1PMHX

Crystal structure of caldicellulosiruptor saccharolyticus cbm27-1 in complex with mannohexaose
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
183
Chain Sequence
SVNPVVLDFEDGTVMSFGEAWGDSLKCIKKVSVSQDLQRPGNKYALRLDVEFNPNNGWDQGDLGTWIGGVVEGQFDFTGYKSVEFEMFIPYDEFSKSQGGFAYKVVINDGWKELGSEFNITANAGKKVKINGKDYTVIHKAFAIPEDFRTKKRAQLVFQFAGQNSNYKGPIYLDNVRIRPEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structures of Caldicellulosiruptor strain Rt8B.4 carbohydrate-binding module CBM27-1 and its complex with mannohexaose.
pubmed doi rcsb
source organism Caldicellulosiruptor saccharolyticus
molecule tags Hydrolase
molecule keywords beta-1,4-mannanase
total genus 49
structure length 183
sequence length 183
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2003-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09212 CBM27 Carbohydrate binding module 27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1pmhX00
4DXRA 1O8PA 3NQHA 5G05L 3I3BA 2CDOA 1F4HA 1DP0A 2W92A 1UZ0A 3ETPA 1W8OA 3OB8A 2VL4A 3VD7A 3SKJE 3OGRA 4P02B 2V5DA 3WNPA 4IUGA 3C7GA 1J84A 1W9WA 3ACIA 4MGQA 2OKXA 2VZSA 1LNSA 2V72A 1JI6A 3VD4A 1JZ4A 3ABZA 3WF1A 3OEBA 1R64A 1DLCA 4A42A 5DQ0A 4CUCA 5CZKA 1EUTA 5DMYA 3IAQA 1K12A 2RVAA 2WDBA 2JE8A 3HEIA 1GU3A 5EJ1B 3PUHA 5JXHA 4LHSA 2J1RA 5HXMA 2C4XA 4M4RA 5JXIA 1OT5A 3UESA 4P5YA 2YC4A 4QX2A 1JHJA 3I2IA 1GNYA 3WF4A 3VD3A 2VZRA 4AG4A 1SDDB 3MUZ1 1JZ8A 1GMMA 2EIEA 2VM9A 1IQDC 1XC6A 1T2XA 2WABA 3ACFA 2DDUA 2WYSA 2QQKA 3FHQA 2YFZA 4Z2AA 1UXZA 2EIBA 3CKHA 4QPWA 3VD9A 3VDBA 3NNGA 4D8MA 5HPOA 3NRUA 5J1XA 4ET7A 4QDQA 2E26A 5DPNA 4JKKA 2VCCA 2YB7A 3IIIA 1MPXA 4RN5A 3DYOA 4QX1A 3IDAA 1JZ5A 3SEEA 4P08A 3OG2A 2EICA 3HPNA 2RJ2A 3CMGA 4OUEA 1UYZA 3K4AA 2XHNA 3W5MA 3C7FA 5LA1A 1H6YA 2Y6LA 3THDA 1GOFA 4XUTA 5CYYA 2YG0A 4MO3M 2B9VA 4XZUG 4A41A 1UMHA 1PMJX 1UX7A 4OMDA 3OEAA 4HG6B 1W9SA 2E33A 3T0AA 3LEIA 2Y6JA 2BZDA 2VMCA 3JXSA 2VQTA 2JDAA 3C7OA 4YPJA 1KEXA 4LPLA 4BJ0A 3NJXA 2PQSA 2W47A 3DECA 3HNYM 3VDCA 3K77A 3I3DA 3LQCA 4A6OA 3ZM8A 4E8DA 1SG3A 1CZTA 4PF1A 2W91A 3C7HA 4W8JA 2WZEA 2BGOA 1KGYA 3BGAA 2E32A 3K46A 1US3A 3WNOA 1PMHX 2CDPA 2W1UA 4CU7A 4PT6A 4QB6A 4BXSV 4DUWA 4JX0A 2WAAA 4LKSA 2X05A 3IAPA 2WBKA 2QQMA 2VMFA 3T08A 3HOBA 2WQ8A 4QDRA 2ZEYA 1JYNA 1UY2A 2WN3A 2Y6GA 4JKMA 1H6XA 2V4VA 3OGSA 2XOMA 1NX9A 4GWIA 2J1AA 3VDAA 2QQLA 3HJRA 1W0NA 2W87A 2DCKA 2XONA 1ULPA 4A44A 3T0DA 3WF0A 5JR2A 3OGVA 3ECQA 4ARYA 3E1F1 2YC2A 2X09A 4AAXA 1K3IA 3GM8A 5FUIA 2BERA 2J1SA 5B4XA 3CZUA 2VZPA 1O8SA 4FI9A 3WNKA 5IYYA 3LEGA 3HN3A 4KWUA 2YFUA 2VO5A 4XUQA 2W3JA 3T09A 2J22A 2VZ3A 4DEQA 3MBWA 4GZ9A 1UY0A 3C8XA 1CX1A 3THCA 3DYPA 1OF4A 3F2ZA 4ZY9A 3I3EA 4CU8A 3P6BA 3A22A 1XNAA 4QB1A 5I0DA 1CIYA 4KI5M 2BBAA 3K4DA 5IFTA 3C7EA 2W94A 1UY1A 1BHGA 4XUPA 2VC9A 4MGSA 5LCWL 5C71A 4GWJA 2QQNA 2VMEA 1UY4A 4UAPA 1K42A 4ZZ5A 2L9LA 3WQBA 2Y6KA 2VQUA 5LA0A 3D3AA 4XURA 4E8CA 1JZ6A 5G04L 3T0BA 5IFPA 4DUVA 1OF3A 3ACHA 2LW8A 2DCJA 1JZ3A 2E31A 3ACGA 2ID4A 3W5NA 4KMQA 1US2A 3T2OA 3GGLA 3A23A 3K4ZA 4W50A 5JUVA 2R7EB 2JKXA 3FHAA 2VZ1A 3WSOA 1GQPA 3BN6A 3IB3A 4QAWA 1JYXA 5IHRA 2W1QA 4P00B 1I5PA 2W1SA 4QB2A 3LEKA 3T2PA 2VCBA 1F4AA 1RYYA 4A45A 4QDSA 2J1UA 5JMOA 3HNMA 4JKLA 3A7QA 2WO2A 3LPFA 1UY3A 1P8JA 4D0QA 1OH4A 1JZ7A 1JYVA 3UETA 2W46A 2HLEA 3MV01 1UWWA 1JU3A 1K45A 2HYXA 1XPWA 2W1WA 5LA2A 4CUAA 2C26A 4QX3A 2X10A 2VZVA 2QQJA 5C7GA 2VJXA 4QX0A 4LQRA 1NKGA 4DUXA 5EIYB 4TTGA 1WCQA 3A21A 4A4AA 3I2JA 1CZVA 5EJZB 3CIHA 1J83A 4PQQA 5B4NA 3NJVA 2VR4A 3LE0A 4XUOA 1O59A 4UI9L 4OYUA 2EIDA 2ZEZA 1GUIA 3HNBM 4JHZA 1D7PM 4BDVB 4BK5A 5JXGA 3CQOA 3AC0A 2ZEXA 2W95A 3EB7A 3EYPA 1ULOA 1GOHA 2VOTA 3GXUA 2ZEWA 2J1EA 2J1TA 3GDBA 2LS6A 2Z4FA 3SEPA 3I97A 4BK4A 4XUNA 1UYYA 1OD3A 2XQXA 3DYMA 1YQ2A 2VZQA 4ARXA 5JXJA 3OBAA 2Y8KA 2VZOA 4CU9A 1XNTA 5C70A 4W4ZA 1L7QA 3WNNA 3T2QA 3WEZA 3I2GA 4UOJA 1PX3A 2W5FA 2JD9A 5IJRA 1JZ2A 2WN2A 1CZSA 3LPGA 4OMCA 1DYOA 1UYXA 3MO4A 3P1IA 4ZXEA 3PUIA 3MUY1 3I2KA 1SHWB 1L7RA 2WUHA 4A3ZA 4DEVA 2Y64A 4L0PA 3UNPA 4XVHA 2VZUA 1W99A 1NUKA 4TXWA 1HN1A 2WO3A 3SKVA 3I2FA 4CU6A 4CVUA 1NAEA 4CUBA 3FN9A 4MOAA 2C9KA 5F7UA 2BGPA 3WNMA 4DXSA 3CDZB 2WO1A 4OZOA 3MV11 4DXTA 2ZXQA 4ZZ8A 3VD5A 1TVGA 2J1VA 1W9TA 3WF3A 1JYWA 2W9XA 2ORZA 1WKYA 2WAOA 4MADA 1PX4A 2WZ8A 3K75B 2QBXA 1EUUA 2J7MA 2VZTA 3FL7A 4RYDA 2Y6HA 2VMDA 5A1AA 3I2HA 3U37A 2QQOA 2VTFA 2QQIA 1UMIA 5DN2A 2KD7A 2ORXA 2RV9A 2VCAA 1GOGA 4M4PA 1JU4A 3CZJA 3WF2A 3WNLA 1W8NA 3J7HA 2B4KA 1TG7A 1UXXX
chains in the Genus database with same CATH superfamily
4DXRA 4AWDA 3H8RA 5EV7A 3DEMA 4NHYA 2XJQA 3OPZA 4CEWC 1HB1A 3NKGA 5HI0A 4XZPA 5I0TA 4IEXA 3I3BA 1Y3TA 3BIEA 2ZPXA 4MXVA 1YJLA 1QOTA 2AENA 2AUYA 1DP0A 2VNVA 3E5UA 1UZ0A 3ETPA 1XYNA 1QJY3 2R16A 1XRUA 1CVNA 3H3UA 3H42B 1AR81 2QZ2A 4OFGA 3MW3A 4TN7A 1AR62 3OGRA 4P02B 2BJSA 4CCNA 4IUGA 4NPMA 2QNKA 3KCYA 1BBT3 1J84A 1GZWB 5ACA2 4BQXA 4CDWC 4R4XA 4KNCA 2ZA9A 2YU2A 1FOD3 3ACIA 1W2TA 2ZTNA 4GB33 2C1FA 5I8SA 4Y4YA 2LALA 1SACA 3MDPA 4FSJA 1V9U1 5CNAA 5BPXA 2J42A 4PIZA 4CUGA 4XC9A 3V0AA 1KDMA 1AL22 1AHSA 5DQ0A 3TEYA 1YJKA 2UY8A 2Y0IA 4CUCA 1XNCA 5JAXA 3I2DA 4E2QA 4YZ1A 3IAQA 1ULCA 1MQTC 1AF9A 3H7JA 1PO21 1QJX1 1C5IA 3AZZA 4Y4RA 2JE8A 5A3OA 3ZDVA 1G9DA 3BU7A 4HSLA 1UD1A 4WV8A 4CDXB 1VBB3 4H7MA 4AK3A 3PUHA 1EAH3 3M1HA 3IMNA 1YXWA 1HKDA 3CU7A 5FLJA 3O0XA 4Q0UA 1WCDJ 4QX2A 3VZOA 4EZHA 2Q1MA 5A33B 2JDPA 5FKCA 3POEA 4PQ9A 2JEMA 3DXUA 3I2IA 3WF4A 3D5OA 2R043 3PJQA 1M06G 2SLIA 2Z42A 3N7JA 4JDMA 2VZRA 3I3QA 4AG4A 4DRVA 3ZR6A 1JBCA 1ONAA 3TWIA 1RUG3 5K8SA 1GMMA 2MHFA 3C2UA 3GBGA 2BWCA 3VZMA 3ZFEC 4JC1A 3ALQA 3VBUA 4OHYA 1HXS3 1RUI3 1VRH1 2P3YA 4GH4B 1MEC2 5BNNC 5A32B 4R8HA 1FATA 1GZ9A 2QVSB 5JOYA 3B93A 2QQKA 4N43A 5CADA 2WNEA 3SCHA 3VGIA 1UXZA 3I8TA 4LEJA 1CR7A 2BDRA 3PDQA 1ND2C 1AR71 1D0HA 4RHV2 2Q8DA 3VD9A 1CAWB 4YVSB 5L36A 2JIGA 3N9NA 3OGJA 1TMF3 1LU2A 3VBOA 1YQCA 2GNTA 4LITA 4Y33A 3WG1A 4LMFA 3NW4A 1W9YA 2XKPA 2ZGKA 4XF9A 4JKKA 3ZYJB 2ZGMA 3MIFA 4MGIE 1R082 3U75A 5EP9A 4BB3A 4R9BA 4OQ8A 5A7PA 4QX1A 1RVF3 3SITA 1W6QB 1R081 3VBSA 3HVDA 4K1YA 2UYBA 1XU2A 1BJQA 2ZGQA 2RS13 3HPNA 4QPGB 1MS1A 4HOOA 4KBZA 4FTSA 1OSGA 1UYZA 2JJ6A 2PELA 3KS7A 4FPCA 4LKEA 5A3NA 4TWTA 4YGBA 3C7FA 3AM2A 5DAQA 1H6YA 2BFUS 2WSVA 2HH9A 5KXCA 3ILNA 1PO12 3GHNA 4SLIA 1R092 4MO3M 5C8WA 1ZZ7A 4GH4C 5IAVA 4A41A 3JB8A 2H6BA 1T6BX 2RM23 2D40A 2RS32 4M3CE 1DCSA 4OMDA 2NP0A 4FFGA 2CGPA 3OEAA 2HWD1 4HT1T 1W9SA 1ENSA 1WLDA 1IKQA 1GZWA 1ZZ9A 3UV9A 4OZXA 1VBD3 1S0BA 3I54A 4QHZA 3JXSA 5J09A 3SHRA 2AACA 4XCAA 1ENRA 1PGW1 3HT2A 4CEWB 2XDVA 4KQ7A 5FZKA 5FYZA 4FTEA 1EYBA 3UKVA 5FYBA 2OPKA 1PNGA 2PQSA 2W47A 2B8MA 4RHV1 4B4RA 2PTMA 3JZVA 2Y6FA 5FY9A 4MSVA 4GD4A 3N9OA 3DECA 3AYEA 1IQAA 1PIV1 2FZ1A 2H0VA 2Q8CA 2NMOA 1XYOA 4F7ZA 1QJY2 5GLUA 1GP4A 4A6OA 4NIHA 2UWCA 2OW4A 4HK8A 3MIDA 2RDSA 1GZCA 1T6GC 2YY1A 1CAXB 4BOWA 5F32A 4W8JA 2DBNA 1MQTA 2YBSA 1QU0A 1SPPA 1RXFA 1W8WA 3E6BA 4UFLA 1SLBA 1S0JA 2E32A 3QH7A 4FO9A 5A6YA 1HB3A 1NCQB 2VUJA 4Y1XA 4HSJA 2NYYA 3K46A 4SBVA 5JZGB 1VBD2 1US3A 4FP2A 1UU6A 2ET7A 2VMGA 4URTA 5C8CC 3URFA 1SBEA 4HLTA 4PT6A 5CA6A 4CRQA 1H9PA 5FZCA 4BXSV 3M3CA 4DUWA 1JODA 4BMEA 4MG2A 1LULA 2VD7A 2X05A 5FYTA 1DHKB 5FJHA 4F3JA 4EN6B 4A7KA 2ZEYA 2GSYA 1UY2A 3FLPA 4IESA 4IE0A 3GZEA 1IPSA 2Y6GA 4JKMA 3RPQA 3ZXAC 2WL1A 4NIAA 1PGSA 4GWIA 5KHJA 3WT3A 3BPZA 1MS0A 2FDFA 1LEDA 4XDQA 5H9QA 4XMIA 1X8MA 4DS0A 2UWBA 1RUD1 1EPWA 1QKQA 4CCEA 2XL7A 3T0DA 2DF7A 1HX6A 1ULGA 1OHFA 2A3YA 4IV1C 1N47A 1ZBA3 1H2NA 4ARYA 1DF0A 1DGWA 1RUI1 5GM0A 5E89A 2YC2A 3OUHA 1VB4A 3PVNA 1NCQC 2AGSA 2EF6A 3UGGA 1FMD2 1C3HA 5LRSA 2WNVA 1AJKA 5FZBA 1AJOA 1LENA 5FLIA 3GF6A 1S0CA 5FZMA 1COV1 2PLV2 1QGLA 4META 5IYYA 3LEGA 4P9XA 3RZKA 2VAUA 2C0ZA 4XUQA 1F8VA 4PDWB 2J22A 3HAGA 4DOUA 1O4YA 3D0JA 2VZ3A 5JOZA 1UY0A 4COZA 1CX1A 3THCA 5BXXA 3F2ZA 3ZMNA 1DGLA 2AC1A 2O1QA 3P6BA 1ZRIA 1W9FA 1LGBA 4CCDA 1H1AA 3TN91 5JOXA 3LIGA 1XOYA 5I0DA 3RGBA 3SLIA 3K4DA 3ZXJA 4A6SA 3O1RA 1AYN3 2WSUA 3ZFGB 3KVBA 2D3SA 5FMOS 2VC9A 2XBO3 1LHOA 1UZZA 4LHNA 3VKFC 3ZLIA 5IK7A 3LAGA 1BMV2 4XW3A 2VNRA 3RWKX 1UZVA 4Z07A 3BPSA 4WM8B 3LDBA 4FPLA 3WZ1A 1RUC1 4JGYC 2Y6KA 2VQUA 5LA0A 3D3AA 3LWCA 4I3PA 1PVC2 2A73B 1LESA 4X6RB 2GH2A 2C6SA 2YROA 3AFKA 1DFQA 4RGKA 1PGW2 1YEWA 2LW8A 2B7YA 1OQ1A 4ZS2A 3WQ0A 3DPRB 1SEFA 4RR3B 1SPPB 2D6KA 2TNFA 4LO6B 1S4CA 4CEYC 4CDXA 1DLLA 4GMP3 5SV5A 1C8M2 4JGZA 5ABJC 1GP6A 2ID4A 1RUJ2 2V5YA 4I0AA 4KMQA 5KHKA 2P17A 5M0TA 1U0AA 4XF3A 1VBC3 5JUVA 2Z69A 2JKXA 2VMIA 1DQ1A 2VVEA 2BBVA 2TUNA 2K0GA 4JGYA 1HV1A 4W6WA 4XJWA 3BN6A 4I0BA 4QAWA 3ZXKA 1JYXA 4P9YA 2XMLA 2W1QA 4FPKA 5C9AA 5IHRA 2WJSA 1IHMA 3T2PA 1AXKA 1SFNA 2GN7A 4QX8A 2D3PA 1ZZBA 2JXAA 3VUOA 5LEKA 4A45A 2J1UA 2W68A 2YUEA 3K3OA 1BBT1 5JMOA 3A7QA 1REFA 3DKQA 4J25A 2WS92 5BUVA 3WQ1A 1ZA7A 2E7QA 1P8JA 3FMGA 3WW4A 5A80A 3VBUB 2W52A 2OPWA 4Y5SA 3WXPA 4A7ZA 1JYVA 1F9KA 1K5MA 1ND2B 3OUJA 4MGTA 1NLRA 4CP0A 4AHYA 3QACA 3VBHB 1C4RA 3H3ZA 3UKNA 2G4IA 5GALA 4QQOA 1XPWA 1OQEA 4E9KA 2YXSA 1PZ9A 4S2HA 2C26A 5D1IA 4D7TA 2X10A 1ZRDA 4GULA 4JGYB 2VJXA 3ZYFA 1YC61 5FCCA 2E63A 5EIYB 2VBBA 2WZR1 2XKOA 4WVZA 1W8TA 4TTGA 2G1MA 3SH5A 4OHWA 4FBFA 4MVTA 3A21A 4C0HA 2C9AA 2VW1A 5EHDA 5EJ3A 1NQDA 4XBLA 2VE1A 2GMPA 1W2NA 5H9PA 2B5HA 2ARAA 1OKQA 2R1BA 3J8F2 3J4UH 4IV1A 4D69A 2VR4A 3HIFA 4XFIA 3ZYIB 3KWVA 5F3IA 4XUOA 4UI9L 3ZSMA 1YFYA 4Q1RA 2EIDA 4NHMA 3HNBM 3RMYA 2RS53 4BK5A 3ZR5A 5FY5A 2ZGNA 3CQOA 1HDKA 4Y24A 5F8PA 3J8F1 2YPJA 1PNFA 4QKBA 4LLOA 1HJFA 1NE6A 1PO22 1RUG1 4Q4W1 5ANQA 4BMBA 1NT0A 2J1EA 2J1TA 2LUWA 4CDXC 3GDBA 4K21A 1QJFA 2GZWA 3O5SA 2DU1A 4P14A 3SEPA 4MHRA 2ZZJA 4YVSA 2FDJA 5FBJA 4J1WA 1V6NA 4LA2A 4BK4A 1UYYA 1TMF1 2XQXA 4Y5Z0 1UOBA 2VZQA 2DU0A 1XNTA 4Y20B 5C70A 2QFEA 4Q2FA 5FZ0A 3WNNA 1NCRC 2NLRA 4AFDA 5FAXA 2FHRA 5L7OA 1RVF2 2KR2A 4CDWA 3WEZA 2LROA 1BXHA 3LFMA 2ZACA 3MLJA 4Q8LA 2JD9A 5DG1A 5T5JA 2BQPA 4CEYB 5KBFA 2VY0A 3S5AA 3P5BA 3BOWA 1LU1A 3PNAA 1VBA3 2ZHKA 4Y1YA 2RMU2 3M4FA 2IWGB 3P1IA 4QPYA 3THTA 4DB5A 4NUBA 3PUIA 2R072 3R4DB 1B35C 4OLLA 4B7KA 3SNMA 1QOOA 1WA6X 4NWWA 2EALA 5EQUA 4GXLA 5C5TA 5FZ6A 1RJ7A 2WUHA 2BW8A 5FPXA 2ZGUA 1PVC3 4PBOA 5FPAA 3OCPA 2Y64A 2BOIA 1AX2A 4H2AA 4YYOA 3UNPA 5KXBA 1CAVB 4XVHA 2JG8B 3POBA 4TXWA 1OLMA 4BQ2A 1RUH1 3SKVA 5C4WB 4YZ3A 4KG0A 4QXCA 4KWLA 1AL21 1NAEA 5C8CB 5KXEA 4XHBA 2BGPA 3EMRA 4XJ9A 3OD4A 1YNAA 5AC91 4MLOA 3AL5A 4BIFA 2PHXA 1DDLA 4OZOA 5C3PA 4YVWA 2ZHMA 3MV11 3V0BA 4M3CB 5L9RA 4DXTA 2XHKA 2ZXQA 4PLOA 1Z0HA 2C24A 3BTAA 1XU1A 1DU3D 4AVBA 3RG0A 2J1VA 4HN0A 4XTMA 1AR63 3ZSEA 1JYWA 4NPLA 1G6NA 1AR92 1FPN3 2ORZA 1VBE3 1L3JA 3APBA 1HB2A 4L99A 1Q8QA 5LK5A 3B7MA 5FY8A 1KJRA 1FPN2 3N9QA 5F37A 1VBE2 1VALA 2QJVA 3KCXA 3ORJA 4Q4V3 2VMDA 5JR7B 5C6CA 5A1AA 5C3OA 2OIIA 2PHUA 2X5IC 3AKTA 2QQOA 2QQIA 1VRH2 5FWJA 3VLBB 3M3OA 1W6NA 2R1DA 5FZ4A 4ASKA 4IV3B 4LE3A 4M4PA 2X8KA 1JU4A 4IEZA 4FT8A 2ARCA 4CYDA 2CU5A 2HJIA 1RUOA 1PGL1 3WNLA 1W8NA 3J7HA 1OD5A 3KVAA 2Q4SA 3RVHA 5C9AC 1RUE1 2VW2A 3GHMA 1O8PA 2NPIA 1DBNA 2FCTA 2WO7A 3TEXA 1O5LA 4D94A 4XIOA 4GKYA 4AYUA 1RUC3 3FHIB 3WY6A 5T3NA 4UFMA 2W92A 1RUNA 3PJYA 5J36A 2AREA 4NN0A 5DAXA 4I02A 3VD7A 5J3UA 2XJUA 4HVQA 1W6MB 3ATGA 4IXLA 2YGLA 1Z7S2 4XILA 4Y1UA 2VULA 4IE6A 4RGAA 4TLFA 4YW3A 1W9WA 3ZYPA 1UW8A 1HQNA 3A0KA 5FOBB 2JE9A 2RS51 4MGQA 4JDNA 4XHXA 5E8AA 2OKXA 4COYA 1NOVA 5GLZA 3NO8A 3VKMA 3GYDA 2V72A 3VD4A 4WVWA 3WF1A 5F3GA 1QJU2 1VMFA 1R64A 1AXYA 2WQ4A 4A42A 2PHWA 4GJYA 4QKNA 4L92A 1C8NA 1EUTA 1LR5A 4XFGA 5CZKA 1K12A 1DQ6A 5FP9A 1PO11 2VVFA 3MPBA 4KWJA 1M4WA 3DPRC 3MEPA 4P9WA 4AQSA 4D3WA 1GQHA 1QEXA 2HWB3 2D6PA 5APAA 5JXHA 3KD4A 4LHSA 5HXMA 5CU1A 5JXIA 1O3QA 1UZYA 3TOJA 1OT5A 5D8AB 4ISRA 4M0NA 2E7AA 4XJZA 3UESA 1HB4A 3KHBA 1ACCA 2AH2A 5FYUA 2OZ6A 4QPIA 4V1PA 1JHJA 5BNPC 3AKQA 1AYM2 1BKZA 1YLLA 2XXZA 3NNFA 1YCIA 2WWJA 4N53A 3MZHA 4D7YA 4N9HA 4AI0A 1Q8OA 3THPA 3AMPA 5FBZA 3MUZ1 4NHXA 3WR0A 3ZSKA 2AYHA 3D4KA 1W05A 2WR9A 2DTYA 4MV2A 3WINE 1EV13 3TEZA 2B9UA 1A8MA 3U1XA 3VZLA 2D6LX 1T2XA 1RUH2 1AYN1 4Q0QA 1OA2A 4QGNA 3IT8A 3ACFA 2DDUA 3WCRA 2VH9A 1DGRA 2XJVA 1GNHA 2ZABA 2GP3A 3M3IA 4GWMA 5FO7B 5BNPB 1HLCA 2B46X 2ZGRA 3FHQA 5IAXA 3O1UA 1OBNA 5FXZA 2JG9B 1LGNA 2P3KA 3M3EA 2CL2A 2Q0AA 2ZHLA 4LBQD 2CNAA 1GLHA 4QDQA 1ULDA 2OQ7A 2CTVA 4QX7A 5A33A 1NQJA 1RUJ3 2AZ5A 3R6SA 3EO6A 3PMEA 1TEIA 1ZVFA 2VCCA 3AMQA 4INDA 3FBMA 1VBC2 4XTPA 2DBIA 3VHOA 4G4FA 4RN5A 4YARA 5F1RA 1E57A 2GNMA 2PAMA 3SEEA 3LA3A 3UGFA 4U2AA 2EICA 2VG9A 3RYKA 2RJ2A 4KGGA 5AC92 1J59A 2YPDA 3CMGA 4EN9B 4OUEA 3K4AA 3KT4A 5FYYA 2JE7A 3H9AA 4ARXA 1R093 4AVAA 1GOFA 4H55A 2YG0A 2OQ6A 1CX4A 1OMIA 4WVMB 3NSTA 3ILFA 5F39A 1CN1A 4XIKA 3P3PA 4G3YC 1UMHA 1H8VA 2KA3A 5CIRA 1H8TA 4K9SA 4RS5C 4UBGA 3AP7A 3WVJA 2RR11 3LEIA 2WQZC 3V64A 3TNPB 1V9U2 1NA1B 2BZDA 1HQWA 2VMCA 4MX3A 5FP8A 2JDAA 4EROA 1KEXA 4GQ7A 4BLJA 4GAZA 4AGGA 4MXWA 4CCCA 4UW5A 1K5JA 1OA4A 3NJXA 5A7OA 5C3QA 5LWBA 1BK0A 4C1WA 1AR72 3QD6A 2EVXA 2PHTA 1RUC2 2FCVA 1AR61 3EHKA 2BWAA 5DZFA 5L73A 5L7OB 2NQYA 3HNYM 4KU8A 4BQ5A 3K77A 3I3DA 4NAOA 3ITQA 1QJX3 4CE8A 4DFSA 1LHNA 3TAYA 1FV2A 5FPLA 5FZ3A 5LATA 3ZM8A 4E8DA 5I93A 1HRV1 2EIGA 2YMZA 4M01A 4AFCA 1MQTB 2JB8A 2MEV2 4H3WA 4KWKA 2W91A 2XLFA 3C7HA 4CDUA 3TB0A 3TN92 4TSVA 3GCWA 5IVEA 3BGAA 4DNYA 2WINB 2EXKA 2IVIB 1DGWX 5A32A 1O4ZA 3W58A 1GP5A 4GH4A 2ILMA 1C1LA 1KS5A 2V4AA 3QOPA 5E1RA 3S30A 3WDTA 5I0RA 5IK8A 1YFWA 1UU5A 4FVVA 2UWAA 3WHUA 4BYYA 2VECA 2NMNA 2WBKA 2GN3A 3VBHA 4CP1A 4FPJA 2XBO1 1QH7A 4I30A 4BU2A 1BK1A 2WN3A 3MIGA 3KMHA 2VTXJ 5FYHA 1S2EA 1VAKA 4S2DA 1IS5A 2IUWA 2VGDA 3OGSA 1SLAA 1RXGA 2VQAA 5IK4A 4K7JA 1UKRA 2WFF3 4HPKA 2XLAA 3D8CA 3EQEA 4LBQB 2BV4A 3IPVB 3B3QE 4AEDA 2EXIA 2DCKA 2G19A 4NIDA 2Q30A 2RMU3 1GWKA 5HCFA 4FQZA 3RI9A 4A44A 1IKPA 3OYWA 4EJRA 3H0OA 1ZBA2 3KLSA 5FZDA 1OH3A 5JR2A 2EAAA 3H8OA 4MHUA 4XF4A 1J58A 4X8NA 1HN0A 3WLUA 1RUF1 4GKXA 2X09A 3U07A 3ROUA 1K3IA 3MIHA 1VBB1 5FUIA 1DGRN 2WNVC 3K3NA 1FNYA 2J1SA 2VZPA 2P3JA 3U4SA 1PO23 1OUSA 2XH6A 4K8RB 4YGDA 3WNKA 1IPJA 1LEMA 4IEYA 4AF9A 3M3QA 1S1AA 2MNGA 4KWUA 2R30A 1S55A 2PFWA 2YFUA 2W3JA 4ATEA 3M70A 5FPVA 1OXCA 2QKDA 2ZGTA 4E2GA 5C4WA 2WT2A 4XJUA 3ZIWA 3MBWA 3OBRA 3B9CA 3C8XA 4YLZA 3R4UA 4XXAA 3G7DA 4ZY9A 3DGTA 4CU8A 3AJYA 3ZXLA 2DYCA 5DUWA 3A22A 3JD71 3JQWA 2P34A 3ZN4A 1CIYA 4CDQA 4KI5M 4PDWC 5IFTA 1HXS1 2W94A 3B5LB 2DFCA 3A4UA 5K0UB 1UY1A 1BHGA 1AX1A 1PMIA 1LKNA 3AZYA 3BYWA 3RZJA 4XMAA 4MGSA 1WBLA 4HN1A 3FZ3A 2VOKA 4L9BA 4CEYA 1FXZA 2Y33A 1C8M1 1QJY1 4QXBA 3B02A 2I45A 3LOBA 3WDVA 3B00A 3MICA 4XAAA 3R05A 4XURA 2R0FA 1LB2A 4IEWA 1PHMA 3IM0A 5G04L 3RZMA 4PBPA 3VHNA 1BCXA 1H30A 1OF3A 1VE0A 3GJAA 4BPZA 4DUVA 4QGLA 1APNA 5FQ0A 3C3VA 2GU9A 3VBFA 5D21A 1KRIA 2A6WA 1RUF2 2VCMA 3PURA 1RVF1 4WM7A 2XWBB 1PK6B 3DL3A 2E31A 3B01A 4FPOB 2ZHNA 4R9DA 3S6PA 1MR5A 3ACGA 4AHXA 4F83A 1G9FA 3CJIC 5IVYA 3SMHA 5ABJB 1RUD2 3W5NA 3VBFC 1A3KA 4RS5A 1J1TA 3QCWA 4UFKA 1QXJA 3A23A 3AK0A 1IS4A 5FYMA 4MH0E 2R7EB 1OQDA 5A7WB 4X6QB 5FR3A 4EWAA 5FO9B 3E5QA 2R49A 4LIVA 1QJX2 2UYAA 3O0VA 1GKBA 2VOXA 4JAAA 1R091 4YVSC 1HRI1 1RMU1 2W1SA 4P00B 4QB2A 3LEKA 1H9WA 2VCBA 4XF0A 4Y1ZA 5BYNA 2MEV3 3N7MA 5K0UA 1QDCA 5FWEA 4M00A 4RQPB 2KXLA 3AB0A 2WFF1 1HXS2 4QDSA 1IZ3A 1URXA 5FQ0B 4AFAA 3HNMA 2H6CA 4E27A 2P3IA 2WO2A 1UY3A 4ONUA 4FOYA 1OC1A 4CDQB 1QF3A 2O14A 2ADDA 2Z2SB 3LEMA 3MF6A 5LK7B 5E16A 3UETA 3AYDA 2W46A 2HLEA 2DCZA 5DZEA 2GC0A 3KT7A 1H2LA 3AMHA 1JU3A 4ZONA 1VAMA 1LAJA 2JDYA 1AR82 3Q8EA 5LA2A 1CAUA 3JUUA 1J1LA 3BCWA 4GALA 4C1XA 1VBA1 2X53S 4O9GA 3JBG1 4LOTA 5FP3A 3USSA 1EAH2 4HVRA 2CAUA 3TYJA 3RZHA 2FD8A 1N1VA 3B69A 2WC2A 4M3CF 3USUA 4YNIA 1DQ4A 4KG8A 3HQRA 1Y4WA 3A0NA 2A6XA 1RUG2 3B9IA 1HV0A 1ZBE3 5EJZB 1ZYBA 1J83A 4LA3A 2GH8A 3LCPA 1VBA2 5DDJ3 3NJVA 5J7MA 4XDOA 2XLGA 4OYUA 3ES1A 3ZXFA 2ZEZA 4QT6A 3QBQA 5HCAA 2DVBA 4JHZA 2ZS6B 4CP2A 4HK9A 1TME2 1D7PM 1VBD1 4RHV3 5BNNA 1QJZA 3K2OA 4FXGB 1CAUB 5DXDA 3NJZA 5A3LA 5A1LA 3NAPC 4CCOA 1XQNA 2ET1A 5A6ZA 1GOHA 2O0OA 2VOTA 3GXUA 2PA7A 5LB6A 4YZ4A 1D4M3 4RR3A 3WOGA 4Z8BA 2OA2A 5FO8B 5E6HA 2Z4FA 2JDZA 2LTNA 2HKXA 5IVFA 4LTAA 4UT5A 5FPBA 5IFPA 1RB8G 1SZBA 2ZGOA 2HWF3 4EWDA 4Y20A 2QTWB 1VR3A 1YQ2A 3NVCA 2GALA 1OVPA 2Y8KA 4LBQA 5LBEA 3IPVA 2VZOA 4ZS3A 4AEDB 5CFCB 1JTZX 1R1A2 4E4SA 2YV8A 1S2BA 3DN7A 3T4VA 5J48A 3LA2A 1ZREA 1S0FA 5BNOA 1AYM3 1MVEA 3T2QA 3VL8A 1N1SA 2W5FA 1QY4A 2VOWA 4Y26A 4OCTA 5ABJA 1UQXA 4RR3C 5T5PA 1VRBA 2A70A 2LM3A 1JOBA 3LPGA 2D5FA 4W6XA 4CZSA 5C5UA 1UYXA 3CJIB 2WS91 1U5IA 4AQTA 1MACA 1WLWA 3OY8A 3TBDA 4NR1A 2F6BA 4YG6A 1ZNPA 4N7IA 1DZTA 2DCTA 5F5QA 4LO4B 4A3ZA 1X36A 1OOPB 3MF9A 4DEVA 4L0PA 1SFPA 2FDHA 1W04A 3GCXA 1W99A 5HXVA 4XETA 1HN1A 4D6QA 3WCSA 5K7PA 4IGOA 2OXBA 1VP6A 4YRDA 4IV3C 4CVUA 1V0AA 4MGYE 2W39A 4CUBA 2JG9A 3MGUA 5F6KA 2QQPA 4Q4Y1 3RZGA 3IIAA 1AR73 1POV0 4NHLA 3LZZA 5F5IA 5FZ8A 4E2SA 4B4QA 5F7UA 3BODA 1L7LA 4XXPA 5JI7A 4BQYA 1H1MA 3AMNA 4G9SB 2VXJA 5LBBA 3VDDA 5GZGA 1DYKA 2BOJA 4YW2A 5FZ1A 5CBLA 3FLRA 2BNMA 1AUYA 1TVGA 3E6CC 1W9TA 3AZVA 3WF3A 4JQRA 3OY8B 1SLTA 4YM0A 1F5FA 4LBJA 1DZQA 1N3QA 1CJPA 1JOJA 2HWF1 4IEQA 2FDIA 3W21A 3UJOA 1WW5A 3ZKUA 4UYBA 2WZ8A 3K75B 4YM2A 3M8LA 4BWOA 2VZTA 3FL7A 5F2SA 3ZDSA 5KHHA 1FMD1 4CCKA 3LD8A 2WFPA 3RMXA 1SFYA 1JOPA 1AR91 1OFSA 3I2HA 2HWC2 3FJSA 3U37A 3VBUC 4D6RA 5J37A 5DN2A 3ZFEA 1LOGA 2KD7A 5JPMB 4KBBA 1J3PA 4AVCA 4EN7B 4COVA 4OHXA 1ZRRA 2VQ0A 1RHI1 5FZAA 3I7DA 4QXHA 4UW3A 3VBHC 3WF2A 3GZUC 3AYAA 4DPNA 5FTTC 3D82A 4OVEA 4QQ2A 2YHJA 4CA9A 4DMIA 3OYWB 1LECA 2A3XA 1YWKA 3FLTA 2CDOA 1KD7A 3ZOIA 5DAWA 3KV5A 2PHRA 5BNOB 1UN1A 1B35A 1W8OA 3ZYGA 1XE0A 2P6CA 2VW0A 3PVEA 2VL4A 4C0BA 3SKJE 3JU9A 2IFRA 4YM3A 2ZBJA 5ISLA 2R071 3BIWE 5A7SA 2XBO2 1C57A 1CWPA 3QH6A 3TEWA 1LNSA 5BNPA 1S0DA 2YBKA 2ZMNA 1Q8VA 1WLTA 2DCYA 3WDXA 3ABZA 4BXFA 1GICA 4Q4W3 3OEBA 4CXYA 1DLCA 3VKLA 1O7FA 4FOVA 1C8M3 4UXAA 1TMF2 2PHFA 2PHLA 2WDBA 5FY7A 2C5DA 5IK5A 2VNGA 4WM7B 1TG7A 1Y9QA 2WZR3 1A34A 1NZCA 1BEV3 2MEV1 3CNAA 4PDWA 2J1RA 2C4XA 1AYN2 5CFCA 2GP5A 5L19A 4R4ZA 3UYJA 4ES8A 5DUVA 1E5SA 4N90A 4LR4A 4XQWA 4P5YA 4Y5TA 2HWE2 3POIA 2YC4A 4IEOA 3VBOB 3HD8B 3Q8FA 4JQTA 4LUKA 1RTVA 5J98B 4QWNA 4XCBA 2NM1A 2KM2A 3GZAA 3MHZA 2CY6A 3VD3A 1CPMA 5DAVA 4RQPA 3WUCA 1ASJ3 1G86A 1Y43B 2XQRA 2IVJA 2XVGA 2ZAHA 1SDDB 4Y22A 4W6YA 1JZ8A 2K46A 3RZZA 4IEUA 1BVVA 2GC1A 1IQDC 2DVAA 1UPSA 4QD2A 4QHBA 4Q0SA 3KT1A 1XC6A 4GB32 2R062 4CDQC 1AZDA 3ON7A 2D97A 4HBNA 1W28A 4UFJA 3PVOA 5BNQA 5AFEA 1CD3G 5F2WA 1UOFA 3MLLA 3INAA 5JWPA 2B45X 3HR9A 1W2UA 2XVKA 3AP9A 3N7KA 4RS5B 3NNJA 1AL23 3VKNA 4Z2AA 2EIBA 5ERLA 3ASIA 2WZR2 5FXWA 1RGSA 4OHZA 5A1FA 2ZX2A 4QPWA 4DZGA 3BUCA 4EN0A 2OZJA 4GB31 4D8MA 2ZMLA 1H4HA 5HPOA 1XSRA 3KHCA 1ND3A 2JDUA 5EYYA 2RMU1 1H8TB 2D44A 5DDJ1 4D7SA 2E26A 1SLIA 1POV3 5A7QA 4AVTA 4ZHNA 3WW3A 3AKRA 4C90A 3MW4A 5FP4A 3AXEA 3VZKA 1BQPA 5T5OA 5BV6A 1RC6A 1MPXA 2ES3A 3DKWA 3IIIA 1H1IA 3DYOA 4B7EA 3IDAA 1ENXA 3AZXA 1GBGA 3LOIA 5IWFA 2IXJA 1JZ5A 4MXWB 5C3SA 4P08A 3OG2A 3OOXA 5CVRA 4KL1A 2QDRA 4AHZA 1X9PA 2RDQA 2Q8OA 2YZ4A 2JG9C 1BBT2 1LOCA 1NYWA 2XHNA 5A6QA 3W5MA 1X82A 1D2SA 2Y6LA 4XUTA 5CYYA 1RMU3 5KWRA 2P4EA 2VU9A 1X33A 2JX9A 3KQRA 5GZCA 2B9VA 1DIWA 4XZUG 2WNUA 4PIXA 1UX7A 1J3QA 5FY4A 3OJBA 3NAPB 1OUXA 1LHWA 1O5UA 3BI3A 2E33A 3T0AA 4IERA 4BLIA 5FMBA 2Y6JA 2BVBA 3J7NA 4CDUC 1RINA 2R061 3LGRA 4XPVA 3AP6A 3UGHA 5FY0A 3H1WA 4LORA 4QU2A 3C7OA 4RFRB 3WG4A 3ZPOA 2VUAA 4LPLA 4L8QA 1J3RA 1WW6A 2A6VA 4QQLA 1RUD3 1JUIA 3H8UA 4XE9A 1C28A 4L2NA 5T5LA 1MS4A 1X9TA 4RL7A 5JZGC 1WMDA 4FP3A 4NRMA 4XBNA 2JD4A 5HCBA 3IDCB 4ZXKA 4LOSA 4YZ5A 4GMP0 3VDCA 1OLRA 2HWE1 1VAVA 1MVQA 1VBE1 1Y9MA 4YW5A 1HRI2 1COV2 5K4LA 1PK6A 3AKSA 3I4IA 2FZ2A 1Y7BA 1N3PA 4LK7A 1S0GA 2JICA 1COV3 1W03A 4NPRA 5FP7A 1CZTA 4NAMA 5L9BA 1W2AX 1BZWA 1UPIA 2ZGPA 4J6GA 2BU9A 3WUDA 4BA6A 3NAPA 2WZEA 1AXZA 2JECA 2E7TA 3O1PA 5EYXA 3Q9OA 3SCGA 4V2VA 3ZO0B 2D6MA 4AQ2A 1VIWB 2CAVA 2RS52 3WQ7A 1X50A 2UY9A 2Y34A 4JCKA 3U78A 3BTXA 1RHI3 4Q4Y3 5IVJA 2WA3A 2QE3A 2XWJB 4QB6A 3HT1A 2DTWA 3NV2A 4MUVA 4NHKA 4Q1PA 1Q56A 4JX0A 5JMCA 3KCCA 4LKSA 4FTBA 3ETQA 1YI7A 4Q29A 2UU8A 2QQMA 2VMFA 4LLFA 3E6DA 1W06A 3VHPA 1KDKA 1NZIA 4S2GA 2Z5WA 4CDWB 2FQPA 5I0SA 5CKNA 2A6YA 2PMWB 4HL0A 2HWF2 4IQPA 4PIYA 1H6XA 2V4VA 4Q0VA 4LNVA 1NX9A 3SC7X 5CFDC 5KR7A 1W6PA 4LE4A 2J1AA 3RZLA 2ZKNA 1Q5OA 1W2OA 4ZPIA 4XAEA 3USUB 3HJRA 3VDAA 4OI0A 2JG8C 1W0NA 2W87A 1WBFA 5L9VA 2CHHA 2CSGA 2XONA 5CISA 2IXKA 4FPYA 3VZNA 1Q3EA 1ULPA 3JQXA 4A2UA 4ZU7A 1YIPA 5C9AB 5JOWA 4WM8A 3WF0A 2GNBA 3AP5A 1ASJ2 3WW2A 2JENA 3S7EA 5FDBA 4QU1A 4CP9B 5EXOA 2JG8A 2VXRA 1SLCA 3I59B 2WWSA 3N4MA 1PGL2 1KJLA 5H9RA 4YG3A 4AI8A 2WS93 2RM22 4CXWA 1LGCA 4Q4V2 1EAH1 3UK9A 1PM4A 2ZGLA 2BERA 4TYSA 5B4XA 1XBFA 3DF0A 2HWC1 4ZU5A 4AE2A 3WDUA 5E88A 3HN3A 4QX5A 4NIIA 3SH3A 3V0BB 1XB9A 2IXLA 5A3WA 1D4M2 3T09A 4FFHA 4LBMA 4XJAA 1JUHA 3VBSB 1XNBA 3R0RA 3VBRA 1G9BA 4GZ9A 4YW4A 2RM21 1QMJA 1FV3A 3POFA 3DYPA 1OF4A 1QWRA 2BNNA 2BTVC 3O0WA 5C8CA 3I3EA 3MI8A 3T1MA 4Q4X1 1WWYA 4JRAA 1MZEA 5JDBA 4COWA 1UIKA 4YSFA 3AVSA 2BBAA 3W9AA 3C7EA 1UYPA 3WG2A 3ZXDA 4M3CA 3KGZA 2R042 2IXIA 1UCXA 4NIGA 3LSEA 5LCWL 5C71A 1WLCA 4WM7C 2QQNA 3EBRA 3PUSA 3WP6A 4UAPA 2ZMKA 1YQ5A 4IV3A 3VHRA 3CJXA 5I8TA 3M7AA 4ZZ5A 4Q5OA 4XFCA 1PZ8A 1OURA 3WQBA 4PJYA 5D8AC 1WCKA 1V6JA 5LBCA 4DIQA 1SMVA 1ZRFA 5JZGA 4I0WB 1GFF2 4FAHA 1V70A 2Y60A 2PLV3 1NLSA 2DCJA 5LRRA 5C3RA 3PUAA 1HIXA 3ACLA 4IE5A 1LCLA 1DQ2A 1GANA 3DPRA 4UF0A 5H9SA 3H8XA 3UJQA 1JZ3A 4COUA 4M0HA 3JB4C 3J26N 1MS9A 4N43B 4ASMB 5F9TA 2XUMA 1BLZA 1CIWA 2LRPA 2DUQA 1GQGA 1US2A 4LULA 1QHDA 1IGOA 3T2OA 1PM7A 5SV8A 3K4ZA 2RJLA 1W3XA 5FKBA 4LJHA 3AVRA 3O12A 3POGA 1GSLA 1KFUL 3ZXEA 1E5IA 2WNOA 1DG6A 1FAYA 1R1A1 2WRAA 5FUPA 5FPUA 5LA9A 1GQPA 3WSOA 4DY3A 4R9AA 3IB3A 2ETEA 4LBKA 4EE2A 1SCRA 3WV6A 2HWB1 5HV4A 1F4AA 3N3HA 4IEVA 3ZN6B 5A3UA 2DUOA 2IC1A 4FPFA 1O3SA 1W6MA 4AFMA 2JDKA 4A7YA 3BTYA 2AR6A 2ARXA 2R073 3H1YA 3VBFB 5FZ7A 1QJU3 4LUMA 1EV12 1FMD3 3LPFA 4BQ3A 1H8TC 1RJ8A 4RGGA 4Q4V1 3AZWA 4BM8A 4URAA 2YBPA 1XSQA 4QKFA 5I91A 1SBFA 1GWMA 5JSOA 2F17A 2Y0OA 2XJSA 4XEZA 1X7NA 2B39A 3ZYRA 1FOD1 2VBPA 2NZ9A 5D2AA 5IATA 1ZZ6A 5IVVA 2A5ZA 1XJAA 3EXUA 4I09A 4PF5A 5DUXA 4QX3A 4P9GA 4N43C 4OULA 2VZVA 5C7GA 2HWB2 3T4HB 2EXJA 3KV6A 1QQP2 4LO5B 4LQRA 1G7YA 1CESA 2DVDA 3ZFFC 1UOGA 4OHVA 1UZWA 4PHZA 2IFWA 3MFCA 1IPKA 1N3OA 1POV1 2RS12 3I2JA 1STMA 2EA7A 2D43A 5FPZA 1NA1C 4XF1A 4ES9A 1TME1 4PQQA 4DRRA 1ZBA1 5B4NA 1RUH3 3CBNA 4HZFA 3LE0A 3SCFA 1O59A 3DUIA 5CEHA 4XJ8A 1EP0A 3LF7A 3UT0A 1LHVA 3NV1A 3BB6A 5FMOL 3Q8BA 3WD5A 1YO8A 5LY1A 5F6LB 2OYZA 4BDVB 4D6SA 3D0SA 3KF3A 3WDYA 2WNVB 2RDNA 5GKAC 2N7GA 4NRPA 2PN5A 2ZEXA 2K2SA 1MS3A 2Q1ZB 3PMSA 2FMDA 4NROA 2YC0A 1SBDA 3GALA 3M2MA 2WYFA 3OPTA 1QQP3 3PL0A 1FYUA 4JGZB 4AL9A 3I97A 1D0GA 2Q1FA 2W2IA 5FZHA 3ZMOA 4BCUA 1OD3A 3DYMA 3L9JT 5DG2A 5JXJA 2TBVA 4O61A 1W39A 2HEVF 1NY71 2Z79A 5FMDA 4CU9A 2JIJA 5FREA 1MZFA 1LODA 3SH4A 1V6IA 4HKOA 5FY1A 4OQ9A 1KS4A 3I2GA 4UOJA 4LHLA 1PX3A 4Y1VA 1JZ2A 1WD4A 1CZSA 2GC3A 1V6OA 1HW5A 3O1TA 4OUMA 2XJTA 4O9EA 1S0IA 1W0PA 2BYVE 3MO4A 5JIAA 1WMXA 1IS6A 2Q8EA 3S57A 3PU8A 4S2FA 3EJKA 3MUY1 3ZFEB 4CCLA 1IS3A 4QPIB 1WW4A 3I2KA 1SHWB 1L7RA 3H7YA 1PIV3 3AL6A 4Y3OA 1I3HA 4FOQA 4UBHA 3V0AB 4OI4A 2GDFA 2VZUA 3N9LA 1NUKA 4UW4A 2VNOA 4CEWA 1Q8SA 2O8QA 1ODNA 4AGVA 2BRTA 3ZPYA 2XPJA 3ZN6A 5FYIA 4LIUA 4CU6A 5JI9A 3VBRC 3VKOA 2X29A 2DV9A 1AR83 3FN9A 2C9KA 3KV4A 5LEJA 1V00A 3IDBB 2BFUL 5IT6A 5GZFA 2Q5TA 3R4SA 3WNMA 4DXSA 3F95A 1H2MA 3ZYBA 2HWD2 2V09A 4XFFA 1PZ7A 1S2KA 4IDZA 1ASJ1 3PHMA 4JVAA 1W8ZA 2HWD3 2JKBA 3ZFGA 1GNZA 3ZXGA 5K9YA 1VPHA 1F31A 2WNUC 3PIGA 3VD5A 4ZZ8A 5HCHA 4N7UA 3Q8CA 5FLHA 2FCUA 3AYCA 3NKTA 2K9ZA 1ZBE2 3IKWA 3NNMA 1H4GA 1W8FA 4UW6A 4YGEA 2PHDA 3U11A 1JN2P 1GV9A 2W9XA 4ISQA 5DDJ2 2PAEA 2GNDA 1WKYA 1KITA 3WG3A 3IWZA 2I07B 5C4WC 4MADA 2BUKA 3H50A 1PX4A 3HQXA 1LRHA 1PIV2 5GZDA 1EUUA 1RMU2 1E5RA 1YHFA 1SDWA 1QJEA 5FUNA 2WLPA 2Y6HA 3VBSC 3LB9A 1TE1B 4NMIA 4DXZA 5GLVA 1VLNA 1RUI2 3T3YA 2WNUB 3KQ4B 5T52A 3BU0A 3S0MA 1UMIA 2D93A 4JV4A 2ORXA 2RV9A 4YFWA 3ZYHA 2JDMA 1LOBA 2VCAA 1GOGA 2DFBA 4CXXA 3CZJA 3VBOC 1O4TA 4HETA 1JXNA 4LBLA 5F5CA 4BZ4A 5FZGA 1UXXX 1QIQA 2O8OA 1RL3A 1AX0A 4NRQA 4XBQA 1MS5A 2A3WA 1QNYA 4I01A 4N53C 3NQHA 5FK8A 5JPNB 2RS11 4W65A 1I9RA 4YW6A 5G05L 4DINB 2A71A 3O14A 4QPIC 1K5MC 3MIBA 4XOGA 2P5BA 4QXKA 4AEDC 3WP3A 4C91A 1F4HA 1W8UA 2ERFA 4E4ZA 4K3UA 1RIRA 2DURA 3BALA 5DUUA 1AVBA 1EPZA 4CP9A 2QDNA 2GC2A 3VDDB 3OB8A 3H3LA 2ADEA 1W6PB 3O1SA 2V5DA 3JD73 4AHWA 3CL1A 3WNPA 5AC93 3C7GA 3PUQA 4AI9A 3FX3A 4PI2A 3O1MA 2VUCA 4IV1B 3T2TA 4LHKA 1QOSA 5FYVA 1UX6A 3WDWA 3RWNA 5BNOC 4JHTA 2VZSA 4FPGA 4AQ6A 2CGOA 5FYCA 1MZ6A 4BQWA 1NXMA 4GIQA 2XGXA 3POWA 4FOWA 1JI6A 2RS33 2P37A 1OOPA 1JZ4A 4K8FA 1OPOA 3I59A 3FC0A 5IUQA 1UF2C 2XVLA 1UO9A 4H14A 5CAZA 1ZRCA 5DMYA 2R0HA 3NMBA 1FI2A 4NVPA 1ZM1A 2RVAA 4JGZC 1N1TA 1RUF3 1VJ2A 2WT1A 3HEIA 3HN1A 1MS8A 3NL1A 4UF0B 1GU3A 5LY2A 4P9JA 5EJ1B 4AZZA 4CTEA 3HQUA 2ATFA 1K5MB 3J7MA 4GA9A 4E4DX 3ZFFB 4M4RA 5L7OC 5KC5A 2RDRA 3LDRA 1RITA 2YDEA 4HPKB 2FDGA 3U10A 5FJKA 3V56A 5D8AA 1UOJA 2JDNA 4AVVA 1VMHA 2XUEA 1GNYA 3GZTB 1VBC1 1DQ0A 3PIJA 2VMHA 1UU4A 4PLMA 1LJ7A 5A3PA 5A6XA 3MW2A 1U5YA 2WWUA 3RSJA 3RYRA 2EIEA 4FQ4A 2VM9A 3ZKYA 4WZCA 4AGRA 5TSWA 1X8EA 2A6ZA 2X5IA 4TLGA 1OI6A 1NCQA 1YQ8A 2WABA 3ES4A 4Z82A 4AR2A 1WD3A 5AVAA 4HXCA 4IE7A 2WYSA 3ZIXA 1OPMA 3ST7A 4NJ4A 2YFZA 4WZFA 2E9QA 1R1ZA 5FK7A 3CKHA 1XNKA 3TRSB 3GJBA 3VDBA 4I3GA 4OI2A 2HEYF 3NNGA 3WW1A 3NRUA 3RQ0A 5GJ6A 4ZKTB 5J1XA 2VUDA 1S0EA 3WP5A 4ET7A 4QMAA 4R9CA 4XQDA 5BY5A 3CEWA 5LZ6A 5DPNA 5FZOA 1IOAA 3RI8A 4IEPA 4CPBA 4I2OA 1JYTA 4QQPA 2YB7A 2RR12 3HMYA 5IVBA 4IE4A 2CWSA 4YZ2A 4HFSA 1DYPA 2ZOEB 3E97A 1NCRB 2ZZQA 5LASA 1Q8PA 5AFBA 1XYPA 4B1LA 4RQPC 3DCQA 5A70A 4RFT0 4N53B 2RJKA 4YM1A 4ZU4A 1GR3A 5LA1A 3THDA 1H0BA 1HRV2 1PVC1 1FX5A 2P6HA 4AFBA 3AKPA 2YU1A 4IGPA 4AOCA 3O1VA 1BMV1 1D2QA 1LOAA 3MYXA 4IL7A 4C8DA 4HONA 4NE9A 3WX5A 1PMJX 3NJYA 5LBFA 1MEC3 3V65A 1SQ4A 3UKTA 1ND3B 1TZOA 1QJU1 4HG6B 4NO4A 2JWPA 5CFDA 3NNLA 2B42B 4IGQA 5FZ9A 4Z2WA 4J1XA 4O65A 4MYEA 4HVOA 2JB4A 3PLQA 2XJPA 4K1ZA 2BEOA 3LFIA 2VQTA 4YPJA 3CF6E 1GYKA 1CPNA 2D5HA 3VV1A 4BJ0A 4GMP1 1OA3A 2UURA 5JVVA 4HKWA 1NCRA 1WGPA 4OUSA 4GWNA 2EXHA 2ZAAA 3MLKA 4K20A 2WFF2 4EN8B 2H0BA 4TZDA 2V73A 4WVVA 4B3NA 1FNZA 1HQLA 2A7AA 3OGGA 1NY72 3AP4A 3LQCA 2ARBA 5FZOB 2ZGSA 2RG4A 4XYXA 2RHPA 4YVWB 1B09A 3L2HA 4RD7A 3VN4A 3PU3A 1QQP1 5GLTA 3S7IA 1SG3A 3N35A 4PF1A 3JBG3 3IBMA 1ZBE1 1TNFA 2ZJCA 1TME3 3ZSLA 2WZPP 3SISA 1AR93 2HBTA 2BGOA 3GBWA 4ASLA 1KGYA 3K51A 4KH9A 2DWRA 4FPEA 2ZX4A 4K6BA 2FDKA 1XXNA 1G8WA 1RHI2 1VB2A 4QGMA 3MPPG 2R041 1JS9A 3WNOA 4B1MA 3IZOA 1PMHX 3RDIA 5ANNA 2CDPA 2W1UA 4CU7A 3VBRB 3ZSJA 1YIFA 1Q43A 2NN8A 3PTRB 1A78A 5FMCA 2WAAA 5KHIA 2ZX3A 3IAPA 5CKQA 3T08A 3HOBA 2WQ8A 4QM8A 4QDRA 1JYNA 4AEMA 1W6NB 2CV6A 1LTEA 4RSUA 1VBB2 4WBBA 4XFBA 3TNQA 4BISA 1JW6A 2E51A 2XOMA 2DUPA 4IW3A 1NXD1 4LBNA 4QQHA 4KGQA 3T1LA 3B94A 2WT0A 2QQLA 4MGZE 1JYIA 2BPA2 2VOVA 2YGMA 2D7FA 4FXKB 2CYFA 2ZKLA 5A7NA 1C5HA 2IZWA 3OBZA 5FFOC 3SXWA 1NE4A 3RFRA 2G9GA 1YUDA 5I8YA 1POQA 1ST8A 1WCSA 1CQ9A 1WZXA 2QQUA 3CO2A 1V6LA 3OGVA 4N9IA 3ECQA 1FOD2 2P2KA 1CAVA 3E1F1 2VTXA 1LHUA 4GJZA 4FPHA 1TQ5A 3ZVXA 3I49A 4AAXA 4WVMA 5ACA3 1UKGA 1W6QA 1F35A 3VDDC 2BGCA 3GM8A 5GZEA 2AEZA 1V6KA 4XFAA 3FWEA 3OF1A 3CZUA 2PXJA 1O8SA 4FI9A 2VBDA 2OT7A 5F3EA 1UAIA 5FXXA 2VO5A 4YGCA 4YWAA 4P9LA 4Q8KA 3L2YA 4XACA 4DEQA 3P3NA 3KZ4C 4L11A 4BHPA 4NWVA 4YFZA 1SLLA 2D3RA 4RA0A 3WNXA 4BQ1A 4FFIA 2HBUA 1CONA 3H1MA 1RUE3 1TNRA 4ITCA 1XNAA 3FUQA 1R083 4QB1A 4A3XA 5CG9A 3ZFGC 1ZZ8A 2W0XA 4LK6A 3RJ2X 3FE5A 3RS6A 2PAKA 1YI9A 2JDHA 2ZX0A 5FZEA 3S5QA 1ODMA 3OPWA 2XL9A 4XUPA 1JMUB 1VMJA 3ZN5A 3NV3A 1XNDA 2RE9A 1JYCA 3OD0A 2D6NA 2VMEA 1UY4A 3J8F3 3J9SA 1QH6A 4GWJA 4LT5A 1GZTA 4HMZA 1Z7S3 3WP4A 1EY2A 4YG0A 4PCRA 2OS2A 1K42A 2RS31 4O7XA 3FFQA 1F5JA 4P5HA 2IXCA 2L9LA 2F4LA 4CCJA 4DO0A 3OSDA 4E8CA 1JZ6A 1UMZA 3T0BA 1FT9A 3N36A 2XJRA 3KM5A 2SBAA 3ACHA 1CAXA 1A8DA 1WCUA 5HBAA 3BKZA 1E5HA 4LO8A 1BEV1 2W08A 1YYNA 1IG0A 3IMMA 4AVSA 1Z78A 1O91A 5F3CA 1AYM1 3AXDA 1RUE2 3OTFA 4AXOA 4JDOA 2OVUA 3OUIA 5B2GB 3SQOA 1PK6C 3POYA 3W20A 1V6MA 1EV11 3GGLA 4B8EA 1C1FA 2HWE3 1OKOA 4AEKA 4W50A 1O6UA 3JD72 4E4HA 3FHAA 3I3MA 3O7OA 3OBTA 3BVCA 1ZA4A 2VZ1A 5CG8A 2CGNA 1NG0A 2OUHA 4CPBD 2TEPA 2WLQA 2R32A 3ILRA 1I5PA 2G9FA 4R52A 2A1XA 2WKKA 1FPN1 3JBG2 1RYYA 5FOJB 2R063 3N9PA 5JIUA 1D4M1 1REDA 4N8MA 1O3RA 4YW7A 1MEC1 5KXDA 2ZX1A 4JKLA 1UL9A 2I2SA 4Q4W2 2QCSB 3VL9A 2Y38A 4EQVA 3E5XA 5CFDB 4FFFA 5I0UA 4MZUA 2X5IB 1QXRA 1LOFA 2E53A 1KFXL 3KV9A 1OH4A 4BIOA 4D0QA 1JZ7A 2AEYA 2GMMA 3LKJA 4FCAA 1V9U3 3X29B 4XDPA 4AI3A 5KC6A 3FFZA 1UWWA 2CWMA 3MV01 1QXPA 3BOPA 3POSA 1DZRA 5FYSA 4AEJA 1Z7S1 1BEV2 1ALYA 1OLQA 1Y9GA 1K45A 4WM8C 2HYXA 2BP6A 3IDEA 1XE7A 1UNBA 2W1WA 4Q26A 4CUAA 3CHXA 4H7LA 4MGKE 4NOTA 1HJGA 1GWLA 3AMMA 3LIHA 5BNNB 4U36A 2QZ3A 2QQJA 1NA1A 1SCSA 4XQ4A 4EZ4A 4AI1A 4Z1VA 4QX0A 4UFIA 1NKGA 1AL0G 2XR4A 4BE3A 4F8AA 4DUXA 5EWSA 1I1EA 4LKDA 1WA4A 4ORFA 4BQ4A 1ENQA 2YYOA 3ZFFA 1WCQA 2GAUA 2G9ZA 4A4AA 4EYUA 1CZVA 1U5XA 2ZCWA 3JCIA 1ZX5A 5JCTA 4CDUB 3HWJA 1N1YA 2A75A 3CIHA 3MFAA 4XFHA 5IW0A 3UL2A 5K0UC 3N7LA 5EFUA 3KF5A 1IG3A 3HBKA 1LOEA 4V2WA 1W0OA 1ND3C 3T30A 4AAPA 2FMYA 5JSPA 3TN93 4ATFA 1WMEA 3LDKA 3U4XA 1GUIA 3BTZA 5GLWA 5KHGA 3RYPA 3FUOA 1W8HA 3AX4A 5JXGA 1WMFA 1CJDA 2GMEA 4FAGA 3AC0A 2HWC3 2HEWF 2MPFA 4JZRA 4LKFA 2HYKA 3CLPA 5DAPA 5CB7A 5T54A 3WHTA 2R6QA 1BYHA 2W95A 3EB7A 1VRH3 1JHNA 1ULOA 1F2NA 3CJIA 3EYPA 4X8PA 1YFXA 4B4PA 5C33A 4PLNA 3K48A 1OFNA 5IVCA 1W6OB 2ZEWA 4HKLA 4L97A 5HV0A 4DY5A 5FZFA 1G9CA 4JRLA 1YRZA 2LS6A 4B29A 4AW7A 4KU7A 3LSDA 2DVFA 4XUNA 3N9MA 1OOPC 5FXVA 2P1BA 2QQWA 3OBAA 4UWDA 5DZGA 3KB5A 2IXHA 1L7QA 4W4ZA 1H2KA 1B35B 5A7WA 1W90A 1D4VB 5EZWA 5CFCC 3GBFA 3QLQA 1ULFA 1KXGA 2F4PA 3KGLA 2D98A 3AFGA 5IJRA 2WN2A 4Y22B 4EWEA 1RUJ1 4QPGC 1YFUA 4QPGA 1QNWA 4OMCA 5T50A 3U0ZA 1DYOA 4YW1A 3ENRA 3RRDA 2OUJA 3PTYA 4JTOA 3VZJA 5J96B 3Q8AA 5DABA 4ZXEA 3J7LA 1HRV3 5JLVA 1QDOA 3DXTA 4OI1A 4CSWA 1W3VA 1BVP1 3GNEA 1WW7A 5A3TA 1OVSA 5FZIA 4P9IA 2DVGA 4JTNA 4QM9A 3VB9A 2Y26A 2XB6C 1JH5A 1UIJA 1I5ZA 1ULEA 4QKDA 2WO3A 3NV4A 2QUOA 4K40A 4DQAA 3I2OA 3I2FA 4Q27A 2WA4A 2D6OX 3O1OA 5AVPA 3HBZA 4HANA 4CCMA 1REEA 4EV0A 4MOAA 1YQ6A 3G6JB 3CDZB 2WO1A 1PVXA 1W6OA 1CGPA 5F5AA 2PQQA 5FV3A 4Q4X2 4LO7A 3RJRA 4Z92B 2RR13 2QQVA 1OLME 1NLQA 1KQRA 4PI0A 1R1A3 5T55A 4IETA 3POJA 5ACA1 3LA7A 1ZZCA 3PVBB 3KSCA 5LW9A 2VVDA 1HRI3 3ELNA 3RNSA 3NWKA 1U12A 5CKMA 1U5ZA 1XE8A 3U14A 1ND2A 2E6VA 2WAOA 3FBYA 1MZ5A 2QBXA 2WIIB 2J7MA 2EAKA 1G9AA 1DQ5A 3MIEA 1CAWA 4XABA 1PO13 2BNOA 3D6EA 4RYDA 2FBEA 3DV8A 4AI2A 1LOFC 4LXLA 5FIXA 2ENRA 5A3MA 1WUVA 2VPVA 1A6CA 2PYTA 4BH9A 3AJZA 2PLV1 4LBOA 2BVVA 4YVWC 2VTFA 4Q4Y2 3W59A 4Q0PA 5FZLA 3IN9A 4QHOA 2I74A 2XG3A 5JSRA 4UFHA 5FRAA 3ZX7A 1O3TA 5EPAA 2B4KA 2OX0A 3ME2A 4Q4X3 1I6XA 1F15A
chains in the Genus database with same CATH topology
4DXRA 1O8PA 3NQHA 5G05L 3I3BA 2CDOA 1F4HA 1DP0A 2W92A 1UZ0A 3ETPA 1W8OA 3OB8A 2VL4A 3VD7A 3SKJE 3OGRA 4P02B 2V5DA 3WNPA 4IUGA 3C7GA 1J84A 1W9WA 3ACIA 4MGQA 2OKXA 2VZSA 1LNSA 2V72A 1JI6A 3VD4A 1JZ4A 3ABZA 3WF1A 3OEBA 1R64A 1DLCA 4A42A 5DQ0A 4CUCA 5CZKA 1EUTA 5DMYA 3IAQA 1K12A 2RVAA 2WDBA 2JE8A 3HEIA 1GU3A 5EJ1B 3PUHA 5JXHA 4LHSA 2J1RA 5HXMA 2C4XA 4M4RA 5JXIA 1OT5A 3UESA 4P5YA 2YC4A 4QX2A 1JHJA 3I2IA 1GNYA 3WF4A 3VD3A 2VZRA 4AG4A 1SDDB 3MUZ1 1JZ8A 1GMMA 2EIEA 2VM9A 1IQDC 1XC6A 1T2XA 2WABA 3ACFA 2DDUA 2WYSA 2QQKA 3FHQA 2YFZA 4Z2AA 1UXZA 2EIBA 3CKHA 4QPWA 3VD9A 3VDBA 3NNGA 4D8MA 5HPOA 3NRUA 5J1XA 4ET7A 4QDQA 2E26A 5DPNA 4JKKA 2VCCA 2YB7A 3IIIA 1MPXA 4RN5A 3DYOA 4QX1A 3IDAA 1JZ5A 3SEEA 4P08A 3OG2A 2EICA 3HPNA 2RJ2A 3CMGA 4OUEA 1UYZA 3K4AA 2XHNA 3W5MA 3C7FA 5LA1A 1H6YA 2Y6LA 3THDA 1GOFA 4XUTA 5CYYA 2YG0A 4MO3M 2B9VA 4XZUG 4A41A 1UMHA 1PMJX 1UX7A 4OMDA 3OEAA 4HG6B 1W9SA 2E33A 3T0AA 3LEIA 2Y6JA 2BZDA 2VMCA 3JXSA 2VQTA 2JDAA 3C7OA 4YPJA 1KEXA 4LPLA 4BJ0A 3NJXA 2PQSA 2W47A 3DECA 3HNYM 3VDCA 3K77A 3I3DA 3LQCA 4A6OA 3ZM8A 4E8DA 1SG3A 1CZTA 4PF1A 2W91A 3C7HA 4W8JA 2WZEA 2BGOA 1KGYA 3BGAA 2E32A 3K46A 1US3A 3WNOA 1PMHX 2CDPA 2W1UA 4CU7A 4PT6A 4QB6A 4BXSV 4DUWA 4JX0A 2WAAA 4LKSA 2X05A 3IAPA 2WBKA 2QQMA 2VMFA 3T08A 3HOBA 2WQ8A 4QDRA 2ZEYA 1JYNA 1UY2A 2WN3A 2Y6GA 4JKMA 1H6XA 2V4VA 3OGSA 2XOMA 1NX9A 4GWIA 2J1AA 3VDAA 2QQLA 3HJRA 1W0NA 2W87A 2DCKA 2XONA 1ULPA 4A44A 3T0DA 3WF0A 5JR2A 3OGVA 3ECQA 4ARYA 3E1F1 2YC2A 2X09A 4AAXA 1K3IA 3GM8A 5FUIA 2BERA 2J1SA 5B4XA 3CZUA 2VZPA 1O8SA 4FI9A 3WNKA 5IYYA 3LEGA 3HN3A 4KWUA 2YFUA 2VO5A 4XUQA 2W3JA 3T09A 2J22A 2VZ3A 4DEQA 3MBWA 4GZ9A 1UY0A 3C8XA 1CX1A 3THCA 3DYPA 1OF4A 3F2ZA 4ZY9A 3I3EA 4CU8A 3P6BA 3A22A 1XNAA 4QB1A 5I0DA 1CIYA 4KI5M 2BBAA 3K4DA 5IFTA 3C7EA 2W94A 1UY1A 1BHGA 4XUPA 2VC9A 4MGSA 5LCWL 5C71A 4GWJA 2QQNA 2VMEA 1UY4A 4UAPA 1K42A 4ZZ5A 2L9LA 3WQBA 2Y6KA 2VQUA 5LA0A 3D3AA 4XURA 4E8CA 1JZ6A 5G04L 3T0BA 5IFPA 4DUVA 1OF3A 3ACHA 2LW8A 2DCJA 1JZ3A 2E31A 3ACGA 2ID4A 3W5NA 4KMQA 1US2A 3T2OA 3GGLA 3A23A 3K4ZA 4W50A 5JUVA 2R7EB 2JKXA 3FHAA 2VZ1A 3WSOA 1GQPA 3BN6A 3IB3A 4QAWA 1JYXA 5IHRA 2W1QA 4P00B 1I5PA 2W1SA 4QB2A 3LEKA 3T2PA 2VCBA 1F4AA 1RYYA 4A45A 4QDSA 2J1UA 5JMOA 3HNMA 4JKLA 3A7QA 2WO2A 3LPFA 1UY3A 1P8JA 4D0QA 1OH4A 1JZ7A 1JYVA 3UETA 2W46A 2HLEA 3MV01 1UWWA 1JU3A 1K45A 2HYXA 1XPWA 2W1WA 5LA2A 4CUAA 2C26A 4QX3A 2X10A 2VZVA 2QQJA 5C7GA 2VJXA 4QX0A 4LQRA 1NKGA 4DUXA 5EIYB 4TTGA 1WCQA 3A21A 4A4AA 3I2JA 1CZVA 5EJZB 3CIHA 1J83A 4PQQA 5B4NA 3NJVA 2VR4A 3LE0A 4XUOA 1O59A 4UI9L 4OYUA 2EIDA 2ZEZA 1GUIA 3HNBM 4JHZA 1D7PM 4BDVB 4BK5A 5JXGA 3CQOA 3AC0A 2ZEXA 2W95A 3EB7A 3EYPA 1ULOA 1GOHA 2VOTA 3GXUA 2ZEWA 2J1EA 2J1TA 3GDBA 2LS6A 2Z4FA 3SEPA 3I97A 4BK4A 4XUNA 1UYYA 1OD3A 2XQXA 3DYMA 1YQ2A 2VZQA 4ARXA 5JXJA 3OBAA 2Y8KA 2VZOA 4CU9A 1XNTA 5C70A 4W4ZA 1L7QA 3WNNA 3T2QA 3WEZA 3I2GA 4UOJA 1PX3A 2W5FA 2JD9A 5IJRA 1JZ2A 2WN2A 1CZSA 3LPGA 4OMCA 1DYOA 1UYXA 3MO4A 3P1IA 4ZXEA 3PUIA 3MUY1 3I2KA 1SHWB 1L7RA 2WUHA 4A3ZA 4DEVA 2Y64A 4L0PA 3UNPA 4XVHA 2VZUA 1W99A 1NUKA 4TXWA 1HN1A 2WO3A 3SKVA 3I2FA 4CU6A 4CVUA 1NAEA 4CUBA 3FN9A 4MOAA 2C9KA 5F7UA 2BGPA 3WNMA 4DXSA 3CDZB 2WO1A 4OZOA 3MV11 4DXTA 2ZXQA 4ZZ8A 3VD5A 1TVGA 2J1VA 1W9TA 3WF3A 1JYWA 2W9XA 2ORZA 1WKYA 2WAOA 4MADA 1PX4A 2WZ8A 3K75B 2QBXA 1EUUA 2J7MA 2VZTA 3FL7A 4RYDA 2Y6HA 2VMDA 5A1AA 3I2HA 3U37A 2QQOA 2VTFA 2QQIA 1UMIA 5DN2A 2KD7A 2ORXA 2RV9A 2VCAA 1GOGA 4M4PA 1JU4A 3CZJA 3WF2A 3WNLA 1W8NA 3J7HA 2B4KA 1TG7A 1UXXX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXR A;  1O8P A;  3NQH A;  5G05 L;  3I3B A;  2CDO A;  1F4H A;  1DP0 A;  2W92 A;  1UZ0 A;  3ETP A;  1W8O A;  3OB8 A;  2VL4 A;  3VD7 A;  3SKJ E;  3OGR A;  4P02 B;  2V5D A;  3WNP A;  4IUG A;  3C7G A;  1J84 A;  1W9W A;  3ACI A;  4MGQ A;  2OKX A;  2VZS A;  1LNS A;  2V72 A;  1JI6 A;  3VD4 A;  1JZ4 A;  3ABZ A;  3WF1 A;  3OEB A;  1R64 A;  1DLC A;  4A42 A;  5DQ0 A;  4CUC A;  5CZK A;  1EUT A;  5DMY A;  3IAQ A;  1K12 A;  2RVA A;  2WDB A;  2JE8 A;  3HEI A;  1GU3 A;  5EJ1 B;  3PUH A;  5JXH A;  4LHS A;  2J1R A;  5HXM A;  2C4X A;  4M4R A;  5JXI A;  1OT5 A;  3UES A;  4P5Y A;  2YC4 A;  4QX2 A;  1JHJ A;  3I2I A;  1GNY A;  3WF4 A;  3VD3 A;  2VZR A;  4AG4 A;  1SDD B;  3MUZ 1;  1JZ8 A;  1GMM A;  2EIE A;  2VM9 A;  1IQD C;  1XC6 A;  1T2X A;  2WAB A;  3ACF A;  2DDU A;  2WYS A;  2QQK A;  3FHQ A;  2YFZ A;  4Z2A A;  1UXZ A;  2EIB A;  3CKH A;  4QPW A;  3VD9 A;  3VDB A;  3NNG A;  4D8M A;  5HPO A;  3NRU A;  5J1X A;  4ET7 A;  4QDQ A;  2E26 A;  5DPN A;  4JKK A;  2VCC A;  2YB7 A;  3III A;  1MPX A;  4RN5 A;  3DYO A;  4QX1 A;  3IDA A;  1JZ5 A;  3SEE A;  4P08 A;  3OG2 A;  2EIC A;  3HPN A;  2RJ2 A;  3CMG A;  4OUE A;  1UYZ A;  3K4A A;  2XHN A;  3W5M A;  3C7F A;  5LA1 A;  1H6Y A;  2Y6L A;  3THD A;  1GOF A;  4XUT A;  5CYY A;  2YG0 A;  4MO3 M;  2B9V A;  4XZU G;  4A41 A;  1UMH A;  1PMJ X;  1UX7 A;  4OMD A;  3OEA A;  4HG6 B;  1W9S A;  2E33 A;  3T0A A;  3LEI A;  2Y6J A;  2BZD A;  2VMC A;  3JXS A;  2VQT A;  2JDA A;  3C7O A;  4YPJ A;  1KEX A;  4LPL A;  4BJ0 A;  3NJX A;  2PQS A;  2W47 A;  3DEC A;  3HNY M;  3VDC A;  3K77 A;  3I3D A;  3LQC A;  4A6O A;  3ZM8 A;  4E8D A;  1SG3 A;  1CZT A;  4PF1 A;  2W91 A;  3C7H A;  4W8J A;  2WZE A;  2BGO A;  1KGY A;  3BGA A;  2E32 A;  3K46 A;  1US3 A;  3WNO A;  1PMH X;  2CDP A;  2W1U A;  4CU7 A;  4PT6 A;  4QB6 A;  4BXS V;  4DUW A;  4JX0 A;  2WAA A;  4LKS A;  2X05 A;  3IAP A;  2WBK A;  2QQM A;  2VMF A;  3T08 A;  3HOB A;  2WQ8 A;  4QDR A;  2ZEY A;  1JYN A;  1UY2 A;  2WN3 A;  2Y6G A;  4JKM A;  1H6X A;  2V4V A;  3OGS A;  2XOM A;  1NX9 A;  4GWI A;  2J1A A;  3VDA A;  2QQL A;  3HJR A;  1W0N A;  2W87 A;  2DCK A;  2XON A;  1ULP A;  4A44 A;  3T0D A;  3WF0 A;  5JR2 A;  3OGV A;  3ECQ A;  4ARY A;  3E1F 1;  2YC2 A;  2X09 A;  4AAX A;  1K3I A;  3GM8 A;  5FUI A;  2BER A;  2J1S A;  5B4X A;  3CZU A;  2VZP A;  1O8S A;  4FI9 A;  3WNK A;  5IYY A;  3LEG A;  3HN3 A;  4KWU A;  2YFU A;  2VO5 A;  4XUQ A;  2W3J A;  3T09 A;  2J22 A;  2VZ3 A;  4DEQ A;  3MBW A;  4GZ9 A;  1UY0 A;  3C8X A;  1CX1 A;  3THC A;  3DYP A;  1OF4 A;  3F2Z A;  4ZY9 A;  3I3E A;  4CU8 A;  3P6B A;  3A22 A;  1XNA A;  4QB1 A;  5I0D A;  1CIY A;  4KI5 M;  2BBA A;  3K4D A;  5IFT A;  3C7E A;  2W94 A;  1UY1 A;  1BHG A;  4XUP A;  2VC9 A;  4MGS A;  5LCW L;  5C71 A;  4GWJ A;  2QQN A;  2VME A;  1UY4 A;  4UAP A;  1K42 A;  4ZZ5 A;  2L9L A;  3WQB A;  2Y6K A;  2VQU A;  5LA0 A;  3D3A A;  4XUR A;  4E8C A;  1JZ6 A;  5G04 L;  3T0B A;  5IFP A;  4DUV A;  1OF3 A;  3ACH A;  2LW8 A;  2DCJ A;  1JZ3 A;  2E31 A;  3ACG A;  2ID4 A;  3W5N A;  4KMQ A;  1US2 A;  3T2O A;  3GGL A;  3A23 A;  3K4Z A;  4W50 A;  5JUV A;  2R7E B;  2JKX A;  3FHA A;  2VZ1 A;  3WSO A;  1GQP A;  3BN6 A;  3IB3 A;  4QAW A;  1JYX A;  5IHR A;  2W1Q A;  4P00 B;  1I5P A;  2W1S A;  4QB2 A;  3LEK A;  3T2P A;  2VCB A;  1F4A A;  1RYY A;  4A45 A;  4QDS A;  2J1U A;  5JMO A;  3HNM A;  4JKL A;  3A7Q A;  2WO2 A;  3LPF A;  1UY3 A;  1P8J A;  4D0Q A;  1OH4 A;  1JZ7 A;  1JYV A;  3UET A;  2W46 A;  2HLE A;  3MV0 1;  1UWW A;  1JU3 A;  1K45 A;  2HYX A;  1XPW A;  2W1W A;  5LA2 A;  4CUA A;  2C26 A;  4QX3 A;  2X10 A;  2VZV A;  2QQJ A;  5C7G A;  2VJX A;  4QX0 A;  4LQR A;  1NKG A;  4DUX A;  5EIY B;  4TTG A;  1WCQ A;  3A21 A;  4A4A A;  3I2J A;  1CZV A;  5EJZ B;  3CIH A;  1J83 A;  4PQQ A;  5B4N A;  3NJV A;  2VR4 A;  3LE0 A;  4XUO A;  1O59 A;  4UI9 L;  4OYU A;  2EID A;  2ZEZ A;  1GUI A;  3HNB M;  4JHZ A;  1D7P M;  4BDV B;  4BK5 A;  5JXG A;  3CQO A;  3AC0 A;  2ZEX A;  2W95 A;  3EB7 A;  3EYP A;  1ULO A;  1GOH A;  2VOT A;  3GXU A;  2ZEW A;  2J1E A;  2J1T A;  3GDB A;  2LS6 A;  2Z4F A;  3SEP A;  3I97 A;  4BK4 A;  4XUN A;  1UYY A;  1OD3 A;  2XQX A;  3DYM A;  1YQ2 A;  2VZQ A;  4ARX A;  5JXJ A;  3OBA A;  2Y8K A;  2VZO A;  4CU9 A;  1XNT A;  5C70 A;  4W4Z A;  1L7Q A;  3WNN A;  3T2Q A;  3WEZ A;  3I2G A;  4UOJ A;  1PX3 A;  2W5F A;  2JD9 A;  5IJR A;  1JZ2 A;  2WN2 A;  1CZS A;  3LPG A;  4OMC A;  1DYO A;  1UYX A;  3MO4 A;  3P1I A;  4ZXE A;  3PUI A;  3MUY 1;  3I2K A;  1SHW B;  1L7R A;  2WUH A;  4A3Z A;  4DEV A;  2Y64 A;  4L0P A;  3UNP A;  4XVH A;  2VZU A;  1W99 A;  1NUK A;  4TXW A;  1HN1 A;  2WO3 A;  3SKV A;  3I2F A;  4CU6 A;  4CVU A;  1NAE A;  4CUB A;  3FN9 A;  4MOA A;  2C9K A;  5F7U A;  2BGP A;  3WNM A;  4DXS A;  3CDZ B;  2WO1 A;  4OZO A;  3MV1 1;  4DXT A;  2ZXQ A;  4ZZ8 A;  3VD5 A;  1TVG A;  2J1V A;  1W9T A;  3WF3 A;  1JYW A;  2W9X A;  2ORZ A;  1WKY A;  2WAO A;  4MAD A;  1PX4 A;  2WZ8 A;  3K75 B;  2QBX A;  1EUU A;  2J7M A;  2VZT A;  3FL7 A;  4RYD A;  2Y6H A;  2VMD A;  5A1A A;  3I2H A;  3U37 A;  2QQO A;  2VTF A;  2QQI A;  1UMI A;  5DN2 A;  2KD7 A;  2ORX A;  2RV9 A;  2VCA A;  1GOG A;  4M4P A;  1JU4 A;  3CZJ A;  3WF2 A;  3WNL A;  1W8N A;  3J7H A;  2B4K A;  1TG7 A;  1UXX X; 
#chains in the Genus database with same CATH topology
 4DXR A;  4AWD A;  3H8R A;  5EV7 A;  3DEM A;  4NHY A;  2XJQ A;  3OPZ A;  4CEW C;  1HB1 A;  3NKG A;  5HI0 A;  4XZP A;  5I0T A;  4IEX A;  3I3B A;  1Y3T A;  3BIE A;  2ZPX A;  4MXV A;  1YJL A;  1QOT A;  2AEN A;  2AUY A;  1DP0 A;  2VNV A;  3E5U A;  1UZ0 A;  3ETP A;  1XYN A;  1QJY 3;  2R16 A;  1XRU A;  1CVN A;  3H3U A;  3H42 B;  1AR8 1;  2QZ2 A;  4OFG A;  3MW3 A;  4TN7 A;  1AR6 2;  3OGR A;  4P02 B;  2BJS A;  4CCN A;  4IUG A;  4NPM A;  2QNK A;  3KCY A;  1BBT 3;  1J84 A;  1GZW B;  5ACA 2;  4BQX A;  4CDW C;  4R4X A;  4KNC A;  2ZA9 A;  2YU2 A;  1FOD 3;  3ACI A;  1W2T A;  2ZTN A;  4GB3 3;  2C1F A;  5I8S A;  4Y4Y A;  2LAL A;  1SAC A;  3MDP A;  4FSJ A;  1V9U 1;  5CNA A;  5BPX A;  2J42 A;  4PIZ A;  4CUG A;  4XC9 A;  3V0A A;  1KDM A;  1AL2 2;  1AHS A;  5DQ0 A;  3TEY A;  1YJK A;  2UY8 A;  2Y0I A;  4CUC A;  1XNC A;  5JAX A;  3I2D A;  4E2Q A;  4YZ1 A;  3IAQ A;  1ULC A;  1MQT C;  1AF9 A;  3H7J A;  1PO2 1;  1QJX 1;  1C5I A;  3AZZ A;  4Y4R A;  2JE8 A;  5A3O A;  3ZDV A;  1G9D A;  3BU7 A;  4HSL A;  1UD1 A;  4WV8 A;  4CDX B;  1VBB 3;  4H7M A;  4AK3 A;  3PUH A;  1EAH 3;  3M1H A;  3IMN A;  1YXW A;  1HKD A;  3CU7 A;  5FLJ A;  3O0X A;  4Q0U A;  1WCD J;  4QX2 A;  3VZO A;  4EZH A;  2Q1M A;  5A33 B;  2JDP A;  5FKC A;  3POE A;  4PQ9 A;  2JEM A;  3DXU A;  3I2I A;  3WF4 A;  3D5O A;  2R04 3;  3PJQ A;  1M06 G;  2SLI A;  2Z42 A;  3N7J A;  4JDM A;  2VZR A;  3I3Q A;  4AG4 A;  4DRV A;  3ZR6 A;  1JBC A;  1ONA A;  3TWI A;  1RUG 3;  5K8S A;  1GMM A;  2MHF A;  3C2U A;  3GBG A;  2BWC A;  3VZM A;  3ZFE C;  4JC1 A;  3ALQ A;  3VBU A;  4OHY A;  1HXS 3;  1RUI 3;  1VRH 1;  2P3Y A;  4GH4 B;  1MEC 2;  5BNN C;  5A32 B;  4R8H A;  1FAT A;  1GZ9 A;  2QVS B;  5JOY A;  3B93 A;  2QQK A;  4N43 A;  5CAD A;  2WNE A;  3SCH A;  3VGI A;  1UXZ A;  3I8T A;  4LEJ A;  1CR7 A;  2BDR A;  3PDQ A;  1ND2 C;  1AR7 1;  1D0H A;  4RHV 2;  2Q8D A;  3VD9 A;  1CAW B;  4YVS B;  5L36 A;  2JIG A;  3N9N A;  3OGJ A;  1TMF 3;  1LU2 A;  3VBO A;  1YQC A;  2GNT A;  4LIT A;  4Y33 A;  3WG1 A;  4LMF A;  3NW4 A;  1W9Y A;  2XKP A;  2ZGK A;  4XF9 A;  4JKK A;  3ZYJ B;  2ZGM A;  3MIF A;  4MGI E;  1R08 2;  3U75 A;  5EP9 A;  4BB3 A;  4R9B A;  4OQ8 A;  5A7P A;  4QX1 A;  1RVF 3;  3SIT A;  1W6Q B;  1R08 1;  3VBS A;  3HVD A;  4K1Y A;  2UYB A;  1XU2 A;  1BJQ A;  2ZGQ A;  2RS1 3;  3HPN A;  4QPG B;  1MS1 A;  4HOO A;  4KBZ A;  4FTS A;  1OSG A;  1UYZ A;  2JJ6 A;  2PEL A;  3KS7 A;  4FPC A;  4LKE A;  5A3N A;  4TWT A;  4YGB A;  3C7F A;  3AM2 A;  5DAQ A;  1H6Y A;  2BFU S;  2WSV A;  2HH9 A;  5KXC A;  3ILN A;  1PO1 2;  3GHN A;  4SLI A;  1R09 2;  4MO3 M;  5C8W A;  1ZZ7 A;  4GH4 C;  5IAV A;  4A41 A;  3JB8 A;  2H6B A;  1T6B X;  2RM2 3;  2D40 A;  2RS3 2;  4M3C E;  1DCS A;  4OMD A;  2NP0 A;  4FFG A;  2CGP A;  3OEA A;  2HWD 1;  4HT1 T;  1W9S A;  1ENS A;  1WLD A;  1IKQ A;  1GZW A;  1ZZ9 A;  3UV9 A;  4OZX A;  1VBD 3;  1S0B A;  3I54 A;  4QHZ A;  3JXS A;  5J09 A;  3SHR A;  2AAC A;  4XCA A;  1ENR A;  1PGW 1;  3HT2 A;  4CEW B;  2XDV A;  4KQ7 A;  5FZK A;  5FYZ A;  4FTE A;  1EYB A;  3UKV A;  5FYB A;  2OPK A;  1PNG A;  2PQS A;  2W47 A;  2B8M A;  4RHV 1;  4B4R A;  2PTM A;  3JZV A;  2Y6F A;  5FY9 A;  4MSV A;  4GD4 A;  3N9O A;  3DEC A;  3AYE A;  1IQA A;  1PIV 1;  2FZ1 A;  2H0V A;  2Q8C A;  2NMO A;  1XYO A;  4F7Z A;  1QJY 2;  5GLU A;  1GP4 A;  4A6O A;  4NIH A;  2UWC A;  2OW4 A;  4HK8 A;  3MID A;  2RDS A;  1GZC A;  1T6G C;  2YY1 A;  1CAX B;  4BOW A;  5F32 A;  4W8J A;  2DBN A;  1MQT A;  2YBS A;  1QU0 A;  1SPP A;  1RXF A;  1W8W A;  3E6B A;  4UFL A;  1SLB A;  1S0J A;  2E32 A;  3QH7 A;  4FO9 A;  5A6Y A;  1HB3 A;  1NCQ B;  2VUJ A;  4Y1X A;  4HSJ A;  2NYY A;  3K46 A;  4SBV A;  5JZG B;  1VBD 2;  1US3 A;  4FP2 A;  1UU6 A;  2ET7 A;  2VMG A;  4URT A;  5C8C C;  3URF A;  1SBE A;  4HLT A;  4PT6 A;  5CA6 A;  4CRQ A;  1H9P A;  5FZC A;  4BXS V;  3M3C A;  4DUW A;  1JOD A;  4BME A;  4MG2 A;  1LUL A;  2VD7 A;  2X05 A;  5FYT A;  1DHK B;  5FJH A;  4F3J A;  4EN6 B;  4A7K A;  2ZEY A;  2GSY A;  1UY2 A;  3FLP A;  4IES A;  4IE0 A;  3GZE A;  1IPS A;  2Y6G A;  4JKM A;  3RPQ A;  3ZXA C;  2WL1 A;  4NIA A;  1PGS A;  4GWI A;  5KHJ A;  3WT3 A;  3BPZ A;  1MS0 A;  2FDF A;  1LED A;  4XDQ A;  5H9Q A;  4XMI A;  1X8M A;  4DS0 A;  2UWB A;  1RUD 1;  1EPW A;  1QKQ A;  4CCE A;  2XL7 A;  3T0D A;  2DF7 A;  1HX6 A;  1ULG A;  1OHF A;  2A3Y A;  4IV1 C;  1N47 A;  1ZBA 3;  1H2N A;  4ARY A;  1DF0 A;  1DGW A;  1RUI 1;  5GM0 A;  5E89 A;  2YC2 A;  3OUH A;  1VB4 A;  3PVN A;  1NCQ C;  2AGS A;  2EF6 A;  3UGG A;  1FMD 2;  1C3H A;  5LRS A;  2WNV A;  1AJK A;  5FZB A;  1AJO A;  1LEN A;  5FLI A;  3GF6 A;  1S0C A;  5FZM A;  1COV 1;  2PLV 2;  1QGL A;  4MET A;  5IYY A;  3LEG A;  4P9X A;  3RZK A;  2VAU A;  2C0Z A;  4XUQ A;  1F8V A;  4PDW B;  2J22 A;  3HAG A;  4DOU A;  1O4Y A;  3D0J A;  2VZ3 A;  5JOZ A;  1UY0 A;  4COZ A;  1CX1 A;  3THC A;  5BXX A;  3F2Z A;  3ZMN A;  1DGL A;  2AC1 A;  2O1Q A;  3P6B A;  1ZRI A;  1W9F A;  1LGB A;  4CCD A;  1H1A A;  3TN9 1;  5JOX A;  3LIG A;  1XOY A;  5I0D A;  3RGB A;  3SLI A;  3K4D A;  3ZXJ A;  4A6S A;  3O1R A;  1AYN 3;  2WSU A;  3ZFG B;  3KVB A;  2D3S A;  5FMO S;  2VC9 A;  2XBO 3;  1LHO A;  1UZZ A;  4LHN A;  3VKF C;  3ZLI A;  5IK7 A;  3LAG A;  1BMV 2;  4XW3 A;  2VNR A;  3RWK X;  1UZV A;  4Z07 A;  3BPS A;  4WM8 B;  3LDB A;  4FPL A;  3WZ1 A;  1RUC 1;  4JGY C;  2Y6K A;  2VQU A;  5LA0 A;  3D3A A;  3LWC A;  4I3P A;  1PVC 2;  2A73 B;  1LES A;  4X6R B;  2GH2 A;  2C6S A;  2YRO A;  3AFK A;  1DFQ A;  4RGK A;  1PGW 2;  1YEW A;  2LW8 A;  2B7Y A;  1OQ1 A;  4ZS2 A;  3WQ0 A;  3DPR B;  1SEF A;  4RR3 B;  1SPP B;  2D6K A;  2TNF A;  4LO6 B;  1S4C A;  4CEY C;  4CDX A;  1DLL A;  4GMP 3;  5SV5 A;  1C8M 2;  4JGZ A;  5ABJ C;  1GP6 A;  2ID4 A;  1RUJ 2;  2V5Y A;  4I0A A;  4KMQ A;  5KHK A;  2P17 A;  5M0T A;  1U0A A;  4XF3 A;  1VBC 3;  5JUV A;  2Z69 A;  2JKX A;  2VMI A;  1DQ1 A;  2VVE A;  2BBV A;  2TUN A;  2K0G A;  4JGY A;  1HV1 A;  4W6W A;  4XJW A;  3BN6 A;  4I0B A;  4QAW A;  3ZXK A;  1JYX A;  4P9Y A;  2XML A;  2W1Q A;  4FPK A;  5C9A A;  5IHR A;  2WJS A;  1IHM A;  3T2P A;  1AXK A;  1SFN A;  2GN7 A;  4QX8 A;  2D3P A;  1ZZB A;  2JXA A;  3VUO A;  5LEK A;  4A45 A;  2J1U A;  2W68 A;  2YUE A;  3K3O A;  1BBT 1;  5JMO A;  3A7Q A;  1REF A;  3DKQ A;  4J25 A;  2WS9 2;  5BUV A;  3WQ1 A;  1ZA7 A;  2E7Q A;  1P8J A;  3FMG A;  3WW4 A;  5A80 A;  3VBU B;  2W52 A;  2OPW A;  4Y5S A;  3WXP A;  4A7Z A;  1JYV A;  1F9K A;  1K5M A;  1ND2 B;  3OUJ A;  4MGT A;  1NLR A;  4CP0 A;  4AHY A;  3QAC A;  3VBH B;  1C4R A;  3H3Z A;  3UKN A;  2G4I A;  5GAL A;  4QQO A;  1XPW A;  1OQE A;  4E9K A;  2YXS A;  1PZ9 A;  4S2H A;  2C26 A;  5D1I A;  4D7T A;  2X10 A;  1ZRD A;  4GUL A;  4JGY B;  2VJX A;  3ZYF A;  1YC6 1;  5FCC A;  2E63 A;  5EIY B;  2VBB A;  2WZR 1;  2XKO A;  4WVZ A;  1W8T A;  4TTG A;  2G1M A;  3SH5 A;  4OHW A;  4FBF A;  4MVT A;  3A21 A;  4C0H A;  2C9A A;  2VW1 A;  5EHD A;  5EJ3 A;  1NQD A;  4XBL A;  2VE1 A;  2GMP A;  1W2N A;  5H9P A;  2B5H A;  2ARA A;  1OKQ A;  2R1B A;  3J8F 2;  3J4U H;  4IV1 A;  4D69 A;  2VR4 A;  3HIF A;  4XFI A;  3ZYI B;  3KWV A;  5F3I A;  4XUO A;  4UI9 L;  3ZSM A;  1YFY A;  4Q1R A;  2EID A;  4NHM A;  3HNB M;  3RMY A;  2RS5 3;  4BK5 A;  3ZR5 A;  5FY5 A;  2ZGN A;  3CQO A;  1HDK A;  4Y24 A;  5F8P A;  3J8F 1;  2YPJ A;  1PNF A;  4QKB A;  4LLO A;  1HJF A;  1NE6 A;  1PO2 2;  1RUG 1;  4Q4W 1;  5ANQ A;  4BMB A;  1NT0 A;  2J1E A;  2J1T A;  2LUW A;  4CDX C;  3GDB A;  4K21 A;  1QJF A;  2GZW A;  3O5S A;  2DU1 A;  4P14 A;  3SEP A;  4MHR A;  2ZZJ A;  4YVS A;  2FDJ A;  5FBJ A;  4J1W A;  1V6N A;  4LA2 A;  4BK4 A;  1UYY A;  1TMF 1;  2XQX A;  4Y5Z 0;  1UOB A;  2VZQ A;  2DU0 A;  1XNT A;  4Y20 B;  5C70 A;  2QFE A;  4Q2F A;  5FZ0 A;  3WNN A;  1NCR C;  2NLR A;  4AFD A;  5FAX A;  2FHR A;  5L7O A;  1RVF 2;  2KR2 A;  4CDW A;  3WEZ A;  2LRO A;  1BXH A;  3LFM A;  2ZAC A;  3MLJ A;  4Q8L A;  2JD9 A;  5DG1 A;  5T5J A;  2BQP A;  4CEY B;  5KBF A;  2VY0 A;  3S5A A;  3P5B A;  3BOW A;  1LU1 A;  3PNA A;  1VBA 3;  2ZHK A;  4Y1Y A;  2RMU 2;  3M4F A;  2IWG B;  3P1I A;  4QPY A;  3THT A;  4DB5 A;  4NUB A;  3PUI A;  2R07 2;  3R4D B;  1B35 C;  4OLL A;  4B7K A;  3SNM A;  1QOO A;  1WA6 X;  4NWW A;  2EAL A;  5EQU A;  4GXL A;  5C5T A;  5FZ6 A;  1RJ7 A;  2WUH A;  2BW8 A;  5FPX A;  2ZGU A;  1PVC 3;  4PBO A;  5FPA A;  3OCP A;  2Y64 A;  2BOI A;  1AX2 A;  4H2A A;  4YYO A;  3UNP A;  5KXB A;  1CAV B;  4XVH A;  2JG8 B;  3POB A;  4TXW A;  1OLM A;  4BQ2 A;  1RUH 1;  3SKV A;  5C4W B;  4YZ3 A;  4KG0 A;  4QXC A;  4KWL A;  1AL2 1;  1NAE A;  5C8C B;  5KXE A;  4XHB A;  2BGP A;  3EMR A;  4XJ9 A;  3OD4 A;  1YNA A;  5AC9 1;  4MLO A;  3AL5 A;  4BIF A;  2PHX A;  1DDL A;  4OZO A;  5C3P A;  4YVW A;  2ZHM A;  3MV1 1;  3V0B A;  4M3C B;  5L9R A;  4DXT A;  2XHK A;  2ZXQ A;  4PLO A;  1Z0H A;  2C24 A;  3BTA A;  1XU1 A;  1DU3 D;  4AVB A;  3RG0 A;  2J1V A;  4HN0 A;  4XTM A;  1AR6 3;  3ZSE A;  1JYW A;  4NPL A;  1G6N A;  1AR9 2;  1FPN 3;  2ORZ A;  1VBE 3;  1L3J A;  3APB A;  1HB2 A;  4L99 A;  1Q8Q A;  5LK5 A;  3B7M A;  5FY8 A;  1KJR A;  1FPN 2;  3N9Q A;  5F37 A;  1VBE 2;  1VAL A;  2QJV A;  3KCX A;  3ORJ A;  4Q4V 3;  2VMD A;  5JR7 B;  5C6C A;  5A1A A;  5C3O A;  2OII A;  2PHU A;  2X5I C;  3AKT A;  2QQO A;  2QQI A;  1VRH 2;  5FWJ A;  3VLB B;  3M3O A;  1W6N A;  2R1D A;  5FZ4 A;  4ASK A;  4IV3 B;  4LE3 A;  4M4P A;  2X8K A;  1JU4 A;  4IEZ A;  4FT8 A;  2ARC A;  4CYD A;  2CU5 A;  2HJI A;  1RUO A;  1PGL 1;  3WNL A;  1W8N A;  3J7H A;  1OD5 A;  3KVA A;  2Q4S A;  3RVH A;  5C9A C;  1RUE 1;  2VW2 A;  3GHM A;  1O8P A;  2NPI A;  1DBN A;  2FCT A;  2WO7 A;  3TEX A;  1O5L A;  4D94 A;  4XIO A;  4GKY A;  4AYU A;  1RUC 3;  3FHI B;  3WY6 A;  5T3N A;  4UFM A;  2W92 A;  1RUN A;  3PJY A;  5J36 A;  2ARE A;  4NN0 A;  5DAX A;  4I02 A;  3VD7 A;  5J3U A;  2XJU A;  4HVQ A;  1W6M B;  3ATG A;  4IXL A;  2YGL A;  1Z7S 2;  4XIL A;  4Y1U A;  2VUL A;  4IE6 A;  4RGA A;  4TLF A;  4YW3 A;  1W9W A;  3ZYP A;  1UW8 A;  1HQN A;  3A0K A;  5FOB B;  2JE9 A;  2RS5 1;  4MGQ A;  4JDN A;  4XHX A;  5E8A A;  2OKX A;  4COY A;  1NOV A;  5GLZ A;  3NO8 A;  3VKM A;  3GYD A;  2V72 A;  3VD4 A;  4WVW A;  3WF1 A;  5F3G A;  1QJU 2;  1VMF A;  1R64 A;  1AXY A;  2WQ4 A;  4A42 A;  2PHW A;  4GJY A;  4QKN A;  4L92 A;  1C8N A;  1EUT A;  1LR5 A;  4XFG A;  5CZK A;  1K12 A;  1DQ6 A;  5FP9 A;  1PO1 1;  2VVF A;  3MPB A;  4KWJ A;  1M4W A;  3DPR C;  3MEP A;  4P9W A;  4AQS A;  4D3W A;  1GQH A;  1QEX A;  2HWB 3;  2D6P A;  5APA A;  5JXH A;  3KD4 A;  4LHS A;  5HXM A;  5CU1 A;  5JXI A;  1O3Q A;  1UZY A;  3TOJ A;  1OT5 A;  5D8A B;  4ISR A;  4M0N A;  2E7A A;  4XJZ A;  3UES A;  1HB4 A;  3KHB A;  1ACC A;  2AH2 A;  5FYU A;  2OZ6 A;  4QPI A;  4V1P A;  1JHJ A;  5BNP C;  3AKQ A;  1AYM 2;  1BKZ A;  1YLL A;  2XXZ A;  3NNF A;  1YCI A;  2WWJ A;  4N53 A;  3MZH A;  4D7Y A;  4N9H A;  4AI0 A;  1Q8O A;  3THP A;  3AMP A;  5FBZ A;  3MUZ 1;  4NHX A;  3WR0 A;  3ZSK A;  2AYH A;  3D4K A;  1W05 A;  2WR9 A;  2DTY A;  4MV2 A;  3WIN E;  1EV1 3;  3TEZ A;  2B9U A;  1A8M A;  3U1X A;  3VZL A;  2D6L X;  1T2X A;  1RUH 2;  1AYN 1;  4Q0Q A;  1OA2 A;  4QGN A;  3IT8 A;  3ACF A;  2DDU A;  3WCR A;  2VH9 A;  1DGR A;  2XJV A;  1GNH A;  2ZAB A;  2GP3 A;  3M3I A;  4GWM A;  5FO7 B;  5BNP B;  1HLC A;  2B46 X;  2ZGR A;  3FHQ A;  5IAX A;  3O1U A;  1OBN A;  5FXZ A;  2JG9 B;  1LGN A;  2P3K A;  3M3E A;  2CL2 A;  2Q0A A;  2ZHL A;  4LBQ D;  2CNA A;  1GLH A;  4QDQ A;  1ULD A;  2OQ7 A;  2CTV A;  4QX7 A;  5A33 A;  1NQJ A;  1RUJ 3;  2AZ5 A;  3R6S A;  3EO6 A;  3PME A;  1TEI A;  1ZVF A;  2VCC A;  3AMQ A;  4IND A;  3FBM A;  1VBC 2;  4XTP A;  2DBI A;  3VHO A;  4G4F A;  4RN5 A;  4YAR A;  5F1R A;  1E57 A;  2GNM A;  2PAM A;  3SEE A;  3LA3 A;  3UGF A;  4U2A A;  2EIC A;  2VG9 A;  3RYK A;  2RJ2 A;  4KGG A;  5AC9 2;  1J59 A;  2YPD A;  3CMG A;  4EN9 B;  4OUE A;  3K4A A;  3KT4 A;  5FYY A;  2JE7 A;  3H9A A;  4ARX A;  1R09 3;  4AVA A;  1GOF A;  4H55 A;  2YG0 A;  2OQ6 A;  1CX4 A;  1OMI A;  4WVM B;  3NST A;  3ILF A;  5F39 A;  1CN1 A;  4XIK A;  3P3P A;  4G3Y C;  1UMH A;  1H8V A;  2KA3 A;  5CIR A;  1H8T A;  4K9S A;  4RS5 C;  4UBG A;  3AP7 A;  3WVJ A;  2RR1 1;  3LEI A;  2WQZ C;  3V64 A;  3TNP B;  1V9U 2;  1NA1 B;  2BZD A;  1HQW A;  2VMC A;  4MX3 A;  5FP8 A;  2JDA A;  4ERO A;  1KEX A;  4GQ7 A;  4BLJ A;  4GAZ A;  4AGG A;  4MXW A;  4CCC A;  4UW5 A;  1K5J A;  1OA4 A;  3NJX A;  5A7O A;  5C3Q A;  5LWB A;  1BK0 A;  4C1W A;  1AR7 2;  3QD6 A;  2EVX A;  2PHT A;  1RUC 2;  2FCV A;  1AR6 1;  3EHK A;  2BWA A;  5DZF A;  5L73 A;  5L7O B;  2NQY A;  3HNY M;  4KU8 A;  4BQ5 A;  3K77 A;  3I3D A;  4NAO A;  3ITQ A;  1QJX 3;  4CE8 A;  4DFS A;  1LHN A;  3TAY A;  1FV2 A;  5FPL A;  5FZ3 A;  5LAT A;  3ZM8 A;  4E8D A;  5I93 A;  1HRV 1;  2EIG A;  2YMZ A;  4M01 A;  4AFC A;  1MQT B;  2JB8 A;  2MEV 2;  4H3W A;  4KWK A;  2W91 A;  2XLF A;  3C7H A;  4CDU A;  3TB0 A;  3TN9 2;  4TSV A;  3GCW A;  5IVE A;  3BGA A;  4DNY A;  2WIN B;  2EXK A;  2IVI B;  1DGW X;  5A32 A;  1O4Z A;  3W58 A;  1GP5 A;  4GH4 A;  2ILM A;  1C1L A;  1KS5 A;  2V4A A;  3QOP A;  5E1R A;  3S30 A;  3WDT A;  5I0R A;  5IK8 A;  1YFW A;  1UU5 A;  4FVV A;  2UWA A;  3WHU A;  4BYY A;  2VEC A;  2NMN A;  2WBK A;  2GN3 A;  3VBH A;  4CP1 A;  4FPJ A;  2XBO 1;  1QH7 A;  4I30 A;  4BU2 A;  1BK1 A;  2WN3 A;  3MIG A;  3KMH A;  2VTX J;  5FYH A;  1S2E A;  1VAK A;  4S2D A;  1IS5 A;  2IUW A;  2VGD A;  3OGS A;  1SLA A;  1RXG A;  2VQA A;  5IK4 A;  4K7J A;  1UKR A;  2WFF 3;  4HPK A;  2XLA A;  3D8C A;  3EQE A;  4LBQ B;  2BV4 A;  3IPV B;  3B3Q E;  4AED A;  2EXI A;  2DCK A;  2G19 A;  4NID A;  2Q30 A;  2RMU 3;  1GWK A;  5HCF A;  4FQZ A;  3RI9 A;  4A44 A;  1IKP A;  3OYW A;  4EJR A;  3H0O A;  1ZBA 2;  3KLS A;  5FZD A;  1OH3 A;  5JR2 A;  2EAA A;  3H8O A;  4MHU A;  4XF4 A;  1J58 A;  4X8N A;  1HN0 A;  3WLU A;  1RUF 1;  4GKX A;  2X09 A;  3U07 A;  3ROU A;  1K3I A;  3MIH A;  1VBB 1;  5FUI A;  1DGR N;  2WNV C;  3K3N A;  1FNY A;  2J1S A;  2VZP A;  2P3J A;  3U4S A;  1PO2 3;  1OUS A;  2XH6 A;  4K8R B;  4YGD A;  3WNK A;  1IPJ A;  1LEM A;  4IEY A;  4AF9 A;  3M3Q A;  1S1A A;  2MNG A;  4KWU A;  2R30 A;  1S55 A;  2PFW A;  2YFU A;  2W3J A;  4ATE A;  3M70 A;  5FPV A;  1OXC A;  2QKD A;  2ZGT A;  4E2G A;  5C4W A;  2WT2 A;  4XJU A;  3ZIW A;  3MBW A;  3OBR A;  3B9C A;  3C8X A;  4YLZ A;  3R4U A;  4XXA A;  3G7D A;  4ZY9 A;  3DGT A;  4CU8 A;  3AJY A;  3ZXL A;  2DYC A;  5DUW A;  3A22 A;  3JD7 1;  3JQW A;  2P34 A;  3ZN4 A;  1CIY A;  4CDQ A;  4KI5 M;  4PDW C;  5IFT A;  1HXS 1;  2W94 A;  3B5L B;  2DFC A;  3A4U A;  5K0U B;  1UY1 A;  1BHG A;  1AX1 A;  1PMI A;  1LKN A;  3AZY A;  3BYW A;  3RZJ A;  4XMA A;  4MGS A;  1WBL A;  4HN1 A;  3FZ3 A;  2VOK A;  4L9B A;  4CEY A;  1FXZ A;  2Y33 A;  1C8M 1;  1QJY 1;  4QXB A;  3B02 A;  2I45 A;  3LOB A;  3WDV A;  3B00 A;  3MIC A;  4XAA A;  3R05 A;  4XUR A;  2R0F A;  1LB2 A;  4IEW A;  1PHM A;  3IM0 A;  5G04 L;  3RZM A;  4PBP A;  3VHN A;  1BCX A;  1H30 A;  1OF3 A;  1VE0 A;  3GJA A;  4BPZ A;  4DUV A;  4QGL A;  1APN A;  5FQ0 A;  3C3V A;  2GU9 A;  3VBF A;  5D21 A;  1KRI A;  2A6W A;  1RUF 2;  2VCM A;  3PUR A;  1RVF 1;  4WM7 A;  2XWB B;  1PK6 B;  3DL3 A;  2E31 A;  3B01 A;  4FPO B;  2ZHN A;  4R9D A;  3S6P A;  1MR5 A;  3ACG A;  4AHX A;  4F83 A;  1G9F A;  3CJI C;  5IVY A;  3SMH A;  5ABJ B;  1RUD 2;  3W5N A;  3VBF C;  1A3K A;  4RS5 A;  1J1T A;  3QCW A;  4UFK A;  1QXJ A;  3A23 A;  3AK0 A;  1IS4 A;  5FYM A;  4MH0 E;  2R7E B;  1OQD A;  5A7W B;  4X6Q B;  5FR3 A;  4EWA A;  5FO9 B;  3E5Q A;  2R49 A;  4LIV A;  1QJX 2;  2UYA A;  3O0V A;  1GKB A;  2VOX A;  4JAA A;  1R09 1;  4YVS C;  1HRI 1;  1RMU 1;  2W1S A;  4P00 B;  4QB2 A;  3LEK A;  1H9W A;  2VCB A;  4XF0 A;  4Y1Z A;  5BYN A;  2MEV 3;  3N7M A;  5K0U A;  1QDC A;  5FWE A;  4M00 A;  4RQP B;  2KXL A;  3AB0 A;  2WFF 1;  1HXS 2;  4QDS A;  1IZ3 A;  1URX A;  5FQ0 B;  4AFA A;  3HNM A;  2H6C A;  4E27 A;  2P3I A;  2WO2 A;  1UY3 A;  4ONU A;  4FOY A;  1OC1 A;  4CDQ B;  1QF3 A;  2O14 A;  2ADD A;  2Z2S B;  3LEM A;  3MF6 A;  5LK7 B;  5E16 A;  3UET A;  3AYD A;  2W46 A;  2HLE A;  2DCZ A;  5DZE A;  2GC0 A;  3KT7 A;  1H2L A;  3AMH A;  1JU3 A;  4ZON A;  1VAM A;  1LAJ A;  2JDY A;  1AR8 2;  3Q8E A;  5LA2 A;  1CAU A;  3JUU A;  1J1L A;  3BCW A;  4GAL A;  4C1X A;  1VBA 1;  2X53 S;  4O9G A;  3JBG 1;  4LOT A;  5FP3 A;  3USS A;  1EAH 2;  4HVR A;  2CAU A;  3TYJ A;  3RZH A;  2FD8 A;  1N1V A;  3B69 A;  2WC2 A;  4M3C F;  3USU A;  4YNI A;  1DQ4 A;  4KG8 A;  3HQR A;  1Y4W A;  3A0N A;  2A6X A;  1RUG 2;  3B9I A;  1HV0 A;  1ZBE 3;  5EJZ B;  1ZYB A;  1J83 A;  4LA3 A;  2GH8 A;  3LCP A;  1VBA 2;  5DDJ 3;  3NJV A;  5J7M A;  4XDO A;  2XLG A;  4OYU A;  3ES1 A;  3ZXF A;  2ZEZ A;  4QT6 A;  3QBQ A;  5HCA A;  2DVB A;  4JHZ A;  2ZS6 B;  4CP2 A;  4HK9 A;  1TME 2;  1D7P M;  1VBD 1;  4RHV 3;  5BNN A;  1QJZ A;  3K2O A;  4FXG B;  1CAU B;  5DXD A;  3NJZ A;  5A3L A;  5A1L A;  3NAP C;  4CCO A;  1XQN A;  2ET1 A;  5A6Z A;  1GOH A;  2O0O A;  2VOT A;  3GXU A;  2PA7 A;  5LB6 A;  4YZ4 A;  1D4M 3;  4RR3 A;  3WOG A;  4Z8B A;  2OA2 A;  5FO8 B;  5E6H A;  2Z4F A;  2JDZ A;  2LTN A;  2HKX A;  5IVF A;  4LTA A;  4UT5 A;  5FPB A;  5IFP A;  1RB8 G;  1SZB A;  2ZGO A;  2HWF 3;  4EWD A;  4Y20 A;  2QTW B;  1VR3 A;  1YQ2 A;  3NVC A;  2GAL A;  1OVP A;  2Y8K A;  4LBQ A;  5LBE A;  3IPV A;  2VZO A;  4ZS3 A;  4AED B;  5CFC B;  1JTZ X;  1R1A 2;  4E4S A;  2YV8 A;  1S2B A;  3DN7 A;  3T4V A;  5J48 A;  3LA2 A;  1ZRE A;  1S0F A;  5BNO A;  1AYM 3;  1MVE A;  3T2Q A;  3VL8 A;  1N1S A;  2W5F A;  1QY4 A;  2VOW A;  4Y26 A;  4OCT A;  5ABJ A;  1UQX A;  4RR3 C;  5T5P A;  1VRB A;  2A70 A;  2LM3 A;  1JOB A;  3LPG A;  2D5F A;  4W6X A;  4CZS A;  5C5U A;  1UYX A;  3CJI B;  2WS9 1;  1U5I A;  4AQT A;  1MAC A;  1WLW A;  3OY8 A;  3TBD A;  4NR1 A;  2F6B A;  4YG6 A;  1ZNP A;  4N7I A;  1DZT A;  2DCT A;  5F5Q A;  4LO4 B;  4A3Z A;  1X36 A;  1OOP B;  3MF9 A;  4DEV A;  4L0P A;  1SFP A;  2FDH A;  1W04 A;  3GCX A;  1W99 A;  5HXV A;  4XET A;  1HN1 A;  4D6Q A;  3WCS A;  5K7P A;  4IGO A;  2OXB A;  1VP6 A;  4YRD A;  4IV3 C;  4CVU A;  1V0A A;  4MGY E;  2W39 A;  4CUB A;  2JG9 A;  3MGU A;  5F6K A;  2QQP A;  4Q4Y 1;  3RZG A;  3IIA A;  1AR7 3;  1POV 0;  4NHL A;  3LZZ A;  5F5I A;  5FZ8 A;  4E2S A;  4B4Q A;  5F7U A;  3BOD A;  1L7L A;  4XXP A;  5JI7 A;  4BQY A;  1H1M A;  3AMN A;  4G9S B;  2VXJ A;  5LBB A;  3VDD A;  5GZG A;  1DYK A;  2BOJ A;  4YW2 A;  5FZ1 A;  5CBL A;  3FLR A;  2BNM A;  1AUY A;  1TVG A;  3E6C C;  1W9T A;  3AZV A;  3WF3 A;  4JQR A;  3OY8 B;  1SLT A;  4YM0 A;  1F5F A;  4LBJ A;  1DZQ A;  1N3Q A;  1CJP A;  1JOJ A;  2HWF 1;  4IEQ A;  2FDI A;  3W21 A;  3UJO A;  1WW5 A;  3ZKU A;  4UYB A;  2WZ8 A;  3K75 B;  4YM2 A;  3M8L A;  4BWO A;  2VZT A;  3FL7 A;  5F2S A;  3ZDS A;  5KHH A;  1FMD 1;  4CCK A;  3LD8 A;  2WFP A;  3RMX A;  1SFY A;  1JOP A;  1AR9 1;  1OFS A;  3I2H A;  2HWC 2;  3FJS A;  3U37 A;  3VBU C;  4D6R A;  5J37 A;  5DN2 A;  3ZFE A;  1LOG A;  2KD7 A;  5JPM B;  4KBB A;  1J3P A;  4AVC A;  4EN7 B;  4COV A;  4OHX A;  1ZRR A;  2VQ0 A;  1RHI 1;  5FZA A;  3I7D A;  4QXH A;  4UW3 A;  3VBH C;  3WF2 A;  3GZU C;  3AYA A;  4DPN A;  5FTT C;  3D82 A;  4OVE A;  4QQ2 A;  2YHJ A;  4CA9 A;  4DMI A;  3OYW B;  1LEC A;  2A3X A;  1YWK A;  3FLT A;  2CDO A;  1KD7 A;  3ZOI A;  5DAW A;  3KV5 A;  2PHR A;  5BNO B;  1UN1 A;  1B35 A;  1W8O A;  3ZYG A;  1XE0 A;  2P6C A;  2VW0 A;  3PVE A;  2VL4 A;  4C0B A;  3SKJ E;  3JU9 A;  2IFR A;  4YM3 A;  2ZBJ A;  5ISL A;  2R07 1;  3BIW E;  5A7S A;  2XBO 2;  1C57 A;  1CWP A;  3QH6 A;  3TEW A;  1LNS A;  5BNP A;  1S0D A;  2YBK A;  2ZMN A;  1Q8V A;  1WLT A;  2DCY A;  3WDX A;  3ABZ A;  4BXF A;  1GIC A;  4Q4W 3;  3OEB A;  4CXY A;  1DLC A;  3VKL A;  1O7F A;  4FOV A;  1C8M 3;  4UXA A;  1TMF 2;  2PHF A;  2PHL A;  2WDB A;  5FY7 A;  2C5D A;  5IK5 A;  2VNG A;  4WM7 B;  1TG7 A;  1Y9Q A;  2WZR 3;  1A34 A;  1NZC A;  1BEV 3;  2MEV 1;  3CNA A;  4PDW A;  2J1R A;  2C4X A;  1AYN 2;  5CFC A;  2GP5 A;  5L19 A;  4R4Z A;  3UYJ A;  4ES8 A;  5DUV A;  1E5S A;  4N90 A;  4LR4 A;  4XQW A;  4P5Y A;  4Y5T A;  2HWE 2;  3POI A;  2YC4 A;  4IEO A;  3VBO B;  3HD8 B;  3Q8F A;  4JQT A;  4LUK A;  1RTV A;  5J98 B;  4QWN A;  4XCB A;  2NM1 A;  2KM2 A;  3GZA A;  3MHZ A;  2CY6 A;  3VD3 A;  1CPM A;  5DAV A;  4RQP A;  3WUC A;  1ASJ 3;  1G86 A;  1Y43 B;  2XQR A;  2IVJ A;  2XVG A;  2ZAH A;  1SDD B;  4Y22 A;  4W6Y A;  1JZ8 A;  2K46 A;  3RZZ A;  4IEU A;  1BVV A;  2GC1 A;  1IQD C;  2DVA A;  1UPS A;  4QD2 A;  4QHB A;  4Q0S A;  3KT1 A;  1XC6 A;  4GB3 2;  2R06 2;  4CDQ C;  1AZD A;  3ON7 A;  2D97 A;  4HBN A;  1W28 A;  4UFJ A;  3PVO A;  5BNQ A;  5AFE A;  1CD3 G;  5F2W A;  1UOF A;  3MLL A;  3INA A;  5JWP A;  2B45 X;  3HR9 A;  1W2U A;  2XVK A;  3AP9 A;  3N7K A;  4RS5 B;  3NNJ A;  1AL2 3;  3VKN A;  4Z2A A;  2EIB A;  5ERL A;  3ASI A;  2WZR 2;  5FXW A;  1RGS A;  4OHZ A;  5A1F A;  2ZX2 A;  4QPW A;  4DZG A;  3BUC A;  4EN0 A;  2OZJ A;  4GB3 1;  4D8M A;  2ZML A;  1H4H A;  5HPO A;  1XSR A;  3KHC A;  1ND3 A;  2JDU A;  5EYY A;  2RMU 1;  1H8T B;  2D44 A;  5DDJ 1;  4D7S A;  2E26 A;  1SLI A;  1POV 3;  5A7Q A;  4AVT A;  4ZHN A;  3WW3 A;  3AKR A;  4C90 A;  3MW4 A;  5FP4 A;  3AXE A;  3VZK A;  1BQP A;  5T5O A;  5BV6 A;  1RC6 A;  1MPX A;  2ES3 A;  3DKW A;  3III A;  1H1I A;  3DYO A;  4B7E A;  3IDA A;  1ENX A;  3AZX A;  1GBG A;  3LOI A;  5IWF A;  2IXJ A;  1JZ5 A;  4MXW B;  5C3S A;  4P08 A;  3OG2 A;  3OOX A;  5CVR A;  4KL1 A;  2QDR A;  4AHZ A;  1X9P A;  2RDQ A;  2Q8O A;  2YZ4 A;  2JG9 C;  1BBT 2;  1LOC A;  1NYW A;  2XHN A;  5A6Q A;  3W5M A;  1X82 A;  1D2S A;  2Y6L A;  4XUT A;  5CYY A;  1RMU 3;  5KWR A;  2P4E A;  2VU9 A;  1X33 A;  2JX9 A;  3KQR A;  5GZC A;  2B9V A;  1DIW A;  4XZU G;  2WNU A;  4PIX A;  1UX7 A;  1J3Q A;  5FY4 A;  3OJB A;  3NAP B;  1OUX A;  1LHW A;  1O5U A;  3BI3 A;  2E33 A;  3T0A A;  4IER A;  4BLI A;  5FMB A;  2Y6J A;  2BVB A;  3J7N A;  4CDU C;  1RIN A;  2R06 1;  3LGR A;  4XPV A;  3AP6 A;  3UGH A;  5FY0 A;  3H1W A;  4LOR A;  4QU2 A;  3C7O A;  4RFR B;  3WG4 A;  3ZPO A;  2VUA A;  4LPL A;  4L8Q A;  1J3R A;  1WW6 A;  2A6V A;  4QQL A;  1RUD 3;  1JUI A;  3H8U A;  4XE9 A;  1C28 A;  4L2N A;  5T5L A;  1MS4 A;  1X9T A;  4RL7 A;  5JZG C;  1WMD A;  4FP3 A;  4NRM A;  4XBN A;  2JD4 A;  5HCB A;  3IDC B;  4ZXK A;  4LOS A;  4YZ5 A;  4GMP 0;  3VDC A;  1OLR A;  2HWE 1;  1VAV A;  1MVQ A;  1VBE 1;  1Y9M A;  4YW5 A;  1HRI 2;  1COV 2;  5K4L A;  1PK6 A;  3AKS A;  3I4I A;  2FZ2 A;  1Y7B A;  1N3P A;  4LK7 A;  1S0G A;  2JIC A;  1COV 3;  1W03 A;  4NPR A;  5FP7 A;  1CZT A;  4NAM A;  5L9B A;  1W2A X;  1BZW A;  1UPI A;  2ZGP A;  4J6G A;  2BU9 A;  3WUD A;  4BA6 A;  3NAP A;  2WZE A;  1AXZ A;  2JEC A;  2E7T A;  3O1P A;  5EYX A;  3Q9O A;  3SCG A;  4V2V A;  3ZO0 B;  2D6M A;  4AQ2 A;  1VIW B;  2CAV A;  2RS5 2;  3WQ7 A;  1X50 A;  2UY9 A;  2Y34 A;  4JCK A;  3U78 A;  3BTX A;  1RHI 3;  4Q4Y 3;  5IVJ A;  2WA3 A;  2QE3 A;  2XWJ B;  4QB6 A;  3HT1 A;  2DTW A;  3NV2 A;  4MUV A;  4NHK A;  4Q1P A;  1Q56 A;  4JX0 A;  5JMC A;  3KCC A;  4LKS A;  4FTB A;  3ETQ A;  1YI7 A;  4Q29 A;  2UU8 A;  2QQM A;  2VMF A;  4LLF A;  3E6D A;  1W06 A;  3VHP A;  1KDK A;  1NZI A;  4S2G A;  2Z5W A;  4CDW B;  2FQP A;  5I0S A;  5CKN A;  2A6Y A;  2PMW B;  4HL0 A;  2HWF 2;  4IQP A;  4PIY A;  1H6X A;  2V4V A;  4Q0V A;  4LNV A;  1NX9 A;  3SC7 X;  5CFD C;  5KR7 A;  1W6P A;  4LE4 A;  2J1A A;  3RZL A;  2ZKN A;  1Q5O A;  1W2O A;  4ZPI A;  4XAE A;  3USU B;  3HJR A;  3VDA A;  4OI0 A;  2JG8 C;  1W0N A;  2W87 A;  1WBF A;  5L9V A;  2CHH A;  2CSG A;  2XON A;  5CIS A;  2IXK A;  4FPY A;  3VZN A;  1Q3E A;  1ULP A;  3JQX A;  4A2U A;  4ZU7 A;  1YIP A;  5C9A B;  5JOW A;  4WM8 A;  3WF0 A;  2GNB A;  3AP5 A;  1ASJ 2;  3WW2 A;  2JEN A;  3S7E A;  5FDB A;  4QU1 A;  4CP9 B;  5EXO A;  2JG8 A;  2VXR A;  1SLC A;  3I59 B;  2WWS A;  3N4M A;  1PGL 2;  1KJL A;  5H9R A;  4YG3 A;  4AI8 A;  2WS9 3;  2RM2 2;  4CXW A;  1LGC A;  4Q4V 2;  1EAH 1;  3UK9 A;  1PM4 A;  2ZGL A;  2BER A;  4TYS A;  5B4X A;  1XBF A;  3DF0 A;  2HWC 1;  4ZU5 A;  4AE2 A;  3WDU A;  5E88 A;  3HN3 A;  4QX5 A;  4NII A;  3SH3 A;  3V0B B;  1XB9 A;  2IXL A;  5A3W A;  1D4M 2;  3T09 A;  4FFH A;  4LBM A;  4XJA A;  1JUH A;  3VBS B;  1XNB A;  3R0R A;  3VBR A;  1G9B A;  4GZ9 A;  4YW4 A;  2RM2 1;  1QMJ A;  1FV3 A;  3POF A;  3DYP A;  1OF4 A;  1QWR A;  2BNN A;  2BTV C;  3O0W A;  5C8C A;  3I3E A;  3MI8 A;  3T1M A;  4Q4X 1;  1WWY A;  4JRA A;  1MZE A;  5JDB A;  4COW A;  1UIK A;  4YSF A;  3AVS A;  2BBA A;  3W9A A;  3C7E A;  1UYP A;  3WG2 A;  3ZXD A;  4M3C A;  3KGZ A;  2R04 2;  2IXI A;  1UCX A;  4NIG A;  3LSE A;  5LCW L;  5C71 A;  1WLC A;  4WM7 C;  2QQN A;  3EBR A;  3PUS A;  3WP6 A;  4UAP A;  2ZMK A;  1YQ5 A;  4IV3 A;  3VHR A;  3CJX A;  5I8T A;  3M7A A;  4ZZ5 A;  4Q5O A;  4XFC A;  1PZ8 A;  1OUR A;  3WQB A;  4PJY A;  5D8A C;  1WCK A;  1V6J A;  5LBC A;  4DIQ A;  1SMV A;  1ZRF A;  5JZG A;  4I0W B;  1GFF 2;  4FAH A;  1V70 A;  2Y60 A;  2PLV 3;  1NLS A;  2DCJ A;  5LRR A;  5C3R A;  3PUA A;  1HIX A;  3ACL A;  4IE5 A;  1LCL A;  1DQ2 A;  1GAN A;  3DPR A;  4UF0 A;  5H9S A;  3H8X A;  3UJQ A;  1JZ3 A;  4COU A;  4M0H A;  3JB4 C;  3J26 N;  1MS9 A;  4N43 B;  4ASM B;  5F9T A;  2XUM A;  1BLZ A;  1CIW A;  2LRP A;  2DUQ A;  1GQG A;  1US2 A;  4LUL A;  1QHD A;  1IGO A;  3T2O A;  1PM7 A;  5SV8 A;  3K4Z A;  2RJL A;  1W3X A;  5FKB A;  4LJH A;  3AVR A;  3O12 A;  3POG A;  1GSL A;  1KFU L;  3ZXE A;  1E5I A;  2WNO A;  1DG6 A;  1FAY A;  1R1A 1;  2WRA A;  5FUP A;  5FPU A;  5LA9 A;  1GQP A;  3WSO A;  4DY3 A;  4R9A A;  3IB3 A;  2ETE A;  4LBK A;  4EE2 A;  1SCR A;  3WV6 A;  2HWB 1;  5HV4 A;  1F4A A;  3N3H A;  4IEV A;  3ZN6 B;  5A3U A;  2DUO A;  2IC1 A;  4FPF A;  1O3S A;  1W6M A;  4AFM A;  2JDK A;  4A7Y A;  3BTY A;  2AR6 A;  2ARX A;  2R07 3;  3H1Y A;  3VBF B;  5FZ7 A;  1QJU 3;  4LUM A;  1EV1 2;  1FMD 3;  3LPF A;  4BQ3 A;  1H8T C;  1RJ8 A;  4RGG A;  4Q4V 1;  3AZW A;  4BM8 A;  4URA A;  2YBP A;  1XSQ A;  4QKF A;  5I91 A;  1SBF A;  1GWM A;  5JSO A;  2F17 A;  2Y0O A;  2XJS A;  4XEZ A;  1X7N A;  2B39 A;  3ZYR A;  1FOD 1;  2VBP A;  2NZ9 A;  5D2A A;  5IAT A;  1ZZ6 A;  5IVV A;  2A5Z A;  1XJA A;  3EXU A;  4I09 A;  4PF5 A;  5DUX A;  4QX3 A;  4P9G A;  4N43 C;  4OUL A;  2VZV A;  5C7G A;  2HWB 2;  3T4H B;  2EXJ A;  3KV6 A;  1QQP 2;  4LO5 B;  4LQR A;  1G7Y A;  1CES A;  2DVD A;  3ZFF C;  1UOG A;  4OHV A;  1UZW A;  4PHZ A;  2IFW A;  3MFC A;  1IPK A;  1N3O A;  1POV 1;  2RS1 2;  3I2J A;  1STM A;  2EA7 A;  2D43 A;  5FPZ A;  1NA1 C;  4XF1 A;  4ES9 A;  1TME 1;  4PQQ A;  4DRR A;  1ZBA 1;  5B4N A;  1RUH 3;  3CBN A;  4HZF A;  3LE0 A;  3SCF A;  1O59 A;  3DUI A;  5CEH A;  4XJ8 A;  1EP0 A;  3LF7 A;  3UT0 A;  1LHV A;  3NV1 A;  3BB6 A;  5FMO L;  3Q8B A;  3WD5 A;  1YO8 A;  5LY1 A;  5F6L B;  2OYZ A;  4BDV B;  4D6S A;  3D0S A;  3KF3 A;  3WDY A;  2WNV B;  2RDN A;  5GKA C;  2N7G A;  4NRP A;  2PN5 A;  2ZEX A;  2K2S A;  1MS3 A;  2Q1Z B;  3PMS A;  2FMD A;  4NRO A;  2YC0 A;  1SBD A;  3GAL A;  3M2M A;  2WYF A;  3OPT A;  1QQP 3;  3PL0 A;  1FYU A;  4JGZ B;  4AL9 A;  3I97 A;  1D0G A;  2Q1F A;  2W2I A;  5FZH A;  3ZMO A;  4BCU A;  1OD3 A;  3DYM A;  3L9J T;  5DG2 A;  5JXJ A;  2TBV A;  4O61 A;  1W39 A;  2HEV F;  1NY7 1;  2Z79 A;  5FMD A;  4CU9 A;  2JIJ A;  5FRE A;  1MZF A;  1LOD A;  3SH4 A;  1V6I A;  4HKO A;  5FY1 A;  4OQ9 A;  1KS4 A;  3I2G A;  4UOJ A;  4LHL A;  1PX3 A;  4Y1V A;  1JZ2 A;  1WD4 A;  1CZS A;  2GC3 A;  1V6O A;  1HW5 A;  3O1T A;  4OUM A;  2XJT A;  4O9E A;  1S0I A;  1W0P A;  2BYV E;  3MO4 A;  5JIA A;  1WMX A;  1IS6 A;  2Q8E A;  3S57 A;  3PU8 A;  4S2F A;  3EJK A;  3MUY 1;  3ZFE B;  4CCL A;  1IS3 A;  4QPI B;  1WW4 A;  3I2K A;  1SHW B;  1L7R A;  3H7Y A;  1PIV 3;  3AL6 A;  4Y3O A;  1I3H A;  4FOQ A;  4UBH A;  3V0A B;  4OI4 A;  2GDF A;  2VZU A;  3N9L A;  1NUK A;  4UW4 A;  2VNO A;  4CEW A;  1Q8S A;  2O8Q A;  1ODN A;  4AGV A;  2BRT A;  3ZPY A;  2XPJ A;  3ZN6 A;  5FYI A;  4LIU A;  4CU6 A;  5JI9 A;  3VBR C;  3VKO A;  2X29 A;  2DV9 A;  1AR8 3;  3FN9 A;  2C9K A;  3KV4 A;  5LEJ A;  1V00 A;  3IDB B;  2BFU L;  5IT6 A;  5GZF A;  2Q5T A;  3R4S A;  3WNM A;  4DXS A;  3F95 A;  1H2M A;  3ZYB A;  2HWD 2;  2V09 A;  4XFF A;  1PZ7 A;  1S2K A;  4IDZ A;  1ASJ 1;  3PHM A;  4JVA A;  1W8Z A;  2HWD 3;  2JKB A;  3ZFG A;  1GNZ A;  3ZXG A;  5K9Y A;  1VPH A;  1F31 A;  2WNU C;  3PIG A;  3VD5 A;  4ZZ8 A;  5HCH A;  4N7U A;  3Q8C A;  5FLH A;  2FCU A;  3AYC A;  3NKT A;  2K9Z A;  1ZBE 2;  3IKW A;  3NNM A;  1H4G A;  1W8F A;  4UW6 A;  4YGE A;  2PHD A;  3U11 A;  1JN2 P;  1GV9 A;  2W9X A;  4ISQ A;  5DDJ 2;  2PAE A;  2GND A;  1WKY A;  1KIT A;  3WG3 A;  3IWZ A;  2I07 B;  5C4W C;  4MAD A;  2BUK A;  3H50 A;  1PX4 A;  3HQX A;  1LRH A;  1PIV 2;  5GZD A;  1EUU A;  1RMU 2;  1E5R A;  1YHF A;  1SDW A;  1QJE A;  5FUN A;  2WLP A;  2Y6H A;  3VBS C;  3LB9 A;  1TE1 B;  4NMI A;  4DXZ A;  5GLV A;  1VLN A;  1RUI 2;  3T3Y A;  2WNU B;  3KQ4 B;  5T52 A;  3BU0 A;  3S0M A;  1UMI A;  2D93 A;  4JV4 A;  2ORX A;  2RV9 A;  4YFW A;  3ZYH A;  2JDM A;  1LOB A;  2VCA A;  1GOG A;  2DFB A;  4CXX A;  3CZJ A;  3VBO C;  1O4T A;  4HET A;  1JXN A;  4LBL A;  5F5C A;  4BZ4 A;  5FZG A;  1UXX X;  1QIQ A;  2O8O A;  1RL3 A;  1AX0 A;  4NRQ A;  4XBQ A;  1MS5 A;  2A3W A;  1QNY A;  4I01 A;  4N53 C;  3NQH A;  5FK8 A;  5JPN B;  2RS1 1;  4W65 A;  1I9R A;  4YW6 A;  5G05 L;  4DIN B;  2A71 A;  3O14 A;  4QPI C;  1K5M C;  3MIB A;  4XOG A;  2P5B A;  4QXK A;  4AED C;  3WP3 A;  4C91 A;  1F4H A;  1W8U A;  2ERF A;  4E4Z A;  4K3U A;  1RIR A;  2DUR A;  3BAL A;  5DUU A;  1AVB A;  1EPZ A;  4CP9 A;  2QDN A;  2GC2 A;  3VDD B;  3OB8 A;  3H3L A;  2ADE A;  1W6P B;  3O1S A;  2V5D A;  3JD7 3;  4AHW A;  3CL1 A;  3WNP A;  5AC9 3;  3C7G A;  3PUQ A;  4AI9 A;  3FX3 A;  4PI2 A;  3O1M A;  2VUC A;  4IV1 B;  3T2T A;  4LHK A;  1QOS A;  5FYV A;  1UX6 A;  3WDW A;  3RWN A;  5BNO C;  4JHT A;  2VZS A;  4FPG A;  4AQ6 A;  2CGO A;  5FYC A;  1MZ6 A;  4BQW A;  1NXM A;  4GIQ A;  2XGX A;  3POW A;  4FOW A;  1JI6 A;  2RS3 3;  2P37 A;  1OOP A;  1JZ4 A;  4K8F A;  1OPO A;  3I59 A;  3FC0 A;  5IUQ A;  1UF2 C;  2XVL A;  1UO9 A;  4H14 A;  5CAZ A;  1ZRC A;  5DMY A;  2R0H A;  3NMB A;  1FI2 A;  4NVP A;  1ZM1 A;  2RVA A;  4JGZ C;  1N1T A;  1RUF 3;  1VJ2 A;  2WT1 A;  3HEI A;  3HN1 A;  1MS8 A;  3NL1 A;  4UF0 B;  1GU3 A;  5LY2 A;  4P9J A;  5EJ1 B;  4AZZ A;  4CTE A;  3HQU A;  2ATF A;  1K5M B;  3J7M A;  4GA9 A;  4E4D X;  3ZFF B;  4M4R A;  5L7O C;  5KC5 A;  2RDR A;  3LDR A;  1RIT A;  2YDE A;  4HPK B;  2FDG A;  3U10 A;  5FJK A;  3V56 A;  5D8A A;  1UOJ A;  2JDN A;  4AVV A;  1VMH A;  2XUE A;  1GNY A;  3GZT B;  1VBC 1;  1DQ0 A;  3PIJ A;  2VMH A;  1UU4 A;  4PLM A;  1LJ7 A;  5A3P A;  5A6X A;  3MW2 A;  1U5Y A;  2WWU A;  3RSJ A;  3RYR A;  2EIE A;  4FQ4 A;  2VM9 A;  3ZKY A;  4WZC A;  4AGR A;  5TSW A;  1X8E A;  2A6Z A;  2X5I A;  4TLG A;  1OI6 A;  1NCQ A;  1YQ8 A;  2WAB A;  3ES4 A;  4Z82 A;  4AR2 A;  1WD3 A;  5AVA A;  4HXC A;  4IE7 A;  2WYS A;  3ZIX A;  1OPM A;  3ST7 A;  4NJ4 A;  2YFZ A;  4WZF A;  2E9Q A;  1R1Z A;  5FK7 A;  3CKH A;  1XNK A;  3TRS B;  3GJB A;  3VDB A;  4I3G A;  4OI2 A;  2HEY F;  3NNG A;  3WW1 A;  3NRU A;  3RQ0 A;  5GJ6 A;  4ZKT B;  5J1X A;  2VUD A;  1S0E A;  3WP5 A;  4ET7 A;  4QMA A;  4R9C A;  4XQD A;  5BY5 A;  3CEW A;  5LZ6 A;  5DPN A;  5FZO A;  1IOA A;  3RI8 A;  4IEP A;  4CPB A;  4I2O A;  1JYT A;  4QQP A;  2YB7 A;  2RR1 2;  3HMY A;  5IVB A;  4IE4 A;  2CWS A;  4YZ2 A;  4HFS A;  1DYP A;  2ZOE B;  3E97 A;  1NCR B;  2ZZQ A;  5LAS A;  1Q8P A;  5AFB A;  1XYP A;  4B1L A;  4RQP C;  3DCQ A;  5A70 A;  4RFT 0;  4N53 B;  2RJK A;  4YM1 A;  4ZU4 A;  1GR3 A;  5LA1 A;  3THD A;  1H0B A;  1HRV 2;  1PVC 1;  1FX5 A;  2P6H A;  4AFB A;  3AKP A;  2YU1 A;  4IGP A;  4AOC A;  3O1V A;  1BMV 1;  1D2Q A;  1LOA A;  3MYX A;  4IL7 A;  4C8D A;  4HON A;  4NE9 A;  3WX5 A;  1PMJ X;  3NJY A;  5LBF A;  1MEC 3;  3V65 A;  1SQ4 A;  3UKT A;  1ND3 B;  1TZO A;  1QJU 1;  4HG6 B;  4NO4 A;  2JWP A;  5CFD A;  3NNL A;  2B42 B;  4IGQ A;  5FZ9 A;  4Z2W A;  4J1X A;  4O65 A;  4MYE A;  4HVO A;  2JB4 A;  3PLQ A;  2XJP A;  4K1Z A;  2BEO A;  3LFI A;  2VQT A;  4YPJ A;  3CF6 E;  1GYK A;  1CPN A;  2D5H A;  3VV1 A;  4BJ0 A;  4GMP 1;  1OA3 A;  2UUR A;  5JVV A;  4HKW A;  1NCR A;  1WGP A;  4OUS A;  4GWN A;  2EXH A;  2ZAA A;  3MLK A;  4K20 A;  2WFF 2;  4EN8 B;  2H0B A;  4TZD A;  2V73 A;  4WVV A;  4B3N A;  1FNZ A;  1HQL A;  2A7A A;  3OGG A;  1NY7 2;  3AP4 A;  3LQC A;  2ARB A;  5FZO B;  2ZGS A;  2RG4 A;  4XYX A;  2RHP A;  4YVW B;  1B09 A;  3L2H A;  4RD7 A;  3VN4 A;  3PU3 A;  1QQP 1;  5GLT A;  3S7I A;  1SG3 A;  3N35 A;  4PF1 A;  3JBG 3;  3IBM A;  1ZBE 1;  1TNF A;  2ZJC A;  1TME 3;  3ZSL A;  2WZP P;  3SIS A;  1AR9 3;  2HBT A;  2BGO A;  3GBW A;  4ASL A;  1KGY A;  3K51 A;  4KH9 A;  2DWR A;  4FPE A;  2ZX4 A;  4K6B A;  2FDK A;  1XXN A;  1G8W A;  1RHI 2;  1VB2 A;  4QGM A;  3MPP G;  2R04 1;  1JS9 A;  3WNO A;  4B1M A;  3IZO A;  1PMH X;  3RDI A;  5ANN A;  2CDP A;  2W1U A;  4CU7 A;  3VBR B;  3ZSJ A;  1YIF A;  1Q43 A;  2NN8 A;  3PTR B;  1A78 A;  5FMC A;  2WAA A;  5KHI A;  2ZX3 A;  3IAP A;  5CKQ A;  3T08 A;  3HOB A;  2WQ8 A;  4QM8 A;  4QDR A;  1JYN A;  4AEM A;  1W6N B;  2CV6 A;  1LTE A;  4RSU A;  1VBB 2;  4WBB A;  4XFB A;  3TNQ A;  4BIS A;  1JW6 A;  2E51 A;  2XOM A;  2DUP A;  4IW3 A;  1NXD 1;  4LBN A;  4QQH A;  4KGQ A;  3T1L A;  3B94 A;  2WT0 A;  2QQL A;  4MGZ E;  1JYI A;  2BPA 2;  2VOV A;  2YGM A;  2D7F A;  4FXK B;  2CYF A;  2ZKL A;  5A7N A;  1C5H A;  2IZW A;  3OBZ A;  5FFO C;  3SXW A;  1NE4 A;  3RFR A;  2G9G A;  1YUD A;  5I8Y A;  1POQ A;  1ST8 A;  1WCS A;  1CQ9 A;  1WZX A;  2QQU A;  3CO2 A;  1V6L A;  3OGV A;  4N9I A;  3ECQ A;  1FOD 2;  2P2K A;  1CAV A;  3E1F 1;  2VTX A;  1LHU A;  4GJZ A;  4FPH A;  1TQ5 A;  3ZVX A;  3I49 A;  4AAX A;  4WVM A;  5ACA 3;  1UKG A;  1W6Q A;  1F35 A;  3VDD C;  2BGC A;  3GM8 A;  5GZE A;  2AEZ A;  1V6K A;  4XFA A;  3FWE A;  3OF1 A;  3CZU A;  2PXJ A;  1O8S A;  4FI9 A;  2VBD A;  2OT7 A;  5F3E A;  1UAI A;  5FXX A;  2VO5 A;  4YGC A;  4YWA A;  4P9L A;  4Q8K A;  3L2Y A;  4XAC A;  4DEQ A;  3P3N A;  3KZ4 C;  4L11 A;  4BHP A;  4NWV A;  4YFZ A;  1SLL A;  2D3R A;  4RA0 A;  3WNX A;  4BQ1 A;  4FFI A;  2HBU A;  1CON A;  3H1M A;  1RUE 3;  1TNR A;  4ITC A;  1XNA A;  3FUQ A;  1R08 3;  4QB1 A;  4A3X A;  5CG9 A;  3ZFG C;  1ZZ8 A;  2W0X A;  4LK6 A;  3RJ2 X;  3FE5 A;  3RS6 A;  2PAK A;  1YI9 A;  2JDH A;  2ZX0 A;  5FZE A;  3S5Q A;  1ODM A;  3OPW A;  2XL9 A;  4XUP A;  1JMU B;  1VMJ A;  3ZN5 A;  3NV3 A;  1XND A;  2RE9 A;  1JYC A;  3OD0 A;  2D6N A;  2VME A;  1UY4 A;  3J8F 3;  3J9S A;  1QH6 A;  4GWJ A;  4LT5 A;  1GZT A;  4HMZ A;  1Z7S 3;  3WP4 A;  1EY2 A;  4YG0 A;  4PCR A;  2OS2 A;  1K42 A;  2RS3 1;  4O7X A;  3FFQ A;  1F5J A;  4P5H A;  2IXC A;  2L9L A;  2F4L A;  4CCJ A;  4DO0 A;  3OSD A;  4E8C A;  1JZ6 A;  1UMZ A;  3T0B A;  1FT9 A;  3N36 A;  2XJR A;  3KM5 A;  2SBA A;  3ACH A;  1CAX A;  1A8D A;  1WCU A;  5HBA A;  3BKZ A;  1E5H A;  4LO8 A;  1BEV 1;  2W08 A;  1YYN A;  1IG0 A;  3IMM A;  4AVS A;  1Z78 A;  1O91 A;  5F3C A;  1AYM 1;  3AXD A;  1RUE 2;  3OTF A;  4AXO A;  4JDO A;  2OVU A;  3OUI A;  5B2G B;  3SQO A;  1PK6 C;  3POY A;  3W20 A;  1V6M A;  1EV1 1;  3GGL A;  4B8E A;  1C1F A;  2HWE 3;  1OKO A;  4AEK A;  4W50 A;  1O6U A;  3JD7 2;  4E4H A;  3FHA A;  3I3M A;  3O7O A;  3OBT A;  3BVC A;  1ZA4 A;  2VZ1 A;  5CG8 A;  2CGN A;  1NG0 A;  2OUH A;  4CPB D;  2TEP A;  2WLQ A;  2R32 A;  3ILR A;  1I5P A;  2G9F A;  4R52 A;  2A1X A;  2WKK A;  1FPN 1;  3JBG 2;  1RYY A;  5FOJ B;  2R06 3;  3N9P A;  5JIU A;  1D4M 1;  1RED A;  4N8M A;  1O3R A;  4YW7 A;  1MEC 1;  5KXD A;  2ZX1 A;  4JKL A;  1UL9 A;  2I2S A;  4Q4W 2;  2QCS B;  3VL9 A;  2Y38 A;  4EQV A;  3E5X A;  5CFD B;  4FFF A;  5I0U A;  4MZU A;  2X5I B;  1QXR A;  1LOF A;  2E53 A;  1KFX L;  3KV9 A;  1OH4 A;  4BIO A;  4D0Q A;  1JZ7 A;  2AEY A;  2GMM A;  3LKJ A;  4FCA A;  1V9U 3;  3X29 B;  4XDP A;  4AI3 A;  5KC6 A;  3FFZ A;  1UWW A;  2CWM A;  3MV0 1;  1QXP A;  3BOP A;  3POS A;  1DZR A;  5FYS A;  4AEJ A;  1Z7S 1;  1BEV 2;  1ALY A;  1OLQ A;  1Y9G A;  1K45 A;  4WM8 C;  2HYX A;  2BP6 A;  3IDE A;  1XE7 A;  1UNB A;  2W1W A;  4Q26 A;  4CUA A;  3CHX A;  4H7L A;  4MGK E;  4NOT A;  1HJG A;  1GWL A;  3AMM A;  3LIH A;  5BNN B;  4U36 A;  2QZ3 A;  2QQJ A;  1NA1 A;  1SCS A;  4XQ4 A;  4EZ4 A;  4AI1 A;  4Z1V A;  4QX0 A;  4UFI A;  1NKG A;  1AL0 G;  2XR4 A;  4BE3 A;  4F8A A;  4DUX A;  5EWS A;  1I1E A;  4LKD A;  1WA4 A;  4ORF A;  4BQ4 A;  1ENQ A;  2YYO A;  3ZFF A;  1WCQ A;  2GAU A;  2G9Z A;  4A4A A;  4EYU A;  1CZV A;  1U5X A;  2ZCW A;  3JCI A;  1ZX5 A;  5JCT A;  4CDU B;  3HWJ A;  1N1Y A;  2A75 A;  3CIH A;  3MFA A;  4XFH A;  5IW0 A;  3UL2 A;  5K0U C;  3N7L A;  5EFU A;  3KF5 A;  1IG3 A;  3HBK A;  1LOE A;  4V2W A;  1W0O A;  1ND3 C;  3T30 A;  4AAP A;  2FMY A;  5JSP A;  3TN9 3;  4ATF A;  1WME A;  3LDK A;  3U4X A;  1GUI A;  3BTZ A;  5GLW A;  5KHG A;  3RYP A;  3FUO A;  1W8H A;  3AX4 A;  5JXG A;  1WMF A;  1CJD A;  2GME A;  4FAG A;  3AC0 A;  2HWC 3;  2HEW F;  2MPF A;  4JZR A;  4LKF A;  2HYK A;  3CLP A;  5DAP A;  5CB7 A;  5T54 A;  3WHT A;  2R6Q A;  1BYH A;  2W95 A;  3EB7 A;  1VRH 3;  1JHN A;  1ULO A;  1F2N A;  3CJI A;  3EYP A;  4X8P A;  1YFX A;  4B4P A;  5C33 A;  4PLN A;  3K48 A;  1OFN A;  5IVC A;  1W6O B;  2ZEW A;  4HKL A;  4L97 A;  5HV0 A;  4DY5 A;  5FZF A;  1G9C A;  4JRL A;  1YRZ A;  2LS6 A;  4B29 A;  4AW7 A;  4KU7 A;  3LSD A;  2DVF A;  4XUN A;  3N9M A;  1OOP C;  5FXV A;  2P1B A;  2QQW A;  3OBA A;  4UWD A;  5DZG A;  3KB5 A;  2IXH A;  1L7Q A;  4W4Z A;  1H2K A;  1B35 B;  5A7W A;  1W90 A;  1D4V B;  5EZW A;  5CFC C;  3GBF A;  3QLQ A;  1ULF A;  1KXG A;  2F4P A;  3KGL A;  2D98 A;  3AFG A;  5IJR A;  2WN2 A;  4Y22 B;  4EWE A;  1RUJ 1;  4QPG C;  1YFU A;  4QPG A;  1QNW A;  4OMC A;  5T50 A;  3U0Z A;  1DYO A;  4YW1 A;  3ENR A;  3RRD A;  2OUJ A;  3PTY A;  4JTO A;  3VZJ A;  5J96 B;  3Q8A A;  5DAB A;  4ZXE A;  3J7L A;  1HRV 3;  5JLV A;  1QDO A;  3DXT A;  4OI1 A;  4CSW A;  1W3V A;  1BVP 1;  3GNE A;  1WW7 A;  5A3T A;  1OVS A;  5FZI A;  4P9I A;  2DVG A;  4JTN A;  4QM9 A;  3VB9 A;  2Y26 A;  2XB6 C;  1JH5 A;  1UIJ A;  1I5Z A;  1ULE A;  4QKD A;  2WO3 A;  3NV4 A;  2QUO A;  4K40 A;  4DQA A;  3I2O A;  3I2F A;  4Q27 A;  2WA4 A;  2D6O X;  3O1O A;  5AVP A;  3HBZ A;  4HAN A;  4CCM A;  1REE A;  4EV0 A;  4MOA A;  1YQ6 A;  3G6J B;  3CDZ B;  2WO1 A;  1PVX A;  1W6O A;  1CGP A;  5F5A A;  2PQQ A;  5FV3 A;  4Q4X 2;  4LO7 A;  3RJR A;  4Z92 B;  2RR1 3;  2QQV A;  1OLM E;  1NLQ A;  1KQR A;  4PI0 A;  1R1A 3;  5T55 A;  4IET A;  3POJ A;  5ACA 1;  3LA7 A;  1ZZC A;  3PVB B;  3KSC A;  5LW9 A;  2VVD A;  1HRI 3;  3ELN A;  3RNS A;  3NWK A;  1U12 A;  5CKM A;  1U5Z A;  1XE8 A;  3U14 A;  1ND2 A;  2E6V A;  2WAO A;  3FBY A;  1MZ5 A;  2QBX A;  2WII B;  2J7M A;  2EAK A;  1G9A A;  1DQ5 A;  3MIE A;  1CAW A;  4XAB A;  1PO1 3;  2BNO A;  3D6E A;  4RYD A;  2FBE A;  3DV8 A;  4AI2 A;  1LOF C;  4LXL A;  5FIX A;  2ENR A;  5A3M A;  1WUV A;  2VPV A;  1A6C A;  2PYT A;  4BH9 A;  3AJZ A;  2PLV 1;  4LBO A;  2BVV A;  4YVW C;  2VTF A;  4Q4Y 2;  3W59 A;  4Q0P A;  5FZL A;  3IN9 A;  4QHO A;  2I74 A;  2XG3 A;  5JSR A;  4UFH A;  5FRA A;  3ZX7 A;  1O3T A;  5EPA A;  2B4K A;  2OX0 A;  3ME2 A;  4Q4X 3;  1I6X A;  1F15 A; 
#chains in the Genus database with same CATH homology
 4DXR A;  1O8P A;  3NQH A;  5G05 L;  3I3B A;  2CDO A;  1F4H A;  1DP0 A;  2W92 A;  1UZ0 A;  3ETP A;  1W8O A;  3OB8 A;  2VL4 A;  3VD7 A;  3SKJ E;  3OGR A;  4P02 B;  2V5D A;  3WNP A;  4IUG A;  3C7G A;  1J84 A;  1W9W A;  3ACI A;  4MGQ A;  2OKX A;  2VZS A;  1LNS A;  2V72 A;  1JI6 A;  3VD4 A;  1JZ4 A;  3ABZ A;  3WF1 A;  3OEB A;  1R64 A;  1DLC A;  4A42 A;  5DQ0 A;  4CUC A;  5CZK A;  1EUT A;  5DMY A;  3IAQ A;  1K12 A;  2RVA A;  2WDB A;  2JE8 A;  3HEI A;  1GU3 A;  5EJ1 B;  3PUH A;  5JXH A;  4LHS A;  2J1R A;  5HXM A;  2C4X A;  4M4R A;  5JXI A;  1OT5 A;  3UES A;  4P5Y A;  2YC4 A;  4QX2 A;  1JHJ A;  3I2I A;  1GNY A;  3WF4 A;  3VD3 A;  2VZR A;  4AG4 A;  1SDD B;  3MUZ 1;  1JZ8 A;  1GMM A;  2EIE A;  2VM9 A;  1IQD C;  1XC6 A;  1T2X A;  2WAB A;  3ACF A;  2DDU A;  2WYS A;  2QQK A;  3FHQ A;  2YFZ A;  4Z2A A;  1UXZ A;  2EIB A;  3CKH A;  4QPW A;  3VD9 A;  3VDB A;  3NNG A;  4D8M A;  5HPO A;  3NRU A;  5J1X A;  4ET7 A;  4QDQ A;  2E26 A;  5DPN A;  4JKK A;  2VCC A;  2YB7 A;  3III A;  1MPX A;  4RN5 A;  3DYO A;  4QX1 A;  3IDA A;  1JZ5 A;  3SEE A;  4P08 A;  3OG2 A;  2EIC A;  3HPN A;  2RJ2 A;  3CMG A;  4OUE A;  1UYZ A;  3K4A A;  2XHN A;  3W5M A;  3C7F A;  5LA1 A;  1H6Y A;  2Y6L A;  3THD A;  1GOF A;  4XUT A;  5CYY A;  2YG0 A;  4MO3 M;  2B9V A;  4XZU G;  4A41 A;  1UMH A;  1PMJ X;  1UX7 A;  4OMD A;  3OEA A;  4HG6 B;  1W9S A;  2E33 A;  3T0A A;  3LEI A;  2Y6J A;  2BZD A;  2VMC A;  3JXS A;  2VQT A;  2JDA A;  3C7O A;  4YPJ A;  1KEX A;  4LPL A;  4BJ0 A;  3NJX A;  2PQS A;  2W47 A;  3DEC A;  3HNY M;  3VDC A;  3K77 A;  3I3D A;  3LQC A;  4A6O A;  3ZM8 A;  4E8D A;  1SG3 A;  1CZT A;  4PF1 A;  2W91 A;  3C7H A;  4W8J A;  2WZE A;  2BGO A;  1KGY A;  3BGA A;  2E32 A;  3K46 A;  1US3 A;  3WNO A;  1PMH X;  2CDP A;  2W1U A;  4CU7 A;  4PT6 A;  4QB6 A;  4BXS V;  4DUW A;  4JX0 A;  2WAA A;  4LKS A;  2X05 A;  3IAP A;  2WBK A;  2QQM A;  2VMF A;  3T08 A;  3HOB A;  2WQ8 A;  4QDR A;  2ZEY A;  1JYN A;  1UY2 A;  2WN3 A;  2Y6G A;  4JKM A;  1H6X A;  2V4V A;  3OGS A;  2XOM A;  1NX9 A;  4GWI A;  2J1A A;  3VDA A;  2QQL A;  3HJR A;  1W0N A;  2W87 A;  2DCK A;  2XON A;  1ULP A;  4A44 A;  3T0D A;  3WF0 A;  5JR2 A;  3OGV A;  3ECQ A;  4ARY A;  3E1F 1;  2YC2 A;  2X09 A;  4AAX A;  1K3I A;  3GM8 A;  5FUI A;  2BER A;  2J1S A;  5B4X A;  3CZU A;  2VZP A;  1O8S A;  4FI9 A;  3WNK A;  5IYY A;  3LEG A;  3HN3 A;  4KWU A;  2YFU A;  2VO5 A;  4XUQ A;  2W3J A;  3T09 A;  2J22 A;  2VZ3 A;  4DEQ A;  3MBW A;  4GZ9 A;  1UY0 A;  3C8X A;  1CX1 A;  3THC A;  3DYP A;  1OF4 A;  3F2Z A;  4ZY9 A;  3I3E A;  4CU8 A;  3P6B A;  3A22 A;  1XNA A;  4QB1 A;  5I0D A;  1CIY A;  4KI5 M;  2BBA A;  3K4D A;  5IFT A;  3C7E A;  2W94 A;  1UY1 A;  1BHG A;  4XUP A;  2VC9 A;  4MGS A;  5LCW L;  5C71 A;  4GWJ A;  2QQN A;  2VME A;  1UY4 A;  4UAP A;  1K42 A;  4ZZ5 A;  2L9L A;  3WQB A;  2Y6K A;  2VQU A;  5LA0 A;  3D3A A;  4XUR A;  4E8C A;  1JZ6 A;  5G04 L;  3T0B A;  5IFP A;  4DUV A;  1OF3 A;  3ACH A;  2LW8 A;  2DCJ A;  1JZ3 A;  2E31 A;  3ACG A;  2ID4 A;  3W5N A;  4KMQ A;  1US2 A;  3T2O A;  3GGL A;  3A23 A;  3K4Z A;  4W50 A;  5JUV A;  2R7E B;  2JKX A;  3FHA A;  2VZ1 A;  3WSO A;  1GQP A;  3BN6 A;  3IB3 A;  4QAW A;  1JYX A;  5IHR A;  2W1Q A;  4P00 B;  1I5P A;  2W1S A;  4QB2 A;  3LEK A;  3T2P A;  2VCB A;  1F4A A;  1RYY A;  4A45 A;  4QDS A;  2J1U A;  5JMO A;  3HNM A;  4JKL A;  3A7Q A;  2WO2 A;  3LPF A;  1UY3 A;  1P8J A;  4D0Q A;  1OH4 A;  1JZ7 A;  1JYV A;  3UET A;  2W46 A;  2HLE A;  3MV0 1;  1UWW A;  1JU3 A;  1K45 A;  2HYX A;  1XPW A;  2W1W A;  5LA2 A;  4CUA A;  2C26 A;  4QX3 A;  2X10 A;  2VZV A;  2QQJ A;  5C7G A;  2VJX A;  4QX0 A;  4LQR A;  1NKG A;  4DUX A;  5EIY B;  4TTG A;  1WCQ A;  3A21 A;  4A4A A;  3I2J A;  1CZV A;  5EJZ B;  3CIH A;  1J83 A;  4PQQ A;  5B4N A;  3NJV A;  2VR4 A;  3LE0 A;  4XUO A;  1O59 A;  4UI9 L;  4OYU A;  2EID A;  2ZEZ A;  1GUI A;  3HNB M;  4JHZ A;  1D7P M;  4BDV B;  4BK5 A;  5JXG A;  3CQO A;  3AC0 A;  2ZEX A;  2W95 A;  3EB7 A;  3EYP A;  1ULO A;  1GOH A;  2VOT A;  3GXU A;  2ZEW A;  2J1E A;  2J1T A;  3GDB A;  2LS6 A;  2Z4F A;  3SEP A;  3I97 A;  4BK4 A;  4XUN A;  1UYY A;  1OD3 A;  2XQX A;  3DYM A;  1YQ2 A;  2VZQ A;  4ARX A;  5JXJ A;  3OBA A;  2Y8K A;  2VZO A;  4CU9 A;  1XNT A;  5C70 A;  4W4Z A;  1L7Q A;  3WNN A;  3T2Q A;  3WEZ A;  3I2G A;  4UOJ A;  1PX3 A;  2W5F A;  2JD9 A;  5IJR A;  1JZ2 A;  2WN2 A;  1CZS A;  3LPG A;  4OMC A;  1DYO A;  1UYX A;  3MO4 A;  3P1I A;  4ZXE A;  3PUI A;  3MUY 1;  3I2K A;  1SHW B;  1L7R A;  2WUH A;  4A3Z A;  4DEV A;  2Y64 A;  4L0P A;  3UNP A;  4XVH A;  2VZU A;  1W99 A;  1NUK A;  4TXW A;  1HN1 A;  2WO3 A;  3SKV A;  3I2F A;  4CU6 A;  4CVU A;  1NAE A;  4CUB A;  3FN9 A;  4MOA A;  2C9K A;  5F7U A;  2BGP A;  3WNM A;  4DXS A;  3CDZ B;  2WO1 A;  4OZO A;  3MV1 1;  4DXT A;  2ZXQ A;  4ZZ8 A;  3VD5 A;  1TVG A;  2J1V A;  1W9T A;  3WF3 A;  1JYW A;  2W9X A;  2ORZ A;  1WKY A;  2WAO A;  4MAD A;  1PX4 A;  2WZ8 A;  3K75 B;  2QBX A;  1EUU A;  2J7M A;  2VZT A;  3FL7 A;  4RYD A;  2Y6H A;  2VMD A;  5A1A A;  3I2H A;  3U37 A;  2QQO A;  2VTF A;  2QQI A;  1UMI A;  5DN2 A;  2KD7 A;  2ORX A;  2RV9 A;  2VCA A;  1GOG A;  4M4P A;  1JU4 A;  3CZJ A;  3WF2 A;  3WNL A;  1W8N A;  3J7H A;  2B4K A;  1TG7 A;  1UXX X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...