D0QA 2V4VA 2ZHKA 2H0BA 2AEYA 5CZKA 5A6QA 4Q4Y1 1HRV1 3ZR5A 4MGQA 4XDPA 2XKPA 5JMCA 2XPJA 3J4UH 1VBA1 5IVEA 2XHKA 3CO2A 1OD3A 1KDMA 1NCRC 5J3UA 1MR5A 4XBLA
chains in the Genus database with same CATH topology
1PM4A 1POQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PM4 A;  1POQ A; 
#chains in the Genus database with same CATH topology
 1YQ2 A;  4TXW A;  2BNO A;  4MXV A;  4CP0 A;  1FOD 1;  4Y4R A;  2XJP A;  1WW6 A;  2EXK A;  5FWJ A;  1CN1 A;  3WX5 A;  4XF9 A;  4AVC A;  2JG9 B;  3ROU A;  1TZO A;  5A3P A;  1FNZ A;  1E57 A;  1EY2 A;  1Y9Q A;  3FZ3 A;  3N7L A;  5FY4 A;  5HBA A;  3B5L B;  1DGL A;  5FZK A;  1DGW X;  1IQD C;  4X8N A;  3GHM A;  4RQP C;  2GMP A;  3Q8E A;  4IE6 A;  1ZRF A;  2VM9 A;  4FP2 A;  2MEV 1;  1W8O A;  4LMF A;  2G9Z A;  3V0A A;  3POB A;  5JOY A;  3RJ2 X;  1VAK A;  4HXC A;  1ULE A;  5FZO A;  3I59 A;  3WCR A;  4BIF A;  3TN9 1;  3WDT A;  4ZPI A;  1O91 A;  5FUP A;  2VZS A;  1N3Q A;  4AEM A;  4W6Y A;  1U5X A;  4DUX A;  2R07 1;  2GP5 A;  2G1M A;  1IS3 A;  1RJ7 A;  3B3Q E;  1SPP B;  3HNM A;  5LY1 A;  3MV1 1;  4GWJ A;  5CFC A;  3I97 A;  1W05 A;  1IPK A;  2R1B A;  2W08 A;  2YDE A;  4OHX A;  1OQ1 A;  2NLR A;  2DFB A;  2WO3 A;  2E7A A;  4B7K A;  4Y4Y A;  4LA2 A;  1CX1 A;  1IQA A;  2D6K A;  3CDZ B;  3IT8 A;  4YRD A;  2WFF 1;  3ILN A;  4JCK A;  4M4P A;  2ZOE B;  1RUG 1;  3OY8 A;  3OUI A;  4O9G A;  1CR7 A;  2RM2 2;  4BZ4 A;  3ST7 A;  1DZR A;  3LSD A;  4IER A;  5FYB A;  3I3B A;  4KG0 A;  5CKN A;  1H6X A;  4LK7 A;  5A3O A;  5IVY A;  4COZ A;  1GZT A;  5C3Q A;  1BMV 2;  1QJY 3;  2J1E A;  2OZ6 A;  3GCW A;  4CP9 A;  3CNA A;  1AR9 3;  4BHP A;  5AVA A;  5JVV A;  1J3Q A;  4DPN A;  4HBN A;  4WV8 A;  5JOW A;  5F39 A;  1DZQ A;  3LEI A;  2YB7 A;  1W39 A;  3EXU A;  5F2S A;  5L19 A;  5L7O A;  2R06 3;  1U5Y A;  3JZV A;  5IVB A;  4LK6 A;  2WN3 A;  3PUR A;  2VL4 A;  2YC4 A;  4OUL A;  5F3E A;  4Z2A A;  1UYY A;  1XJA A;  2AGS A;  2J1A A;  4BQ4 A;  1DGW A;  1LEM A;  4RHV 1;  1JZ8 A;  2B45 X;  4Q2F A;  1MVQ A;  4WVM A;  2AZ5 A;  3GBG A;  4QMA A;  1YQ5 A;  2LAL A;  4I02 A;  4R4X A;  2ZBJ A;  4JGZ C;  4K40 A;  2W52 A;  5F9T A;  3JUU A;  4DUV A;  3N7M A;  2A6W A;  4B7E A;  3VD9 A;  1PGW 1;  5JCT A;  4Q5O A;  1PO2 2;  4L97 A;  4LE4 A;  3BOD A;  3EHK A;  4QGM A;  4YVS C;  1VBD 1;  1H2M A;  5FO8 B;  3M2M A;  4AEK A;  3GGL A;  2VNG A;  4Q8L A;  3SXW A;  2WNE A;  5JOZ A;  1MAC A;  3O1P A;  1MS3 A;  3KWV A;  3NVC A;  1O3Q A;  1PM7 A;  2WL1 A;  5CFD A;  4Y24 A;  3BB6 A;  1UPI A;  2BVV A;  5I8Y A;  5FY7 A;  1RUF 1;  2DCT A;  4Q4V 3;  3VHN A;  3BPZ A;  1AX0 A;  4ASM B;  1AX1 A;  1N3O A;  4ERO A;  1UAI A;  1MS5 A;  1O4Z A;  5E8A A;  3NJX A;  3H9A A;  4ISQ A;  3U14 A;  2OVU A;  4TTG A;  3GZT B;  4D7S A;  4IE5 A;  5FCC A;  1WW7 A;  2FDK A;  3DEC A;  4MGK E;  1GOH A;  4NPL A;  5EJ1 B;  2DWR A;  1NA1 A;  3RQ0 A;  3FBM A;  1SLA A;  4JDM A;  2J42 A;  4NE9 A;  1D4M 3;  3WDX A;  3PVE A;  3H7J A;  4LOS A;  4AF9 A;  5IT6 A;  2BOJ A;  3BOP A;  2ZZJ A;  2D97 A;  4GH4 A;  4MH0 E;  5T5J A;  2WDB A;  4COV A;  2D98 A;  3LA7 A;  3VZM A;  3BTY A;  1RHI 2;  2O14 A;  1QHD A;  3RMX A;  3T1L A;  3MIG A;  4QQ2 A;  4U2A A;  3VKO A;  5CFC B;  5FPX A;  3BTX A;  2CGO A;  4Y20 A;  2VNO A;  5DZF A;  1RUJ 2;  4FOV A;  5GZF A;  4GXL A;  4KL1 A;  4QX3 A;  5LA2 A;  5GM0 A;  3T2O A;  5LRS A;  2PN5 A;  3WG3 A;  2D3P A;  3HQR A;  2D6L X;  2ET7 A;  5A6X A;  1OBN A;  2HH9 A;  3OY8 B;  5DQ0 A;  3RYR A;  4EZ4 A;  1APN A;  2WS9 2;  3DXU A;  1UZY A;  5C5U A;  4ORF A;  2GH8 A;  2IXK A;  1XSQ A;  3WNL A;  3ZN6 A;  2NPI A;  3AZY A;  3KHC A;  4CXY A;  3LSE A;  4O9E A;  3GXU A;  1UZV A;  3VBO B;  2YC0 A;  2ZAB A;  1V9U 3;  1VRH 3;  5F1R A;  3MDP A;  5J98 B;  3SHR A;  2F17 A;  2YBK A;  4XYX A;  2P3Y A;  4CU6 A;  1CAV A;  4W50 A;  1JS9 A;  1J1T A;  4N8M A;  4AYU A;  5BUV A;  4FFG A;  2ZML A;  4UFK A;  1OF3 A;  3AP6 A;  3WVJ A;  4UFM A;  3VBS C;  1DQ2 A;  1O8S A;  2NMN A;  4WZC A;  3ZLI A;  1JZ5 A;  3ACG A;  4NVP A;  4BMB A;  4UBH A;  2BFU L;  1GOF A;  2AUY A;  4BWO A;  1UY2 A;  1Y43 B;  3PUA A;  5JXI A;  1VAM A;  1LAJ A;  2FHR A;  3KVA A;  1PMH X;  5AFE A;  2YUE A;  2QJV A;  4IDZ A;  4RN5 A;  5FMO S;  5FXV A;  1KD7 A;  4CSW A;  3N3H A;  1P8J A;  1XNB A;  3OTF A;  4S2D A;  1JU3 A;  3C7H A;  3LEM A;  3M3E A;  5IVC A;  4HT1 T;  2PHR A;  2YHJ A;  4L92 A;  4Y3O A;  5CFD B;  1WCQ A;  4P9Y A;  3Q9O A;  4IND A;  1GUI A;  5FZA A;  3QH7 A;  4XFH A;  5HPO A;  5KXC A;  3O1V A;  1QH7 A;  1HJG A;  4YG0 A;  5FPB A;  2GC1 A;  2IWG B;  3RYK A;  4NWV A;  4TWT A;  3BIE A;  2XJV A;  1ULO A;  2PLV 2;  5L7O C;  1BBT 3;  3EO6 A;  5C33 A;  5L36 A;  2ZX4 A;  3ZSJ A;  5SV8 A;  4NRP A;  2Y6G A;  2EXH A;  1GIC A;  1C57 A;  1NA1 B;  4GJY A;  3WXP A;  4FOQ A;  1SG3 A;  3J7N A;  2TUN A;  5L9B A;  1W6N B;  3BIW E;  2UUR A;  1REE A;  4AHY A;  4K6B A;  1UN1 A;  3VD7 A;  2AEZ A;  3E6D A;  3WV6 A;  4CUA A;  2ERF A;  2UWC A;  4XXA A;  4D6R A;  1MQT A;  1RTV A;  3HWJ A;  1RIT A;  4CDW A;  2DYC A;  1J83 A;  1ZZ7 A;  2JDY A;  4Y20 B;  2FZ2 A;  1NKG A;  3WNP A;  4YZ3 A;  3W20 A;  2HWC 1;  4BOW A;  2B5H A;  4B4Q A;  3P3N A;  1RUE 2;  5F5C A;  1QJY 1;  3KZ4 C;  2BER A;  1S0G A;  5F2W A;  1AR9 1;  5DUX A;  2A6X A;  3U4S A;  3ZMN A;  1UU5 A;  2W3J A;  1O5U A;  2D93 A;  2WZ8 A;  3MLJ A;  1CIY A;  1ND3 A;  3ZN6 B;  4UFH A;  4LPL A;  2ZKN A;  1PVX A;  5FZL A;  1QDC A;  4N43 B;  1YI7 A;  1CPM A;  1PIV 1;  3HT2 A;  3ORJ A;  4FQ4 A;  4XIL A;  2IXH A;  3I2D A;  1LRH A;  2J1S A;  1BYH A;  2QNK A;  2O8Q A;  1YFW A;  3RJR A;  3RDI A;  3FBY A;  4GH4 C;  1UWW A;  1S2E A;  3WUC A;  2EIE A;  5FKB A;  1QJU 3;  1GP6 A;  5BNP A;  2EAA A;  1EV1 3;  2YPJ A;  3LF7 A;  5I0U A;  1QXJ A;  5ABJ B;  2MNG A;  3K51 A;  2VW0 A;  2GH2 A;  1PVC 2;  2QQO A;  3AXD A;  1GP5 A;  3WLU A;  3MLL A;  4BM8 A;  2UU8 A;  4AVT A;  3T08 A;  1KJR A;  1BVP 1;  1X9T A;  4LLO A;  5FXW A;  3U07 A;  4QPG A;  5FXX A;  3NV4 A;  2Y6K A;  3III A;  4EN7 B;  1E5H A;  4EN8 B;  4Q4V 1;  3HR9 A;  5JWP A;  2R7E B;  1GFF 2;  3MV0 1;  2RDQ A;  3GF6 A;  1QJF A;  4XEZ A;  3MIB A;  3WOG A;  1UOG A;  2QKD A;  2RV9 A;  2VNR A;  4OHY A;  3J9S A;  4YW3 A;  4XUN A;  2TEP A;  2XJU A;  3NO8 A;  4Q1P A;  5J36 A;  5FZF A;  3JQW A;  1OH3 A;  1RIN A;  1HX6 A;  3AB0 A;  4M0H A;  4XTP A;  5B4X A;  1D4M 1;  2BGO A;  1I1E A;  1R08 2;  1DGR A;  3S0M A;  2HEW F;  3NRU A;  4HZF A;  4NRO A;  1JN2 P;  2B9U A;  2VME A;  2WQZ C;  3APB A;  1ZZC A;  3POS A;  4B3N A;  2DV9 A;  3O12 A;  3RWN A;  2O1Q A;  1WZX A;  2VUD A;  3Q8F A;  5A1L A;  2QZ3 A;  5T54 A;  1XND A;  3ACL A;  1JYC A;  4W6W A;  4XF0 A;  2BQP A;  4JAA A;  3AJY A;  3I2H A;  3L2H A;  4ASL A;  1AL2 3;  4E27 A;  2QQM A;  4A7Y A;  3AMM A;  1R64 A;  1OOP C;  3H3U A;  4ZU4 A;  2WUH A;  2PHT A;  3SIS A;  3F95 A;  5K7P A;  1X9P A;  2QUO A;  1DLC A;  2K46 A;  1WME A;  4FT8 A;  1BJQ A;  1FPN 2;  3I3D A;  1G86 A;  1MQT B;  3N7J A;  4YG3 A;  5EP9 A;  3WW3 A;  4CDW B;  1W99 A;  4XJ8 A;  4NHM A;  2IXC A;  3H8X A;  4UF0 A;  5LB6 A;  1NYW A;  3MO4 A;  2RDN A;  4AGR A;  4QU2 A;  1JMU B;  1A8M A;  3QD6 A;  2Y60 A;  5ANQ A;  1MS8 A;  1VRH 1;  2ZGL A;  3GZE A;  2VMI A;  1AUY A;  2FCU A;  5DMY A;  1XE7 A;  2VZV A;  1HB3 A;  4RS5 C;  1W9S A;  2W1U A;  3WQ0 A;  4V1P A;  3POF A;  4LIT A;  4MX3 A;  4Y5S A;  5A3M A;  3V0B B;  1O8P A;  4FPL A;  2CSG A;  5EYY A;  2B8M A;  4NR1 A;  3QOP A;  1W2U A;  2VCB A;  4NRM A;  1G9F A;  1DYP A;  2RMU 2;  3VBF A;  4YM1 A;  4NOT A;  2A73 B;  1RXG A;  3GBF A;  5HCB A;  2YPD A;  1VBB 3;  2HWD 1;  4ONU A;  3T0B A;  3D6E A;  4GMP 0;  3AK0 A;  5C4W A;  4F7Z A;  4TYS A;  3WT3 A;  1GQG A;  2JE9 A;  4FXK B;  5F7U A;  5DN2 A;  3Q8A A;  1UF2 C;  3VDB A;  1E5S A;  1JYI A;  3TNP B;  4WVV A;  4R4Z A;  4JV4 A;  1Q5O A;  2OUJ A;  2WZR 2;  1PO2 3;  2HYX A;  2Y6L A;  4UFJ A;  3ZKU A;  4CXW A;  3IMM A;  3ZYI B;  3L2Y A;  4EN6 B;  4E9K A;  4QPI A;  2GND A;  2ORZ A;  4JKM A;  2BNN A;  3AMN A;  3LZZ A;  3RVH A;  3BKZ A;  1ND3 C;  1QQP 2;  4M3C E;  4PDW C;  1H1M A;  2PAM A;  4QKB A;  1BBT 1;  4QX7 A;  1TME 2;  1QJZ A;  1POV 3;  4OLL A;  3HOB A;  5LBE A;  1QIQ A;  5IWF A;  1W2T A;  5B2G B;  1OA3 A;  2Y33 A;  3RYP A;  1VB2 A;  4L9B A;  2G4I A;  4LQR A;  3MID A;  3TWI A;  1D2S A;  3SH3 A;  4YFW A;  2ZGN A;  3B02 A;  3ZDV A;  4IXL A;  4LE3 A;  1KQR A;  1SCS A;  5BNP C;  5JDB A;  2DBN A;  4MXW A;  1YIF A;  4QQP A;  2A6V A;  2PHU A;  2C9A A;  3W59 A;  2LRP A;  4XUP A;  3NW4 A;  3LPF A;  5FBZ A;  4S2G A;  1HXS 1;  1OLR A;  4QPG C;  1ODM A;  1QF3 A;  1I5Z A;  2R04 3;  1RHI 3;  4TLG A;  1KXG A;  2BZD A;  5FZC A;  3ZFE B;  1VBC 2;  1BKZ A;  3H50 A;  1N1T A;  1PX3 A;  1RUJ 3;  4XUO A;  4AHZ A;  3NQH A;  4AED B;  1KDK A;  3IAQ A;  1FNY A;  2BNM A;  3B7M A;  3OEB A;  3URF A;  2TNF A;  3CMG A;  4D94 A;  1W2O A;  1S2B A;  1O3S A;  1RUC 2;  2HWE 2;  2RR1 2;  3H1W A;  2VCM A;  3VKF C;  3HQU A;  1RUH 2;  1CJP A;  3HEI A;  1UIJ A;  2D7F A;  1VP6 A;  2WO7 A;  4BPZ A;  4CEY C;  2YU2 A;  2KD7 A;  1RXF A;  3S5Q A;  4DIN B;  5L9R A;  3BI3 A;  4FTS A;  1OVP A;  1EV1 1;  3G6J B;  1DQ6 A;  4XMI A;  5A33 A;  4DEQ A;  3NJV A;  1XYN A;  1Y4W A;  4AE2 A;  1SFP A;  1AR7 2;  5I0D A;  1NX9 A;  3E5X A;  4TSV A;  3VBF B;  4JHT A;  2J7M A;  1WGP A;  4WZF A;  5BNN A;  1OA2 A;  1J3P A;  4UW4 A;  1SHW B;  1VBE 2;  3HMY A;  4LUM A;  1UU6 A;  1XQN A;  1XNC A;  3OB8 A;  4C8D A;  3N9M A;  2VOK A;  4N9H A;  2E9Q A;  3MF6 A;  3RI9 A;  3O1M A;  3MGU A;  4ASK A;  3UK9 A;  1UX7 A;  3VBH A;  5HCH A;  2Q1M A;  1AXK A;  4R8H A;  4G4F A;  1W6P A;  3AMH A;  4LTA A;  1VAV A;  4KI5 M;  4LOR A;  5CKQ A;  2OKX A;  1HIX A;  3WQ1 A;  5LK5 A;  3VZN A;  4D3W A;  2W92 A;  4QPY A;  4HOO A;  4A7K A;  1AX2 A;  1AL0 G;  1MZE A;  3MIC A;  4MZU A;  5C71 A;  2XJQ A;  4Q4Y 3;  5ACA 2;  3VBU A;  4SLI A;  5A7S A;  2NN8 A;  4GB3 2;  2PLV 3;  4HKW A;  3FN9 A;  1AR6 3;  1W2N A;  5CKM A;  1F35 A;  3VBF C;  4BDV B;  4HVQ A;  2GMM A;  3ZIW A;  4B8E A;  2JDU A;  4I0A A;  1IZ3 A;  2VMC A;  3R4U A;  3OGR A;  3NNJ A;  1CES A;  4CCM A;  2D43 A;  2P5B A;  3DKW A;  4CVU A;  4LHK A;  5C4W C;  5T5O A;  4MYE A;  5H9P A;  3X29 B;  3IWZ A;  5J48 A;  3ITQ A;  1SLT A;  4A7Z A;  2VBP A;  1UW8 A;  1OUX A;  2HBU A;  3O0W A;  3ZVX A;  3ZXL A;  2ZPX A;  4CDU A;  1UX6 A;  2XML A;  4QPI C;  4NII A;  3NNM A;  4XAE A;  4QB2 A;  1QJE A;  3CJI A;  1BMV 1;  4KWJ A;  5HV0 A;  3VZJ A;  5JAX A;  1NE6 A;  1Q8P A;  2WWU A;  3AM2 A;  3T0A A;  5KXE A;  1V6K A;  3SIT A;  3OYW A;  3MW3 A;  2CAU A;  3HAG A;  3PIG A;  3HT1 A;  3SC7 X;  4HKO A;  3BU0 A;  5EYX A;  2EIB A;  2GAU A;  3AZZ A;  1XU1 A;  3KF3 A;  4CDQ C;  4FBF A;  2Q0A A;  5IK5 A;  2VH9 A;  1OKO A;  2EXJ A;  3JU9 A;  2PAE A;  1Y9M A;  1W9T A;  1SFY A;  3DF0 A;  2CL2 A;  3USU A;  4JKL A;  5FIX A;  2Y6F A;  1JOJ A;  4I01 A;  4N53 B;  5KC5 A;  2WFF 3;  1AJO A;  5I8T A;  4AFC A;  4EZH A;  5LEJ A;  1H9W A;  1GR3 A;  2WA3 A;  2VTX A;  3W58 A;  4GKX A;  3MIF A;  3VDA A;  4A6O A;  1PO2 1;  4CEW A;  5BNO A;  3K75 B;  3GAL A;  1W9W A;  4M3C F;  4AHW A;  2PA7 A;  3NJY A;  1HV1 A;  2CWS A;  4KG8 A;  1JYT A;  3IB3 A;  1POV 1;  1XSR A;  1W3V A;  3VKL A;  3ENR A;  1W6P B;  4MLO A;  1XYO A;  2J1U A;  1VMH A;  2VZQ A;  3LA2 A;  2FDJ A;  1GWL A;  1QOT A;  2OPW A;  2XR4 A;  4FFH A;  2DBI A;  4FOW A;  4NPR A;  3SNM A;  2Y8K A;  3C7E A;  4QGN A;  3U75 A;  4LBQ D;  2D3S A;  3W9A A;  3M70 A;  2A70 A;  2JG9 A;  3VBU B;  1R08 3;  1WMD A;  2BWC A;  4FPY A;  4XUQ A;  1ASJ 2;  3IKW A;  2XON A;  3LA3 A;  2IUW A;  5J37 A;  1STM A;  3WNX A;  2X53 S;  5BNN C;  1OLM E;  2ZEZ A;  5FP4 A;  1RED A;  1RHI 1;  5C9A A;  4W65 A;  3N36 A;  1UIK A;  2LW8 A;  4YGE A;  3AXE A;  3JCI A;  1C1L A;  1CZS A;  4L0P A;  1ZBA 3;  2VE1 A;  3FJS A;  1RUJ 1;  4IEO A;  1RUF 3;  2C24 A;  4Q0U A;  1J1L A;  2QFE A;  3VBH C;  1U5I A;  1GZW A;  1XC6 A;  5JIU A;  2VBD A;  2ZJC A;  4P9L A;  3FL7 A;  5I0T A;  3DYM A;  4AI3 A;  4I30 A;  1JI6 A;  3RZM A;  4MAD A;  4CDU B;  4S2F A;  3RG0 A;  2FDG A;  1W2A X;  4YM0 A;  2DUO A;  3VL9 A;  1OD5 A;  1SPP A;  3AL6 A;  5C3R A;  2C0Z A;  3I2O A;  3BCW A;  5DPN A;  3O14 A;  1W6Q A;  2DTW A;  1X82 A;  1CZV A;  2A3X A;  1LED A;  3FX3 A;  3NNL A;  3DN7 A;  4WM7 C;  4DOU A;  1RL3 A;  1PK6 A;  2VUA A;  3T1M A;  1KIT A;  4PBP A;  2RS3 2;  3DKQ A;  4Z82 A;  4D69 A;  3AYC A;  4YSF A;  1MVE A;  1WMF A;  5D8A B;  1OUS A;  1X36 A;  2QQL A;  5A7O A;  4DY3 A;  5A7P A;  3TRS B;  2X29 A;  2VW1 A;  1PO1 2;  2B9V A;  5F6K A;  2FCV A;  3R0R A;  4PQ9 A;  5C5T A;  3FUQ A;  4MG2 A;  3GYD A;  3EBR A;  5GLV A;  3FFZ A;  4R9C A;  1XOY A;  2W95 A;  3LD8 A;  3USU B;  4D6Q A;  5T5L A;  5EIY B;  2BV4 A;  2VW2 A;  4O65 A;  4RR3 B;  3IN9 A;  3OEA A;  3LGR A;  4IV1 A;  4YW7 A;  1ZVF A;  2YGL A;  3N35 A;  4WVZ A;  2NMO A;  4XDQ A;  1SZB A;  1N1S A;  4H7M A;  4CEW B;  1UYX A;  2PFW A;  4YLZ A;  5FYS A;  1Y9G A;  5I0R A;  3CJI C;  1O3R A;  3BTA A;  4GWM A;  1V00 A;  1TVG A;  4LIU A;  2GSY A;  2VOV A;  4KH9 A;  2E31 A;  4JX0 A;  2DTY A;  4QM9 A;  4AQS A;  3LIH A;  1DHK B;  2Z69 A;  5ISL A;  1XBF A;  4IEY A;  3VUO A;  1YQC A;  2V5Y A;  1DU3 D;  4TN7 A;  2GAL A;  1N47 A;  1R09 2;  2WBK A;  3WDV A;  1QQP 3;  2ZGT A;  2PLV 1;  5T52 A;  3WQB A;  2R32 A;  4FQZ A;  3WQ7 A;  1AR6 1;  1TME 3;  2ET1 A;  1HJF A;  3GCX A;  4XXP A;  1MZF A;  1MEC 3;  4UW5 A;  2W2I A;  1DG6 A;  2NZ9 A;  4YM3 A;  2V5D A;  2G9F A;  4FPH A;  4GD4 A;  2PEL A;  2VVD A;  2WO1 A;  3ELN A;  3I49 A;  2O0O A;  2EIC A;  2EVX A;  2WII B;  2DCK A;  3UYJ A;  4XMA A;  4CXX A;  4CUC A;  1ZBE 2;  4HK9 A;  1ZX5 A;  4EWA A;  1W06 A;  4NO4 A;  2RDR A;  4COW A;  2ZX2 A;  5BNO C;  5C9A B;  5JR7 B;  2XVG A;  1C8N A;  4LHL A;  1ZZB A;  1BEV 2;  1VLN A;  4K1Y A;  3A22 A;  4IV3 A;  4Q27 A;  3K77 A;  4NID A;  5DAW A;  3B9C A;  1B35 A;  1RVF 2;  1LOA A;  3K3N A;  1GZW B;  5JUV A;  3H8R A;  2BFU S;  2VG9 A;  4X6Q B;  5IAV A;  5C3P A;  3ZIX A;  3MW2 A;  5LWB A;  3PVB B;  4Z2W A;  1WA4 A;  3AL5 A;  4CCD A;  1BQP A;  2RS5 3;  4Q29 A;  3N9Q A;  2A3Y A;  2RE9 A;  3AFK A;  5FP9 A;  1W6Q B;  3ZXD A;  4K20 A;  5LW9 A;  5H9S A;  1E5R A;  3PDQ A;  4JQT A;  5GLW A;  1PK6 B;  4LUK A;  2CV6 A;  3MI8 A;  1RUC 3;  4GA9 A;  5C3O A;  5JSP A;  2HWE 3;  2RR1 3;  3ACI A;  2FBE A;  2JG9 C;  1YNA A;  1RUH 3;  4WVW A;  4BK5 A;  4DFS A;  4I0W B;  5T55 A;  1JZ6 A;  2DVD A;  3VDD B;  4J1X A;  5AC9 2;  4PF1 A;  1EYB A;  4FPF A;  3AMP A;  3M3O A;  3ZFF B;  4UFL A;  1WD3 A;  1K42 A;  2YY1 A;  2A71 A;  3WHT A;  5IYY A;  5C9A C;  2V73 A;  4YYO A;  1J59 A;  1NCQ B;  1ULD A;  2HWC 3;  3QCW A;  1AR7 3;  2E7T A;  5APA A;  2C1F A;  2VVF A;  3VBO A;  3KHB A;  4IV1 B;  5HXM A;  1GMM A;  1VBE 3;  4BME A;  1ZNP A;  4AAP A;  1GWK A;  2ZGS A;  4PIX A;  1KRI A;  1PM4 A;  4AVS A;  1CX4 A;  4GWN A;  3L9J T;  4AW7 A;  3GHN A;  3OUH A;  2R0F A;  1DZT A;  1PIV 3;  1COV 2;  2WLP A;  4JGY A;  1LB2 A;  2P34 A;  3VV1 A;  3U78 A;  2H6B A;  1BCX A;  1UZW A;  2ZA9 A;  3AP4 A;  2RG4 A;  2GDF A;  4KWU A;  4LKD A;  2Y64 A;  1EPW A;  2QQJ A;  1D0G A;  4XBQ A;  4XF4 A;  4YG6 A;  1OT5 A;  5FMB A;  3SMH A;  3JBG 2;  2UWA A;  5C70 A;  4DXR A;  1R08 1;  1XE0 A;  1N3P A;  4XFB A;  4XPV A;  4KBZ A;  4MHR A;  4QKN A;  5FYH A;  1GQP A;  3GDB A;  3I2J A;  3LDB A;  5AFB A;  1SLI A;  5CAD A;  3WG4 A;  4I09 A;  1PGL 2;  3J7M A;  3KV4 A;  1CQ9 A;  1QGL A;  2I74 A;  2P6C A;  1D0H A;  3T3Y A;  4XFA A;  5ACA 3;  5BYN A;  1C8M 3;  2P3I A;  1NZI A;  3I8T A;  1VRB A;  3NNF A;  3ZXF A;  5FQ0 B;  1YIP A;  1ZBA 1;  2VCA A;  1H0B A;  5A7N A;  3VZL A;  2MPF A;  3E5U A;  4A42 A;  2BUK A;  3FHA A;  2WFP A;  4X8P A;  1G9B A;  2YZ4 A;  3IIA A;  3M3Q A;  1FPN 1;  1UKG A;  4AGV A;  2BBV A;  2Z42 A;  4QD2 A;  3O7O A;  4GAL A;  1SBE A;  4IV3 B;  4MVT A;  3M3I A;  4NUB A;  2XL7 A;  1C3H A;  1B35 B;  1DCS A;  3AP9 A;  1H8T A;  2Q30 A;  3IMN A;  3F2Z A;  1LOF A;  3WW1 A;  2VBB A;  5IW0 A;  1IPJ A;  1W6N A;  1SBF A;  2I2S A;  4NJ4 A;  2X5I A;  3SKJ E;  3VKM A;  5FPZ A;  5A7Q A;  3WNO A;  3EJK A;  2A3W A;  4URA A;  5JZG B;  2W46 A;  2R49 A;  1J58 A;  1AZD A;  1LHN A;  4NRQ A;  4HPK A;  3K3O A;  5D2A A;  4YZ1 A;  4PLN A;  5L9V A;  2WQ8 A;  1US2 A;  2XHN A;  2P4E A;  4GMP 1;  1YUD A;  5DUW A;  4YM2 A;  1RYY A;  2RMU 1;  4OI0 A;  4XET A;  2HEV F;  2ORX A;  1V6N A;  4IGO A;  2PMW B;  2FDI A;  1K5M B;  4DQA A;  1OLM A;  4AQ2 A;  3H1M A;  1TG7 A;  4IV3 C;  3OGS A;  5FOB B;  4N43 A;  4PQQ A;  4KQ7 A;  4XJ9 A;  1YQ6 A;  2DVB A;  2VXJ A;  2A6Y A;  2CHH A;  2GU9 A;  3HN1 A;  1WLW A;  4LKS A;  4BXF A;  3THC A;  2WZR 1;  2UY9 A;  3TBD A;  5F5Q A;  5FYC A;  1U0A A;  4BK4 A;  1QQP 1;  3Q8C A;  4L11 A;  5CFC C;  1IPS A;  1HB2 A;  1TME 1;  4JGY B;  3C7F A;  4PI0 A;  5KBF A;  5ABJ A;  1MEC 1;  2XVK A;  3SH5 A;  4LEJ A;  3NAP B;  4Y1U A;  5LAS A;  5CYY A;  4IEX A;  4Z8B A;  3FHI B;  2WRA A;  4K3U A;  2PTM A;  5FV3 A;  2HWD 3;  1O5L A;  4DB5 A;  1K12 A;  1FMD 2;  3QAC A;  2CGN A;  3BAL A;  2GZW A;  5FKC A;  2YV8 A;  2WQ4 A;  5FBJ A;  2CGP A;  4LBN A;  4HON A;  4NAO A;  1ZRR A;  1AJK A;  1QXR A;  4OZO A;  2E33 A;  3NKG A;  2KA3 A;  4P5H A;  4UYB A;  2Y26 A;  3VBO C;  1IKQ A;  4AFD A;  3PUI A;  5EJZ B;  2ZAH A;  1HRI 2;  5JI9 A;  2XJT A;  4HVR A;  3TEY A;  1VBC 1;  1SMV A;  3LCP A;  2RS5 1;  4ET7 A;  4P9I A;  1Z7S 2;  3FE5 A;  2P1B A;  2PHD A;  2UWB A;  1M06 G;  4LO4 B;  2PXJ A;  4LJH A;  1H8T B;  1UY4 A;  1ZA4 A;  5F3G A;  5IK4 A;  4BYY A;  1RUC 1;  1V6I A;  2HWE 1;  2RR1 1;  1S0B A;  4QWN A;  4CZS A;  3NL1 A;  2X5I B;  1RUH 1;  1VMF A;  2Y6J A;  3AVR A;  5FTT C;  4FPJ A;  5FYU A;  1LOC A;  2RS3 3;  1RUO A;  4IUG A;  4IEW A;  3O1O A;  3JD7 2;  4HPK B;  4JZR A;  5IK8 A;  2N7G A;  3IPV A;  1HXS 3;  1F31 A;  2BDR A;  2F6B A;  2JIC A;  4JC1 A;  5A3T A;  5CFD C;  1AR7 1;  5FZ6 A;  1A78 A;  1FOD 2;  5FZI A;  1QOO A;  3POY A;  3VHP A;  4GJZ A;  1HDK A;  5J1X A;  4H7L A;  3SH4 A;  3AKS A;  3ZO0 B;  3RZG A;  5JIA A;  1OI6 A;  1VBE 1;  4YW6 A;  2EXI A;  5KHK A;  3UKN A;  5DAB A;  1YWK A;  2P3K A;  5BNQ A;  1KJL A;  2DUQ A;  2QQU A;  2YG0 A;  5EV7 A;  4AVV A;  2ARA A;  4YAR A;  3POI A;  4AWD A;  3KV6 A;  5A6Y A;  1NA1 C;  5LY2 A;  4LKE A;  4KWK A;  1W0N A;  3S6P A;  4XHX A;  3V0B A;  2MEV 2;  4PF5 A;  5FFO C;  5FZM A;  1PMI A;  4IEU A;  2VGD A;  3FHQ A;  4FOY A;  4TLF A;  4XBN A;  1ZM1 A;  2OX0 A;  5EQU A;  3LKJ A;  2ZX0 A;  2E63 A;  4UXA A;  2YFZ A;  2PYT A;  5GZC A;  2H0V A;  1ENQ A;  1IS4 A;  2BRT A;  2P6H A;  4K9S A;  3TN9 2;  4NN0 A;  4XW3 A;  1W9Y A;  4YWA A;  3VGI A;  4E4D X;  3PUH A;  2B42 B;  2FDH A;  4OQ9 A;  2A7A A;  2W94 A;  3BUC A;  1R09 3;  3V56 A;  5ACA 1;  2CYF A;  4LA3 A;  3ASI A;  1G9D A;  3LAG A;  1C8M 1;  1F5J A;  1YQ8 A;  3HQX A;  2DDU A;  2V09 A;  1WUV A;  1X8M A;  1RUD 2;  2G9G A;  2GNT A;  3IDB B;  4X6R B;  4XF1 A;  3NMB A;  4Q4W 2;  3UJO A;  5FP8 A;  4QHO A;  3J7L A;  1YCI A;  1C5H A;  4CP1 A;  5FK8 A;  4N43 C;  4LOT A;  1JBC A;  1S55 A;  1ZBE 3;  2B7Y A;  2HJI A;  5BXX A;  5A1F A;  5JI7 A;  1AR8 2;  5LCW L;  1SLL A;  1T6B X;  2YC2 A;  1LHU A;  1S0F A;  1OSG A;  2ZGO A;  3NV1 A;  3NST A;  1BEV 3;  1D4V B;  4XQD A;  3DL3 A;  3LQC A;  4ZS2 A;  5GLZ A;  2LS6 A;  2ZHL A;  1FT9 A;  5ABJ C;  4GIQ A;  1TMF 2;  4N90 A;  4XOG A;  4EWE A;  2VZU A;  5FZE A;  3J8F 2;  5F3C A;  4QDQ A;  4HFS A;  3H1Y A;  3WZ1 A;  2D5H A;  1F15 A;  1IOA A;  2WSV A;  4KU7 A;  3ZXG A;  2YRO A;  1RC6 A;  1XU2 A;  2JD9 A;  4JVA A;  4OVE A;  1YJK A;  3ZFE A;  1G8W A;  3A4U A;  3OBZ A;  2QTW B;  1W8T A;  1H1I A;  1ND2 B;  4AED A;  1KGY A;  1JXN A;  2WAO A;  3IPV B;  1XNK A;  4XZU G;  4MHU A;  1OFS A;  2QCS B;  5FZ4 A;  2RM2 3;  1ZRD A;  5FUN A;  3KM5 A;  4P02 B;  4LT5 A;  3B69 A;  3QBQ A;  3N9P A;  3U0Z A;  1VMJ A;  3WNM A;  1SBD A;  2JJ6 A;  3MIE A;  2CAV A;  4K8R B;  4NIA A;  3LOB A;  4QDR A;  4ARY A;  1I6X A;  1OXC A;  1GOG A;  2ZHM A;  5A80 A;  3PLQ A;  4CPB A;  5C7G A;  2L9L A;  2W5F A;  2X05 A;  3CF6 E;  3KB5 A;  5DAP A;  3M7A A;  3ZX7 A;  1F5F A;  2VQA A;  1VE0 A;  2R1D A;  4QGL A;  5GZD A;  1LOE A;  3U11 A;  4BQ2 A;  4ITC A;  4FTE A;  4YFZ A;  1UOF A;  2QQI A;  2DUR A;  1SLC A;  2HWB 2;  4E2G A;  4LLF A;  1CZT A;  3VBR A;  2RDS A;  1ZRE A;  1COV 3;  1EUU A;  1GP4 A;  1N1V A;  2JG8 B;  4Q0V A;  2PAK A;  1UKR A;  5FRA A;  3TAY A;  4DS0 A;  5K9Y A;  2GNB A;  4UW6 A;  4Z1V A;  5A1A A;  1MQT C;  3MLK A;  1DGR N;  1NQD A;  4CDW C;  4DUW A;  1UQX A;  3WG2 A;  1OPO A;  2JDA A;  2JDZ A;  2Z2S B;  3HNY M;  1OMI A;  2W47 A;  1ASJ 1;  2ARX A;  4XJW A;  1K45 A;  1CAX A;  4Z07 A;  5LEK A;  4HLT A;  3TNQ A;  4EYU A;  3SCG A;  5JXG A;  5FYV A;  1W8N A;  2WNU B;  5EWS A;  2ZMN A;  4ZON A;  3U1X A;  3MZH A;  5DDJ 2;  1R1A 2;  2XGX A;  5FZ0 A;  5FYT A;  3WR0 A;  2JX9 A;  5CAZ A;  4CCL A;  4AVA A;  3ABZ A;  3LDR A;  5GLT A;  2DCJ A;  3ZFG A;  4NHX A;  2WZE A;  1AYN 2;  4DO0 A;  2YBS A;  3ILF A;  2VZP A;  2XLA A;  4XJU A;  3S7E A;  1J84 A;  3AFG A;  3LB9 A;  2ZGR A;  4LO8 A;  4UAP A;  3WY6 A;  1S0J A;  1CVN A;  2V72 A;  3OGJ A;  3O0X A;  3OPW A;  1K3I A;  2WJS A;  4XUT A;  2D44 A;  5JPM B;  2A6Z A;  2RS3 1;  3KCY A;  2HWF 2;  3OBR A;  1QMJ A;  2CDP A;  1NT0 A;  1LEN A;  5F8P A;  5FZ9 A;  1CJD A;  1XPW A;  4C0B A;  4C91 A;  4F3J A;  4OHZ A;  2DF7 A;  2TBV A;  4NIH A;  1V6O A;  4CDX B;  2NYY A;  5G04 L;  1W6M A;  1S0C A;  2ARB A;  2BYV E;  5DUV A;  1PHM A;  1PO1 1;  5FYY A;  3ZN5 A;  4BQ3 A;  4RL7 A;  4P14 A;  5FPA A;  3FLT A;  3T2P A;  1KEX A;  3B9I A;  3CLP A;  4QX1 A;  4BCU A;  2DVF A;  1MS1 A;  3IAP A;  2JEN A;  2QQK A;  3VD3 A;  1HN0 A;  3DPR A;  3WNN A;  5F5A A;  4M0N A;  3EQE A;  4IW3 A;  5CVR A;  3U10 A;  2WS9 3;  1M4W A;  3B00 A;  2WN2 A;  3MBW A;  3WUD A;  3SLI A;  3WDW A;  2W1Q A;  2I45 A;  1GSL A;  1E5I A;  1HQL A;  1YLL A;  4SBV A;  3SCF A;  4FPE A;  4UI9 L;  3ETP A;  3U4X A;  2OXB A;  4FPK A;  4MSV A;  5BY5 A;  5DAX A;  4AVB A;  4HSL A;  2OS2 A;  3A7Q A;  1QXP A;  2SBA A;  4G3Y C;  4N53 A;  2UY8 A;  5LBB A;  2PQS A;  5IK7 A;  1R09 1;  3GM8 A;  5T3N A;  5KWR A;  1JYX A;  3VBR B;  3PHM A;  3E5Q A;  4QQO A;  4ZZ5 A;  2IXL A;  4HAN A;  4JKK A;  3ZFE C;  2Q5T A;  3VZK A;  5FZH A;  1NAE A;  2A75 A;  4OHW A;  4HVO A;  4QM8 A;  3LEG A;  3PUS A;  4UT5 A;  3I4I A;  4FI9 A;  5FMC A;  4AED C;  5FMD A;  1SDW A;  5DG1 A;  1LGB A;  1GLH A;  3V64 A;  3KV9 A;  4B1L A;  1CAX B;  1W8Z A;  3OD0 A;  4QX2 A;  1ZBE 1;  1FMD 3;  4XAC A;  3FUO A;  4XHB A;  4IET A;  2W87 A;  4CU7 A;  4AG4 A;  2VC9 A;  1H4G A;  4OQ8 A;  1BEV 1;  1NLR A;  4IEV A;  4RFT 0;  4ATF A;  4OUM A;  5D1I A;  4UBG A;  3BOW A;  3ZFG B;  4IES A;  3QLQ A;  5F37 A;  1HRI 3;  4I3P A;  2R06 2;  1YXW A;  2QQV A;  3NWK A;  1NXM A;  2VAU A;  1EUT A;  1GV9 A;  3ZM8 A;  4LBO A;  3H42 B;  1Z7S 3;  4PI2 A;  5FYI A;  3N9N A;  2WNV B;  4DEV A;  2ADD A;  3ZXJ A;  4IGQ A;  5FY0 A;  1UZ0 A;  5A70 A;  3RZL A;  1DBN A;  3MUZ 1;  2CY6 A;  1O3T A;  2VOW A;  2BEO A;  2ZCW A;  1ONA A;  5F3I A;  1RUN A;  3AMQ A;  4QPW A;  4U36 A;  2XKO A;  4FVV A;  4OZX A;  3D8C A;  1W03 A;  1W6M B;  3RSJ A;  2RM2 1;  5G05 L;  1UD1 A;  1JUH A;  3BGA A;  3JD7 3;  5HI0 A;  4N9I A;  4O61 A;  1D7P M;  1G7Y A;  3BU7 A;  2HYK A;  2IVJ A;  4LR4 A;  3RGB A;  4AR2 A;  2ILM A;  4H2A A;  2WIN B;  3T4V A;  2AR6 A;  1RUE 3;  4Q4V 2;  3DPR B;  3ZFG C;  4D7Y A;  3JQX A;  3J7H A;  5FY8 A;  1SFN A;  5A6Z A;  5D8A A;  3O1S A;  1LES A;  4IE0 A;  1HQW A;  2RJL A;  4A2U A;  1S4C A;  2D5F A;  5TSW A;  5A3N A;  2ZS6 B;  3JB8 A;  1OUR A;  2C5D A;  4XUR A;  5FY5 A;  1YEW A;  1H1A A;  2YXS A;  1HQN A;  2ZGK A;  2VOT A;  4BA6 A;  5A32 B;  4WM8 B;  4CE8 A;  2P37 A;  4OUS A;  4COY A;  1UY3 A;  1COV 1;  2CNA A;  2CTV A;  2OZJ A;  2BU9 A;  3VKN A;  1F8V A;  3DGT A;  3T30 A;  5C3S A;  1LU1 A;  1W8F A;  2ZAC A;  4ARX A;  2OW4 A;  1IHM A;  1CON A;  2VR4 A;  1GWM A;  2ZGM A;  4KU8 A;  4RR3 A;  5E89 A;  3J26 N;  1XNA A;  4AI2 A;  1L7L A;  3HD8 B;  5K0U A;  2WAB A;  4RFR B;  3D5O A;  3KSC A;  4MOA A;  4NPM A;  5I8S A;  1VPH A;  4YVW B;  1ULC A;  2NP0 A;  2YBP A;  1IGO A;  1PGL 1;  1PVC 3;  4YPJ A;  5IFP A;  2LM3 A;  5DZG A;  4IL7 A;  2QVS B;  4AI0 A;  4AQT A;  1PZ9 A;  3Q8B A;  4FXG B;  4W4Z A;  2VUC A;  4DXS A;  3LEK A;  2XVL A;  3AVS A;  1F9K A;  3OSD A;  4EWD A;  3B01 A;  2H6C A;  5FJH A;  4FTB A;  2Z5W A;  4OYU A;  2D40 A;  2XB6 C;  1JTZ X;  1XE8 A;  5J7M A;  3WF2 A;  1RMU 2;  3POJ A;  1QNY A;  4A6S A;  4J1W A;  1A8D A;  2ENR A;  5CIS A;  1QDO A;  3RMY A;  1C28 A;  1V9U 2;  4N7I A;  2Y6H A;  3UJQ A;  4XTM A;  1MS0 A;  1AR8 3;  3PU3 A;  4A41 A;  4BH9 A;  1UY0 A;  3HVD A;  2FDF A;  1F2N A;  3PVN A;  4JDO A;  4N53 C;  2GC3 A;  3POE A;  5FOJ B;  1ALY A;  3VDC A;  3ZSM A;  1QOS A;  3ZMO A;  3JB4 C;  2R30 A;  5LZ6 A;  3LE0 A;  1PZ8 A;  2XQX A;  1AF9 A;  5IJR A;  1TMF 3;  3CIH A;  3DEM A;  5H9R A;  1K5J A;  3WW2 A;  1EPZ A;  1JW6 A;  2PHW A;  5CEH A;  2XXZ A;  2NM1 A;  1G9A A;  4W6X A;  1GYK A;  1WKY A;  1GZC A;  3R4D B;  1W0O A;  5AVP A;  4GKY A;  2IFW A;  4DNY A;  1FPN 3;  2QZ2 A;  2WS9 1;  4LBK A;  4CUG A;  4EJR A;  4CCN A;  1G6N A;  3OJB A;  3PL0 A;  3WP5 A;  1GNY A;  1FXZ A;  3A0K A;  2B4K A;  3PNA A;  1NUK A;  1YRZ A;  2Y0I A;  3I3E A;  3OBT A;  5H9Q A;  2HLE A;  2VZO A;  2JDN A;  4YZ2 A;  4AZZ A;  2F4P A;  3VBU C;  3N9O A;  1BBT 2;  1X7N A;  5FPL A;  3UET A;  3ZN4 A;  4P00 B;  3ZSK A;  3MPB A;  1GU3 A;  3VDD A;  2EID A;  2RHP A;  5CIR A;  5KHJ A;  2C9K A;  3ZFF A;  1QU0 A;  2BBA A;  2YU1 A;  2ZXQ A;  3WF3 A;  2JKX A;  3HPN A;  4K7J A;  1NCQ A;  1LHV A;  1BLZ A;  3GJB A;  4GMP 3;  1O4T A;  1S0I A;  4MV2 A;  4NHL A;  3POG A;  1MPX A;  1DYK A;  2RMU 3;  1UYP A;  4Y26 A;  5LK7 B;  1H4H A;  1Q8S A;  1QNW A;  2BTV C;  2I07 B;  2R16 A;  1H30 A;  5LBF A;  5K0U B;  2E53 A;  2PHF A;  4BXS V;  4YGC A;  3DUI A;  4CDU C;  3IDA A;  1Q8O A;  4HN1 A;  3KGL A;  1FMD 1;  5CB7 A;  2VTX J;  2XBO 2;  4R9B A;  1PMJ X;  5IFT A;  2AYH A;  3E6C C;  1Q3E A;  1AVB A;  1KS5 A;  2IFR A;  3VD5 A;  5FYM A;  2J22 A;  1W28 A;  2E51 A;  1NCR B;  5EXO A;  2R0H A;  3EB7 A;  2ZTN A;  3MFC A;  3DV8 A;  2WZR 3;  1V6J A;  4YW4 A;  4BQ5 A;  4QT6 A;  5D8A C;  3S57 A;  3KF5 A;  1YHF A;  5JR2 A;  1LGC A;  1HRI 1;  5LRR A;  5FAX A;  3IBM A;  1IKP A;  3W5M A;  5DDJ 3;  4FAH A;  1DQ1 A;  1KS4 A;  2VZ3 A;  3WSO A;  3M3C A;  2QQN A;  1Z7S 1;  4R9D A;  1LU2 A;  4DIQ A;  2Y38 A;  1QH6 A;  1SQ4 A;  4RQP B;  3FLP A;  3H3Z A;  4XE9 A;  4HG6 B;  2KR2 A;  1TEI A;  1WW5 A;  1L3J A;  4QKD A;  5FQ0 A;  2RJK A;  4RR3 C;  2RVA A;  2DVA A;  4IEP A;  5GKA C;  2B39 A;  3N7K A;  2XH6 A;  3ACH A;  4JTO A;  1QJU 2;  2JD4 A;  4UWD A;  2XUM A;  1B09 A;  3G7D A;  3P3P A;  1AYM 2;  5F32 A;  4CEW C;  4BQW A;  3A0N A;  2HWF 3;  3AKQ A;  2A5Z A;  3JD7 1;  2YMZ A;  1GNH A;  3M8L A;  2K0G A;  2VO5 A;  2WC2 A;  2MHF A;  3RFR A;  3VB9 A;  1Y7B A;  4XQW A;  5FDB A;  4HET A;  5I91 A;  1RUE 1;  3CZU A;  5K8S A;  3N4M A;  2VU9 A;  4OHV A;  3ZXE A;  5FY1 A;  4XCA A;  1VBC 3;  3I2G A;  2FMD A;  1L7Q A;  3HIF A;  1ZYB A;  3OGG A;  3SCH A;  5A3W A;  5GAL A;  2XLG A;  1HN1 A;  3THP A;  1DQ4 A;  1NLQ A;  3MIH A;  2VMG A;  4ZY9 A;  5T50 A;  5JZG A;  2J1V A;  1UOB A;  1TNF A;  5FZD A;  3ZR6 A;  2P17 A;  1UYZ A;  3RPQ A;  4NWW A;  4J6G A;  4M4R A;  4O7X A;  4CU9 A;  1X8E A;  5BNP B;  1GQH A;  1RGS A;  3CQO A;  1PNF A;  3P6B A;  4Q4X 2;  4XIO A;  3C7G A;  1QY4 A;  5IHR A;  1XRU A;  1BZW A;  5CG9 A;  3CU7 A;  4QX5 A;  1K5M A;  3S7I A;  3LPG A;  3USS A;  4KNC A;  2QBX A;  4IGP A;  4DZG A;  1PVC 1;  1AL2 2;  3ZPO A;  2HEY F;  2WT1 A;  1KFX L;  2JEM A;  3EYP A;  4M3C B;  3VBS A;  1RUD 1;  3A23 A;  1UL9 A;  5KHG A;  2IVI B;  3ZYR A;  4CCE A;  2HBT A;  2WO2 A;  1QWR A;  4JGZ B;  4PT6 A;  2WWJ A;  4Q4W 1;  1EAH 2;  2JKB A;  4LXL A;  3I2K A;  3HN3 A;  3WG1 A;  1JHJ A;  1LOD A;  2WT2 A;  3CBN A;  4RGA A;  1PK6 C;  5ERL A;  5FZ7 A;  2ZAA A;  3ZOI A;  2A1X A;  4YVS B;  3NAP A;  3CL1 A;  1AR8 1;  2V4A A;  1PX4 A;  4RYD A;  5HV4 A;  2QQP A;  1UMH A;  4H14 A;  1ZZ6 A;  4AK3 A;  4B4R A;  3VDD C;  2C26 A;  4BQ1 A;  4Y1Y A;  3D0J A;  1QJX 2;  2K2S A;  5EHD A;  3ZFF C;  1NOV A;  4IEZ A;  4E4Z A;  2C6S A;  4NIG A;  1TNR A;  3ZYB A;  1NCQ C;  2LTN A;  1WLT A;  4QX0 A;  4N7U A;  3UGF A;  3AKP A;  4GB3 3;  1TMF 1;  2WAA A;  1W8U A;  1NXD 1;  3PME A;  2W9X A;  3ILR A;  1T2X A;  5FLI A;  1JU4 A;  3MPP G;  3J8F 1;  3OOX A;  4IV1 C;  1FAT A;  1UNB A;  1VBB 2;  5EFU A;  2W91 A;  5DUU A;  2E7Q A;  3IZO A;  1NY7 2;  1ZZ8 A;  1Q8V A;  4P5Y A;  4ZS3 A;  1LNS A;  2VMD A;  2VZ1 A;  4YNI A;  1W04 A;  3KLS A;  1JZ3 A;  2RS1 2;  4KWL A;  1HB4 A;  2FZ1 A;  4I2O A;  3R05 A;  4I0B A;  1C4R A;  4CCJ A;  4CUB A;  3BTZ A;  2OQ6 A;  1N1Y A;  2QQW A;  2WZP P;  4K1Z A;  1S1A A;  4EQV A;  3NJZ A;  2ZEY A;  5J96 B;  2WKK A;  4QQL A;  1Q56 A;  2WSU A;  2LUW A;  1YJL A;  1UOJ A;  2X8K A;  1DF0 A;  4MUV A;  2K9Z A;  3KT1 A;  2ZEX A;  1LEC A;  5FRE A;  1L7R A;  3AP5 A;  3M1H A;  2HWB 1;  1HLC A;  1POV 0;  4AFM A;  1W90 A;  3V0A B;  3O1T A;  3UNP A;  1BXH A;  3I2I A;  3CHX A;  3CEW A;  3VHO A;  5FZO B;  1UO9 A;  3I59 B;  2BOI A;  2BPA 2;  1WLD A;  1NQJ A;  2VPV A;  1V70 A;  4YZ5 A;  1RUI 2;  2CWM A;  3HJR A;  4FPC A;  1FI2 A;  5C6C A;  1V0A A;  5JMO A;  2W0X A;  1B35 C;  4Q0S A;  2R04 2;  4XFF A;  3T0D A;  1CIW A;  2VD7 A;  3C2U A;  3VBS B;  2DU0 A;  3AKT A;  5C8C A;  2Q1F A;  4FSJ A;  3WNK A;  2P2K A;  3I54 A;  5A7W A;  3DXT A;  3LOI A;  4XJA A;  5IVJ A;  3T09 A;  2RJ2 A;  5A3L A;  3D82 A;  5JZG C;  3ETQ A;  2PQQ A;  5DDJ 1;  3ACF A;  1R1A 1;  4Y5T A;  2Q8C A;  4CCC A;  4EN9 B;  2XDV A;  1ZA7 A;  1C5I A;  3AYA A;  3MFA A;  3ZSE A;  1UZZ A;  1H2K A;  4ZZ8 A;  4XFG A;  3BN6 A;  3D3A A;  4ZU5 A;  1AYN 1;  5BV6 A;  4QHB A;  3ZYF A;  1RMU 3;  3AP7 A;  4OFG A;  5BPX A;  4CP9 B;  3WP4 A;  4FPG A;  2VNV A;  4PBO A;  1K5M C;  1IG0 A;  4KMQ A;  1ZRI A;  2JE8 A;  5GZG A;  2XLF A;  2HWF 1;  3A21 A;  5L7O B;  1ASJ 3;  4CU8 A;  1JYV A;  4AEJ A;  1OH4 A;  3AKR A;  2ZMK A;  4XFI A;  1POQ A;  5CNA A;  2ARC A;  1W9F A;  4AL9 A;  1WBF A;  4XFC A;  2GN3 A;  1O6U A;  4AI8 A;  3ZDS A;  4D6S A;  4E4H A;  2GN7 A;  4WVM B;  1LCL A;  5FUI A;  2Q4S A;  4LIV A;  1Y3T A;  4K21 A;  2C4X A;  1Z78 A;  3OGV A;  1OOP A;  3SEE A;  4JGY C;  2JEC A;  3NV3 A;  3T4H B;  4IQP A;  2DUP A;  1QKQ A;  3LIG A;  4FP3 A;  3KV5 A;  3NAP C;  4AI9 A;  1OF4 A;  3KT4 A;  1ZRC A;  1OA4 A;  2FMY A;  3KCX A;  4NHY A;  3CJX A;  1LUL A;  1OQE A;  3AX4 A;  5EPA A;  3TEW A;  1BK1 A;  3T2T A;  4LO7 A;  4Q0Q A;  4HSJ A;  4OI1 A;  4Q4Y 2;  1HRV 2;  3TOJ A;  1YC6 1;  2O8O A;  1LHO A;  3GNE A;  1ND2 A;  3OPT A;  2QDN A;  5JSO A;  4QHZ A;  1VBA 2;  5FZB A;  1AR6 2;  4AI1 A;  1AHS A;  1VB4 A;  4RS5 A;  4XCB A;  5CA6 A;  3O1U A;  4J25 A;  1ENS A;  4PJY A;  3PMS A;  1FAY A;  1PO1 3;  2GP3 A;  4RSU A;  4A45 A;  4YGD A;  4CYD A;  1VIW B;  2VUJ A;  4EN0 A;  3H0O A;  3OG2 A;  3KQR A;  2OQ7 A;  3RZH A;  1SDD B;  3WHU A;  2F4L A;  2Z79 A;  2B46 X;  3WW4 A;  3ON7 A;  1G9C A;  1YI9 A;  1WMX A;  4GH4 B;  4ZXK A;  4DXT A;  4QU1 A;  1UY1 A;  4OMC A;  4AFA A;  1FV3 A;  3SKV A;  4GWI A;  1H8T C;  3OF1 A;  1LOF C;  4NHK A;  5C8C B;  2XBO 3;  1WW4 A;  3LWC A;  2VQU A;  4CA9 A;  2X5I C;  5FP3 A;  5DAQ A;  4BIS A;  1DLL A;  5A7W B;  1WCS A;  4Q0P A;  4JDN A;  2JG8 A;  2VCC A;  4UFI A;  1H2N A;  1HW5 A;  4C90 A;  3B94 A;  1DP0 A;  2R07 2;  2XOM A;  1C1F A;  5F5I A;  3KGZ A;  2GC0 A;  1CD3 G;  3VL8 A;  4PDW A;  4GB3 1;  5I0S A;  2R06 1;  4ZHN A;  5CG8 A;  2ZGU A;  1R1Z A;  3KS7 A;  2WNO A;  4LHS A;  1PGS A;  1I5P A;  4PIY A;  1W3X A;  1W6O A;  3EMR A;  1ST8 A;  4LHN A;  4PHZ A;  2WNU A;  5GLU A;  1H6Y A;  1UU4 A;  2ZGP A;  3OPZ A;  1CAV B;  2WFF 2;  2KXL A;  3THT A;  1RUG 2;  4DXZ A;  3WF4 A;  1ULG A;  3GBW A;  2JB4 A;  3HBZ A;  5A3U A;  1AYM 3;  5EZW A;  3SQO A;  5C8C C;  3KCC A;  5LA9 A;  5T5P A;  1S0E A;  3OD4 A;  2SLI A;  5JXH A;  1OOP B;  3H8U A;  1RVF 3;  4Y1X A;  4A44 A;  1BK0 A;  5IVF A;  1IG3 A;  4KGQ A;  4PLO A;  4AGG A;  2YFU A;  1V6L A;  1LGN A;  1FV2 A;  4IE7 A;  2ZKL A;  4OCT A;  3RWK X;  1XNT A;  1XXN A;  3IDC B;  4CTE A;  2FCT A;  4MO3 M;  4AQ6 A;  4XVH A;  1WD4 A;  3WP6 A;  1OKQ A;  4CDX A;  5J09 A;  4RHV 2;  4CCO A;  4Y33 A;  4JQR A;  5FY9 A;  4ATE A;  1VAL A;  4NMI A;  1LTE A;  2Z4F A;  5FYZ A;  4P9G A;  5FP7 A;  4C1W A;  1LOG A;  4CCK A;  5JPN B;  2VJX A;  1PGW 2;  3VD4 A;  2CU5 A;  4CEY A;  4Q4X 3;  4R9A A;  1IS5 A;  4RS5 B;  3O0V A;  5AC9 3;  4P9X A;  2IZW A;  5KHI A;  1VBD 2;  4H55 A;  4JTN A;  5LA0 A;  4KBB A;  4I3G A;  2D6P A;  3INA A;  4YW1 A;  2VOX A;  1ULF A;  1ZBA 2;  1LOB A;  3HNB M;  1RUF 2;  2WWS A;  1JOB A;  3C8X A;  4OUE A;  3WIN E;  5GJ6 A;  4NAM A;  3QH6 A;  4HMZ A;  3VZO A;  2FD8 A;  2EIG A;  4GAZ A;  3POW A;  5D21 A;  5FLH A;  4FPO B;  3VLB B;  2EAL A;  2VQ0 A;  2EF6 A;  1EAH 3;  3P5B A;  3DYO A;  1RMU 1;  4A3X A;  3LDK A;  2W68 A;  1ULP A;  1SCR A;  4M01 A;  5HCA A;  5IVV A;  2Q8D A;  1V9U 1;  5C8W A;  4MGT A;  2VUL A;  3HBK A;  4XJZ A;  4QDS A;  1DQ5 A;  1ND2 C;  1H2L A;  2ATF A;  3JBG 3;  5JLV A;  1F4H A;  5FMO L;  1ND3 B;  4PDW B;  1UXZ A;  3NV2 A;  3OCP A;  3LFI A;  1QJX 3;  4XZP A;  2Y34 A;  3R4S A;  2ID4 A;  4HN0 A;  2P3J A;  1W6O B;  1A34 A;  1BVV A;  4LO6 B;  2UYB A;  2XJR A;  2EAK A;  4URT A;  4F8A A;  1FX5 A;  2Q8O A;  4BE3 A;  4AAX A;  1DDL A;  1XB9 A;  2ZEW A;  4FFI A;  3UGH A;  4BQX A;  5JSR A;  2DCZ A;  3ME2 A;  3TB0 A;  3UT0 A;  1UPS A;  4L2N A;  4M00 A;  3RZZ A;  1ENX A;  1DQ0 A;  3AZX A;  3NNG A;  1OFN A;  4W8J A;  5FZ3 A;  4JRL A;  4BU2 A;  4RD7 A;  2OUH A;  5B4N A;  4MET A;  5CBL A;  1HKD A;  2W39 A;  4HK8 A;  3RZJ A;  4BLJ A;  3FFQ A;  1MZ5 A;  4V2V A;  3ZXK A;  2JG8 C;  3O5S A;  4QPG B;  4B1M A;  4YW5 A;  4LBQ A;  2RS1 3;  1W8H A;  2JDP A;  2WNV A;  2J1T A;  2OPK A;  1H8V A;  2VZR A;  2ZX1 A;  4P9J A;  5HCF A;  1GAN A;  3ATG A;  2PHX A;  1A6C A;  3OBA A;  5FJK A;  4LBL A;  4BLI A;  1DYO A;  3AJZ A;  1MEC 2;  3TEX A;  2WNU C;  4A4A A;  2JIJ A;  4LBJ A;  4PCR A;  4CDQ A;  3GJA A;  2CDO A;  3WDU A;  4CEY B;  4XC9 A;  4IEQ A;  1U12 A;  4HKL A;  4DRV A;  4GQ7 A;  1W0P A;  2JWP A;  4Y1V A;  4B29 A;  4BB3 A;  2JE7 A;  3IDE A;  2XBO 1;  1RUI 3;  1QEX A;  2DU1 A;  2ZHN A;  3V65 A;  1JH5 A;  2JDK A;  4AFB A;  4WM8 A;  5A32 A;  2J1R A;  2VY0 A;  4QB6 A;  4DRR A;  3KD4 A;  1A3K A;  5L73 A;  3AZW A;  2RS5 2;  1YFU A;  2ES3 A;  1U5Z A;  4MGS A;  3UKV A;  2W1S A;  2Y0O A;  3M4F A;  3ZSL A;  1MZ6 A;  4LBM A;  4CDX C;  4FFF A;  3FLR A;  1OQD A;  4EE2 A;  1JOP A;  2E32 A;  4UF0 B;  2DFC A;  4YVW A;  1JOD A;  1NG0 A;  3MEP A;  1LR5 A;  1LKN A;  2JDM A;  1GBG A;  1NE4 A;  3RI8 A;  2IC1 A;  1SAC A;  3JXS A;  3MHZ A;  5F6L B;  4QXC A;  4WBB A;  3T2Q A;  2JIG A;  2WT0 A;  4GZ9 A;  4E2S A;  1AXY A;  3E97 A;  4K8F A;  3THD A;  1PNG A;  1HV0 A;  2PHL A;  3N9L A;  3I3Q A;  4YW2 A;  1YFX A;  1US3 A;  1QJU 1;  2ARE A;  5E1R A;  1CPN A;  3RRD A;  2OYZ A;  1EP0 A;  2BW8 A;  3UKT A;  1AYM 1;  2HWC 2;  2ETE A;  3MW4 A;  4D8M A;  2YYO A;  5FLJ A;  1QJY 2;  1JYN A;  3R6S A;  2BGC A;  3KVB A;  1UCX A;  4E4S A;  1RIR A;  1AXZ A;  5FZG A;  1AR9 2;  1O59 A;  3I2F A;  2HKX A;  4QAW A;  3H8O A;  1RVF 1;  5FXZ A;  5IUQ A;  4MGY E;  2JB8 A;  1T6G C;  4H3W A;  4L8Q A;  3ZKY A;  5C4W B;  1UXX X;  4Q8K A;  4DMI A;  2WYS A;  3VBR C;  1V6M A;  1PIV 2;  2AC1 A;  2XL9 A;  3H7Y A;  2FQP A;  3E1F 1;  5FWE A;  4C0H A;  1O7F A;  2VXR A;  3LFM A;  3PUQ A;  4LBQ B;  4QQH A;  3PVO A;  4LO5 B;  1WWY A;  1CAW A;  5ANN A;  1YYN A;  4QPI B;  4E8C A;  2VVE A;  1CAU A;  2XQR A;  4WM7 A;  1PZ7 A;  3UGG A;  4E2Q A;  4Q4X 1;  3SEP A;  1YFY A;  2OT7 A;  5AC9 1;  1Q8Q A;  3FC0 A;  4XAA A;  1HRV 3;  2AH2 A;  4AOC A;  3GZU C;  1C8M 2;  1LJ7 A;  1VBA 3;  4OI2 A;  3ES4 A;  1I9R A;  1NZC A;  5FPV A;  1URX A;  3ZYG A;  1AL2 1;  4A3Z A;  4BJ0 A;  3BVC A;  4CDQ B;  5FO7 B;  4Z92 B;  2VEC A;  1FOD 3;  2VMF A;  5IAT A;  4F83 A;  4S2H A;  1OLQ A;  3E6B A;  2VQT A;  4MXW B;  1WBL A;  2BJS A;  1ZZ9 A;  3GZA A;  5M0T A;  1UMZ A;  3AYE A;  5KR7 A;  3AYD A;  4HL0 A;  4ZU7 A;  1EAH 1;  4QB1 A;  1KFU L;  5I93 A;  2VTF A;  2WNV C;  1D4M 2;  4YZ4 A;  2MEV 3;  3K4A A;  1ACC A;  1OHF A;  4Y5Z 0;  2JXA A;  2VZT A;  3K48 A;  2ZZQ A;  1MS4 A;  1F4A A;  3ALQ A;  3JBG 1;  1Q43 A;  5DG2 A;  3D4K A;  4LNV A;  2IXI A;  4L99 A;  1X50 A;  4JHZ A;  3TN9 3;  3B93 A;  4CPB D;  3S5A A;  1QJX 1;  1JHN A;  3BPS A;  3MF9 A;  4COU A;  2E6V A;  4RGK A;  3ZYP A;  1OC1 A;  2R07 3;  3DYP A;  3BYW A;  4GUL A;  4DY5 A;  3I3M A;  3PTY A;  4R52 A;  1OVS A;  3WCS A;  4OMD A;  1I3H A;  1BHG A;  5FZ1 A;  4V2W A;  3FMG A;  5FZ8 A;  2VMH A;  3MYX A;  1NCR A;  3PIJ A;  5E88 A;  3C3V A;  4Q26 A;  3DPR C;  5EJ3 A;  1RUD 3;  4Q1R A;  1OPM A;  2QE3 A;  3C7O A;  4B4P A;  4ES8 A;  5E6H A;  2BGP A;  1WCK A;  4RGG A;  1VBB 1;  5A33 B;  1D2Q A;  4Q4W 3;  3NKT A;  3UES A;  4EV0 A;  1NY7 1;  4ZXE A;  4Y22 A;  1WCU A;  1RUG 3;  3WF1 A;  2ADE A;  2XJS A;  4FO9 A;  4WM8 C;  2ZGQ A;  5BNN B;  1JUI A;  2XWJ B;  1VRH 2;  4RQP A;  4MGZ E;  2RS1 1;  5KXD A;  5LBC A;  4QX8 A;  2WA4 A;  3ZPY A;  4ZKT B;  2NQY A;  2WLQ A;  5JOX A;  1TQ5 A;  2OII A;  3VBH B;  3K2O A;  4QXB A;  2GME A;  1JYW A;  1J3R A;  4YVW C;  1RJ8 A;  3WF0 A;  3TEZ A;  1RB8 G;  1DIW A;  1TE1 B;  2XG3 A;  2UYA A;  3IM0 A;  4JRA A;  4QXK A;  2YGM A;  5HXV A;  1CAW B;  3VN4 A;  3WDY A;  4QXH A;  2BP6 A;  1CAU B;  1YO8 A;  4P08 A;  3RS6 A;  4C1X A;  3J8F 3;  1IS6 A;  4AHX A;  1ENR A;  4WM7 B;  3TYJ A;  3WEZ A;  2HWD 2;  2BVB A;  4RHV 3;  1S2K A;  1JZ7 A;  3KT7 A;  2WYF A;  1XYP A;  1WCD J;  2EA7 A;  3O1R A;  2KM2 A;  4IE4 A;  3OUJ A;  2D6M A;  2XUE A;  1W8W A;  1RUI 1;  2JDH A;  3WD5 A;  4FAG A;  1VBD 3;  1S0D A;  3K4Z A;  2R04 1;  2X09 A;  4XIK A;  2BWA A;  5E16 A;  1Z0H A;  2GNM A;  3RNS A;  4AXO A;  4KGG A;  3H3L A;  5FPU A;  2E26 A;  1X33 A;  3CZJ A;  4ISR A;  4XQ4 A;  5FO9 B;  3W5N A;  1SLB A;  5GZE A;  3FWE A;  4D7T A;  5FK7 A;  4PLM A;  1JZ2 A;  1LHW A;  4XAB A;  2LRO A;  5K4L A;  3VHR A;  4CRQ A;  5FR3 A;  1VJ2 A;  3PJQ A;  2Q8E A;  1HB1 A;  2IXJ A;  1UMI A;  1ODN A;  2DCY A;  2QDR A;  2W1W A;  5JXJ A;  2HWB 3;  2AEN A;  2ZX3 A;  4LKF A;  3S30 A;  3UL2 A;  2D3R A;  2XWB B;  3AZV A;  3CJI B;  3PTR B;  1GKB A;  3ZXA C;  4M3C A;  4ES9 A;  3KMH A;  1O4Y A;  2DVG A;  5KHH A;  1DFQ A;  1REF A;  5DZE A;  3OYW B;  2AAC A;  1NLS A;  3K4D A;  3KQ4 B;  1GNZ A;  1HXS 2;  3MUY 1;  4JGZ A;  4E8D A;  4Y1Z A;  1GZ9 A;  4LUL A;  4YGB A;  2D6O X;  4QKF A;  3P1I A;  1H9P A;  3AC0 A;  4YVS A;  4XF3 A;  3ZYH A;  1CGP A;  5DXD A;  1WA6 X;  1VR3 A;  1MS9 A;  2WR9 A;  3K46 A;  3U37 A;  4UOJ A;  5LAT A;  2OA2 A;  2G19 A;  4G9S B;  4XDO A;  3RZK A;  1WLC A;  1R1A 3;  1JZ4 A;  1SEF A;  4Y22 B;  5CU1 A;  2D6N A;  3DCQ A;  3UV9 A;  3WP3 A;  5KC6 A;  4PIZ A;  3ES1 A;  3W21 A;  3ZYJ B;  2GC2 A;  3I7D A;  1AYN 3;  5KXB A;  5BNO B;  1FYU A;  4RA0 A;  3PJY A;  4UW3 A;  2X10 A;  4BIO A;  4CP2 A;  2R6Q A;  1CWP A;  5LA1 A;  3CKH A;  4P9W A;  3ECQ A;  5SV5 A;  5IAX A;  2Q1Z B;  4MGI E;  4OI4 A;  5DAV A;  5K0U C;  3D0S A;  4BQY A;  1EV1 2;  4TZD A;  4FCA A;  3PU8 A;  4D0Q A;  2V4V A;  2ZHK A;  2H0B A;  2AEY A;  5CZK A;  5A6Q A;  4Q4Y 1;  1HRV 1;  3ZR5 A;  4MGQ A;  4XDP A;  2XKP A;  5JMC A;  2XPJ A;  3J4U H;  1VBA 1;  5IVE A;  2XHK A;  3CO2 A;  1OD3 A;  1KDM A;  1NCR C;  5J3U A;  1MR5 A;  4XBL A; 
#chains in the Genus database with same CATH homology
 1PM4 A;  1POQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...