1PM4A

Crystal structure of yersinia pseudotuberculosis-derived mitogen (ypm)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
IPNIATYTGTIQGKGEVCIIGNKEGKTRGGELYAVLHSTNVNADMTLILLRNVGGNGWGEIKRNDIDKPLKYEDYYTSGLSWIWKIKNNSSETSNYSLDATVHDDKEDSDVLTKCPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and Solution Structures of a Superantigen from Yersinia pseudotuberculosis Reveal a Jelly-Roll Fold.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Toxin
molecule keywords YPM
total genus 28
structure length 117
sequence length 117
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09144 YpM Yersinia pseudo-tuberculosis mitogen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.510 Mainly Beta Sandwich Jelly Rolls Mitogen Ypm 1pm4A00
1PM4A 1POQA
chains in the Genus database with same CATH superfamily
1OOPA 3LCPA 4IEXA 4P5HA 3V56A 1F5FA 5HPOA 1UXXX 4JHTA 3BIEA 2Z69A 2X5IA 1WA6X 2BYVE 2VBPA 2RMU2 5CG8A 4K7JA 5F39A 2WSUA 4YNIA 1FATA 4XJWA 2ZKLA 1F2NA 3T09A 2BUKA 2VNRA 1ND3C 3ATGA 1SCSA 4L97A 2ATFA 4O65A 4EN9B 2JDKA 4GH4A 4EZ4A 1AX1A 2W1WA 4KGQA 2JKBA 4H7LA 1ZZ6A 5CFDB 2XJQA 4Y5Z0 3R0RA 3JD73 3H3ZA 1HRV3 2OZ6A 2PAMA 2AR6A 2Q4SA 4BIOA 3NO8A 3I7DA 3WCRA 5FUIA 4XJZA 2PHLA 1RUI3 2WZEA 3HMYA 3A4UA 3RYPA 3AYDA 2WO7A 1XNTA 5A80A 4GH4C 3KF5A 2RS11 1VRH2 2BNMA 2XLFA 4IUGA 5A7OA 1W6QA 4AHZA 5FJKA 3SHRA 1DQ4A 1O8SA 3FHQA 3SXWA 1NE4A 3OBRA 4FOVA 5F3GA 1HB1A 4OCTA 2YBSA 1KITA 2VXJA 1GUIA 3ZYJB 2E7TA 5JAXA 5KBFA 2GU9A 2VECA 4ZXEA 4GB31 5FY0A 4IETA 2FZ2A 1W8FA 3GBWA 1EPZA 3DEMA 1LNSA 1UKGA 1D0HA 2HBTA 2ZGLA 4PCRA 2IZWA 1PVC2 2WT2A 1I6XA 1R1A2 3NNGA 4OYUA 1J84A 4GWIA 3ES4A 2OQ6A 3D0JA 4GMP3 3AMQA 3BGAA 5A1FA 5E6HA 5A3NA 1PNGA 3M4FA 3H9AA 4QM8A 3SCFA 1AJOA 1OKQA 3H1YA 3N3HA 1ODMA 4NPRA 3V65A 5J37A 1QJY2 1W9FA 2LW8A 3BYWA 3L2HA 4JGZC 5LW9A 5C9AB 4PLMA 5CKQA 3U1XA 4C0HA 3AJYA 4QDRA 3IAQA 5AC93 2RG4A 2YBPA 4XBQA 3H3UA 2Z42A 1JOJA 2Y34A 3CMGA 2R042 2XL9A 3KM5A 4P5YA 1CZVA 4EN6B 3VV1A 3FWEA 4ZU7A 2WINB 2H0VA 2ZZQA 3N7LA 2ZHLA 1LOAA 1ODNA 2A75A 4XFBA 2J1VA 2VM9A 4OFGA 4IV1C 1YJKA 3W5MA 5K0UA 3BU0A 3HBZA 5A7QA 4QQLA 4CCOA 5IJRA 1G9FA 1O3TA 2YC2A 1RINA 2Y0OA 2XPJA 1H9WA 3AKQA 3FHIB 1UIJA 1XE0A 2BV4A 5FZIA 3G7DA 3VBUB 1U5ZA 3AKSA 1FPN3 1EV11 3E97A 5F9TA 4I02A 3IKWA 1KDMA 4AR2A 1X82A 1JHNA 3JBG3 3S5AA 1YI7A 3K2OA 1XOYA 2G9FA 3KQ4B 3TRSB 3VBHC 3ZKYA 5EPAA 1BMV2 4LK7A 2Z79A 2EVXA 1QHDA 1QXRA 4D6SA 3PMSA 5J3UA 3I97A 3DYOA 4NPMA 4Y1UA 1RUG2 2DFBA 2YROA 2BRTA 2QQNA 4I0AA 4TYSA 4FQZA 3EYPA 2IVJA 2H0BA 2GNDA 1FXZA 5LA0A 4Q4V3 4EWAA 3I2JA 2A70A 2VQUA 1MEC2 1QJY3 4CDWC 1F31A 3KLSA 1UQXA 3POEA 4CDXC 2TNFA 4CUBA 4XC9A 1GOFA 3LIGA 3ENRA 2JG8A 1TVGA 4FFHA 2WNUB 4JAAA 3H0OA 3H8UA 2DU1A 3ZIXA 2ZGNA 1OH3A 1UU6A 5AC91 2EIDA 2ZXQA 3RWNA 3SISA 4JZRA 5FPZA 4YW5A 1Z7S2 1LOBA 1XNCA 2A3WA 3GJBA 3KT1A 3NV3A 4V2WA 1A8DA 3K4DA 3JQXA 1YQ8A 2VAUA 2BTVC 1OFSA 2D7FA 5ACA2 5JXJA 2BGPA 4MZUA 1CWPA 3NRUA 3J4UH 1IG0A 1ACCA 3OG2A 4Q0UA 2QQUA 4META 4QX5A 1TMF1 3C2UA 3NNMA 3POWA 4XXAA 4AEMA 2AGSA 1VBD3 3IPVB 4RFRB 4DRVA 2SBAA 1PK6B 1ZBA3 1JTZX 2JE7A 3ON7A 4Q29A 2D6NA 5LBEA 4FAHA 1AR82 4BOWA 1SLIA 1CONA 1VBB2 2G4IA 2TUNA 2WABA 2F4LA 4S2FA 4Y1ZA 4LK6A 5EFUA 3VZLA 5KHHA 1H8TA 1VBE3 4QPIB 3HVDA 3ZN6B 2XQXA 2GMPA 2JG9C 4IEVA 5DPNA 4Y4RA 4B4PA 2CL2A 4PI0A 3WG3A 4BLIA 4XVHA 3AL5A 1LR5A 4BQ2A 4P00B 3QH7A 1YO8A 2R071 1RXGA 2XLAA 5JOWA 4JTNA 1JOBA 1F5JA 3U11A 2XJRA 4QHOA 5FMDA 5CFCC 2VZQA 3AB0A 4QU1A 4XQ4A 3TB0A 1HQNA 1NCRB 2WWSA 2HWC3 2O8OA 1KD7A 3O1UA 1DQ0A 3A0NA 3X29B 5LY1A 1WMDA 2J1AA 2QQVA 4I09A 3VZKA 2IC1A 4Y5TA 5JPMB 4IQPA 4URTA 4CCDA 3INAA 3BKZA 4RR3B 1V6NA 1U5YA 4QB6A 3DPRC 3MPPG 2ZGOA 3VBSA 4AOCA 4JKKA 4JX0A 5FK7A 1HKDA 1LOFC 4FCAA 2RVAA 4HMZA 3IB3A 1ENRA 3WW4A 4CEYB 3OGJA 3LKJA 5J09A 4DY5A 4FQ4A 5FZ1A 1W6MB 3PIJA 2JDZA 3AZVA 1H2NA 5A32A 1BBT3 4H2AA 2PQQA 2WDBA 1WMFA 2CY6A 2R7EB 3EJKA 1MPXA 4KG0A 1VMJA 5FY5A 4D6RA 2VR4A 4EN8B 3HQUA 5EYYA 5FO8B 3FUOA 1TNFA 2B39A 1RGSA 2BWCA 3G6JB 1CIWA 4GJZA 4AVAA 4BM8A 3M3QA 4I01A 1Y9QA 1Y3TA 3POBA 3TNQA 1KGYA 3UESA 2QJVA 1WGPA 1Q8PA 4CDUB 1QJY1 4M00A 4DUVA 1QH7A 2GC1A 2Q8DA 1VBD1 1US3A 2G9GA 2W1UA 3O0XA 3WW1A 5EWSA 1S2KA 4NMIA 1DBNA 3CZUA 1FOD1 3MYXA 4OHZA 4OUMA 2XH6A 3SQOA 2IWGB 3UV9A 1JZ2A 1POV1 2NMOA 3WDTA 2J1TA 5DUVA 1N47A 1XYPA 4XAAA 1H8TB 4XOGA 3B00A 4L0PA 5FJHA 3Q8BA 4MO3M 3B9CA 3JCIA 5C6CA 1JS9A 1DQ2A 3FUQA 3ZYRA 4B3NA 1ZRCA 4IE7A 1RUI2 4YSFA 4UWDA 1IQAA 3LE0A 3W20A 2BGOA 4Q8LA 2OKXA 4HVQA 4XPVA 4JGZA 2DBIA 1DYPA 5FCCA 1UZYA 2VTXJ 3FFQA 3MZHA 1OQDA 3PLQA 2YPDA 3AKTA 1AYN2 1MS9A 2BBAA 1CVNA 5SV8A 2XWBB 3VZJA 2NMNA 5FMOL 4AVBA 4BK5A 1XXNA 5T3NA 1QXPA 3ZN5A 3C7GA 3MICA 2VD7A 4NUBA 4PDWA 3HWJA 4OI2A 3TEXA 2VNOA 1SBFA 3B94A 2PXJA 5AFBA 3AMHA 4DZGA 2BERA 2PQSA 2YMZA 3MW4A 4FT8A 3P1IA 4NHKA 5L36A 3MEPA 1UOJA 3SCHA 4HG6B 1N1SA 1W9SA 1RUD1 3I8TA 3SKVA 4CEWB 1WCUA 4DEQA 4ATFA 1C8NA 1GNYA 4LQRA 3ZFGA 2YU2A 4CDQB 1EAH2 4CPBA 3O0WA 1SPPA 3AZWA 2B5HA 1WW5A 2VQ0A 4UW5A 2A6YA 4NHLA 1ASJ3 1RUJ2 2R32A 1PK6A 4RQPC 3M7AA 2WJSA 1CQ9A 4R52A 5D8AB 2PHUA 2YV8A 1ND3A 2ZKNA 3LSDA 3QLQA 1RUC3 3ZXDA 1SMVA 4KU8A 4BJ0A 4UXAA 2PHFA 5JIAA 5EYXA 3USSA 4A6OA 3N7KA 2ET7A 4GAZA 5AC92 1GZWA 1CPNA 3E6DA 4HSLA 5LWBA 2K46A 1W3XA 2WQ4A 2BQPA 1OA3A 2R043 2JDAA 2VUDA 1UYZA 4PIZA 4NIHA 5IT6A 1CR7A 3APBA 1O91A 1B09A 3E5XA 2YUEA 3O1MA 3JBG1 1LTEA 1OMIA 2X29A 2Z5WA 1POQA 3VD9A 1ZREA 1DLLA 3WLUA 2OIIA 3F2ZA 5FYCA 5DAWA 5GM0A 4DMIA 1W9TA 1WW6A 3VDDB 2RJ2A 4AI0A 3VN4A 4TTGA 3TN91 1DGRA 1XB9A 1H9PA 4LBLA 4E4HA 3ZFEC 4AG4A 1G7YA 2PYTA 4DB5A 2XBO1 2DUQA 4XZUG 3K4ZA 1QOSA 2H6BA 4QHBA 4D8MA 4CDWB 5K0UB 1QGLA 1BKZA 3LWCA 1G8WA 5HCBA 5CZKA 1ZBE2 4Q4V1 1OA4A 1AYM1 2VY0A 5BNOA 1ZZCA 1R64A 3UGHA 1BZWA 4OZXA 4LR4A 5ABJC 4D7SA 2WNVC 3DUIA 4JKLA 4LKDA 5FZ8A 2BW8A 2DUPA 1GNZA 3O14A 3V0BB 3KF3A 3N36A 3VBOB 3N9MA 2VW2A 3OY8B 5FY9A 1D4M2 1C5HA 1OD3A 4XYXA 3LGRA 2W94A 1YHFA 2W91A 3QCWA 3T2OA 3AVRA 3WD5A 2RHPA 1RHI2 1YFWA 4NWWA 1KXGA 2VUCA 1DGWX 3D82A 3HEIA 5FYIA 1D7PM 1LEDA 5GZFA 4YPJA 1OUXA 4FPFA 1J1LA 3DN7A 1S2EA 1HB2A 3VBUC 1NXMA 1XNDA 5K8SA 3WDWA 4FTSA 1WA4A 1ASJ1 1NZCA 3PURA 1EUTA 3VL9A 1C3HA 2JIJA 5F5CA 1TMF3 1SFPA 3RZGA 2XONA 5B2GB 5FDBA 2UYBA 3NSTA 4JV4A 4UFMA 1I5ZA 4YGEA 2ZMNA 1ZBA1 3ZXLA 1YFXA 2HJIA 4UF0A 1XNKA 1VB2A 2J42A 4IV1B 4AW7A 4URAA 4FPOB 3AFGA 3V0AA 2DVBA 4XF0A 3V0AB 4ZS2A 2FMDA 4UFHA 2DVDA 1ZZ9A 4BK4A 5IK4A 1VBA3 3D6EA 4FPGA 3HT2A 1F4HA 1RUD3 3TEYA 5JSOA 3AKPA 1BBT2 2V4AA 1QNWA 3FC0A 3QBQA 2JD9A 3AM2A 4PT6A 2OS2A 1RUG3 3EO6A 3B3QE 2E63A 3WNNA 5CIRA 2P3KA 4AAXA 3OGSA 1X9PA 1MVQA 1WUVA 2JDHA 1GSLA 3J9SA 1R082 4K8RB 3I49A 2B46X 2RS12 3FZ3A 4QAWA 1AR91 1LHOA 3VHOA 4EN7B 2RR12 5C71A 3K51A 2JIGA 5T5PA 1C8M3 1IZ3A 2YY1A 1HRI2 2HKXA 2GNTA 3LEKA 4DINB 4IE0A 5CFCB 3CJIA 4K6BA 4CTEA 3KCXA 1W03A 5DDJ1 1HRV2 3WSOA 4WM7A 1R1ZA 4MX3A 1YCIA 4PBPA 3ILRA 1NY72 3ZYFA 1W6MA 2QBXA 5CA6A 3H42B 4HKOA 3TN93 5A7SA 1N3PA 1LESA 3DL3A 1BBT1 4BE3A 4QPIC 4QXHA 4OI0A 1K42A 4ARYA 3H8XA 2R16A 2CWSA 2ES3A 1OVSA 3AKRA 3JQWA 3WZ1A 1OH4A 3C8XA 4Q26A 4LULA 4GMP1 4BLJA 1DQ1A 5KXBA 4OHYA 1XYNA 2QQWA 3Q8CA 5L19A 3WG1A 2RMU3 5FXVA 4Y20A 2RJLA 4CDQC 5CVRA 1D4M1 3DKWA 3KWVA 1ZZBA 4FPCA 5C3SA 1SCRA 1GV9A 1OPMA 4LLFA 2RS53 3KGZA 4NN0A 5A7WA 1OVPA 3OUJA 1EP0A 2JG8B 2IXKA 3JU9A 2XKOA 1Z0HA 2IUWA 2Q5TA 5DUXA 5FP8A 3V0BA 1HDKA 4DXSA 4Q5OA 2RDNA 2LTNA 2WYFA 4KBZA 2HWD3 4IW3A 1LU2A 1N1VA 3AXEA 4WM8A 3WVJA 4LEJA 3LEIA 2N7GA 2R30A 3MPBA 1RUJ1 3W21A 1R083 2HWC2 3RPQA 1BJQA 4XBLA 3D4KA 2D6MA 4TN7A 1W8TA 4EROA 4NOTA 2JD4A 2CAVA 3VUOA 1O5LA 3BOPA 1PGL2 1OOPB 1HXS1 5A3WA 4QDSA 2BGCA 1I9RA 5ANNA 5A7WB 3IDCB 1RUH2 5GLTA 1OFNA 4BMEA 3OBAA 2D3RA 2ZMLA 2PTMA 5FPAA 5T54A 1NAEA 5BV6A 5H9PA 5FTTC 2AEYA 3J8F3 2W46A 4PQQA 5CFCA 4PBOA 4N9HA 2LUWA 2OPWA 2JB8A 1JYVA 3KQRA 3LSEA 2CNAA 3MV11 5FQ0A 5D8AC 4UFJA 2KD7A 5K0UC 3ASIA 2V5DA 4GQ7A 5FY8A 4AHYA 3O1OA 5FP3A 5J1XA 1PO21 1F9KA 2WZR1 3ZMNA 4S2GA 1E5SA 4AI9A 1ZBE3 3OBZA 3SCGA 2YFUA 3BTYA 5JDBA 5DABA 5A6YA 1HJFA 5GALA 4OQ9A 2HWE3 4ARXA 1OPOA 5L7OC 2WYSA 2VZRA 4AGRA 5JSPA 1UW8A 3MFAA 1OUSA 1FT9A 1XSQA 3WOGA 2NN8A 3KT7A 5FXXA 1E57A 1UAIA 2Y26A 3CJIB 1C8M2 3LDKA 3LFMA 1BEV1 4QXCA 1WCKA 5C4WA 4BXFA 1O3SA 1UY4A 2WLQA 2RS33 4QDQA 1UU5A 3E5UA 3S30A 3UGGA 4BQ1A 3N35A 1YQ6A 5C9AA 2VZUA 4R8HA 2AUYA 4GWNA 4L11A 2JEMA 4ZU4A 4D3WA 3M1HA 2WNUA 1DGRN 5L7OA 4GA9A 1EAH3 1ZZ7A 2DCYA 2Y6KA 4FTBA 1GP5A 2XUEA 4LO5B 4Y24A 4TWTA 5DAQA 3VLBB 3WP6A 4EZHA 3TEWA 2V4VA 1WCSA 2WNVB 4IERA 4FPJA 2WWUA 3CDZB 4Q0QA 5GZDA 2Y8KA 5FY1A 4XHXA 3O1VA 3SLIA 1G9AA 2KA3A 1R1A1 1QDOA 2GAUA 4JRAA 3BI3A 2Z4FA 2ET1A 4IE5A 4HXCA 5KHJA 2I74A 4KGGA 4QQOA 3GZAA 5A3LA 2DVGA 4COZA 4Z8BA 4MGYE 1QEXA 1FNZA 2VUAA 1W9YA 5BNNC 3M3IA 4IV3B 2FDGA 4O9GA 4CVUA 4IV3A 4FFGA 4G4FA 5KXCA 3A0KA 4K8FA 3RI9A 4CU6A 5C8CC 1US2A 1QJX3 1L7LA 1SHWB 1PMIA 1C1LA 1W8NA 4HPKB 4LTAA 2R073 2WO1A 1ENXA 4HN0A 3UNPA 4YG0A 4RSUA 4YW3A 4I3GA 4E8DA 4CUAA 3ILFA 2G19A 2JENA 3AMNA 2FDKA 4UFLA 4XJAA 1UNBA 1I3HA 3LA7A 2VZPA 4WZFA 4CDUA 3AK0A 3L9JT 4DUWA 2W39A 1W2OA 3ZDVA 2ZGQA 3MDPA 3VZOA 4EWDA 4INDA 5B4XA 4AEJA 4F7ZA 1K3IA 1ND2C 5C4WB 3FLPA 5CG9A 1GYKA 5LEKA 2J1RA 2JXAA 4LITA 1RJ8A 3WHUA 1W6OA 4MHRA 1AR71 1VBC2 3ZVXA 3K4AA 3SKJE 3NWKA 3SEPA 3WR0A 4ES8A 2EAAA 2XDVA 4ZY9A 1NT0A 3H3LA 4CPBD 2FDIA 4UBGA 5I91A 5DZGA 3A7QA 4EWEA 4IL7A 2A3XA 5T50A 4BH9A 5LA1A 1TMF2 1GLHA 1X8EA 2HWB2 3HQXA 4LKSA 1APNA 2H6CA 2Y6FA 5A33B 3VB9A 4HVRA 1QXJA 2C9AA 1OF3A 2ZAAA 2JB4A 1MQTA 4DXRA 2D6OX 4NR1A 2VCAA 2K2SA 1Q56A 2RS52 2ZZJA 2VOWA 4Q0VA 5I8YA 1KS5A 2W5FA 3KZ4C 5D21A 5H9QA 4XDOA 2JG9B 2RDSA 2XGXA 3EBRA 3ZYIB 4ZZ5A 1AZDA 4Z82A 4P9IA 1UL9A 1Q5OA 3UT0A 3OF1A 1V6JA 1O3QA 5F5IA 1AR72 3AP7A 3KV9A 5ANQA 5FZ9A 3HQRA 3R6SA 4BHPA 2WIIB 3IIIA 1GFF2 1HRV1 1A34A 3N9LA 2Z2SB 3KGLA 1O7FA 1PVC1 4K3UA 3FBMA 3ZN6A 5M0TA 1OOPC 4HK8A 1NZIA 1SLAA 1LGCA 1J1TA 4R9DA 1F4AA 1K5MC 5A33A 1OC1A 4CCNA 3M3EA 4C1XA 4QGNA 3QD6A 2E9QA 4WM8B 3ZFFC 3PNAA 4X6QB 4C8DA 3QACA 2RR13 5FZ0A 3W9AA 5JI7A 3ZKUA 1XJAA 3WDXA 1U12A 2K9ZA 3O7OA 4XTPA 3PUQA 2FDJA 2YDEA 5BXXA 3RQ0A 1K5MB 3H1WA 1OXCA 2HH9A 4BQ3A 2YZ4A 5GZGA 2I07B 3OOXA 5AFEA 5BY5A 1JYNA 1LGBA 1GZ9A 1A6CA 1W2TA 3I2KA 3OUIA 1UMZA 1S2BA 4QWNA 2FCVA 5DZFA 4QGMA 1AL23 1WLCA 2IVIB 2PLV3 2RV9A 2VW0A 4ATEA 3MGUA 3E6CC 1SBDA 2ZAHA 5LCWL 4A42A 1JYWA 4XUNA 2OPKA 3BN6A 5KHKA 2HWB3 3DXTA 4K9SA 3WUCA 3H8RA 1UZ0A 2DWRA 2WWJA 3NKGA 5A7NA 5ACA3 4JGZB 2OUJA 5C9AC 1CX1A 4WZCA 4LHSA 3VBSC 4XE9A 4B8EA 4XACA 2FZ1A 3N9NA 5HBAA 1JYXA 1UYXA 4E8CA 3HPNA 1AX2A 3MF9A 4MVTA 3ZX7A 1RUC1 1HXS3 2C26A 3ZO0B 1JOPA 2W68A 5EJ3A 1QJU1 2R1DA 1K12A 4LBQD 4XFHA 4IEQA 1RC6A 1NE6A 1ENSA 3WT3A 1XNAA 2GZWA 3GZEA 1QDCA 3ZFGC 3OBTA 2ZHKA 1KFUL 4ASLA 4IEUA 4D69A 5FPXA 3ZSEA 1U5IA 4DQAA 3N7JA 1RHI3 2GC3A 4YM1A 3BIWE 1MVEA 4F83A 4IXLA 5JPNB 4QQPA 4XXPA 2IXLA 3T2PA 4JGYC 5FAXA 1MS8A 5J48A 1IS5A 1Y9MA 2JECA 5FP9A 3P3NA 4E4SA 2Q0AA 2WNOA 1OLME 2HWE1 3GGLA 3VHRA 2JWPA 2KXLA 1AR81 3I3QA 5GLZA 3VBHB 4Q27A 4NO4A 5I8TA 1DYKA 1QJU2 1Z7S3 3H7YA 1JMUB 5FYSA 1BEV2 1XSRA 2CGOA 2VVDA 1WZXA 4XAEA 1W6OB 1RUH1 4DXZA 1PO12 4EE2A 4QPIA 1YC61 4Q4Y3 4K1YA 4TLGA 1Y43B 5EV7A 3ZLIA 5TSWA 2Y33A 5BNPC 1X9TA 2D5FA 4H14A 2EICA 2VTXA 4RA0A 4S2HA 4Y33A 2HLEA 3N7MA 4KNCA 3AP5A 2TBVA 1COV2 1S0EA 3BU7A 4KI5M 4L8QA 4ITCA 2CDOA 2DU0A 4IEOA 1VBD2 4AEDA 1EAH1 3PUIA 1OF4A 4XTMA 4OI4A 5IVFA 1DGLA 4XMAA 1MS5A 3WF4A 5J96B 2OX0A 1ZM1A 1ZA7A 1NX9A 3NAPA 3FHAA 1URXA 3PTYA 3ZSLA 2P3JA 4ZPIA 2VQAA 3O1RA 5GKAC 2AACA 3EB7A 3KB5A 1NLSA 1PIV2 1VBC3 3ZXGA 3O1TA 2VVEA 4OUSA 4XUQA 1JYIA 5LBFA 3GZUC 3UYJA 1S0IA 3IWZA 1JN2P 2VZVA 1DU3D 4XBNA 1NQJA 2R49A 4YW7A 3UETA 4C91A 2PAKA 1RB8G 4B1LA 4YVSB 4EYUA 3T4HB 1XU2A 1VBA1 3JD71 4YW4A 2OYZA 2SLIA 1AYN1 4PIYA 4Y22A 2HWB1 1OLQA 4Q4W1 3VKMA 1QQP1 1R092 2K0GA 3NKTA 3ZN4A 5IVJA 2OA2A 1GBGA 2VW1A 1NG0A 3GBFA 1N3QA 4KWJA 5GLUA 1OT5A 1TE1B 3EQEA 1R093 1V9U1 1Q8OA 4AXOA 2VC9A 1H4HA 4CCLA 2QE3A 4K21A 2Y38A 3K46A 4P02B 3IT8A 1AR93 4AI8A 4CA9A 1HW5A 2GH8A 1AR83 2BVVA 4W6WA 1FPN2 4AVCA 1ZVFA 1QJX2 4IGOA 5FZ3A 1UPIA 1E5IA 3T0AA 4BB3A 2AZ5A 2YXSA 1PX3A 4YVSC 4PDWB 5KXDA 1S0DA 2CDPA 4XFIA 1AR73 1IS4A 3KS7A 5E16A 5F1RA 4A7KA 2FDFA 4N43A 2ENRA 2VO5A 1S0GA 3OPWA 4AFAA 4IE6A 5FRAA 1TQ5A 2J1EA 3VKFC 2C4XA 1ULPA 4GIQA 5L9VA 3ZMOA 2ID4A 3ELNA 3N9QA 3MUY1 4CDWA 2A1XA 1S4CA 4Z2AA 1QF3A 4IEYA 2V73A 4XZPA 5B4NA 1RUF2 1YEWA 3RS6A 1PGW1 1AF9A 5FYHA 3WCSA 5A6QA 2RDRA 5FZAA 2R6QA 4QT6A 4YZ4A 4BQ4A 5FPVA 2A6WA 2HEWF 2RMU1 2YU1A 2QCSB 1NQDA 3NJZA 4F3JA 1W6NB 1J83A 1F15A 3VD7A 4RGKA 3TN92 4AI1A 4D7YA 3HOBA 1G9BA 2QQMA 2HWF1 4HSJA 5FUPA 2XB6C 4XF4A 1J59A 4FXKB 2ILMA 5E88A 3I3MA 3MBWA 1AL22 1AYN3 1S0FA 3K48A 3VHNA 1YWKA 1NOVA 3I59B 4FOQA 4UFKA 1DCSA 3DV8A 3HAGA 3ILNA 3NL1A 2CSGA 1GNHA 3OSDA 5IVEA 1W28A 3OGGA 1TG7A 4YYOA 1HXS2 1LOFA 3KVBA 4RHV1 1HV1A 4QQ2A 1O5UA 4XFCA 3TAYA 4ES9A 4YZ2A 1HJGA 2XVKA 1UOBA 3KV5A 4DRRA 3CL1A 1VAVA 5L73A 1W8OA 4PDWC 1W8WA 4XHBA 1G9CA 2JJ6A 3OD4A 3SH4A 3VDAA 2WSVA 2B4KA 2O0OA 1VPHA 4BQ5A 4YM2A 1H8TC 1QH6A 2YGLA 3UKVA 4KMQA 3RZMA 3R4DB 4CSWA 3PUHA 5DUUA 2ETEA 4ZU5A 5LBCA 1P8JA 5HCAA 3LPFA 3DXUA 4YGCA 1WBFA 5FYBA 1OURA 4B4RA 1O6UA 3A23A 3ECQA 3FMGA 5C5UA 3LEMA 1YQ2A 4LO4B 1JYTA 2AREA 4M01A 3W58A 3WP4A 1VR3A 1JHJA 1ULOA 1X33A 4Q4W3 5JUVA 5IVYA 1LODA 2NPIA 3ZR5A 2BPA2 3RDIA 2YBKA 4UYBA 3J26N 3OPZA 1POV0 1GQHA 2JX9A 1T6BX 3WP5A 4BIFA 2MPFA 4JTOA 2UY8A 2EIEA 3S57A 1FPN1 4FBFA 4NROA 4UW3A 1SLTA 3C7HA 1Y7BA 2WS91 1TME2 4MGTA 3JBG2 5C5TA 1NKGA 5CYYA 3PU8A 5IWFA 1V0AA 1YQCA 2HEYF 1J3QA 4M3CB 5GLVA 4LBMA 1CESA 3PJQA 2LALA 2VZ1A 3DF0A 3IIAA 2D97A 3NAPC 2O1QA 5FZFA 2CAUA 5GLWA 1AUYA 3GYDA 1WMEA 2GP5A 3AYAA 4JDOA 1RUE2 4L2NA 2WZ8A 5BNOB 3ZXAC 3AJZA 4LUKA 5KC5A 3THCA 1S1AA 4XETA 1QNYA 3ZXJA 4WVWA 5I0SA 5FUNA 1QJFA 2V5YA 4IESA 4M4RA 3WNLA 3NNJA 4FP2A 5IVCA 3VBFA 4BU2A 5I93A 2VZ3A 2DF7A 1W6PA 2XVLA 2Y6HA 3BODA 4RHV3 1PNFA 1KFXL 1TZOA 4XIOA 3TNPB 5DN2A 1ULEA 1UD1A 2FDHA 1C57A 4AHWA 2FBEA 2UYAA 2ZGMA 5GZEA 4YW6A 2RS13 1LAJA 1FNYA 4MYEA 4YW1A 1HN1A 1UN1A 4N7IA 2W47A 1IOAA 2PHDA 4WVMB 4XQDA 5DDJ2 4NIAA 1HN0A 4FAGA 4RGAA 2VNVA 2ZABA 1WW4A 2DCZA 4AEDC 2I2SA 2W1QA 2WL1A 1GOHA 2DDUA 4CU8A 4PHZA 1OQEA 3ZSJA 4C1WA 3CKHA 1PZ8A 1YIPA 4AAPA 4Q4W2 2BU9A 5BNQA 4UF0B 1PK6C 4RQPA 4BDVB 1WBLA 4YW2A 4QPWA 2GNBA 1JU4A 4LHLA 4BA6A 4OHXA 5I0TA 5LBBA 4P9YA 3RG0A 1UMIA 2PMWB 1CN1A 1H2KA 2PHWA 2QZ2A 4KQ7A 3ZFGB 4ZZ8A 1RUOA 1BK0A 2BWAA 4GJYA 1IPKA 4HBNA 5BNNA 2X5IC 5F6LB 1HQWA 4R4XA 1XQNA 1I5PA 1RMU3 2A7AA 2RE9A 4XJ9A 3CQOA 2B42B 4IV3C 1CAVB 1BVP1 4PF5A 4Y1YA 4BZ4A 3IZOA 1VALA 2A6XA 3AVSA 3CEWA 1GQPA 1UOFA 3VBRA 1D2SA 3V64A 1VBC1 5LRSA 2YC4A 4JDNA 5DZEA 1PM7A 2CV6A 2ZX3A 3B01A 2NM1A 3FJSA 3HR9A 2IXHA 4Q4X2 1SBEA 5FKBA 3EMRA 4G3YC 5LB6A 5KXEA 1G6NA 1LHVA 4QXKA 2D93A 5F5AA 4NAMA 3WNMA 3NNLA 3M8LA 2OZJA 4HKWA 1ALYA 3RZZA 1W6PB 1COV1 1YNAA 3WDYA 4AEKA 1ZRIA 3VBFB 1DDLA 4PI2A 1QQP3 1G86A 3MV01 2GALA 2LS6A 4HOOA 4L9BA 4PF1A 4YGBA 1VAKA 2Q8OA 2D44A 2VULA 1GANA 1HRI1 1ASJ2 4Y5SA 2VOKA 1PIV3 1JH5A 4LJHA 1STMA 3LOIA 5KWRA 1WCQA 4BPZA 5LEJA 5AVAA 3GCXA 1S0JA 3POJA 4MXWB 4CEWC 4GWMA 3CU7A 1UY2A 3L2YA 3ACGA 3C7EA 4I3PA 2E51A 3T2QA 3MFCA 5F3IA 3ZR6A 1BYHA 1AX0A 3J7HA 3TEZA 3LEGA 4UFIA 1EUUA 2ZEZA 4QD2A 4XEZA 3AP9A 4BXSV 4Q4Y2 3MIEA 3IDEA 4CU7A 4OULA 3SITA 2EA7A 2X09A 2R072 3KCYA 2Y6JA 1GWMA 3OUHA 1SZBA 2ZA9A 3W59A 4LO7A 3I4IA 3NJXA 1XBFA 1JUHA 2DURA 3LD8A 2ARAA 1D0GA 2X05A 3N4MA 4CU9A 2QQKA 1WW7A 4XUPA 2BOIA 5FWEA 1C8M1 1H30A 4CDQA 3Q8AA 1IPSA 3CNAA 1QJZA 2Y60A 4W4ZA 5T5LA 1EV13 3BPSA 4M0HA 1VBB1 2D98A 5FK8A 1NCQB 4XABA 5FZCA 4CXXA 1W8HA 2G9ZA 4AI2A 5BNPA 4KH9A 3POFA 5D1IA 2HBUA 4B7EA 5DDJ3 5HV0A 1W0NA 4RD7A 2RDQA 4QKFA 2YPJA 1VBE2 1CX4A 4Q4X3 3ZXEA 5LK5A 1OKOA 4NRPA 3MW2A 2J7MA 3FLTA 4UW4A 3RGBA 5FZBA 4DO0A 3VD4A 3HN3A 1WD4A 5J98B 4AWDA 1LHUA 3ZSKA 5CB7A 1UF2C 3IM0A 4ASMB 2XUMA 4NAOA 2Q1FA 4XDPA 2Q30A 4P08A 1V6IA 3W5NA 1QY4A 1W9WA 3ZPOA 3RZJA 2RM21 1BK1A 2W92A 3NJVA 4V1PA 5ACA1 4Z2WA 2ZGPA 2ERFA 1EY2A 2D3SA 2E26A 5FOBB 2JG8C 2JKXA 5F2SA 1KQRA 5JOXA 2ZACA 1JZ3A 1LU1A 1GWKA 3LDRA 2BZDA 2WZPP 3S7EA 4MSVA 2C24A 5E1RA 5F7UA 1OLMA 1UKRA 2EIGA 3NV4A 1VBE1 1VIWB 4M3CE 1TME3 2D43A 1BQPA 3FE5A 5FYVA 1V00A 1IG3A 5LY2A 3U78A 5JIUA 1DG6A 2R063 3ITQA 3J7LA 3CBNA 1U0AA 2XVGA 3ZIWA 1W2UA 3IBMA 4CCMA 3M70A 3GM8A 5G04L 3RJ2X 3WG4A 4CEYA 3BPZA 3I3DA 4HLTA 2A5ZA 3OYWB 2ARXA 3T2TA 5C3PA 1COV3 4O7XA 5DQ0A 2KM2A 3O12A 3B02A 1W8UA 3RMXA 2VGDA 2CU5A 3E1F1 1EV12 4GD4A 1MS1A 2JICA 4FTEA 2O8QA 4LORA 2E7AA 1PGL1 4N53C 4RHV2 3T0BA 1BMV1 4CCKA 2ZBJA 2F6BA 2WS93 1NCRA 2BFUL 4R9CA 3DPRA 2Y6GA 4YZ3A 3IMNA 3ETQA 3HBKA 4YG3A 3WHTA 1DFQA 4XURA 3B69A 4CCCA 2QKDA 2VMDA 2G1MA 2ZS6B 2AC1A 1W39A 4XUOA 4IV1A 1QMJA 2ZJCA 4NHXA 4A45A 2D3PA 1Q8SA 2ORXA 4QKDA 4RL7A 5D8AA 1GKBA 2XR4A 1LOEA 4ZONA 1IS6A 2QQLA 4PIXA 3ZDSA 2EIBA 3ZFEA 4CXYA 2VMHA 5CISA 2XJSA 1ENQA 4AVSA 2YFZA 3ROUA 4HT1T 1HQLA 1UY1A 4LE3A 2UY9A 4GALA 2WKKA 1LGNA 3O1SA 1JI6A 3AC0A 5FZOA 1IPJA 2GMMA 5ISLA 2J1UA 2VNGA 1XPWA 3CHXA 2MHFA 1SQ4A 2V72A 1Y9GA 2WT0A 5LA2A 3GALA 5JOZA 1UZZA 2BOJA 4G9SB 1RMU2 1YUDA 1JZ7A 5EXOA 1TME1 1UMHA 4Q4X1 2JG9A 2ZHMA 3U10A 4AL9A 1M06G 2W9XA 2R061 3JB8A 1YFYA 1LKNA 1N1TA 3J7MA 1DGWA 2ADDA 5SV5A 3VGIA 1V6KA 4AVTA 4KL1A 1QQP2 2WNUC 4KBBA 3C7FA 4RS5C 1JW6A 4ORFA 4BISA 1QOOA 5F2WA 3RVHA 3USUA 1H4GA 2P3IA 1GP4A 1RUG1 3MI8A 4LOTA 4OHVA 1TEIA 2ARBA 5F3EA 1H0BA 3DECA 1FYUA 3FX3A 5CADA 2A6ZA 3KSCA 1DQ5A 3WQ7A 2NQYA 2X8KA 1IKQA 2Y64A 5EHDA 4TSVA 5ABJB 1A78A 1W90A 1QJEA 5FKCA 1AJKA 4YZ5A 2GP3A 4LIUA 2XKPA 2DFCA 5FIXA 2FCTA 4M3CA 4MGQA 4YRDA 2IFWA 5JSRA 2EAKA 1LRHA 2E7QA 2P6CA 2E33A 3J8F2 5FYZA 5FXZA 5F6KA 5BYNA 1F8VA 4ZS3A 2VMGA 3WNXA 1LENA 3ZOIA 1X36A 3KCCA 1ZRDA 2BJSA 2LROA 3K75B 4N7UA 4CP2A 2B9UA 3LA2A 4MADA 5A6ZA 4HN1A 5FOJB 3NMBA 4HANA 4U2AA 2VZSA 3RFRA 4QX1A 3RYKA 2E6VA 1O4ZA 2FMYA 3CF6E 4LBQB 1JZ5A 4GULA 4YFWA 1IQDC 3VD3A 4YM0A 5DAPA 3U75A 1AXZA 2W87A 3NQHA 3WNKA 1O3RA 4YLZA 4CP9B 4IEZA 4YVWC 1VE0A 4JC1A 3GHNA 1ND2B 4D7TA 5C4WC 1BLZA 2PAEA 5J7MA 1H6XA 4NIIA 3ZM8A 4Z1VA 5C3RA 5IAXA 4AZZA 1AXYA 5FR3A 3VBOC 3RZLA 3WNOA 4Y20B 4Y26A 4Y1XA 5FY7A 4ISRA 1ZNPA 2VMFA 5C7GA 3BUCA 3I2FA 4COYA 1HB4A 4JVAA 3ES1A 5EIYB 2DVAA 1C28A 2ZOEB 2ZX1A 4YVWA 4PJYA 5C33A 2QQJA 4DUXA 1CAWA 1UPSA 3ABZA 3MLLA 3WP3A 1CD3G 3KMHA 3WQ0A 2WBKA 3PVBB 4RGGA 4W50A 5JXGA 4MXVA 1RITA 3LIHA 3WV6A 1REEA 2W0XA 3WX5A 2VCMA 2WAOA 3AFKA 3AZXA 1REDA 2P3YA 3NV1A 2CHHA 5JI9A 4FSJA 5D2AA 5FWJA 1UYYA 2HEVF 1GWLA 1CAXA 2GC2A 2XXZA 5LA9A 2EXKA 4FPYA 2D40A 4F8AA 1GU3A 1MS3A 3DKQA 4XF3A 3AX4A 4Y1VA 1RJ7A 2DBNA 3ZYBA 3WUDA 3WF0A 1LOCA 5K4LA 1PO13 3ZYPA 4QM9A 5T55A 4D94A 2PN5A 4I30A 5LATA 1UZVA 1RUD2 3QOPA 5DUWA 4M3CF 3Q8FA 1H2LA 1WMXA 1UYPA 1VLNA 1SEFA 2QDRA 4LBJA 4LO6B 4IE4A 1ULCA 3LQCA 3UKNA 1ZBE1 2P34A 4Q4V2 3VBSB 1FV3A 1PZ7A 5F37A 1CZSA 5JMOA 1VMHA 5A3OA 1MS0A 1W3VA 2EXHA 2C0ZA 5FZGA 5FPUA 2QUOA 3S5QA 1SLCA 2PELA 2ZMKA 2RM23 1C1FA 4MUVA 5FQ0B 5A3UA 3RRDA 4XJ8A 3H1MA 5DG2A 1AYM3 2WNVA 4I0BA 5IHRA 1M4WA 4OVEA 5FO7B 2ARCA 2Q8EA 5G05L 4XJUA 3J8F1 1FOD3 2C9KA 2QTWB 3IDAA 5F5QA 2ZGTA 4LO8A 3CJIC 1LULA 1YQ5A 2RS31 2EF6A 5E89A 5CFDC 5FO9B 1AR61 3CIHA 2PLV1 4XFGA 1W0PA 1FAYA 2V09A 1HLCA 2W95A 4N43C 2OUHA 4SBVA 5CKMA 4ZKTB 3MIDA 2ZGUA 3HNMA 3NW4A 2BNNA 4I2OA 2VOXA 4BMBA 4DNYA 4FPHA 3POIA 4FO9A 3TOJA 2DUOA 2TEPA 3BTXA 1NLRA 2MEV2 3BALA 4O9EA 4P9XA 5J36A 3A21A 2ORZA 2GC0A 4N90A 3OEBA 4A3ZA 1J3PA 2JDNA 4LPLA 4ONUA 2JE9A 5I0DA 4QXBA 5A70A 5L9RA 1W0OA 2GN7A 2VH9A 5FP7A 3MW3A 3H8OA 4RQPB 1H2MA 1Q43A 4TZDA 1ONAA 1BEV3 3WXPA 5IFTA 2WA3A 2YGMA 1FMD2 2W08A 3SC7X 1POV3 2NZ9A 4LLOA 1B35A 1AR92 3AYEA 3ZXKA 3J7NA 2UURA 1CGPA 1ULGA 1QKQA 3DPRB 4X6RB 4DIQA 1NXD1 1AR62 4P14A 4OHWA 4AQ2A 4CDXA 4MGIE 2VOTA 4AF9A 5FY4A 4XFAA 2FHRA 4OLLA 4YZ1A 4ZHNA 2JDUA 2MNGA 2VBBA 3ZSMA 1JZ8A 5CEHA 4PQ9A 2CGNA 1UCXA 3PVOA 5FYYA 4R4ZA 4LT5A 1WLTA 3NJYA 3N9PA 1XE7A 4XILA 2VCCA 1MZ5A 1W05A 2VCBA 3ZFFA 2ZGSA 2W3JA 1JZ6A 4JQTA 1A3KA 3GBGA 4A44A 4CYDA 2XJTA 1MZEA 2D6KA 3PUAA 4W65A 2A3YA 3KT4A 4HFSA 4J1XA 3ACIA 4LA2A 4WV8A 3USUB 1XC6A 4E2QA 4N43B 5JZGC 3WY6A 4FPEA 1HV0A 2B45X 3LAGA 2ZPXA 3S0MA 3WW2A 3VDDA 4QU2A 5A3MA 4E2GA 4DPNA 1V70A 1JUIA 1LEMA 4A4AA 2YHJA 1HX6A 3FN9A 4WVZA 5FMCA 3WQ1A 4BQWA 4IEPA 4LIVA 4KWUA 2R041 1X7NA 2DCJA 2VTFA 2WN3A 1VBA2 3POSA 2F17A 2B8MA 4Q1PA 5CAZA 3VBRB 5FLIA 5FZ4A 4A7YA 1RIRA 1UX6A 1GZWB 1S0BA 1H8VA 5T5OA 4HETA 5JWPA 1OD5A 3GNEA 3C3VA 1GZTA 3T1MA 2XHKA 5BPXA 1CAWB 1XE8A 4XCBA 3AXDA 5DAVA 3VL8A 4YVWB 3R05A 2IXJA 4MLOA 4LXLA 3GF6A 1ZX5A 4RR3C 1RTVA 1U5XA 4HPKA 4COVA 3T4VA 1NA1B 1FX5A 4JRLA 3ACHA 4CDUC 1T2XA 1HRI3 5L7OB 1I1EA 3ZYGA 3ACFA 2JDPA 1AYM2 1MEC3 1DIWA 4QQHA 1QIQA 2VG9A 1CAUA 3AL6A 3C7OA 4GB32 4AYUA 5C8CB 2WS92 5C3OA 2XQRA 2ZTNA 2YB7A 1ND2A 3KV4A 3WQBA 1EYBA 4CP9A 3O0VA 3MHZA 3PMEA 2FQPA 2BBVA 3HN1A 1PMHX 2NYYA 4RR3A 1XU1A 3POYA 4IGQA 4KWKA 3LB9A 4DXTA 1ZA4A 1LHNA 1MACA 3RSJA 2WFF3 5HXMA 3THDA 4NHMA 5A3TA 3RZHA 1AL0G 4LKFA 1PVXA 3UGFA 3VKOA 1R081 3AP6A 2WFF2 2X53S 5LK7B 4QX2A 4NJ4A 2WR9A 2XWJB 4JGYA 1FV2A 1VAMA 2HYKA 2A73B 3WDVA 5I8SA 2DV9A 2PHTA 3ACLA 1LHWA 1PM4A 1V9U2 2WQZC 3OYWA 4D6QA 1O8PA 5CFDA 2FD8A 2ZEYA 3VZNA 2VMCA 4R9BA 5FZ7A 4CUCA 1DQ6A 1ZRRA 4X8PA 4JHZA 1OHFA 1JODA 3BCWA 3GJAA 4RS5B 3WG2A 1JZ4A 3VDBA 5FMOS 3HD8B 2VU9A 1OSGA 1REFA 1K45A 1CJPA 4FXGB 3U0ZA 2DVFA 2JE8A 5FBJA 1YRZA 4C90A 5JCTA 5IK8A 1UO9A 3IPVA 1O59A 1RUE3 1X50A 4BYYA 4CRQA 1L7QA 3WF2A 2WLPA 3ALQA 3M3CA 1H6YA 2PHXA 1HB3A 2RM22 1W6QB 4KWLA 4N9IA 4HONA 3AZZA 2E32A 4FFFA 2QQPA 3D8CA 3SH5A 1RYYA 1NA1A 4P9JA 4B7KA 3ZXFA 3OB8A 4ISQA 4AFDA 4QPYA 1CZTA 2WUHA 3K3NA 2OT7A 1S55A 5DAXA 4OUEA 4AFCA 1RUF3 3CO2A 5DG1A 1VP6A 2ZX0A 3LFIA 4NVPA 1MEC1 4CEYC 1SFNA 3BOWA 1GOGA 4W6XA 5HXVA 1GICA 3PUSA 1ULDA 5JXIA 4IEWA 2X10A 4H3WA 3URFA 3NVCA 2GSYA 3Q8EA 3IN9A 4WBBA 4MOAA 1PZ9A 4AK3A 4LHNA 1WLDA 4FP3A 4HL0A 4IGPA 5JMCA 2ZX2A 2UWCA 3RMYA 3SEEA 4A7ZA 4JCKA 1GQGA 2YG0A 4GMP0 1DP0A 3VKNA 4LBKA 1NCQA 3E5QA 1RL3A 1BCXA 2WO3A 3PL0A 1KDKA 3WINE 4D0QA 1SDWA 1V6LA 4I0WB 3P6BA 3LF7A 3VHPA 2QDNA 1YJLA 4KG8A 4AFBA 1XRUA 1NCRC 4YARA 2VPVA 3JXSA 3ZFEB 5KR7A 1WLWA 3QH6A 1Q3EA 4XQWA 3WEZA 2X5IB 4MGSA 1R1A3 4QMAA 5H9RA 3VDDC 2XLGA 1LB2A 2GMEA 5ERLA 4S2DA 4TXWA 1VJ2A 1RUNA 2ZX4A 3N9OA 1WKYA 4NWVA 1C4RA 1ULFA 3WF1A 5A1LA 1Z7S1 1UIKA 4K1ZA 1EPWA 3MLJA 5FLJA 1D4M3 1K5JA 4GH4B 4AE2A 2GH2A 1DZTA 5JLVA 3CZJA 3PDQA 2DYCA 4A3XA 1SLLA 3FLRA 1W6NA 1AR63 1PGSA 1J3RA 5C3QA 4FOWA 4AFMA 4LMFA 2OXBA 3AMMA 2XMLA 3THTA 2W52A 2WA4A 4LKEA 1L3JA 2XJPA 1ZRFA 1K5MA 1YYNA 3LA3A 4DS0A 3LZZA 1L7RA 2AEZA 2HWD1 4W8JA 1WCDJ 2XJUA 4XIKA 5JR7B 2P37A 4YGDA 4LBNA 4AQTA 2QZ3A 1T6GC 2D6PA 1RUJ3 4AI3A 5A1AA 5EP9A 2ZEXA 4QX3A 3P3PA 5CBLA 2ZGKA 5LRRA 1FOD2 3HJRA 3OTFA 4WM7B 2E31A 2DTWA 3JB4C 4COUA 4UBHA 2P6HA 3BVCA 1JXNA 5A32B 1RUH3 4J25A 5GJ6A 5A7PA 2RS51 2WN2A 3GCWA 5JXHA 1CAUB 3UKTA 3VDCA 3VBHA 5BNOC 1MR5A 4C0BA 3U07A 1UX7A 4FFIA 1RVF3 2UWBA 2ZCWA 3JUUA 5KHIA 2PLV2 2AH2A 1DLCA 4Y4YA 3T30A 2VXRA 2LRPA 3UJQA 2OVUA 3MUZ1 4NE9A 3GXUA 4A6SA 3HIFA 3SNMA 4EV0A 1XNBA 1IHMA 4JQRA 5FV3A 1H1AA 4LNVA 4CP0A 1NUKA 3LPGA 4XW3A 4BCUA 5IVVA 2XBO3 3OJBA 4QGLA 2UWAA 1PO23 2WZR3 4NHYA 4UAPA 1UU4A 3WW3A 1AXKA 1KJRA 3EXUA 2NLRA 3PVNA 4XFFA 5FPLA 2C6SA 4L92A 5FZLA 1AHSA 2XJVA 4V2VA 2BNOA 2JDYA 2WAAA 4Y22B 3UK9A 4PLNA 4LE4A 1BXHA 3M2MA 2CTVA 4CXWA 5A3PA 4Q0SA 1QOTA 5BNPB 3U14A 5IVBA 4UW6A 1C5IA 3FBYA 4P9GA 3ZPYA 3JD72 1CJDA 1W99A 3KHCA 3S6PA 3T3YA 4WVMA 2A71A 1KJLA 2Q1MA 1NA1C 4P9LA 3AZYA 3I3BA 5FZHA 3VBUA 3KD4A 2MEV3 1OI6A 1J58A 2EXIA 3TYJA 1UOGA 1D2QA 1ZYBA 1OBNA 1V9U3 5FPBA 4E4DX 4OI1A 3RYRA 5HI0A 2ZHNA 3T08A 4DFSA 2AENA 5GZCA 1KEXA 4B1MA 2VOVA 4A2UA 2QNKA 4YM3A 2QFEA 5FZEA 3VBOA 4W6YA 2WQ8A 4MGZE 3VD5A 1BHGA 1H1IA 4NPLA 5C8WA 4DY3A 1FMD3 3O5SA 5JOYA 2D6LX 2W1SA 5IK5A 1QJU3 4U36A 3UJOA 4GKYA 1NCQC 4RFT0 4UI9L 2NP0A 4UT5A 4NRMA 4CP1A 3B93A 2IFRA 5KC6A 4YFZA 1CIYA 2HWF3 3E6BA 1RVF1 1PX4A 3OEAA 3A22A 2PA7A 2UU8A 4QB2A 3I54A 1V6OA 2YC0A 4MHUA 1ND3B 3DCQA 2XBO2 2B9VA 1LOGA 3I2HA 3IMMA 4WM7C 5LZ6A 1RHI1 5HCHA 5A6XA 4M0NA 1YLLA 2IXIA 3FL7A 1W2AX 3CJXA 2L9LA 1E5HA 1GP6A 1IKPA 1RUC2 2BFUS 4QKNA 3I2OA 4CCEA 1NLQA 4LBQA 1UY3A 2ZEWA 4N53B 4K20A 5FLHA 4B29A 1IS3A 3R4UA 4MH0E 4MG2A 2VE1A 1ST8A 3GZTB 1W06A 1VB4A 1SDDB 2Q8CA 4CZSA 3I59A 5H9SA 1MS4A 5IUQA 1W8ZA 3KV6A 1MZFA 5L9BA 3WNPA 5HCFA 3SH3A 4QPGA 2DCKA 1SACA 1QJX1 4AQSA 2BDRA 5FZOB 1BVVA 2XOMA 2KR2A 4ZXKA 5I0RA 5FZ6A 1PO11 1RUI1 4GZ9A 3U4SA 3FFZA 1VRBA 4BQYA 1SG3A 5FYTA 3I3EA 5AVPA 5DMYA 2YYOA 5IATA 5JZGA 1G9DA 2ZGRA 3T0DA 1N3OA 1Z78A 3IAPA 2VMEA 4J1WA 4GXLA 4WM8C 3ZFFB 4QPGC 4AGVA 3I2IA 1DZQA 1VBB3 3OGVA 5EJ1B 4OQ8A 2QQIA 4R9AA 5FZMA 1TNRA 1RXFA 3MF6A 2EALA 1RUF1 4E27A 5IAVA 2WO2A 1UY0A 1UWWA 3SMHA 4GB33 4OMCA 5APAA 3R4SA 3MIBA 4AGGA 4M4PA 3UL2A 4CDXB 2PFWA 3LDBA 1QU0A 4Z07A 3NAPB 5F32A 2PHRA 1NY71 2D5HA 2R0FA 3EHKA 4GKXA 1WWYA 4OZOA 5FFOC 3DYMA 5I0UA 1V6MA 5JVVA 3RWKX 3VBFC 5CKNA 3PJYA 4MGKE 3GDBA 1YXWA 3RNSA 5F8PA 5K9YA 1LECA 3K77A 3NNFA 5JR2A 1WD3A 1R091 3KVAA 4N53A 5IK7A 3MLKA 3TBDA 4B4QA 2RR11 5F3CA 3ETPA 3BTAA 4QX7A 5IW0A 1PGW2 2WC2A 5E8AA 2P5BA 2VUJA 1DF0A 1X8MA 4CEWA 2VQTA 4UOJA 2XHNA 1DYOA 1VRH1 3D3AA 3M3OA 3PHMA 3RJRA 2VJXA 4YWAA 4FPLA 4QPGB 4A41A 1JYCA 4HKLA 2R062 3THPA 3GHMA 4HZFA 3U37A 2A6VA 4J6GA 2BEOA 3AYCA 4BQXA 1DHKB 5FXWA 3Q9OA 1PVC3 2F4PA 2Y6LA 4CCJA 4EJRA 3OD0A 3T1LA 3AP4A 1F35A 1AL21 3K3OA 4Q2FA 2OQ7A 2J1SA 4LOSA 5IFPA 2CGPA 1W2NA 4XCAA 5IYYA 3RZKA 3O1PA 3HNYM 2GN3A 3OCPA 5HV4A 1N1YA 2Q1ZB 1VMFA 2HWD2 4HVOA 2VBDA 4IDZA 2EXJA 1UXZA 4Y3OA 4AQ6A 4E4ZA 1UZWA 2CWMA 2P4EA 1ZBA2 4Q1RA 1OQ1A 2WFPA 3JZVA 3F95A 1HIXA 4JGYB 3CLPA 1YIFA 1GR3A 1S0CA 1B35C 1RMU1 4Z92B 4TLFA 5EZWA 5FYMA 4AEDB 3OY8A 4YVSA 5FZDA 1QWRA 3WDUA 2IXCA 2RS32 2VMIA 4MV2A 4ASKA 4K40A 1LCLA 1H1MA 4HK9A 1OLRA 3MIHA 4XMIA 2VZOA 2OW4A 2Y0IA 4JKMA 1ZZ8A 4FPKA 4KU7A 2QVSB 4Q8KA 4MXWA 4RS5A 3VZMA 3MIGA 1O4TA 4XUTA 4E9KA 5BNNB 3TWIA 3ST7A 2HYXA 5K7PA 1CAXB 3DYPA 5T5JA 3H7JA 5C8CA 4LHKA 4BWOA 3B5LB 3D0SA 1A8MA 1JBCA 1PMJX 2VVFA 1MZ6A 2W2IA 1NYWA 5KHGA 3KHBA 4FVVA 2QQOA 2C5DA 4XDQA 3AMPA 1GZCA 4QKBA 1KRIA 4H55A 4QB1A 4CUGA 3BTZA 2R0HA 2XL7A 3ORJA 3P5BA 3MIFA 4SLIA 1PIV1 5FZKA 3LOBA 3MO4A 4E2SA 2LM3A 2WRAA 4X8NA 3RI8A 2HWE2 1CPMA 1Y4WA 4Q0PA 2HWF2 2R1BA 1JU3A 1O4YA 3PIGA 1OA2A 2DTYA 2VL4A 5EQUA 4RN5A 3H50A 4QX0A 3VBRC 4FOYA 2P1BA 1B35B 1XYOA 2J22A 1Q8VA 5BUVA 2AYHA 4ET7A 5DXDA 4OMDA 1CAVA 4EN0A 4H7MA 2ADEA 5T52A 4DEVA 4LUMA 2VZTA 3ME2A 4L99A 3BB6A 4PLOA 1YI9A 5FREA 5C70A 3B9IA 4CE8A 1PO22 2WZR2 3IDBB 2WFF1 5JZGB 2GNMA 4P9WA 2CYFA 1SPPB 5FBZA 1DZRA 1PHMA 4N8MA 2B7YA 2JDMA 2MEV1 4QHZA 4XF1A 4WVVA 3I2DA 2WT1A 4YG6A 2DCTA 1GMMA 1AVBA 2XG3A 5FP4A 1E5RA 3PVEA 1IGOA 2E53A 3D5OA 3U4XA 2P2KA 2O14A 3HNBM 1Q8QA 3OGRA 4AHXA 1SLBA 4COWA 2WNEA 4GWJA 2I45A 4O61A 4QX8A 3ZYHA 1VRH3 4FI9A 3S7IA 1KS4A 3WF3A 5EJZB 1FMD1 5LASA 2RJKA 4Q4Y1 5FMBA 3NV2A 4NRQA 4NIDA 3PU3A 3I2GA 5CU1A 5FYUA 1LJ7A 3VKLA 3B7MA 2GDFA 3DGTA 4DOUA 4LBOA 1MQTB 4LA3A 1RVF2 3OPTA 2HWC1 1SFYA 4JDMA 3PTRB 4NIGA 2C1FA 5ABJA 2P17A 1RUE1 1YFUA 4RYDA 2BVBA 5CNAA 2BP6A 4XF9A 4EQVA 1FI2A 3HT1A 1W04A 4AVVA 3POGA 1D4VB 2FCUA 1MQTC
chains in the Genus database with same CATH topology
1PM4A 1POQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PM4 A;  1POQ A; 
#chains in the Genus database with same CATH topology
 1OOP A;  3LCP A;  4IEX A;  4P5H A;  3V56 A;  1F5F A;  5HPO A;  1UXX X;  4JHT A;  3BIE A;  2Z69 A;  2X5I A;  1WA6 X;  2BYV E;  2VBP A;  2RMU 2;  5CG8 A;  4K7J A;  5F39 A;  2WSU A;  4YNI A;  1FAT A;  4XJW A;  2ZKL A;  1F2N A;  3T09 A;  2BUK A;  2VNR A;  1ND3 C;  3ATG A;  1SCS A;  4L97 A;  2ATF A;  4O65 A;  4EN9 B;  2JDK A;  4GH4 A;  4EZ4 A;  1AX1 A;  2W1W A;  4KGQ A;  2JKB A;  4H7L A;  1ZZ6 A;  5CFD B;  2XJQ A;  4Y5Z 0;  3R0R A;  3JD7 3;  3H3Z A;  1HRV 3;  2OZ6 A;  2PAM A;  2AR6 A;  2Q4S A;  4BIO A;  3NO8 A;  3I7D A;  3WCR A;  5FUI A;  4XJZ A;  2PHL A;  1RUI 3;  2WZE A;  3HMY A;  3A4U A;  3RYP A;  3AYD A;  2WO7 A;  1XNT A;  5A80 A;  4GH4 C;  3KF5 A;  2RS1 1;  1VRH 2;  2BNM A;  2XLF A;  4IUG A;  5A7O A;  1W6Q A;  4AHZ A;  5FJK A;  3SHR A;  1DQ4 A;  1O8S A;  3FHQ A;  3SXW A;  1NE4 A;  3OBR A;  4FOV A;  5F3G A;  1HB1 A;  4OCT A;  2YBS A;  1KIT A;  2VXJ A;  1GUI A;  3ZYJ B;  2E7T A;  5JAX A;  5KBF A;  2GU9 A;  2VEC A;  4ZXE A;  4GB3 1;  5FY0 A;  4IET A;  2FZ2 A;  1W8F A;  3GBW A;  1EPZ A;  3DEM A;  1LNS A;  1UKG A;  1D0H A;  2HBT A;  2ZGL A;  4PCR A;  2IZW A;  1PVC 2;  2WT2 A;  1I6X A;  1R1A 2;  3NNG A;  4OYU A;  1J84 A;  4GWI A;  3ES4 A;  2OQ6 A;  3D0J A;  4GMP 3;  3AMQ A;  3BGA A;  5A1F A;  5E6H A;  5A3N A;  1PNG A;  3M4F A;  3H9A A;  4QM8 A;  3SCF A;  1AJO A;  1OKQ A;  3H1Y A;  3N3H A;  1ODM A;  4NPR A;  3V65 A;  5J37 A;  1QJY 2;  1W9F A;  2LW8 A;  3BYW A;  3L2H A;  4JGZ C;  5LW9 A;  5C9A B;  4PLM A;  5CKQ A;  3U1X A;  4C0H A;  3AJY A;  4QDR A;  3IAQ A;  5AC9 3;  2RG4 A;  2YBP A;  4XBQ A;  3H3U A;  2Z42 A;  1JOJ A;  2Y34 A;  3CMG A;  2R04 2;  2XL9 A;  3KM5 A;  4P5Y A;  1CZV A;  4EN6 B;  3VV1 A;  3FWE A;  4ZU7 A;  2WIN B;  2H0V A;  2ZZQ A;  3N7L A;  2ZHL A;  1LOA A;  1ODN A;  2A75 A;  4XFB A;  2J1V A;  2VM9 A;  4OFG A;  4IV1 C;  1YJK A;  3W5M A;  5K0U A;  3BU0 A;  3HBZ A;  5A7Q A;  4QQL A;  4CCO A;  5IJR A;  1G9F A;  1O3T A;  2YC2 A;  1RIN A;  2Y0O A;  2XPJ A;  1H9W A;  3AKQ A;  3FHI B;  1UIJ A;  1XE0 A;  2BV4 A;  5FZI A;  3G7D A;  3VBU B;  1U5Z A;  3AKS A;  1FPN 3;  1EV1 1;  3E97 A;  5F9T A;  4I02 A;  3IKW A;  1KDM A;  4AR2 A;  1X82 A;  1JHN A;  3JBG 3;  3S5A A;  1YI7 A;  3K2O A;  1XOY A;  2G9F A;  3KQ4 B;  3TRS B;  3VBH C;  3ZKY A;  5EPA A;  1BMV 2;  4LK7 A;  2Z79 A;  2EVX A;  1QHD A;  1QXR A;  4D6S A;  3PMS A;  5J3U A;  3I97 A;  3DYO A;  4NPM A;  4Y1U A;  1RUG 2;  2DFB A;  2YRO A;  2BRT A;  2QQN A;  4I0A A;  4TYS A;  4FQZ A;  3EYP A;  2IVJ A;  2H0B A;  2GND A;  1FXZ A;  5LA0 A;  4Q4V 3;  4EWA A;  3I2J A;  2A70 A;  2VQU A;  1MEC 2;  1QJY 3;  4CDW C;  1F31 A;  3KLS A;  1UQX A;  3POE A;  4CDX C;  2TNF A;  4CUB A;  4XC9 A;  1GOF A;  3LIG A;  3ENR A;  2JG8 A;  1TVG A;  4FFH A;  2WNU B;  4JAA A;  3H0O A;  3H8U A;  2DU1 A;  3ZIX A;  2ZGN A;  1OH3 A;  1UU6 A;  5AC9 1;  2EID A;  2ZXQ A;  3RWN A;  3SIS A;  4JZR A;  5FPZ A;  4YW5 A;  1Z7S 2;  1LOB A;  1XNC A;  2A3W A;  3GJB A;  3KT1 A;  3NV3 A;  4V2W A;  1A8D A;  3K4D A;  3JQX A;  1YQ8 A;  2VAU A;  2BTV C;  1OFS A;  2D7F A;  5ACA 2;  5JXJ A;  2BGP A;  4MZU A;  1CWP A;  3NRU A;  3J4U H;  1IG0 A;  1ACC A;  3OG2 A;  4Q0U A;  2QQU A;  4MET A;  4QX5 A;  1TMF 1;  3C2U A;  3NNM A;  3POW A;  4XXA A;  4AEM A;  2AGS A;  1VBD 3;  3IPV B;  4RFR B;  4DRV A;  2SBA A;  1PK6 B;  1ZBA 3;  1JTZ X;  2JE7 A;  3ON7 A;  4Q29 A;  2D6N A;  5LBE A;  4FAH A;  1AR8 2;  4BOW A;  1SLI A;  1CON A;  1VBB 2;  2G4I A;  2TUN A;  2WAB A;  2F4L A;  4S2F A;  4Y1Z A;  4LK6 A;  5EFU A;  3VZL A;  5KHH A;  1H8T A;  1VBE 3;  4QPI B;  3HVD A;  3ZN6 B;  2XQX A;  2GMP A;  2JG9 C;  4IEV A;  5DPN A;  4Y4R A;  4B4P A;  2CL2 A;  4PI0 A;  3WG3 A;  4BLI A;  4XVH A;  3AL5 A;  1LR5 A;  4BQ2 A;  4P00 B;  3QH7 A;  1YO8 A;  2R07 1;  1RXG A;  2XLA A;  5JOW A;  4JTN A;  1JOB A;  1F5J A;  3U11 A;  2XJR A;  4QHO A;  5FMD A;  5CFC C;  2VZQ A;  3AB0 A;  4QU1 A;  4XQ4 A;  3TB0 A;  1HQN A;  1NCR B;  2WWS A;  2HWC 3;  2O8O A;  1KD7 A;  3O1U A;  1DQ0 A;  3A0N A;  3X29 B;  5LY1 A;  1WMD A;  2J1A A;  2QQV A;  4I09 A;  3VZK A;  2IC1 A;  4Y5T A;  5JPM B;  4IQP A;  4URT A;  4CCD A;  3INA A;  3BKZ A;  4RR3 B;  1V6N A;  1U5Y A;  4QB6 A;  3DPR C;  3MPP G;  2ZGO A;  3VBS A;  4AOC A;  4JKK A;  4JX0 A;  5FK7 A;  1HKD A;  1LOF C;  4FCA A;  2RVA A;  4HMZ A;  3IB3 A;  1ENR A;  3WW4 A;  4CEY B;  3OGJ A;  3LKJ A;  5J09 A;  4DY5 A;  4FQ4 A;  5FZ1 A;  1W6M B;  3PIJ A;  2JDZ A;  3AZV A;  1H2N A;  5A32 A;  1BBT 3;  4H2A A;  2PQQ A;  2WDB A;  1WMF A;  2CY6 A;  2R7E B;  3EJK A;  1MPX A;  4KG0 A;  1VMJ A;  5FY5 A;  4D6R A;  2VR4 A;  4EN8 B;  3HQU A;  5EYY A;  5FO8 B;  3FUO A;  1TNF A;  2B39 A;  1RGS A;  2BWC A;  3G6J B;  1CIW A;  4GJZ A;  4AVA A;  4BM8 A;  3M3Q A;  4I01 A;  1Y9Q A;  1Y3T A;  3POB A;  3TNQ A;  1KGY A;  3UES A;  2QJV A;  1WGP A;  1Q8P A;  4CDU B;  1QJY 1;  4M00 A;  4DUV A;  1QH7 A;  2GC1 A;  2Q8D A;  1VBD 1;  1US3 A;  2G9G A;  2W1U A;  3O0X A;  3WW1 A;  5EWS A;  1S2K A;  4NMI A;  1DBN A;  3CZU A;  1FOD 1;  3MYX A;  4OHZ A;  4OUM A;  2XH6 A;  3SQO A;  2IWG B;  3UV9 A;  1JZ2 A;  1POV 1;  2NMO A;  3WDT A;  2J1T A;  5DUV A;  1N47 A;  1XYP A;  4XAA A;  1H8T B;  4XOG A;  3B00 A;  4L0P A;  5FJH A;  3Q8B A;  4MO3 M;  3B9C A;  3JCI A;  5C6C A;  1JS9 A;  1DQ2 A;  3FUQ A;  3ZYR A;  4B3N A;  1ZRC A;  4IE7 A;  1RUI 2;  4YSF A;  4UWD A;  1IQA A;  3LE0 A;  3W20 A;  2BGO A;  4Q8L A;  2OKX A;  4HVQ A;  4XPV A;  4JGZ A;  2DBI A;  1DYP A;  5FCC A;  1UZY A;  2VTX J;  3FFQ A;  3MZH A;  1OQD A;  3PLQ A;  2YPD A;  3AKT A;  1AYN 2;  1MS9 A;  2BBA A;  1CVN A;  5SV8 A;  2XWB B;  3VZJ A;  2NMN A;  5FMO L;  4AVB A;  4BK5 A;  1XXN A;  5T3N A;  1QXP A;  3ZN5 A;  3C7G A;  3MIC A;  2VD7 A;  4NUB A;  4PDW A;  3HWJ A;  4OI2 A;  3TEX A;  2VNO A;  1SBF A;  3B94 A;  2PXJ A;  5AFB A;  3AMH A;  4DZG A;  2BER A;  2PQS A;  2YMZ A;  3MW4 A;  4FT8 A;  3P1I A;  4NHK A;  5L36 A;  3MEP A;  1UOJ A;  3SCH A;  4HG6 B;  1N1S A;  1W9S A;  1RUD 1;  3I8T A;  3SKV A;  4CEW B;  1WCU A;  4DEQ A;  4ATF A;  1C8N A;  1GNY A;  4LQR A;  3ZFG A;  2YU2 A;  4CDQ B;  1EAH 2;  4CPB A;  3O0W A;  1SPP A;  3AZW A;  2B5H A;  1WW5 A;  2VQ0 A;  4UW5 A;  2A6Y A;  4NHL A;  1ASJ 3;  1RUJ 2;  2R32 A;  1PK6 A;  4RQP C;  3M7A A;  2WJS A;  1CQ9 A;  4R52 A;  5D8A B;  2PHU A;  2YV8 A;  1ND3 A;  2ZKN A;  3LSD A;  3QLQ A;  1RUC 3;  3ZXD A;  1SMV A;  4KU8 A;  4BJ0 A;  4UXA A;  2PHF A;  5JIA A;  5EYX A;  3USS A;  4A6O A;  3N7K A;  2ET7 A;  4GAZ A;  5AC9 2;  1GZW A;  1CPN A;  3E6D A;  4HSL A;  5LWB A;  2K46 A;  1W3X A;  2WQ4 A;  2BQP A;  1OA3 A;  2R04 3;  2JDA A;  2VUD A;  1UYZ A;  4PIZ A;  4NIH A;  5IT6 A;  1CR7 A;  3APB A;  1O91 A;  1B09 A;  3E5X A;  2YUE A;  3O1M A;  3JBG 1;  1LTE A;  1OMI A;  2X29 A;  2Z5W A;  1POQ A;  3VD9 A;  1ZRE A;  1DLL A;  3WLU A;  2OII A;  3F2Z A;  5FYC A;  5DAW A;  5GM0 A;  4DMI A;  1W9T A;  1WW6 A;  3VDD B;  2RJ2 A;  4AI0 A;  3VN4 A;  4TTG A;  3TN9 1;  1DGR A;  1XB9 A;  1H9P A;  4LBL A;  4E4H A;  3ZFE C;  4AG4 A;  1G7Y A;  2PYT A;  4DB5 A;  2XBO 1;  2DUQ A;  4XZU G;  3K4Z A;  1QOS A;  2H6B A;  4QHB A;  4D8M A;  4CDW B;  5K0U B;  1QGL A;  1BKZ A;  3LWC A;  1G8W A;  5HCB A;  5CZK A;  1ZBE 2;  4Q4V 1;  1OA4 A;  1AYM 1;  2VY0 A;  5BNO A;  1ZZC A;  1R64 A;  3UGH A;  1BZW A;  4OZX A;  4LR4 A;  5ABJ C;  4D7S A;  2WNV C;  3DUI A;  4JKL A;  4LKD A;  5FZ8 A;  2BW8 A;  2DUP A;  1GNZ A;  3O14 A;  3V0B B;  3KF3 A;  3N36 A;  3VBO B;  3N9M A;  2VW2 A;  3OY8 B;  5FY9 A;  1D4M 2;  1C5H A;  1OD3 A;  4XYX A;  3LGR A;  2W94 A;  1YHF A;  2W91 A;  3QCW A;  3T2O A;  3AVR A;  3WD5 A;  2RHP A;  1RHI 2;  1YFW A;  4NWW A;  1KXG A;  2VUC A;  1DGW X;  3D82 A;  3HEI A;  5FYI A;  1D7P M;  1LED A;  5GZF A;  4YPJ A;  1OUX A;  4FPF A;  1J1L A;  3DN7 A;  1S2E A;  1HB2 A;  3VBU C;  1NXM A;  1XND A;  5K8S A;  3WDW A;  4FTS A;  1WA4 A;  1ASJ 1;  1NZC A;  3PUR A;  1EUT A;  3VL9 A;  1C3H A;  2JIJ A;  5F5C A;  1TMF 3;  1SFP A;  3RZG A;  2XON A;  5B2G B;  5FDB A;  2UYB A;  3NST A;  4JV4 A;  4UFM A;  1I5Z A;  4YGE A;  2ZMN A;  1ZBA 1;  3ZXL A;  1YFX A;  2HJI A;  4UF0 A;  1XNK A;  1VB2 A;  2J42 A;  4IV1 B;  4AW7 A;  4URA A;  4FPO B;  3AFG A;  3V0A A;  2DVB A;  4XF0 A;  3V0A B;  4ZS2 A;  2FMD A;  4UFH A;  2DVD A;  1ZZ9 A;  4BK4 A;  5IK4 A;  1VBA 3;  3D6E A;  4FPG A;  3HT2 A;  1F4H A;  1RUD 3;  3TEY A;  5JSO A;  3AKP A;  1BBT 2;  2V4A A;  1QNW A;  3FC0 A;  3QBQ A;  2JD9 A;  3AM2 A;  4PT6 A;  2OS2 A;  1RUG 3;  3EO6 A;  3B3Q E;  2E63 A;  3WNN A;  5CIR A;  2P3K A;  4AAX A;  3OGS A;  1X9P A;  1MVQ A;  1WUV A;  2JDH A;  1GSL A;  3J9S A;  1R08 2;  4K8R B;  3I49 A;  2B46 X;  2RS1 2;  3FZ3 A;  4QAW A;  1AR9 1;  1LHO A;  3VHO A;  4EN7 B;  2RR1 2;  5C71 A;  3K51 A;  2JIG A;  5T5P A;  1C8M 3;  1IZ3 A;  2YY1 A;  1HRI 2;  2HKX A;  2GNT A;  3LEK A;  4DIN B;  4IE0 A;  5CFC B;  3CJI A;  4K6B A;  4CTE A;  3KCX A;  1W03 A;  5DDJ 1;  1HRV 2;  3WSO A;  4WM7 A;  1R1Z A;  4MX3 A;  1YCI A;  4PBP A;  3ILR A;  1NY7 2;  3ZYF A;  1W6M A;  2QBX A;  5CA6 A;  3H42 B;  4HKO A;  3TN9 3;  5A7S A;  1N3P A;  1LES A;  3DL3 A;  1BBT 1;  4BE3 A;  4QPI C;  4QXH A;  4OI0 A;  1K42 A;  4ARY A;  3H8X A;  2R16 A;  2CWS A;  2ES3 A;  1OVS A;  3AKR A;  3JQW A;  3WZ1 A;  1OH4 A;  3C8X A;  4Q26 A;  4LUL A;  4GMP 1;  4BLJ A;  1DQ1 A;  5KXB A;  4OHY A;  1XYN A;  2QQW A;  3Q8C A;  5L19 A;  3WG1 A;  2RMU 3;  5FXV A;  4Y20 A;  2RJL A;  4CDQ C;  5CVR A;  1D4M 1;  3DKW A;  3KWV A;  1ZZB A;  4FPC A;  5C3S A;  1SCR A;  1GV9 A;  1OPM A;  4LLF A;  2RS5 3;  3KGZ A;  4NN0 A;  5A7W A;  1OVP A;  3OUJ A;  1EP0 A;  2JG8 B;  2IXK A;  3JU9 A;  2XKO A;  1Z0H A;  2IUW A;  2Q5T A;  5DUX A;  5FP8 A;  3V0B A;  1HDK A;  4DXS A;  4Q5O A;  2RDN A;  2LTN A;  2WYF A;  4KBZ A;  2HWD 3;  4IW3 A;  1LU2 A;  1N1V A;  3AXE A;  4WM8 A;  3WVJ A;  4LEJ A;  3LEI A;  2N7G A;  2R30 A;  3MPB A;  1RUJ 1;  3W21 A;  1R08 3;  2HWC 2;  3RPQ A;  1BJQ A;  4XBL A;  3D4K A;  2D6M A;  4TN7 A;  1W8T A;  4ERO A;  4NOT A;  2JD4 A;  2CAV A;  3VUO A;  1O5L A;  3BOP A;  1PGL 2;  1OOP B;  1HXS 1;  5A3W A;  4QDS A;  2BGC A;  1I9R A;  5ANN A;  5A7W B;  3IDC B;  1RUH 2;  5GLT A;  1OFN A;  4BME A;  3OBA A;  2D3R A;  2ZML A;  2PTM A;  5FPA A;  5T54 A;  1NAE A;  5BV6 A;  5H9P A;  5FTT C;  2AEY A;  3J8F 3;  2W46 A;  4PQQ A;  5CFC A;  4PBO A;  4N9H A;  2LUW A;  2OPW A;  2JB8 A;  1JYV A;  3KQR A;  3LSE A;  2CNA A;  3MV1 1;  5FQ0 A;  5D8A C;  4UFJ A;  2KD7 A;  5K0U C;  3ASI A;  2V5D A;  4GQ7 A;  5FY8 A;  4AHY A;  3O1O A;  5FP3 A;  5J1X A;  1PO2 1;  1F9K A;  2WZR 1;  3ZMN A;  4S2G A;  1E5S A;  4AI9 A;  1ZBE 3;  3OBZ A;  3SCG A;  2YFU A;  3BTY A;  5JDB A;  5DAB A;  5A6Y A;  1HJF A;  5GAL A;  4OQ9 A;  2HWE 3;  4ARX A;  1OPO A;  5L7O C;  2WYS A;  2VZR A;  4AGR A;  5JSP A;  1UW8 A;  3MFA A;  1OUS A;  1FT9 A;  1XSQ A;  3WOG A;  2NN8 A;  3KT7 A;  5FXX A;  1E57 A;  1UAI A;  2Y26 A;  3CJI B;  1C8M 2;  3LDK A;  3LFM A;  1BEV 1;  4QXC A;  1WCK A;  5C4W A;  4BXF A;  1O3S A;  1UY4 A;  2WLQ A;  2RS3 3;  4QDQ A;  1UU5 A;  3E5U A;  3S30 A;  3UGG A;  4BQ1 A;  3N35 A;  1YQ6 A;  5C9A A;  2VZU A;  4R8H A;  2AUY A;  4GWN A;  4L11 A;  2JEM A;  4ZU4 A;  4D3W A;  3M1H A;  2WNU A;  1DGR N;  5L7O A;  4GA9 A;  1EAH 3;  1ZZ7 A;  2DCY A;  2Y6K A;  4FTB A;  1GP5 A;  2XUE A;  4LO5 B;  4Y24 A;  4TWT A;  5DAQ A;  3VLB B;  3WP6 A;  4EZH A;  3TEW A;  2V4V A;  1WCS A;  2WNV B;  4IER A;  4FPJ A;  2WWU A;  3CDZ B;  4Q0Q A;  5GZD A;  2Y8K A;  5FY1 A;  4XHX A;  3O1V A;  3SLI A;  1G9A A;  2KA3 A;  1R1A 1;  1QDO A;  2GAU A;  4JRA A;  3BI3 A;  2Z4F A;  2ET1 A;  4IE5 A;  4HXC A;  5KHJ A;  2I74 A;  4KGG A;  4QQO A;  3GZA A;  5A3L A;  2DVG A;  4COZ A;  4Z8B A;  4MGY E;  1QEX A;  1FNZ A;  2VUA A;  1W9Y A;  5BNN C;  3M3I A;  4IV3 B;  2FDG A;  4O9G A;  4CVU A;  4IV3 A;  4FFG A;  4G4F A;  5KXC A;  3A0K A;  4K8F A;  3RI9 A;  4CU6 A;  5C8C C;  1US2 A;  1QJX 3;  1L7L A;  1SHW B;  1PMI A;  1C1L A;  1W8N A;  4HPK B;  4LTA A;  2R07 3;  2WO1 A;  1ENX A;  4HN0 A;  3UNP A;  4YG0 A;  4RSU A;  4YW3 A;  4I3G A;  4E8D A;  4CUA A;  3ILF A;  2G19 A;  2JEN A;  3AMN A;  2FDK A;  4UFL A;  4XJA A;  1UNB A;  1I3H A;  3LA7 A;  2VZP A;  4WZF A;  4CDU A;  3AK0 A;  3L9J T;  4DUW A;  2W39 A;  1W2O A;  3ZDV A;  2ZGQ A;  3MDP A;  3VZO A;  4EWD A;  4IND A;  5B4X A;  4AEJ A;  4F7Z A;  1K3I A;  1ND2 C;  5C4W B;  3FLP A;  5CG9 A;  1GYK A;  5LEK A;  2J1R A;  2JXA A;  4LIT A;  1RJ8 A;  3WHU A;  1W6O A;  4MHR A;  1AR7 1;  1VBC 2;  3ZVX A;  3K4A A;  3SKJ E;  3NWK A;  3SEP A;  3WR0 A;  4ES8 A;  2EAA A;  2XDV A;  4ZY9 A;  1NT0 A;  3H3L A;  4CPB D;  2FDI A;  4UBG A;  5I91 A;  5DZG A;  3A7Q A;  4EWE A;  4IL7 A;  2A3X A;  5T50 A;  4BH9 A;  5LA1 A;  1TMF 2;  1GLH A;  1X8E A;  2HWB 2;  3HQX A;  4LKS A;  1APN A;  2H6C A;  2Y6F A;  5A33 B;  3VB9 A;  4HVR A;  1QXJ A;  2C9A A;  1OF3 A;  2ZAA A;  2JB4 A;  1MQT A;  4DXR A;  2D6O X;  4NR1 A;  2VCA A;  2K2S A;  1Q56 A;  2RS5 2;  2ZZJ A;  2VOW A;  4Q0V A;  5I8Y A;  1KS5 A;  2W5F A;  3KZ4 C;  5D21 A;  5H9Q A;  4XDO A;  2JG9 B;  2RDS A;  2XGX A;  3EBR A;  3ZYI B;  4ZZ5 A;  1AZD A;  4Z82 A;  4P9I A;  1UL9 A;  1Q5O A;  3UT0 A;  3OF1 A;  1V6J A;  1O3Q A;  5F5I A;  1AR7 2;  3AP7 A;  3KV9 A;  5ANQ A;  5FZ9 A;  3HQR A;  3R6S A;  4BHP A;  2WII B;  3III A;  1GFF 2;  1HRV 1;  1A34 A;  3N9L A;  2Z2S B;  3KGL A;  1O7F A;  1PVC 1;  4K3U A;  3FBM A;  3ZN6 A;  5M0T A;  1OOP C;  4HK8 A;  1NZI A;  1SLA A;  1LGC A;  1J1T A;  4R9D A;  1F4A A;  1K5M C;  5A33 A;  1OC1 A;  4CCN A;  3M3E A;  4C1X A;  4QGN A;  3QD6 A;  2E9Q A;  4WM8 B;  3ZFF C;  3PNA A;  4X6Q B;  4C8D A;  3QAC A;  2RR1 3;  5FZ0 A;  3W9A A;  5JI7 A;  3ZKU A;  1XJA A;  3WDX A;  1U12 A;  2K9Z A;  3O7O A;  4XTP A;  3PUQ A;  2FDJ A;  2YDE A;  5BXX A;  3RQ0 A;  1K5M B;  3H1W A;  1OXC A;  2HH9 A;  4BQ3 A;  2YZ4 A;  5GZG A;  2I07 B;  3OOX A;  5AFE A;  5BY5 A;  1JYN A;  1LGB A;  1GZ9 A;  1A6C A;  1W2T A;  3I2K A;  3OUI A;  1UMZ A;  1S2B A;  4QWN A;  2FCV A;  5DZF A;  4QGM A;  1AL2 3;  1WLC A;  2IVI B;  2PLV 3;  2RV9 A;  2VW0 A;  4ATE A;  3MGU A;  3E6C C;  1SBD A;  2ZAH A;  5LCW L;  4A42 A;  1JYW A;  4XUN A;  2OPK A;  3BN6 A;  5KHK A;  2HWB 3;  3DXT A;  4K9S A;  3WUC A;  3H8R A;  1UZ0 A;  2DWR A;  2WWJ A;  3NKG A;  5A7N A;  5ACA 3;  4JGZ B;  2OUJ A;  5C9A C;  1CX1 A;  4WZC A;  4LHS A;  3VBS C;  4XE9 A;  4B8E A;  4XAC A;  2FZ1 A;  3N9N A;  5HBA A;  1JYX A;  1UYX A;  4E8C A;  3HPN A;  1AX2 A;  3MF9 A;  4MVT A;  3ZX7 A;  1RUC 1;  1HXS 3;  2C26 A;  3ZO0 B;  1JOP A;  2W68 A;  5EJ3 A;  1QJU 1;  2R1D A;  1K12 A;  4LBQ D;  4XFH A;  4IEQ A;  1RC6 A;  1NE6 A;  1ENS A;  3WT3 A;  1XNA A;  2GZW A;  3GZE A;  1QDC A;  3ZFG C;  3OBT A;  2ZHK A;  1KFU L;  4ASL A;  4IEU A;  4D69 A;  5FPX A;  3ZSE A;  1U5I A;  4DQA A;  3N7J A;  1RHI 3;  2GC3 A;  4YM1 A;  3BIW E;  1MVE A;  4F83 A;  4IXL A;  5JPN B;  4QQP A;  4XXP A;  2IXL A;  3T2P A;  4JGY C;  5FAX A;  1MS8 A;  5J48 A;  1IS5 A;  1Y9M A;  2JEC A;  5FP9 A;  3P3N A;  4E4S A;  2Q0A A;  2WNO A;  1OLM E;  2HWE 1;  3GGL A;  3VHR A;  2JWP A;  2KXL A;  1AR8 1;  3I3Q A;  5GLZ A;  3VBH B;  4Q27 A;  4NO4 A;  5I8T A;  1DYK A;  1QJU 2;  1Z7S 3;  3H7Y A;  1JMU B;  5FYS A;  1BEV 2;  1XSR A;  2CGO A;  2VVD A;  1WZX A;  4XAE A;  1W6O B;  1RUH 1;  4DXZ A;  1PO1 2;  4EE2 A;  4QPI A;  1YC6 1;  4Q4Y 3;  4K1Y A;  4TLG A;  1Y43 B;  5EV7 A;  3ZLI A;  5TSW A;  2Y33 A;  5BNP C;  1X9T A;  2D5F A;  4H14 A;  2EIC A;  2VTX A;  4RA0 A;  4S2H A;  4Y33 A;  2HLE A;  3N7M A;  4KNC A;  3AP5 A;  2TBV A;  1COV 2;  1S0E A;  3BU7 A;  4KI5 M;  4L8Q A;  4ITC A;  2CDO A;  2DU0 A;  4IEO A;  1VBD 2;  4AED A;  1EAH 1;  3PUI A;  1OF4 A;  4XTM A;  4OI4 A;  5IVF A;  1DGL A;  4XMA A;  1MS5 A;  3WF4 A;  5J96 B;  2OX0 A;  1ZM1 A;  1ZA7 A;  1NX9 A;  3NAP A;  3FHA A;  1URX A;  3PTY A;  3ZSL A;  2P3J A;  4ZPI A;  2VQA A;  3O1R A;  5GKA C;  2AAC A;  3EB7 A;  3KB5 A;  1NLS A;  1PIV 2;  1VBC 3;  3ZXG A;  3O1T A;  2VVE A;  4OUS A;  4XUQ A;  1JYI A;  5LBF A;  3GZU C;  3UYJ A;  1S0I A;  3IWZ A;  1JN2 P;  2VZV A;  1DU3 D;  4XBN A;  1NQJ A;  2R49 A;  4YW7 A;  3UET A;  4C91 A;  2PAK A;  1RB8 G;  4B1L A;  4YVS B;  4EYU A;  3T4H B;  1XU2 A;  1VBA 1;  3JD7 1;  4YW4 A;  2OYZ A;  2SLI A;  1AYN 1;  4PIY A;  4Y22 A;  2HWB 1;  1OLQ A;  4Q4W 1;  3VKM A;  1QQP 1;  1R09 2;  2K0G A;  3NKT A;  3ZN4 A;  5IVJ A;  2OA2 A;  1GBG A;  2VW1 A;  1NG0 A;  3GBF A;  1N3Q A;  4KWJ A;  5GLU A;  1OT5 A;  1TE1 B;  3EQE A;  1R09 3;  1V9U 1;  1Q8O A;  4AXO A;  2VC9 A;  1H4H A;  4CCL A;  2QE3 A;  4K21 A;  2Y38 A;  3K46 A;  4P02 B;  3IT8 A;  1AR9 3;  4AI8 A;  4CA9 A;  1HW5 A;  2GH8 A;  1AR8 3;  2BVV A;  4W6W A;  1FPN 2;  4AVC A;  1ZVF A;  1QJX 2;  4IGO A;  5FZ3 A;  1UPI A;  1E5I A;  3T0A A;  4BB3 A;  2AZ5 A;  2YXS A;  1PX3 A;  4YVS C;  4PDW B;  5KXD A;  1S0D A;  2CDP A;  4XFI A;  1AR7 3;  1IS4 A;  3KS7 A;  5E16 A;  5F1R A;  4A7K A;  2FDF A;  4N43 A;  2ENR A;  2VO5 A;  1S0G A;  3OPW A;  4AFA A;  4IE6 A;  5FRA A;  1TQ5 A;  2J1E A;  3VKF C;  2C4X A;  1ULP A;  4GIQ A;  5L9V A;  3ZMO A;  2ID4 A;  3ELN A;  3N9Q A;  3MUY 1;  4CDW A;  2A1X A;  1S4C A;  4Z2A A;  1QF3 A;  4IEY A;  2V73 A;  4XZP A;  5B4N A;  1RUF 2;  1YEW A;  3RS6 A;  1PGW 1;  1AF9 A;  5FYH A;  3WCS A;  5A6Q A;  2RDR A;  5FZA A;  2R6Q A;  4QT6 A;  4YZ4 A;  4BQ4 A;  5FPV A;  2A6W A;  2HEW F;  2RMU 1;  2YU1 A;  2QCS B;  1NQD A;  3NJZ A;  4F3J A;  1W6N B;  1J83 A;  1F15 A;  3VD7 A;  4RGK A;  3TN9 2;  4AI1 A;  4D7Y A;  3HOB A;  1G9B A;  2QQM A;  2HWF 1;  4HSJ A;  5FUP A;  2XB6 C;  4XF4 A;  1J59 A;  4FXK B;  2ILM A;  5E88 A;  3I3M A;  3MBW A;  1AL2 2;  1AYN 3;  1S0F A;  3K48 A;  3VHN A;  1YWK A;  1NOV A;  3I59 B;  4FOQ A;  4UFK A;  1DCS A;  3DV8 A;  3HAG A;  3ILN A;  3NL1 A;  2CSG A;  1GNH A;  3OSD A;  5IVE A;  1W28 A;  3OGG A;  1TG7 A;  4YYO A;  1HXS 2;  1LOF A;  3KVB A;  4RHV 1;  1HV1 A;  4QQ2 A;  1O5U A;  4XFC A;  3TAY A;  4ES9 A;  4YZ2 A;  1HJG A;  2XVK A;  1UOB A;  3KV5 A;  4DRR A;  3CL1 A;  1VAV A;  5L73 A;  1W8O A;  4PDW C;  1W8W A;  4XHB A;  1G9C A;  2JJ6 A;  3OD4 A;  3SH4 A;  3VDA A;  2WSV A;  2B4K A;  2O0O A;  1VPH A;  4BQ5 A;  4YM2 A;  1H8T C;  1QH6 A;  2YGL A;  3UKV A;  4KMQ A;  3RZM A;  3R4D B;  4CSW A;  3PUH A;  5DUU A;  2ETE A;  4ZU5 A;  5LBC A;  1P8J A;  5HCA A;  3LPF A;  3DXU A;  4YGC A;  1WBF A;  5FYB A;  1OUR A;  4B4R A;  1O6U A;  3A23 A;  3ECQ A;  3FMG A;  5C5U A;  3LEM A;  1YQ2 A;  4LO4 B;  1JYT A;  2ARE A;  4M01 A;  3W58 A;  3WP4 A;  1VR3 A;  1JHJ A;  1ULO A;  1X33 A;  4Q4W 3;  5JUV A;  5IVY A;  1LOD A;  2NPI A;  3ZR5 A;  2BPA 2;  3RDI A;  2YBK A;  4UYB A;  3J26 N;  3OPZ A;  1POV 0;  1GQH A;  2JX9 A;  1T6B X;  3WP5 A;  4BIF A;  2MPF A;  4JTO A;  2UY8 A;  2EIE A;  3S57 A;  1FPN 1;  4FBF A;  4NRO A;  4UW3 A;  1SLT A;  3C7H A;  1Y7B A;  2WS9 1;  1TME 2;  4MGT A;  3JBG 2;  5C5T A;  1NKG A;  5CYY A;  3PU8 A;  5IWF A;  1V0A A;  1YQC A;  2HEY F;  1J3Q A;  4M3C B;  5GLV A;  4LBM A;  1CES A;  3PJQ A;  2LAL A;  2VZ1 A;  3DF0 A;  3IIA A;  2D97 A;  3NAP C;  2O1Q A;  5FZF A;  2CAU A;  5GLW A;  1AUY A;  3GYD A;  1WME A;  2GP5 A;  3AYA A;  4JDO A;  1RUE 2;  4L2N A;  2WZ8 A;  5BNO B;  3ZXA C;  3AJZ A;  4LUK A;  5KC5 A;  3THC A;  1S1A A;  4XET A;  1QNY A;  3ZXJ A;  4WVW A;  5I0S A;  5FUN A;  1QJF A;  2V5Y A;  4IES A;  4M4R A;  3WNL A;  3NNJ A;  4FP2 A;  5IVC A;  3VBF A;  4BU2 A;  5I93 A;  2VZ3 A;  2DF7 A;  1W6P A;  2XVL A;  2Y6H A;  3BOD A;  4RHV 3;  1PNF A;  1KFX L;  1TZO A;  4XIO A;  3TNP B;  5DN2 A;  1ULE A;  1UD1 A;  2FDH A;  1C57 A;  4AHW A;  2FBE A;  2UYA A;  2ZGM A;  5GZE A;  4YW6 A;  2RS1 3;  1LAJ A;  1FNY A;  4MYE A;  4YW1 A;  1HN1 A;  1UN1 A;  4N7I A;  2W47 A;  1IOA A;  2PHD A;  4WVM B;  4XQD A;  5DDJ 2;  4NIA A;  1HN0 A;  4FAG A;  4RGA A;  2VNV A;  2ZAB A;  1WW4 A;  2DCZ A;  4AED C;  2I2S A;  2W1Q A;  2WL1 A;  1GOH A;  2DDU A;  4CU8 A;  4PHZ A;  1OQE A;  3ZSJ A;  4C1W A;  3CKH A;  1PZ8 A;  1YIP A;  4AAP A;  4Q4W 2;  2BU9 A;  5BNQ A;  4UF0 B;  1PK6 C;  4RQP A;  4BDV B;  1WBL A;  4YW2 A;  4QPW A;  2GNB A;  1JU4 A;  4LHL A;  4BA6 A;  4OHX A;  5I0T A;  5LBB A;  4P9Y A;  3RG0 A;  1UMI A;  2PMW B;  1CN1 A;  1H2K A;  2PHW A;  2QZ2 A;  4KQ7 A;  3ZFG B;  4ZZ8 A;  1RUO A;  1BK0 A;  2BWA A;  4GJY A;  1IPK A;  4HBN A;  5BNN A;  2X5I C;  5F6L B;  1HQW A;  4R4X A;  1XQN A;  1I5P A;  1RMU 3;  2A7A A;  2RE9 A;  4XJ9 A;  3CQO A;  2B42 B;  4IV3 C;  1CAV B;  1BVP 1;  4PF5 A;  4Y1Y A;  4BZ4 A;  3IZO A;  1VAL A;  2A6X A;  3AVS A;  3CEW A;  1GQP A;  1UOF A;  3VBR A;  1D2S A;  3V64 A;  1VBC 1;  5LRS A;  2YC4 A;  4JDN A;  5DZE A;  1PM7 A;  2CV6 A;  2ZX3 A;  3B01 A;  2NM1 A;  3FJS A;  3HR9 A;  2IXH A;  4Q4X 2;  1SBE A;  5FKB A;  3EMR A;  4G3Y C;  5LB6 A;  5KXE A;  1G6N A;  1LHV A;  4QXK A;  2D93 A;  5F5A A;  4NAM A;  3WNM A;  3NNL A;  3M8L A;  2OZJ A;  4HKW A;  1ALY A;  3RZZ A;  1W6P B;  1COV 1;  1YNA A;  3WDY A;  4AEK A;  1ZRI A;  3VBF B;  1DDL A;  4PI2 A;  1QQP 3;  1G86 A;  3MV0 1;  2GAL A;  2LS6 A;  4HOO A;  4L9B A;  4PF1 A;  4YGB A;  1VAK A;  2Q8O A;  2D44 A;  2VUL A;  1GAN A;  1HRI 1;  1ASJ 2;  4Y5S A;  2VOK A;  1PIV 3;  1JH5 A;  4LJH A;  1STM A;  3LOI A;  5KWR A;  1WCQ A;  4BPZ A;  5LEJ A;  5AVA A;  3GCX A;  1S0J A;  3POJ A;  4MXW B;  4CEW C;  4GWM A;  3CU7 A;  1UY2 A;  3L2Y A;  3ACG A;  3C7E A;  4I3P A;  2E51 A;  3T2Q A;  3MFC A;  5F3I A;  3ZR6 A;  1BYH A;  1AX0 A;  3J7H A;  3TEZ A;  3LEG A;  4UFI A;  1EUU A;  2ZEZ A;  4QD2 A;  4XEZ A;  3AP9 A;  4BXS V;  4Q4Y 2;  3MIE A;  3IDE A;  4CU7 A;  4OUL A;  3SIT A;  2EA7 A;  2X09 A;  2R07 2;  3KCY A;  2Y6J A;  1GWM A;  3OUH A;  1SZB A;  2ZA9 A;  3W59 A;  4LO7 A;  3I4I A;  3NJX A;  1XBF A;  1JUH A;  2DUR A;  3LD8 A;  2ARA A;  1D0G A;  2X05 A;  3N4M A;  4CU9 A;  2QQK A;  1WW7 A;  4XUP A;  2BOI A;  5FWE A;  1C8M 1;  1H30 A;  4CDQ A;  3Q8A A;  1IPS A;  3CNA A;  1QJZ A;  2Y60 A;  4W4Z A;  5T5L A;  1EV1 3;  3BPS A;  4M0H A;  1VBB 1;  2D98 A;  5FK8 A;  1NCQ B;  4XAB A;  5FZC A;  4CXX A;  1W8H A;  2G9Z A;  4AI2 A;  5BNP A;  4KH9 A;  3POF A;  5D1I A;  2HBU A;  4B7E A;  5DDJ 3;  5HV0 A;  1W0N A;  4RD7 A;  2RDQ A;  4QKF A;  2YPJ A;  1VBE 2;  1CX4 A;  4Q4X 3;  3ZXE A;  5LK5 A;  1OKO A;  4NRP A;  3MW2 A;  2J7M A;  3FLT A;  4UW4 A;  3RGB A;  5FZB A;  4DO0 A;  3VD4 A;  3HN3 A;  1WD4 A;  5J98 B;  4AWD A;  1LHU A;  3ZSK A;  5CB7 A;  1UF2 C;  3IM0 A;  4ASM B;  2XUM A;  4NAO A;  2Q1F A;  4XDP A;  2Q30 A;  4P08 A;  1V6I A;  3W5N A;  1QY4 A;  1W9W A;  3ZPO A;  3RZJ A;  2RM2 1;  1BK1 A;  2W92 A;  3NJV A;  4V1P A;  5ACA 1;  4Z2W A;  2ZGP A;  2ERF A;  1EY2 A;  2D3S A;  2E26 A;  5FOB B;  2JG8 C;  2JKX A;  5F2S A;  1KQR A;  5JOX A;  2ZAC A;  1JZ3 A;  1LU1 A;  1GWK A;  3LDR A;  2BZD A;  2WZP P;  3S7E A;  4MSV A;  2C24 A;  5E1R A;  5F7U A;  1OLM A;  1UKR A;  2EIG A;  3NV4 A;  1VBE 1;  1VIW B;  4M3C E;  1TME 3;  2D43 A;  1BQP A;  3FE5 A;  5FYV A;  1V00 A;  1IG3 A;  5LY2 A;  3U78 A;  5JIU A;  1DG6 A;  2R06 3;  3ITQ A;  3J7L A;  3CBN A;  1U0A A;  2XVG A;  3ZIW A;  1W2U A;  3IBM A;  4CCM A;  3M70 A;  3GM8 A;  5G04 L;  3RJ2 X;  3WG4 A;  4CEY A;  3BPZ A;  3I3D A;  4HLT A;  2A5Z A;  3OYW B;  2ARX A;  3T2T A;  5C3P A;  1COV 3;  4O7X A;  5DQ0 A;  2KM2 A;  3O12 A;  3B02 A;  1W8U A;  3RMX A;  2VGD A;  2CU5 A;  3E1F 1;  1EV1 2;  4GD4 A;  1MS1 A;  2JIC A;  4FTE A;  2O8Q A;  4LOR A;  2E7A A;  1PGL 1;  4N53 C;  4RHV 2;  3T0B A;  1BMV 1;  4CCK A;  2ZBJ A;  2F6B A;  2WS9 3;  1NCR A;  2BFU L;  4R9C A;  3DPR A;  2Y6G A;  4YZ3 A;  3IMN A;  3ETQ A;  3HBK A;  4YG3 A;  3WHT A;  1DFQ A;  4XUR A;  3B69 A;  4CCC A;  2QKD A;  2VMD A;  2G1M A;  2ZS6 B;  2AC1 A;  1W39 A;  4XUO A;  4IV1 A;  1QMJ A;  2ZJC A;  4NHX A;  4A45 A;  2D3P A;  1Q8S A;  2ORX A;  4QKD A;  4RL7 A;  5D8A A;  1GKB A;  2XR4 A;  1LOE A;  4ZON A;  1IS6 A;  2QQL A;  4PIX A;  3ZDS A;  2EIB A;  3ZFE A;  4CXY A;  2VMH A;  5CIS A;  2XJS A;  1ENQ A;  4AVS A;  2YFZ A;  3ROU A;  4HT1 T;  1HQL A;  1UY1 A;  4LE3 A;  2UY9 A;  4GAL A;  2WKK A;  1LGN A;  3O1S A;  1JI6 A;  3AC0 A;  5FZO A;  1IPJ A;  2GMM A;  5ISL A;  2J1U A;  2VNG A;  1XPW A;  3CHX A;  2MHF A;  1SQ4 A;  2V72 A;  1Y9G A;  2WT0 A;  5LA2 A;  3GAL A;  5JOZ A;  1UZZ A;  2BOJ A;  4G9S B;  1RMU 2;  1YUD A;  1JZ7 A;  5EXO A;  1TME 1;  1UMH A;  4Q4X 1;  2JG9 A;  2ZHM A;  3U10 A;  4AL9 A;  1M06 G;  2W9X A;  2R06 1;  3JB8 A;  1YFY A;  1LKN A;  1N1T A;  3J7M A;  1DGW A;  2ADD A;  5SV5 A;  3VGI A;  1V6K A;  4AVT A;  4KL1 A;  1QQP 2;  2WNU C;  4KBB A;  3C7F A;  4RS5 C;  1JW6 A;  4ORF A;  4BIS A;  1QOO A;  5F2W A;  3RVH A;  3USU A;  1H4G A;  2P3I A;  1GP4 A;  1RUG 1;  3MI8 A;  4LOT A;  4OHV A;  1TEI A;  2ARB A;  5F3E A;  1H0B A;  3DEC A;  1FYU A;  3FX3 A;  5CAD A;  2A6Z A;  3KSC A;  1DQ5 A;  3WQ7 A;  2NQY A;  2X8K A;  1IKQ A;  2Y64 A;  5EHD A;  4TSV A;  5ABJ B;  1A78 A;  1W90 A;  1QJE A;  5FKC A;  1AJK A;  4YZ5 A;  2GP3 A;  4LIU A;  2XKP A;  2DFC A;  5FIX A;  2FCT A;  4M3C A;  4MGQ A;  4YRD A;  2IFW A;  5JSR A;  2EAK A;  1LRH A;  2E7Q A;  2P6C A;  2E33 A;  3J8F 2;  5FYZ A;  5FXZ A;  5F6K A;  5BYN A;  1F8V A;  4ZS3 A;  2VMG A;  3WNX A;  1LEN A;  3ZOI A;  1X36 A;  3KCC A;  1ZRD A;  2BJS A;  2LRO A;  3K75 B;  4N7U A;  4CP2 A;  2B9U A;  3LA2 A;  4MAD A;  5A6Z A;  4HN1 A;  5FOJ B;  3NMB A;  4HAN A;  4U2A A;  2VZS A;  3RFR A;  4QX1 A;  3RYK A;  2E6V A;  1O4Z A;  2FMY A;  3CF6 E;  4LBQ B;  1JZ5 A;  4GUL A;  4YFW A;  1IQD C;  3VD3 A;  4YM0 A;  5DAP A;  3U75 A;  1AXZ A;  2W87 A;  3NQH A;  3WNK A;  1O3R A;  4YLZ A;  4CP9 B;  4IEZ A;  4YVW C;  1VE0 A;  4JC1 A;  3GHN A;  1ND2 B;  4D7T A;  5C4W C;  1BLZ A;  2PAE A;  5J7M A;  1H6X A;  4NII A;  3ZM8 A;  4Z1V A;  5C3R A;  5IAX A;  4AZZ A;  1AXY A;  5FR3 A;  3VBO C;  3RZL A;  3WNO A;  4Y20 B;  4Y26 A;  4Y1X A;  5FY7 A;  4ISR A;  1ZNP A;  2VMF A;  5C7G A;  3BUC A;  3I2F A;  4COY A;  1HB4 A;  4JVA A;  3ES1 A;  5EIY B;  2DVA A;  1C28 A;  2ZOE B;  2ZX1 A;  4YVW A;  4PJY A;  5C33 A;  2QQJ A;  4DUX A;  1CAW A;  1UPS A;  3ABZ A;  3MLL A;  3WP3 A;  1CD3 G;  3KMH A;  3WQ0 A;  2WBK A;  3PVB B;  4RGG A;  4W50 A;  5JXG A;  4MXV A;  1RIT A;  3LIH A;  3WV6 A;  1REE A;  2W0X A;  3WX5 A;  2VCM A;  2WAO A;  3AFK A;  3AZX A;  1RED A;  2P3Y A;  3NV1 A;  2CHH A;  5JI9 A;  4FSJ A;  5D2A A;  5FWJ A;  1UYY A;  2HEV F;  1GWL A;  1CAX A;  2GC2 A;  2XXZ A;  5LA9 A;  2EXK A;  4FPY A;  2D40 A;  4F8A A;  1GU3 A;  1MS3 A;  3DKQ A;  4XF3 A;  3AX4 A;  4Y1V A;  1RJ7 A;  2DBN A;  3ZYB A;  3WUD A;  3WF0 A;  1LOC A;  5K4L A;  1PO1 3;  3ZYP A;  4QM9 A;  5T55 A;  4D94 A;  2PN5 A;  4I30 A;  5LAT A;  1UZV A;  1RUD 2;  3QOP A;  5DUW A;  4M3C F;  3Q8F A;  1H2L A;  1WMX A;  1UYP A;  1VLN A;  1SEF A;  2QDR A;  4LBJ A;  4LO6 B;  4IE4 A;  1ULC A;  3LQC A;  3UKN A;  1ZBE 1;  2P34 A;  4Q4V 2;  3VBS B;  1FV3 A;  1PZ7 A;  5F37 A;  1CZS A;  5JMO A;  1VMH A;  5A3O A;  1MS0 A;  1W3V A;  2EXH A;  2C0Z A;  5FZG A;  5FPU A;  2QUO A;  3S5Q A;  1SLC A;  2PEL A;  2ZMK A;  2RM2 3;  1C1F A;  4MUV A;  5FQ0 B;  5A3U A;  3RRD A;  4XJ8 A;  3H1M A;  5DG2 A;  1AYM 3;  2WNV A;  4I0B A;  5IHR A;  1M4W A;  4OVE A;  5FO7 B;  2ARC A;  2Q8E A;  5G05 L;  4XJU A;  3J8F 1;  1FOD 3;  2C9K A;  2QTW B;  3IDA A;  5F5Q A;  2ZGT A;  4LO8 A;  3CJI C;  1LUL A;  1YQ5 A;  2RS3 1;  2EF6 A;  5E89 A;  5CFD C;  5FO9 B;  1AR6 1;  3CIH A;  2PLV 1;  4XFG A;  1W0P A;  1FAY A;  2V09 A;  1HLC A;  2W95 A;  4N43 C;  2OUH A;  4SBV A;  5CKM A;  4ZKT B;  3MID A;  2ZGU A;  3HNM A;  3NW4 A;  2BNN A;  4I2O A;  2VOX A;  4BMB A;  4DNY A;  4FPH A;  3POI A;  4FO9 A;  3TOJ A;  2DUO A;  2TEP A;  3BTX A;  1NLR A;  2MEV 2;  3BAL A;  4O9E A;  4P9X A;  5J36 A;  3A21 A;  2ORZ A;  2GC0 A;  4N90 A;  3OEB A;  4A3Z A;  1J3P A;  2JDN A;  4LPL A;  4ONU A;  2JE9 A;  5I0D A;  4QXB A;  5A70 A;  5L9R A;  1W0O A;  2GN7 A;  2VH9 A;  5FP7 A;  3MW3 A;  3H8O A;  4RQP B;  1H2M A;  1Q43 A;  4TZD A;  1ONA A;  1BEV 3;  3WXP A;  5IFT A;  2WA3 A;  2YGM A;  1FMD 2;  2W08 A;  3SC7 X;  1POV 3;  2NZ9 A;  4LLO A;  1B35 A;  1AR9 2;  3AYE A;  3ZXK A;  3J7N A;  2UUR A;  1CGP A;  1ULG A;  1QKQ A;  3DPR B;  4X6R B;  4DIQ A;  1NXD 1;  1AR6 2;  4P14 A;  4OHW A;  4AQ2 A;  4CDX A;  4MGI E;  2VOT A;  4AF9 A;  5FY4 A;  4XFA A;  2FHR A;  4OLL A;  4YZ1 A;  4ZHN A;  2JDU A;  2MNG A;  2VBB A;  3ZSM A;  1JZ8 A;  5CEH A;  4PQ9 A;  2CGN A;  1UCX A;  3PVO A;  5FYY A;  4R4Z A;  4LT5 A;  1WLT A;  3NJY A;  3N9P A;  1XE7 A;  4XIL A;  2VCC A;  1MZ5 A;  1W05 A;  2VCB A;  3ZFF A;  2ZGS A;  2W3J A;  1JZ6 A;  4JQT A;  1A3K A;  3GBG A;  4A44 A;  4CYD A;  2XJT A;  1MZE A;  2D6K A;  3PUA A;  4W65 A;  2A3Y A;  3KT4 A;  4HFS A;  4J1X A;  3ACI A;  4LA2 A;  4WV8 A;  3USU B;  1XC6 A;  4E2Q A;  4N43 B;  5JZG C;  3WY6 A;  4FPE A;  1HV0 A;  2B45 X;  3LAG A;  2ZPX A;  3S0M A;  3WW2 A;  3VDD A;  4QU2 A;  5A3M A;  4E2G A;  4DPN A;  1V70 A;  1JUI A;  1LEM A;  4A4A A;  2YHJ A;  1HX6 A;  3FN9 A;  4WVZ A;  5FMC A;  3WQ1 A;  4BQW A;  4IEP A;  4LIV A;  4KWU A;  2R04 1;  1X7N A;  2DCJ A;  2VTF A;  2WN3 A;  1VBA 2;  3POS A;  2F17 A;  2B8M A;  4Q1P A;  5CAZ A;  3VBR B;  5FLI A;  5FZ4 A;  4A7Y A;  1RIR A;  1UX6 A;  1GZW B;  1S0B A;  1H8V A;  5T5O A;  4HET A;  5JWP A;  1OD5 A;  3GNE A;  3C3V A;  1GZT A;  3T1M A;  2XHK A;  5BPX A;  1CAW B;  1XE8 A;  4XCB A;  3AXD A;  5DAV A;  3VL8 A;  4YVW B;  3R05 A;  2IXJ A;  4MLO A;  4LXL A;  3GF6 A;  1ZX5 A;  4RR3 C;  1RTV A;  1U5X A;  4HPK A;  4COV A;  3T4V A;  1NA1 B;  1FX5 A;  4JRL A;  3ACH A;  4CDU C;  1T2X A;  1HRI 3;  5L7O B;  1I1E A;  3ZYG A;  3ACF A;  2JDP A;  1AYM 2;  1MEC 3;  1DIW A;  4QQH A;  1QIQ A;  2VG9 A;  1CAU A;  3AL6 A;  3C7O A;  4GB3 2;  4AYU A;  5C8C B;  2WS9 2;  5C3O A;  2XQR A;  2ZTN A;  2YB7 A;  1ND2 A;  3KV4 A;  3WQB A;  1EYB A;  4CP9 A;  3O0V A;  3MHZ A;  3PME A;  2FQP A;  2BBV A;  3HN1 A;  1PMH X;  2NYY A;  4RR3 A;  1XU1 A;  3POY A;  4IGQ A;  4KWK A;  3LB9 A;  4DXT A;  1ZA4 A;  1LHN A;  1MAC A;  3RSJ A;  2WFF 3;  5HXM A;  3THD A;  4NHM A;  5A3T A;  3RZH A;  1AL0 G;  4LKF A;  1PVX A;  3UGF A;  3VKO A;  1R08 1;  3AP6 A;  2WFF 2;  2X53 S;  5LK7 B;  4QX2 A;  4NJ4 A;  2WR9 A;  2XWJ B;  4JGY A;  1FV2 A;  1VAM A;  2HYK A;  2A73 B;  3WDV A;  5I8S A;  2DV9 A;  2PHT A;  3ACL A;  1LHW A;  1PM4 A;  1V9U 2;  2WQZ C;  3OYW A;  4D6Q A;  1O8P A;  5CFD A;  2FD8 A;  2ZEY A;  3VZN A;  2VMC A;  4R9B A;  5FZ7 A;  4CUC A;  1DQ6 A;  1ZRR A;  4X8P A;  4JHZ A;  1OHF A;  1JOD A;  3BCW A;  3GJA A;  4RS5 B;  3WG2 A;  1JZ4 A;  3VDB A;  5FMO S;  3HD8 B;  2VU9 A;  1OSG A;  1REF A;  1K45 A;  1CJP A;  4FXG B;  3U0Z A;  2DVF A;  2JE8 A;  5FBJ A;  1YRZ A;  4C90 A;  5JCT A;  5IK8 A;  1UO9 A;  3IPV A;  1O59 A;  1RUE 3;  1X50 A;  4BYY A;  4CRQ A;  1L7Q A;  3WF2 A;  2WLP A;  3ALQ A;  3M3C A;  1H6Y A;  2PHX A;  1HB3 A;  2RM2 2;  1W6Q B;  4KWL A;  4N9I A;  4HON A;  3AZZ A;  2E32 A;  4FFF A;  2QQP A;  3D8C A;  3SH5 A;  1RYY A;  1NA1 A;  4P9J A;  4B7K A;  3ZXF A;  3OB8 A;  4ISQ A;  4AFD A;  4QPY A;  1CZT A;  2WUH A;  3K3N A;  2OT7 A;  1S55 A;  5DAX A;  4OUE A;  4AFC A;  1RUF 3;  3CO2 A;  5DG1 A;  1VP6 A;  2ZX0 A;  3LFI A;  4NVP A;  1MEC 1;  4CEY C;  1SFN A;  3BOW A;  1GOG A;  4W6X A;  5HXV A;  1GIC A;  3PUS A;  1ULD A;  5JXI A;  4IEW A;  2X10 A;  4H3W A;  3URF A;  3NVC A;  2GSY A;  3Q8E A;  3IN9 A;  4WBB A;  4MOA A;  1PZ9 A;  4AK3 A;  4LHN A;  1WLD A;  4FP3 A;  4HL0 A;  4IGP A;  5JMC A;  2ZX2 A;  2UWC A;  3RMY A;  3SEE A;  4A7Z A;  4JCK A;  1GQG A;  2YG0 A;  4GMP 0;  1DP0 A;  3VKN A;  4LBK A;  1NCQ A;  3E5Q A;  1RL3 A;  1BCX A;  2WO3 A;  3PL0 A;  1KDK A;  3WIN E;  4D0Q A;  1SDW A;  1V6L A;  4I0W B;  3P6B A;  3LF7 A;  3VHP A;  2QDN A;  1YJL A;  4KG8 A;  4AFB A;  1XRU A;  1NCR C;  4YAR A;  2VPV A;  3JXS A;  3ZFE B;  5KR7 A;  1WLW A;  3QH6 A;  1Q3E A;  4XQW A;  3WEZ A;  2X5I B;  4MGS A;  1R1A 3;  4QMA A;  5H9R A;  3VDD C;  2XLG A;  1LB2 A;  2GME A;  5ERL A;  4S2D A;  4TXW A;  1VJ2 A;  1RUN A;  2ZX4 A;  3N9O A;  1WKY A;  4NWV A;  1C4R A;  1ULF A;  3WF1 A;  5A1L A;  1Z7S 1;  1UIK A;  4K1Z A;  1EPW A;  3MLJ A;  5FLJ A;  1D4M 3;  1K5J A;  4GH4 B;  4AE2 A;  2GH2 A;  1DZT A;  5JLV A;  3CZJ A;  3PDQ A;  2DYC A;  4A3X A;  1SLL A;  3FLR A;  1W6N A;  1AR6 3;  1PGS A;  1J3R A;  5C3Q A;  4FOW A;  4AFM A;  4LMF A;  2OXB A;  3AMM A;  2XML A;  3THT A;  2W52 A;  2WA4 A;  4LKE A;  1L3J A;  2XJP A;  1ZRF A;  1K5M A;  1YYN A;  3LA3 A;  4DS0 A;  3LZZ A;  1L7R A;  2AEZ A;  2HWD 1;  4W8J A;  1WCD J;  2XJU A;  4XIK A;  5JR7 B;  2P37 A;  4YGD A;  4LBN A;  4AQT A;  2QZ3 A;  1T6G C;  2D6P A;  1RUJ 3;  4AI3 A;  5A1A A;  5EP9 A;  2ZEX A;  4QX3 A;  3P3P A;  5CBL A;  2ZGK A;  5LRR A;  1FOD 2;  3HJR A;  3OTF A;  4WM7 B;  2E31 A;  2DTW A;  3JB4 C;  4COU A;  4UBH A;  2P6H A;  3BVC A;  1JXN A;  5A32 B;  1RUH 3;  4J25 A;  5GJ6 A;  5A7P A;  2RS5 1;  2WN2 A;  3GCW A;  5JXH A;  1CAU B;  3UKT A;  3VDC A;  3VBH A;  5BNO C;  1MR5 A;  4C0B A;  3U07 A;  1UX7 A;  4FFI A;  1RVF 3;  2UWB A;  2ZCW A;  3JUU A;  5KHI A;  2PLV 2;  2AH2 A;  1DLC A;  4Y4Y A;  3T30 A;  2VXR A;  2LRP A;  3UJQ A;  2OVU A;  3MUZ 1;  4NE9 A;  3GXU A;  4A6S A;  3HIF A;  3SNM A;  4EV0 A;  1XNB A;  1IHM A;  4JQR A;  5FV3 A;  1H1A A;  4LNV A;  4CP0 A;  1NUK A;  3LPG A;  4XW3 A;  4BCU A;  5IVV A;  2XBO 3;  3OJB A;  4QGL A;  2UWA A;  1PO2 3;  2WZR 3;  4NHY A;  4UAP A;  1UU4 A;  3WW3 A;  1AXK A;  1KJR A;  3EXU A;  2NLR A;  3PVN A;  4XFF A;  5FPL A;  2C6S A;  4L92 A;  5FZL A;  1AHS A;  2XJV A;  4V2V A;  2BNO A;  2JDY A;  2WAA A;  4Y22 B;  3UK9 A;  4PLN A;  4LE4 A;  1BXH A;  3M2M A;  2CTV A;  4CXW A;  5A3P A;  4Q0S A;  1QOT A;  5BNP B;  3U14 A;  5IVB A;  4UW6 A;  1C5I A;  3FBY A;  4P9G A;  3ZPY A;  3JD7 2;  1CJD A;  1W99 A;  3KHC A;  3S6P A;  3T3Y A;  4WVM A;  2A71 A;  1KJL A;  2Q1M A;  1NA1 C;  4P9L A;  3AZY A;  3I3B A;  5FZH A;  3VBU A;  3KD4 A;  2MEV 3;  1OI6 A;  1J58 A;  2EXI A;  3TYJ A;  1UOG A;  1D2Q A;  1ZYB A;  1OBN A;  1V9U 3;  5FPB A;  4E4D X;  4OI1 A;  3RYR A;  5HI0 A;  2ZHN A;  3T08 A;  4DFS A;  2AEN A;  5GZC A;  1KEX A;  4B1M A;  2VOV A;  4A2U A;  2QNK A;  4YM3 A;  2QFE A;  5FZE A;  3VBO A;  4W6Y A;  2WQ8 A;  4MGZ E;  3VD5 A;  1BHG A;  1H1I A;  4NPL A;  5C8W A;  4DY3 A;  1FMD 3;  3O5S A;  5JOY A;  2D6L X;  2W1S A;  5IK5 A;  1QJU 3;  4U36 A;  3UJO A;  4GKY A;  1NCQ C;  4RFT 0;  4UI9 L;  2NP0 A;  4UT5 A;  4NRM A;  4CP1 A;  3B93 A;  2IFR A;  5KC6 A;  4YFZ A;  1CIY A;  2HWF 3;  3E6B A;  1RVF 1;  1PX4 A;  3OEA A;  3A22 A;  2PA7 A;  2UU8 A;  4QB2 A;  3I54 A;  1V6O A;  2YC0 A;  4MHU A;  1ND3 B;  3DCQ A;  2XBO 2;  2B9V A;  1LOG A;  3I2H A;  3IMM A;  4WM7 C;  5LZ6 A;  1RHI 1;  5HCH A;  5A6X A;  4M0N A;  1YLL A;  2IXI A;  3FL7 A;  1W2A X;  3CJX A;  2L9L A;  1E5H A;  1GP6 A;  1IKP A;  1RUC 2;  2BFU S;  4QKN A;  3I2O A;  4CCE A;  1NLQ A;  4LBQ A;  1UY3 A;  2ZEW A;  4N53 B;  4K20 A;  5FLH A;  4B29 A;  1IS3 A;  3R4U A;  4MH0 E;  4MG2 A;  2VE1 A;  1ST8 A;  3GZT B;  1W06 A;  1VB4 A;  1SDD B;  2Q8C A;  4CZS A;  3I59 A;  5H9S A;  1MS4 A;  5IUQ A;  1W8Z A;  3KV6 A;  1MZF A;  5L9B A;  3WNP A;  5HCF A;  3SH3 A;  4QPG A;  2DCK A;  1SAC A;  1QJX 1;  4AQS A;  2BDR A;  5FZO B;  1BVV A;  2XOM A;  2KR2 A;  4ZXK A;  5I0R A;  5FZ6 A;  1PO1 1;  1RUI 1;  4GZ9 A;  3U4S A;  3FFZ A;  1VRB A;  4BQY A;  1SG3 A;  5FYT A;  3I3E A;  5AVP A;  5DMY A;  2YYO A;  5IAT A;  5JZG A;  1G9D A;  2ZGR A;  3T0D A;  1N3O A;  1Z78 A;  3IAP A;  2VME A;  4J1W A;  4GXL A;  4WM8 C;  3ZFF B;  4QPG C;  4AGV A;  3I2I A;  1DZQ A;  1VBB 3;  3OGV A;  5EJ1 B;  4OQ8 A;  2QQI A;  4R9A A;  5FZM A;  1TNR A;  1RXF A;  3MF6 A;  2EAL A;  1RUF 1;  4E27 A;  5IAV A;  2WO2 A;  1UY0 A;  1UWW A;  3SMH A;  4GB3 3;  4OMC A;  5APA A;  3R4S A;  3MIB A;  4AGG A;  4M4P A;  3UL2 A;  4CDX B;  2PFW A;  3LDB A;  1QU0 A;  4Z07 A;  3NAP B;  5F32 A;  2PHR A;  1NY7 1;  2D5H A;  2R0F A;  3EHK A;  4GKX A;  1WWY A;  4OZO A;  5FFO C;  3DYM A;  5I0U A;  1V6M A;  5JVV A;  3RWK X;  3VBF C;  5CKN A;  3PJY A;  4MGK E;  3GDB A;  1YXW A;  3RNS A;  5F8P A;  5K9Y A;  1LEC A;  3K77 A;  3NNF A;  5JR2 A;  1WD3 A;  1R09 1;  3KVA A;  4N53 A;  5IK7 A;  3MLK A;  3TBD A;  4B4Q A;  2RR1 1;  5F3C A;  3ETP A;  3BTA A;  4QX7 A;  5IW0 A;  1PGW 2;  2WC2 A;  5E8A A;  2P5B A;  2VUJ A;  1DF0 A;  1X8M A;  4CEW A;  2VQT A;  4UOJ A;  2XHN A;  1DYO A;  1VRH 1;  3D3A A;  3M3O A;  3PHM A;  3RJR A;  2VJX A;  4YWA A;  4FPL A;  4QPG B;  4A41 A;  1JYC A;  4HKL A;  2R06 2;  3THP A;  3GHM A;  4HZF A;  3U37 A;  2A6V A;  4J6G A;  2BEO A;  3AYC A;  4BQX A;  1DHK B;  5FXW A;  3Q9O A;  1PVC 3;  2F4P A;  2Y6L A;  4CCJ A;  4EJR A;  3OD0 A;  3T1L A;  3AP4 A;  1F35 A;  1AL2 1;  3K3O A;  4Q2F A;  2OQ7 A;  2J1S A;  4LOS A;  5IFP A;  2CGP A;  1W2N A;  4XCA A;  5IYY A;  3RZK A;  3O1P A;  3HNY M;  2GN3 A;  3OCP A;  5HV4 A;  1N1Y A;  2Q1Z B;  1VMF A;  2HWD 2;  4HVO A;  2VBD A;  4IDZ A;  2EXJ A;  1UXZ A;  4Y3O A;  4AQ6 A;  4E4Z A;  1UZW A;  2CWM A;  2P4E A;  1ZBA 2;  4Q1R A;  1OQ1 A;  2WFP A;  3JZV A;  3F95 A;  1HIX A;  4JGY B;  3CLP A;  1YIF A;  1GR3 A;  1S0C A;  1B35 C;  1RMU 1;  4Z92 B;  4TLF A;  5EZW A;  5FYM A;  4AED B;  3OY8 A;  4YVS A;  5FZD A;  1QWR A;  3WDU A;  2IXC A;  2RS3 2;  2VMI A;  4MV2 A;  4ASK A;  4K40 A;  1LCL A;  1H1M A;  4HK9 A;  1OLR A;  3MIH A;  4XMI A;  2VZO A;  2OW4 A;  2Y0I A;  4JKM A;  1ZZ8 A;  4FPK A;  4KU7 A;  2QVS B;  4Q8K A;  4MXW A;  4RS5 A;  3VZM A;  3MIG A;  1O4T A;  4XUT A;  4E9K A;  5BNN B;  3TWI A;  3ST7 A;  2HYX A;  5K7P A;  1CAX B;  3DYP A;  5T5J A;  3H7J A;  5C8C A;  4LHK A;  4BWO A;  3B5L B;  3D0S A;  1A8M A;  1JBC A;  1PMJ X;  2VVF A;  1MZ6 A;  2W2I A;  1NYW A;  5KHG A;  3KHB A;  4FVV A;  2QQO A;  2C5D A;  4XDQ A;  3AMP A;  1GZC A;  4QKB A;  1KRI A;  4H55 A;  4QB1 A;  4CUG A;  3BTZ A;  2R0H A;  2XL7 A;  3ORJ A;  3P5B A;  3MIF A;  4SLI A;  1PIV 1;  5FZK A;  3LOB A;  3MO4 A;  4E2S A;  2LM3 A;  2WRA A;  4X8N A;  3RI8 A;  2HWE 2;  1CPM A;  1Y4W A;  4Q0P A;  2HWF 2;  2R1B A;  1JU3 A;  1O4Y A;  3PIG A;  1OA2 A;  2DTY A;  2VL4 A;  5EQU A;  4RN5 A;  3H50 A;  4QX0 A;  3VBR C;  4FOY A;  2P1B A;  1B35 B;  1XYO A;  2J22 A;  1Q8V A;  5BUV A;  2AYH A;  4ET7 A;  5DXD A;  4OMD A;  1CAV A;  4EN0 A;  4H7M A;  2ADE A;  5T52 A;  4DEV A;  4LUM A;  2VZT A;  3ME2 A;  4L99 A;  3BB6 A;  4PLO A;  1YI9 A;  5FRE A;  5C70 A;  3B9I A;  4CE8 A;  1PO2 2;  2WZR 2;  3IDB B;  2WFF 1;  5JZG B;  2GNM A;  4P9W A;  2CYF A;  1SPP B;  5FBZ A;  1DZR A;  1PHM A;  4N8M A;  2B7Y A;  2JDM A;  2MEV 1;  4QHZ A;  4XF1 A;  4WVV A;  3I2D A;  2WT1 A;  4YG6 A;  2DCT A;  1GMM A;  1AVB A;  2XG3 A;  5FP4 A;  1E5R A;  3PVE A;  1IGO A;  2E53 A;  3D5O A;  3U4X A;  2P2K A;  2O14 A;  3HNB M;  1Q8Q A;  3OGR A;  4AHX A;  1SLB A;  4COW A;  2WNE A;  4GWJ A;  2I45 A;  4O61 A;  4QX8 A;  3ZYH A;  1VRH 3;  4FI9 A;  3S7I A;  1KS4 A;  3WF3 A;  5EJZ B;  1FMD 1;  5LAS A;  2RJK A;  4Q4Y 1;  5FMB A;  3NV2 A;  4NRQ A;  4NID A;  3PU3 A;  3I2G A;  5CU1 A;  5FYU A;  1LJ7 A;  3VKL A;  3B7M A;  2GDF A;  3DGT A;  4DOU A;  4LBO A;  1MQT B;  4LA3 A;  1RVF 2;  3OPT A;  2HWC 1;  1SFY A;  4JDM A;  3PTR B;  4NIG A;  2C1F A;  5ABJ A;  2P17 A;  1RUE 1;  1YFU A;  4RYD A;  2BVB A;  5CNA A;  2BP6 A;  4XF9 A;  4EQV A;  1FI2 A;  3HT1 A;  1W04 A;  4AVV A;  3POG A;  1D4V B;  2FCU A;  1MQT C; 
#chains in the Genus database with same CATH homology
 1PM4 A;  1POQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...