1PMRA

Lipoyl domain from the dihydrolipoyl succinyltransferase component of the 2-oxoglutarate dehydrogenase multienzyme complex of escherichia coli, nmr, 25 structures
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
80
structure length
80
Chain Sequence
SSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAVLEDEGTTVTSRQILGRLREGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the lipoyl domain from the dihydrolipoyl succinyltransferase component of the 2-oxoglutarate dehydrogenase multienzyme complex of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DIHYDROLIPOYL SUCCINYLTRANSFERASE
total genus 2
structure length 80
sequence length 80
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pmrA00
4LK1C 1Q90A 5K36G 2JXMB 3VR2A 1E2WA 1G291 2BE5D 3PV0A 2YYZA 3IFTA 3PUZA 4KKTA 2NN6H 3MXUA 3A7LA 3VA7A 5A35A 5KNDA 2CW0C 3DXJC 1GHJA 1YNNC 2D5DA 1Y69U 1Q1EA 3QIAA 4G7ZC 3FPPA 3SE0A 4DK0A 4RCNA 3M85A 1OXSC 1QJOA 1Z7TA 2DNCA 1I6VC 1V43A 4G7OC 1IYVA 1IW7C 2DNEA 3A8KE 1LACA 2BA1A 2DN8A 3A7AB 3BG3A 3IKJA 2R6GA 1FR3A 2BE5C 2E75C 5C0XH 3U9SA 2O5IC 2O5JC 1GHKA 2A6EC 3TZUA 1ONLA 2KA7A 3W3AA 4BA2I 2JE6I 5JEAH 1T5EA 2A69C 2NN6I 1E2VA 1OXUA 2BDOA 2A6HD 2K7VA 3L7ZC 3OPOA 4KKUA 1YNJC 2JEBI 4IQZA 3VR6A 2IT1A 1HQMC 5K36H 3CRLC 3BDOA 3I73A 2KCCA 1HCZA 3EQLC 1K8OA 1Z6HA 5KNCA 1CFMA 2E74C 2JEAI 1VCIA 1CI3M 1B9MA 2EVBA 4H44C 1H9MA 1VF5C 1Q12A 2EJFC 3GD7A 1LABA 3LWUA 3ND8A 1HPCA 1H9JA 1HTPA 4KHZA 3QJYA 4JBWA 4TKOB 4LJZC 1IW7D 2EJGC 2K32A 3VR5A 4KN7C 1VF7A 2L5TA 3GQBA 3M4YA 3OW7A 3T51B 3VR3A 1A6XA 2D2CC 1IYUA 3H94A 1B9NA 4OO1G 3I72A 1Q1BA 2AWOA 1GUNA 1OXTA 3FMCA 3PUVA 3PUYA 2ZT9C 3N6RA 4XIGS 4DK1A 2D62A 3A8IE 3SDZA 5BN3A 1V8QA 3A8JE 3KLRA 3OOCA 1O7LA 4KI0A 4IFDG 2A6HC 3PUWA 2PCFB 3T53B 1SMYC 3I4LA 3RLFA 3WDNA 3PUXA 1CTMA 2F1MA 1DD2A 4KKSA 1OXVA 4TQUS 4H0LC 4PV1C 1Y8NB 1VDZA 3HGBA 3P20A 4I7ZC 3VR4A 3D4RA 5KNBA 2A69D 4L8JA 5BN5A 1DCZA 2AUKA 4GZYC 1DXMA 4OO1H 3MFYA 1GUSA 1GUGA 1H9SA 2K33A 2QF7A 1K8MA 3NE5B 4G7HC 1GUOA 4IFDH 4DNTB 4HR7B 2V4DA 1GUTA 2EDGA 4DNRB 2E76C 3M7NA 1GJXA 4BA1I 2AUJD 1H9KA 3T56B 1EWHA 3QG1A 2Q8IB 4JK1C 1E2ZA 1TKWB 1TU2B 3LNNA 1PMRA 2LMCB 3ND9A 5JEAG 3CRKC 1O78A 2A68D 2A68C 1H9RA 1H9SB 5C0XG 1Y8PB 1Y8OB 4XTCS 2A6ED 2B8FA 4KMUC 5BN4A 3AB9A 4OGQC 4KN4C 1BDOA 1ZYRC 2B8GA 3D31A 2PNRC 2PPBC 1OXXK 1ZKOA 2NN6G 4H13C 2BA0A 1FYCA 2EJMA
chains in the Genus database with same CATH superfamily
3L0OA 2NTSA 1NJIC 2PI2E 2BE5D 3U4ZA 3PV0A 1XYIA 2F03A 5FOBB 5A35A 2HHHL 1N36Q 4A3FB 2MPMA 3S1NH 1KAAA 5KEEA 5C6AA 4CBVA 4HIDA 1EOTA 1YITA 2N8NA 3TP7A 5JJZA 1EL0A 1I6VC 4IUUA 3ONAB 1PYBA 4DR4Q 1UE7A 3T4AC 1PH5A 1K3RA 1SJED 4R4IA 4B3RL 2BE5C 4ILWA 1Y1WB 3Q8DA 5C4XB 5JEAH 3NQTA 3TREA 3ULLA 2XWBB 1D7QA 1JJ2A 2VW9A 3R2TA 1BCPD 2JA5G 5C4ZA 4KLKA 2MUYA 4HJ7A 2KCCA 1XTDA 1K8OA 4RGTA 1EIYB 2ZJQA 3S16B 4DUZQ 1EYGA 2SEBD 2EVBA 2KHIA 1J8IA 3GD7A 2I5MX 4WORA 4EQ5A 3JAMi 4HCEA 4KY6A 3T51B 3VR3A 3KJPA 4LF6L 5IYDH 4WJ3M 5FJ8H 3TQYA 3PUYA 3ULJA 3BU2A 4N8X1 5BN3A 1ENCA 4QIWB 4KI0A 4JV5L 4V0BA 3HOZG 5C3EB 3WDNA 2ID0A 5JJLA 1BOSA 4KKSA 3AMUA 1SMYD 1I3QB 4HJ9A 4XQJA 2K5WA 4K5WA 3B6YA 4DK6C 2N55A 3BVZA 5LL6X 3W5OA 1IBKQ 3F2UA 1I4HA 1VQ4A 1SEBD 4CKEA 1QE6A 1SR3A 3NEMA 3RN5A 4DAYA 2CW0D 4PQXA 4DV2Q 4KY7A 4QUFA 2HHHQ 1VQHA 4YY3Q 4J15A 2JA7H 2WIIB 4IUTA 3KLSA 5D3DA 2AQ1B 2F0FA 1EQTA 4B3MQ 1SNCA 2EYLA 5FLXE 1B44D 2K5HA 4DR3L 4OELB 2WB1E 4CDFC 4FXKC 4HJ5A 1GOZA 4QB4A 5E4WC 1SJHD 5CGKA 1GM5A 2EPBA 3KK7A 3KF8A 1N34Q 2KQ3A 4JI4L 1Y69U 1IBML 4R8NA 1IZ6A 5IYBG 1NR4A 1QJOA 3IAYA 4G7OC 1AEXA 3ZJYC 4DK3C 4GLVB 3W1BA 4LF7Q 5DNFA 3CCRA 3HOUH 3HZXA 4K0KQ 2MHVA 2RCFA 1EUJA 4A3LG 1MIUA 4ZQ3A 1IYJB 1X3FA 1UE1A 2MQHA 3VR6A 3T1HL 3WOFA 4GN4B 4DV4Q 1LTAD 3ICEA 4UP9A 1DOLA 2NVQB 3TBIB 1HZAA 1AH9A 1CKMA 4GKJQ 1EU3A 1EY5A 4DPGA 2GVAA 4ME3A 5GADC 2N88A 2DGYA 1JICA 1ML0D 1KNEA 4B3SQ 1RODA 3A5ZB 3S9WA 3OOCA 1N32Q 1QCBD 3M4OH 4MTKA 2BH8A 1VQ9A 3HKZE 1OXVA 2ASBA 4R4TA 3T16A 3D8GA 3J80L 1A62A 2JSOA 5KNBA 1KXLA 3GTQH 4JI5L 4JBKA 1XTCD 1DCZA 1NMFA 4GZYC 4JVZA 4WJ4A 4G7HC 1JORA 1L1OA 2JA8H 3MXGA 3GTMB 4EQPA 5C4JB 3RD4A 4YWMA 1ICWA 1LTGD 3DWAA 5EQ0A 1PH8A 2Q2TA 2F0IA 4U68A 1E2ZA 4HMIA 3EA6A 2MFIA 2LS01 4KMUC 2F0OA 5IE8A 2TMPA 4X3TA 4C3HB 2K01A 3D31A 4IJHA 1K8AC 3TP8A 3CCQA 1KRSA 4YWLA 3OMCA 1ZKOA 2WKCA 2X6LA 3K81C 1NAPA 2B2WC 2NVXB 1FNVA 2M00A 4KHVA 5GROA 2UUBQ 3SVMA 3J81E 1XPOA 3K0XA 2J7ZA 1O80A 4EQNA 3R2IA 3O13A 4CKBA 4DR2L 3M3YB 4RFBA 2WFWA 4FDBA 1W6KA 1OTCA 1B70B 1KC8C 4A3CG 5M5WB 2WV6D 2ZJPA 3GTKH 3OHXC 2Z6KA 2K50A 3S1QH 4JI6Q 1HZ9A 1GHKA 2TSSA 1CQVA 2JE6I 2BDOA 2QEJC 1PH2A 5GAHC 5CORA 3D4WA 2NUCA 2IT1A 1SYDA 1K8GA 3KF6B 5IT9L 5IY0A 2PYKA 5I9OA 4A3IB 4K5VA 2A5HA 1PFNA 1EY6A 1TIID 2AQ3B 3PO2H 2L12A 3NP8A 1H9JA 3AFQA 1QZHA 2HQLA 4LJZC 4A3DB 1NMGA 1Q8KA 3OW7A 1LTBD 4LF4L 1IYUA 2UXDL 5LMNW 1PVOA 1Q1BA 4DXGA 1PRTC 3ZYYX 1K83H 1PTOF 1F9PA 2F0HA 3GP7A 1HRJA 2B2UC 2XGTA 2PCFB 3G48A 5EKLA 1VQFA 1SE3A 1SE8A 2F1MA 2YTYA 5KYLA 4MIUA 1WTRA 1CM9A 5JVG3 3M9BA 2N78A 2A8VA 4A93G 3HG9A 5D65A 1PRTD 1I94L 4NXMQ 1HFNA 5BN5A 3QOJA 3L2PA 3HOVH 3FHWA 2K05A 4IUQA 4K8IA 1TWFH 3BYTB 3C1FA 5I9PA 2EIFA 2E76C 5ELNA 4BY7H 3S17B 1SYBA 1BKBA 2NYZD 1AP0A 1VQ7A 5C5LA 2R92H 1ILPA 3UE0A 5C0XG 2DY7A 1NBWA 3R8BA 2QDLA 2UU9Q 1MHWC 1Y1VG 3D6CA 4OWTB 2MO1A 2PNRC 3SEBA 1SYEA 2VS1A 1EY0A 2EJMA 3NTHA 1B53A 1Q90A 4KHPQ 1JQYD 3S1NB 2WAQB 2ZTDA 3IFTA 2YTXA 3A7LA 1MI2A 2CW0C 1TT2A 2H5XA 3BJUA 4RG1A 4IURA 3UDGA 3CMAA 4BBRG 3SK5A 2FXQA 3HOUG 2EYJA 2VXWA 3HOXB 4OONA 2L0CA 1QZGA 3E3XA 3VYRA 2QCPX 2XRSD 3HEJA 2O5IC 2ICIA 1WTWA 2R93H 4P71A 2YTVA 3JAME 4FXGC 2KCNA 2NBFA 2L11A 1L1OC 2HDLA 4PZ7A 4AH6A 4X65L 1KAWA 5H1SE 4L5QA 4DAMA 1WYDA 3GO5A 1HXYD 1KHIA 3ERQA 3J81c 3V05A 3MVVA 4ZUJA 2UUAQ 1NSNS 4A3IH 1D5MC 3J7AF 3KBXA 3GTLB 3NPPA 3I7FA 1A6XA 1JOKA 5KYIA 4DR7L 3PUVA 4A3DH 4A3KB 5C3EH 4FF4A 3RZOB 1A63A 2EY6A 4OIJA 4RCOA 1PZID 3PMFA 1U4PA 3U50C 4FXDA 1CQFA 3PIOA 1STBA 4A3FH 2F0TA 2K5VA 4TQUS 3G4SA 1VQPA 1UE5A 1BNZA 1EIHA 3ITPA 1D2BA 1PLFA 1QWYA 3RUZA 5CR3A 3JAML 4KK7A 2M2LA 1TVXA 3CCJA 2HQEA 1BF4A 4JOIC 1C7YA 1LT5D 2NVTB 1K3BC 3S15H 4C3IG 4OWWB 1RTNA 1GUWA 1Y8PB 1G2SA 4BBSG 1X55A 4CJ1B 4DGZA 2RCNA 4DV6L 2RDGA 1BCPF 2F3IA 1BQQT 2CWPA 2BA0A 1UWVA 3KBGA 3J80c 3RZOH 1X9NA 1P16A 2OT2A 2O4XA 4LK1C 3FP9A 1JE5A 4KKTA 3M7GA 1QB5D 4BBSB 1K0SA 1J5EL 4JI5Q 2JP1A 3I4MH 4LF8L 1UNSA 1U4LA 2F0NA 4DNIA 3I90A 2FINB 3BZCA 2XWJB 4DK0A 1FD7D 4QJFA 3KUPA 4KY5A 4LFAQ 1PTOC 5KGUA 3I91A 2G9DA 2MJ8A 1TWGB 3HKSA 4S3SA 2UUAL 1M90C 2BA1A 1MSGA 4BBRB 1S5FD 1AE2A 2KEDA 4DUYL 3KF6A 5C4HA 2V1CC 3STBD 3C2PA 5IYCH 1HZBA 4XT3B 4O1NA 4NB3A 1LT6D 1YNJC 1C0AA 3OWEB 4JI3L 3GV3A 1HQMC 4QCLA 3UI2A 1B1ZA 2F0JA 2RSNA 4F8MA 1CFMA 3P1HA 5IGBA 2OXPA 4KD3A 4ODGA 4H44C 2A19A 5J39A 5I2XA 3DM1A 4TKOB 1IW7D 2N49A 4JI0L 4C3IH 4R4QA 4UAIA 1WTVA 4FF2A 2XTIA 2WB1B 1JOOA 5C0XJ 2K4KA 5CV4A 4A3BH 1O7LA 5LMUL 2Y0SB 3T53B 4K6LA 3TS2A 3D0FA 4UY8C 4LF5Q 4ALPA 4A3EG 4L63B 2CH4W 2VUMB 2L9HA 1VQKA 3HOWG 4DR5L 1KDAA 1F2ZA 4PV1C 4LNQA 2L1BA 3S2HH 3RLNA 3EJIA 1PH3A 2CVRA 3CC2A 2O2LD 4XT1B 4PNYA 1SNQA 4HR7B 3M7NA 1GJXA 5E4XA 4KJOA 5IYDG 3EN2A 3VYTA 3K7AH 1B2TA 1TU2B 3LNNA 1Q7YC 1LTTD 2F52A 4C3IB 3K6OA 1DM0B 1RJTA 3AB9A 4LF9Q 2ZXRA 2NVQH 4A3LH 1TS2A 2NN6G 1MKHA 1ET9A 4QIWE 2KCTA 3NSWA 5T1GA 1N8RC 2ZJRA 2F0QA 2HDMA 4B3RQ 5IP9G 3DM3A 3IFDA 4K0KL 1EU4A 4JC0A 3K5NA 3PIPA 5HGTA 1IYVA 3JC66 4AYBG 5IIFA 2WACA 3DLLA 2OTLA 5CBEE 4J1MA 4PMCA 2I0QA 1STGA 1XMOL 4I65A 5M5XH 5C0XH 1YJNA 5M5YB 4JCVE 4BBRH 1ONLA 1AW7A 3TP6A 1HR0Q 3GV6A 1AFPA 2MGSA 4NXNL 5JPMC 1PH6A 4OX9Q 4YIJA 1EY9A 2BOSA 1A2UA 1HA5A 2NZHA 5IGCA 2FMMA 4R4OA 4X62L 1PXUA 1YI2A 3L3OC 1Q12A 4LF8Q 1Q46A 3CD6A 3S16H 1V1QA 1EEID 4A3JH 4A3MH 2M9VA 4GN5A 1VMPA 4WJWA 4ZAIA 3VR5A 5DM63 1XJVA 4OX9L 3BVMA 3PO3H 2RHSB 2F0PA 3CKIB 2D0OA 3CF5A 1D5XC 1TS3A 2UXCQ 3I4NB 2XSCA 4JBJA 1KDBA 3A56A 4QQBX 2NVXH 1SBBB 1EFWA 1CZWA 5M9OA 1SNPA 5ISRA 3RLFA 1EY8A 1S5ED 4YHHQ 3L9AX 3HOUB 3C46A 1MSHA 3NQIA 5JOBA 5KRUA 4A3BG 3T1HQ 1TWCH 2Q8TA 4U673 1WCMG 3MFYA 3CCMA 1W3SA 2WB1G 3EROA 3BDCA 1PYSB 2IX1A 4FVMA 2ZXOA 4ZKBB 2R92B 1XNRQ 4JI2L 2JJQA 2Q8IB 4A3GH 1AE3A 1PMRA 4F88A 3V2TA 3SK6A 2NZ1D 2CQOA 4A3MB 4JI7L 1EWIA 2HD3A 4B9WA 1IL8A 2OWOA 3BZKA 1SYGA 1F9QA 3FDTA 2IW3A 5GQOA 1HFGA 1HR0L 4DV7L 1CA5A 5LMUQ 2H1EA 2L15A 4BXXH 1N9WA 1XMOQ 5FLXc 5M3FH 4NXNQ 1MJCA 3RNUA 4BY1B 4OXPA 2K75A 1GHJA 4L5TA 1YNNC 2OCEA 1CHQD 1I4PA 1KL9A 2K5DA 3SE0A 2RBMA 3H15A 4IFDJ 4ME5A 4CDCC 1Z7TA 1M1KC 2F4VL 3S14H 1IW7C 4R1JA 5CV9A 3H0GG 1EOVA 4IZ8A 1II3A 1TY2A 2F3VA 2JQOA 4JI1Q 1TWAH 2A6EC 4BA2I 1E1TA 2FMCA 4LUOA 1G51A 1Y1VH 2ICEC 4RH6A 3C3LA 4K6DA 3CRLC 3S24A 4ZYSA 1B50A 1SNDA 5C0XI 2XNAC 4N9PA 2NB0A 4GNXC 1Z6HA 1OO9B 3G6EA 4JI8L 2K5QA 2B2VC 3ND8A 3LWUA 1LUZA 1A0IA 2JK8A 3QJYA 1I50H 2UUCQ 2BCOA 2IX0A 3X3NA 2LFNA 3LX0A 1KRTA 4BY1H 1B9NA 3I72A 2K1BA 2Z9HA 5EJWA 4G57A 4LF6Q 5IP7H 2D62A 1HR0W 3E0JA 2KCMA 4ZLTF 3Q6SA 1SE2A 2L4NA 4B3SL 1E24A 1QILA 5EGTA 4OL7A 3D6WA 2OEOA 4XDXA 1WTQA 1S5CD 1T5XD 3FKIB 3F2BA 3M4OB 4DN4M 4IUPA 4H0LC 1VMCA 1HNWQ 4BWGB 1CZGA 4DAPA 3VR4A 5C3EG 1EZ6A 3AFPA 4L8JA 2XRQD 3WOEA 1YZ6A 3I4NG 5KIXA 2RVLA 4RKLA 1VQCA 1X3EA 4G4KA 3H3VI 2A68D 1D5ZC 4LFBQ 4GKJL 1I50B 1HNWL 4R9WA 1ZYRD 4IUNA 5CC4A 3MFGA 5IGFA 1BXTA 5JAVA 3C1EA 5TSSA 3KDFA 1SFOB 3KF8B 4JOIA 4H13C 1ENFA 1FYCA 2B2TC 3GDEA 4C3HH 3WWVA 3GTLH 1E1OA 4HAEA 5JJKA 3TP5A 4M8AA 5CYUA 4EX5A 1EZ8A 4DKAC 3ERSX 3S2DH 2RSOA 5FO9B 3PIP3 1LO5D 3MEHA 4LFCQ 3HP3A 5ELOA 2IX3A 5C44B 1I4QA 5EPKA 4P72A 3GTOH 5IGGA 2Q2IA 3IKJA 2PZUA 4NP5A 1VQIA 1CK1A 4GOPB 1FR3A 1QUQA 4DF7A 3UDFA 2B29A 3I70A 1I6HB 3S1QB 1K0RA 4UPAA 2K7VA 3H3VC 1IHZA 2CHBD 2RF4A 1WD1A 3F2CA 3KFUA 3FEWX 4J8QA 1JMCA 3JAMc 2EOTA 4HJAA 4DV5Q 1P8LA 1VCIA 1CI3M 1WOCA 5EPLA 3Q22A 4WRDA 4KHZA 4QF4A 2JA8G 1FJGL 4KHPL 3GQBA 2QA4A 1BBXC 2ES2A 2D2CC 4QY7A 4A3FG 2ZM6Q 2DY8A 3MXPA 1TQOA 4RHSA 3HOYB 2ZT9C 3N6RA 4RGNA 3H6MA 3A8JE 5FO8B 3S1RH 1I3QH 2A6HC 1JE4A 1SMYC 2QW7A 1IBKL 1QOHA 1RD9D 4OO1I 3A74A 4DAYB 2EYMA 2G9HD 4CJ2C 1CA6A 2R93B 2QILA 1ICFB 3OTOL 2VB2X 4I7ZC 1G2TA 2A69D 1I5FA 3NWSA 4IPCA 1S40A 3A0JA 4NXML 3K7AB 1BBWA 1W6JA 2AUJD 1EY4A 1J5EQ 2GN5A 2C9OA 1VQEA 4CHTB 1JWSD 2OQ0A 1J6QA 3CRKC 1TXYA 1G91A 2A6ED 1F9RA 5BN4A 3K59A 3DEOA 1YBYA 1RIPA 2B8GA 1XXGA 2AHOB 4XYOA 5AFWA 3OMGA 3T13A 3BDLA 3CCSA 1WCMB 4KV6A 5KNDA 4I7AA 2R7FA 2HIVA 5IGEA 5A2QE 5EKKA 3J80E 1M8AA 1OXSC 4GNXB 2F0VA 3HRZC 4PZ8A 3CMEA 1PDQA 2PQAA 1J9OA 4JG2A 3CPFA 1LTSD 1A3VA 4MNOA 2O5JC 3OIQA 2G5DA 2K28A 1CKNA 2X69A 1AZQA 2Z6KC 1C9OA 1E2VA 1VQJA 5FO7B 3NENA 3Q23A 3QB3A 4IO9A 4IN3A 2OQKA 5D3IB 4JYAQ 1STAA 4OWXB 1LT3D 2VQEQ 4ZUIA 3RR5A 2JEAI 4A3EH 1LTLA 4Q0FA 2PQAB 1LYLA 2YU9H 4MTNA 4DXFA 3OW2A 2J0TD 4GNXA 2RDHA 3EBEA 3U4VA 4LUVA 4QMGA 2L5TA 3J81L 2IPKD 4HEDA 1BVSA 4X3KA 1HH2P 4NKLA 2EXDA 3CAMA 5LMNQ 1KNAA 3HOYH 4A3DG 1QG7A 1CTMA 1DD2A 1K9MC 4GKKL 5NUCA 3DMUA 2IY5B 1N33L 2FHTA 4LAAA 1TWCB 1RF2D 2VQFQ 1EYCA 4A3IG 5C4XH 4O42A 1DOKA 1VDZA 3HGBA 5C3XA 5AJ3Q 3D4RA 2LSSA 2X6GA 2ATWA 1X6OA 2R3ZA 4H02A 3X3MA 4DNTB 2A1AA 1L2FA 5BR8L 3ER0A 3DEPA 4LF4Q 2UXDQ 4TRDA 4FF1A 1GO3E 1EIGA 3OYYA 3BZDB 3QWNA 4IOCA 1GKHA 1Y8OB 4XTCS 3S15B 2Y0SE 4EQOA 1AN8A 5I4DA 3S1MB 3M4PA 1MJEA 2RQXA 3PCOB 3MWYW 1R9TH 1A3UA 4A3JB 2JXMB 3VR2A 4CDDC 3PQIA 1SNMA 4DUYQ 4WFN3 1HQRD 4X6AH 2XN9C 2VZAA 4BBSH 1EY7A 2VQEL 1DYQA 4UP8A 3P75A 3S2HB 1JR0D 3E5SA 3PGZA 3A7AB 3Q0AA 5COYA 3TRZA 5J22A 4ZK9B 5G3LF 5JJIA 1BO0A 2LKVA 1Y1VB 3G7LA 2PO4A 2A6HD 2F0EA 4B3TL 2JA7B 4C3JB 4JI0Q 1YHAA 2JN4A 3KLWA 1Q3LA 1FL0A 5CV8A 1HUMA 1TY0A 2E74C 3QR8A 2UXBL 2JA7G 1ENAA 1KIXA 1H9MA 2EJFC 3OIPA 4ZCKA 1VQ6A 3F1ZA 4GS3A 1I4GA 2EJGC 1KQSA 2NVYH 1VF7A 1N33Q 4XYQA 1D1KA 1B8AA 1WI5A 2LXKA 2EY2A 4PG3A 1L0YB 1Q86C 3NELA 1FNWA 3QO2A 2K14A 3MHBA 1V8QA 1A15A 3NBHB 4C1NK 3T1YQ 4A75A 3PUXA 1CSQA 4KTAA 4YCWA 4BS9A 3J7ZC 1O7YA 1HNXQ 2D9UA 5C44G 1XNQQ 2MNAA 2ENBA 5M5YH 5ELBA 5EKIA 2F3WA 1JWMD 4XQQA 3HOVB 1Y8NB 5E1FA 1JB7A 5J3BA 1JCKB 1NE3A 1Q8IA 3MTSA 1DXMA 2CCZA 1GUGA 2WP8J 1KABA 4POFA 2R7ZH 3S17H 1JJGA 2RA4A 4IFDH 2R93G 4DNRB 2SOBA 3A5UA 3CCEA 1H9KA 2DUDA 3QG1A 3E6ZX 3MEFA 3ND9A 3SXHA 4NMZA 1A2TA 4HSVA 1X56A 4APVA 4UDUC 2EXZA 4DR1Q 5F2DA 2B8FA 2NVYB 1SFOH 1XPRA 3E9HA 1PRTF 3A55A 4OEMB 3F8TA 3CXCA 2KJXA 4M1UB 3VYSA 2F4VQ 1HUNA 1UAPA 2Z4IA 2RDFA 1QNKA 1ET6A 1G291 5M3MG 1WD0A 2B2TA 2YYZA 3MA2B 4B3TQ 4RGMA 5IP9H 2IJ0A 3DXJC 3J80i 4HIMA 1RTOA 2VQFL 5EPJA 1L0XB 1VQAA 1YIJA 3NTKA 2VY3A 3A8KE 2KECA 1EFID 4X62Q 4A3GG 1E22A 4QL5A 3VYUA 3CCVA 2F0MA 2A73B 4BY7G 3FKIH 3GTMH 1E3PA 2ZXPA 3H09A 1PHJA 2CQAA 3STBC 5A2QL 4GN3B 1LLRD 1T5EA 4UHVA 5M5XB 3L7ZC 1XMQQ 2E2JH 4YY3L 2E5LQ 1BBUA 3R3OA 4K14A 1XNRL 3AEVA 4A76A 2JEBI 4A3GB 3TEHB 1I94Q 5K36H 2PI2A 3HS0C 4NDXA 4LUZA 4PMBA 2K03A 2CFMA 4AYBB 1VF5C 1LTID 1U4MA 5AJ3L 2E2HH 5ELFA 3U9OA 1STYA 4GOPA 4JBWA 3TSSA 2K32A 3HOZB 1SMXA 1Q82C 4FF3A 3I4OA 2C35B 2YV5A 1SROA 3I3CA 1Z9FA 1YJ9A 2QGQA 2Q8RE 1GUNA 1OXTA 2P5ZX 1X65A 4A93H 5I2YA 4IFDG 1PFMA 3I4NH 1EYAA 2VNUD 4FO2A 4JW0A 4R4CA 4C3JG 3CQZB 1B3AA 4HJ8A 3HOXG 1TS5A 1X32A 4Y7NB 1YVCA 4JI1L 4Y52H 2KBNA 4Q5VA 2E2JB 4DR4L 4RKBA 1EIFA 1EQRA 1JWUD 3NE5B 5IOCA 4HIOA 3CC7A 3R93A 1JT8A 2V4DA 3GTPH 1HNZL 4ZRZA 4QGUA 3PO2G 4BA1I 2R7ZB 3T56B 1ILQA 3H0GH 5FLXL 5JEAG 2I5HA 2E2HB 4DFAA 1C48A 2IWHA 1ASYA 1WTXA 4HSPA 1U5KA 2WINB 4OGQC 2A74C 4POGA 1HTLD 4IOAA 2Z8LA 4AYBE 5M3FG 1NNXA 1H95A 4A93B 4K8JA 3CHBD 5E7NA 1CHPD 1DJRD 4GLXA 1ESFA 3MXUA 3I4MG 4K2KA 1FNUA 5HY6A 2EYHA 5IGDA 2DJFC 3FPPA 1HJPA 4HMJA 4Y7NH 4RCNA 3SHLA 1LTRD 3S1RB 1V43A 5GAEC 4GLAC 1STEA 3M3YH 5E3FA 3KLSX 1L1OB 1LACA 3UDXA 4C2MH 1KTKA 3S14B 3NTIA 1FGUA 4DV3L 4B08A 3TZUA 4IPHA 1YNXA 4C56C 3K5OA 2EQSA 2ZM6L 2JA6H 3OPOA 1GXDC 2PW7A 4DR1L 1EQVA 2AMCB 4J6HA 4KD4A 1HCZA 3HOWH 5KNCA 4RHRA 4QUCA 3EVQA 1LT4D 2R61A 2UU9L 4RGOS 1EWCA 2BDNA 2AKWB 1GVPA 1HPCA 1FGBD 2PZWA 2VB3X 4KN7C 5EAYA 3GTJB 1I4RA 5C3WA 1TWHH 1BCPB 3HOZH 1HNZQ 3S2DB 4DK1A 2PMZE 4A3JG 2B63H 1IXRA 2IHEA 1BUVT 1BR9A 3AU7A 3HOXH 3LGJA 4PZ6A 2B2VA 3PF5A 1V1PA 1XX8A 5DEHA 1QUQB 3KJOA 3I2ZA 3LWEA 2UXBQ 3G71A 4DV5L 5IYCG 4RWSC 1B4OA 1KLUD 1Y1WH 4DR6L 1Y14B 4AQYL 3K7UC 2QDBA 4LF9L 5LL6S 3PO3G 4DV4L 1DGSA 1PTOH 1MD2D 3SGIA 3RZDB 3Q24A 3CCLA 4JI3Q 1V9PA 3GTJH 2Z0SA 2Z1CA 2YU9B 1VQ8A 4OHJA 3CC4A 3K58A 4HN7A 2EYPA 3K8AA 3PUZA 3EFXD 2NN6H 4RMFA 2MP1A 2OF1A 4DU9A 4FYDA 3MC0B 1AZPA 2QKIC 1JOQA 1CUKA 4DR3Q 3E9IA 1K28A 2PMZB 3MZ5A 2DJGC 3BG3A 4V190 1CKOA 2F0GA 4RAUC 2FJ2A 2VUMH 3TZDA 3UDIA 5M3MH 4LFBL 3W3AA 1G6PA 2NN6I 2NZOA 3RLOA 3U58A 1UE6A 1YHQA 1I6HH 1VQBA 4DV1L 4IQZA 3FPUB 2CKZB 1Y1WG 2K6AA 2LXJA 3RZDH 3EQLC 1STNA 4X3SA 3HOVG 1HA6A 1ESRA 1PH9A 1RL2A 2MO0A 5FLMG 4GKKQ 4IPGA 5ELDA 2ALYB 3K80C 3PSIA 4X65Q 4JI8Q 4DV1Q 1QVGA 1KLGD 1SN8A 3DHQA 4OO1G 1SDFA 1F9SA 1QNUA 1UEBA 4L6TB 2B63G 4DV0Q 5JVH3 2EE1A 3AYHB 5D14A 4DR6Q 3BYYB 3KLRA 1WJJA 5JEAJ 2HUGA 1ZXTA 2RKSA 1TWGH 2NTTA 4DR7Q 2JYOA 5J1ZA 2B63B 3H91A 3IRBA 4ID6A 4P75A 3NBIA 3SK8A 1NR2A 2K04A 2JA8B 2F0KA 4HTHA 3KDFB 4EVOA 1VQNA 2K33A 1H9SA 5ELEA 1K8MA 3HOYG 2EY1A 3NXWA 1GUTA 3W1GA 4AIMA 4E6IA 1LV9A 1NTGA 3TS0A 1EWHA 2N3SA 1PZJD 1JC7A 2B2YA 3V96A 2A68C 2IL8A 1WFQA 2Z4HA 1U9RA 1NUCA 2XVSA 5DM73 1BDOA 1PTOB 2OTJA 1OXXK 3OSOA 3HKZG 2GVBA 5IODA 4R8IA 5GAGC 4A3BB 1E2WA 1PZKD 5IWAQ 1NCVA 1VQ5A 5CV6A 4OIKA 3OWFA 4G7ZC 5M5WH 4DA2A 4F87A 4K2LA 3M85A 2DNCA 3J81i 2SNMA 2R92G 1ZEQX 1TWAB 2DN8A 3URYA 3FRPB 2R6GA 5IWAL 1L0WA 4ULLA 1XMQL 1K73C 1HHVA 3I8ZA 2F4IA 2H4OA 3AQQA 3NHHA 5EBDA 5T1IA 2HCIA 2F0DA 1N34L 4JI4Q 3GTQB 3K5LA 4JV5Q 1PH1A 1PFBA 4EGVA 3I73A 5ELCA 2B2UA 2PZTA 4F7XA 3S1MH 2UUCL 2B2WA 4X64Q 1A8VA 4JI7Q 1FVIA 1HTPA 4X66L 1IBLQ 3IL8A 4LFCL 1XPUA 3N52A 1D1IA 2I5LX 3CW2C 2E8GA 3DUZA 3H94A 5FKAC 1EEFD 1QVCA 3DWPA 1V1OA 3MAQA 3FVQA 3BS1A 1STHA 2C5CA 3A8IE 3SDZA 5C4XG 1F2YA 2B39A 1W2BA 1I4XA 1D6EC 1TR5A 1S4ZA 3PUWA 3VDYA 2Q2UA 1S5BD 2KEEA 3KYHC 3H3VH 4Z9CB 3OTOQ 2EZVA 4A4IA 2E2DC 1F2LA 2F0UA 2NWGA 3PF4A 1RHPA 3P20A 4JBMA 4MZ9A 1N36L 2F0WA 4C3JH 4P73A 4OO1H 1GUSA 1GUOA 1XWEA 2WAQG 4TVAB 2KHJA 1PH4A 3PIO3 4CDEC 3J7A5 4YWKA 1DZ1A 4XXEA 1RDPD 5FLMH 5DAUA 4KJNA 1VQGA 1C8CA 1H9RA 1IKMA 1SRUA 3FKIG 5IT9c 3I55A 2FFKB 4L5SA 3P7JA 4K5XA 1F77A 2AQ2B 4KN4C 1KDCA 1DONA 2EYFA 2KENA 5EBCA 5FK9C 3CU7A 1ASZA 2IHFA 1UUPA 5IYBH 2VL6A 4HCSA 5K36G 4P2CB 2L55A 1VQLA 1G8ZD 4UP7A 3VA7A 3HKZB 1RKNA 2HCCA 1WTOA 2I07B 4NW2A 1PTOD 2WKDA 5DLQE 3I56A 3RMHA 1G6ZA 2DNEA 3HFZB 3CQZH 5CMDA 3K0YA 4GOPC 1UEAB 1X3GA 2E75C 1SLJA 3SK4A 5BR8Q 4DR2Q 2KOLA 2KA7A 3E0EA 4DV0L 1O7IA 4CGYB 1C4QA 4CJ0B 1MBYA 4YCUA 1WTHA 1PV4A 1YNJD 4LF7L 2HT1A 3K57A 4P74A 3MXNA 4BXXG 5C5MA 3BDOA 1M4VA 3TN2A 1PRTB 4H7BA 2ZTCA 3ULPA 2F0LA 1HNXL 1FJGQ 5I6YA 3D4DA 1LABA 3T1YL 4XQNA 1SXTA 4N9TA 1GD7A 2KHSA 2Y0SG 4N8FA 3G6JB 4A3KH 1XNQL 5M3FB 1SYFA 2R7DA 1A3TA 2AWOA 1YNND 3FMCA 4DV6Q 3PO3B 4MHEA 2I46A 3EIVA 4A3MG 4B3ML 3I4LA 1DOMA 3GTKB 3MXNB 1R4QB 1NY4A 2ZTEA 4DUZL 1PH7A 5HGQA 4LFAL 1VS0A 3NWTA 4IFDI 3NK9A 2K52A 2PW5A 2WAQE 5C44H 1E7ZA 4YCVA 2QEXA 3GTOB 4C2MB 2AUKA 5CBAE 2EY5A 1WTPA 2CH4A 2PQEA 2UUBL 2GA4B 4A3KG 1B3QA 1JJCB 4C1NI 2EDGA 5IP7G 1R4PB 1SNOA 4IUVA 5K5PA 3NBHA 1S3OA 2JA6B 4O0AA 1TKWB 5C4JH 2PNHA 4HIKA 1YJWA 1T9HA 1H9SB 4NPSA 1E0BA 2F0SA 4O2DA 2JA6G 5JPNC 2UXCL 2PPBC 2LY7A 4RA8A 2CWAA 3J7AV 1X3PA 4ZKCB 5I6WA 2D0PA 4PMWA 4DV7Q 1QVFA 3BVGA 5HURA 4JPBW 4AQYQ 2D5DA 1Q1EA 3QIAA 1TWHB 1RCVD 4LWCA 3TMEA 3VA5A 1CT1D 1CSPA 4IJLA 1U0LA 4LW1A 5LHY1 4X64L 5M3MB 1PFSA 1PYWD 1SAPA 4LMQD 4A3CH 1TS4A 1U4RA 3U9SA 3RN2A 4DAVA 4JYAL 5IT9E 3F2DA 4C3HG 4BY7B 2HIXA 2A69C 1SYCA 3J7YW 1OXUA 1KD1C 1B7YB 2JA5B 2E2IB 3GTGB 4KKUA 1N32L 4B9XA 3A54A 3M4QA 3CCUA 2SNSA 1JB3A 1B9MA 1IL2A 2NVTH 1SE4A 4MN3A 4FP5D 2EYOA 4CKCA 1WVLA 1HZCA 3K5MA 2BH2A 1YHBA 3SR1A 5LMNL 3M4YA 1Q81C 2R7ZG 1F2MA 4JI2Q 3PO2B 1MGSA 5FJ8G 3DWQA 4XIGS 2KUMA 1BCPC 2JA9A 3D3RA 1EYDA 5CV5A 3KOJA 3TDQA 1S72A 2XIWA 4YHHL 1WCMH 2K5NA 1K83B 2SDFA 4TSSA 3J81j 3CP0A 3I4MB 2Z6BA 3NUCA 4IPDA 4L5RC 4ABNA 1PA6A 4FNFA 1O7ZA 4DV3Q 2AWNA 1IBMQ 1VQOA 1IKLA 2JA5H 2E2IH 3CPWA 5CV7A 3GTGH 2E5LL 4BY1G 2QF7A 4X3UA 5L37A 2Q2HA 1D8LA 1LM0A 2KVMA 4X66Q 1CKNB 1VQDA 1IBLL 3HOWB 1X3QA 3W2DA 1YEZA 1VQMA 1TWFB 1Z47A 4JK1C 3GTPB 2LMCB 4LF5L 5G3LD 2B3GA 1O78A 3H0GB 4IALA 3UE1A 2J4XA 3QOLA 2VUMG 4DR5Q 1SSOA 2B2YC 4JI6L 2RHQB 1R9TB 4A3EB 1ZYRC 1X54A 4DV2L 1EQQA 1V1PB 1S5DD
chains in the Genus database with same CATH topology
2NTSA 2BE5D 3PV0A 1XYIA 2F03A 5FOBB 5A35A 4A3FB 2MPMA 1KAAA 5KEEA 5C6AA 4CBVA 1EOTA 3TP7A 5JJZA 1EL0A 1I6VC 4IUUA 3ONAB 3T4AC 1SJED 2BE5C 4ILWA 1Y1WB 5C4XB 5JEAH 3NQTA 2XWBB 3R2TA 1BCPD 5C4ZA 2MUYA 2KCCA 1K8OA 4RGTA 3S16B 2SEBD 2EVBA 1J8IA 3GD7A 4WORA 4HCEA 4KY6A 3T51B 3VR3A 3PUYA 5BN3A 1ENCA 4QIWB 4KI0A 4V0BA 5C3EB 3WDNA 2ID0A 3AMUA 1BOSA 4KKSA 1SMYD 1I3QB 4XQJA 2K5WA 4K5WA 2N55A 3BVZA 5LL6X 3F2UA 1I4HA 1SEBD 4CKEA 1QE6A 4DAYA 2CW0D 4PQXA 4KY7A 4QUFA 2WIIB 4IUTA 3KLSA 5D3DA 2AQ1B 2F0FA 1EQTA 1SNCA 2EYLA 5FLXE 1B44D 4FXKC 1GOZA 4QB4A 5E4WC 1SJHD 5CGKA 2EPBA 3KK7A 3KF8A 2KQ3A 1Y69U 4R8NA 1NR4A 1QJOA 3IAYA 4G7OC 1AEXA 5DNFA 3HZXA 2MHVA 4ZQ3A 3VR6A 3WOFA 1LTAD 1DOLA 2NVQB 3TBIB 1EU3A 1EY5A 2N88A 1JICA 1ML0D 1KNEA 1RODA 3S9WA 3OOCA 1QCBD 1OXVA 3T16A 3D8GA 3J80L 2JSOA 5KNBA 1XTCD 1DCZA 4GZYC 4G7HC 1JORA 3MXGA 3GTMB 4EQPA 5C4JB 3RD4A 1ICWA 1LTGD 3DWAA 5EQ0A 2F0IA 4U68A 1E2ZA 4HMIA 3EA6A 2LS01 4KMUC 2F0OA 2TMPA 4X3TA 4C3HB 2K01A 3D31A 3TP8A 3OMCA 1ZKOA 2WKCA 2X6LA 1NAPA 2B2WC 2NVXB 1FNVA 2M00A 4KHVA 3SVMA 3J81E 2J7ZA 1O80A 4EQNA 3R2IA 3O13A 4CKBA 3M3YB 4RFBA 1W6KA 5M5WB 2WV6D 3OHXC 1GHKA 2TSSA 1CQVA 2JE6I 2BDOA 2QEJC 5CORA 3D4WA 2NUCA 2IT1A 1SYDA 5IT9L 2PYKA 5I9OA 4A3IB 4K5VA 2A5HA 1PFNA 1EY6A 1TIID 2AQ3B 2L12A 3NP8A 1H9JA 4LJZC 4A3DB 3OW7A 1LTBD 1IYUA 4DXGA 1Q1BA 1PRTC 3ZYYX 1PTOF 1F9PA 2F0HA 3GP7A 1HRJA 2B2UC 2PCFB 5EKLA 1SE3A 2F1MA 5KYLA 4MIUA 1WTRA 1CM9A 5JVG3 3HG9A 5D65A 1PRTD 1HFNA 5BN5A 3QOJA 2K05A 4IUQA 4K8IA 3BYTB 3C1FA 5I9PA 2E76C 3S17B 1SYBA 2NYZD 1AP0A 5C5LA 1ILPA 5C0XG 2DY7A 3R8BA 3D6CA 2PNRC 3SEBA 1SYEA 1EY0A 2EJMA 3NTHA 1B53A 1Q90A 1JQYD 3S1NB 2WAQB 3IFTA 3A7LA 1MI2A 2CW0C 1TT2A 4IURA 3SK5A 2EYJA 2VXWA 3HOXB 2L0CA 3VYRA 2QCPX 2XRSD 3HEJA 2O5IC 2ICIA 1WTWA 3JAME 4FXGC 2KCNA 2NBFA 2L11A 2HDLA 3GO5A 1HXYD 3ERQA 3V05A 3MVVA 4ZUJA 1NSNS 1D5MC 3J7AF 3KBXA 3GTLB 3NPPA 1A6XA 1JOKA 5KYIA 3PUVA 4A3KB 4FF4A 3RZOB 2EY6A 4OIJA 4RCOA 1PZID 3PMFA 1U4PA 4FXDA 1CQFA 1STBA 2F0TA 4TQUS 1BNZA 1EIHA 3ITPA 1D2BA 1PLFA 1QWYA 3RUZA 5CR3A 3JAML 2M2LA 4KK7A 1TVXA 2HQEA 1BF4A 1LT5D 2NVTB 4C3IG 1RTNA 1GUWA 1Y8PB 1G2SA 4CJ1B 4DGZA 2RDGA 1BCPF 1BQQT 2BA0A 3KBGA 2OT2A 2O4XA 4LK1C 4KKTA 3M7GA 1QB5D 4BBSB 2JP1A 1UNSA 1U4LA 2F0NA 3I90A 2FINB 4DK0A 2XWJB 1FD7D 3KUPA 4KY5A 1PTOC 5KGUA 3I91A 2G9DA 2MJ8A 1TWGB 4S3SA 2BA1A 1MSGA 4BBRB 1S5FD 2KEDA 5C4HA 3C2PA 4XT3B 4O1NA 1LT6D 1YNJC 3OWEB 3GV3A 1HQMC 4QCLA 3UI2A 1B1ZA 2F0JA 2RSNA 4F8MA 1CFMA 3P1HA 5IGBA 2OXPA 4KD3A 4ODGA 4H44C 5J39A 5I2XA 3DM1A 4TKOB 1IW7D 4UAIA 1WTVA 4FF2A 2WB1B 1JOOA 5C0XJ 5CV4A 1O7LA 2Y0SB 3T53B 4K6LA 4L63B 2VUMB 2L9HA 1KDAA 1F2ZA 4PV1C 2L1BA 3EJIA 2CVRA 2O2LD 4XT1B 4PNYA 1SNQA 4HR7B 3M7NA 1GJXA 5E4XA 4KJOA 3VYTA 1B2TA 1TU2B 3LNNA 1LTTD 4C3IB 3K6OA 1DM0B 1RJTA 3AB9A 2ZXRA 1TS2A 2NN6G 1ET9A 3NSWA 5T1GA 2F0QA 2HDMA 3IFDA 1EU4A 3K5NA 5HGTA 1IYVA 5IIFA 2WACA 5CBEE 4J1MA 4PMCA 1STGA 4I65A 5C0XH 5M5YB 1ONLA 1AW7A 3TP6A 3GV6A 1AFPA 2MGSA 5JPMC 4YIJA 1EY9A 2BOSA 1A2UA 1HA5A 5IGCA 2FMMA 1PXUA 3L3OC 1Q12A 1EEID 2M9VA 4ZAIA 1VMPA 4WJWA 3VR5A 5DM63 3BVMA 2F0PA 3CKIB 1D5XC 1TS3A 3I4NB 2XSCA 1KDBA 3A56A 1SBBB 1CZWA 5M9OA 1SNPA 5ISRA 3RLFA 1EY8A 1S5ED 3L9AX 3HOUB 3C46A 1MSHA 3NQIA 5JOBA 5KRUA 2Q8TA 4U673 3MFYA 3EROA 3BDCA 2IX1A 4FVMA 2ZXOA 4ZKBB 2R92B 2Q8IB 1PMRA 4F88A 3V2TA 3SK6A 2NZ1D 4A3MB 4B9WA 1IL8A 1SYGA 1F9QA 3FDTA 2IW3A 1HFGA 1CA5A 2H1EA 4BY1B 1GHJA 1YNNC 1CHQD 1I4PA 2K5DA 3SE0A 2RBMA 4IFDJ 4ME5A 1Z7TA 1IW7C 5CV9A 4IZ8A 1II3A 1TY2A 2F3VA 2A6EC 4BA2I 2FMCA 2ICEC 4RH6A 3C3LA 4K6DA 3CRLC 4ZYSA 1B50A 1SNDA 5C0XI 2XNAC 4N9PA 2NB0A 1Z6HA 1OO9B 2K5QA 2B2VC 3LWUA 3ND8A 3QJYA 2BCOA 2IX0A 3X3NA 2LFNA 3LX0A 1B9NA 3I72A 2K1BA 5EJWA 4G57A 2D62A 3E0JA 4ZLTF 3Q6SA 1SE2A 2L4NA 1QILA 5EGTA 4OL7A 3D6WA 2OEOA 4XDXA 1WTQA 1S5CD 1T5XD 3FKIB 3M4OB 4DN4M 4IUPA 4H0LC 1VMCA 4BWGB 1CZGA 4DAPA 3VR4A 1EZ6A 4L8JA 2XRQD 3WOEA 5KIXA 2RVLA 4RKLA 4G4KA 2A68D 1D5ZC 1I50B 4R9WA 1ZYRD 4IUNA 5CC4A 3MFGA 5IGFA 1BXTA 5JAVA 3C1EA 5TSSA 1SFOB 4H13C 1ENFA 1FYCA 2B2TC 4HAEA 3TP5A 4M8AA 5CYUA 1EZ8A 2RSOA 5FO9B 3PIP3 1LO5D 3MEHA 3HP3A 2IX3A 5C44B 1I4QA 5EPKA 5IGGA 3IKJA 2PZUA 4NP5A 1CK1A 1FR3A 4DF7A 3I70A 1I6HB 3S1QB 2K7VA 3H3VC 1IHZA 2CHBD 1WD1A 3FEWX 4J8QA 2EOTA 1VCIA 1CI3M 5EPLA 3Q22A 4WRDA 4KHZA 4QF4A 3GQBA 1BBXC 2D2CC 2DY8A 3MXPA 1TQOA 4RHSA 3HOYB 2ZT9C 3N6RA 4RGNA 3H6MA 3A8JE 5FO8B 2A6HC 1JE4A 1SMYC 1QOHA 1RD9D 4OO1I 2EYMA 2G9HD 4CJ2C 1CA6A 2R93B 2QILA 2VB2X 4I7ZC 1G2TA 2A69D 3NWSA 3K7AB 1W6JA 2AUJD 1EY4A 2C9OA 4CHTB 1JWSD 3CRKC 1G91A 2A6ED 1F9RA 5BN4A 3K59A 3DEOA 2B8GA 1XXGA 4XYOA 5AFWA 3OMGA 3T13A 3BDLA 1WCMB 4KV6A 5KNDA 5IGEA 5A2QE 5EKKA 3J80E 1M8AA 1OXSC 2F0VA 3HRZC 1PDQA 1J9OA 1LTSD 1A3VA 2O5JC 3OIQA 2K28A 2X69A 1AZQA 1E2VA 5FO7B 3Q23A 3QB3A 4IN3A 5D3IB 1STAA 1LT3D 4ZUIA 2JEAI 4Q0FA 4DXFA 2J0TD 2RDHA 4QMGA 2L5TA 3J81L 2IPKD 4HEDA 4X3KA 4NKLA 1KNAA 1QG7A 1CTMA 1DD2A 5NUCA 3DMUA 2FHTA 4LAAA 1TWCB 1RF2D 1EYCA 4O42A 1DOKA 1VDZA 3HGBA 5C3XA 3D4RA 2X6GA 2R3ZA 3X3MA 4DNTB 3DEPA 4TRDA 4FF1A 1EIGA 3BZDB 3QWNA 1Y8OB 4XTCS 3S15B 4EQOA 1AN8A 5I4DA 3S1MB 2RQXA 3MWYW 1A3UA 4A3JB 2JXMB 3VR2A 1SNMA 4WFN3 1HQRD 2XN9C 1EY7A 1DYQA 3P75A 3S2HB 1JR0D 3E5SA 3A7AB 3Q0AA 5COYA 5J22A 4ZK9B 5G3LF 1BO0A 2LKVA 1Y1VB 3G7LA 2PO4A 2A6HD 2F0EA 2JA7B 4C3JB 1Q3LA 5CV8A 1HUMA 1TY0A 2E74C 1ENAA 1H9MA 2EJFC 3OIPA 1I4GA 2EJGC 1VF7A 4XYQA 1D1KA 2EY2A 1L0YB 1FNWA 3QO2A 3MHBA 1V8QA 1A15A 4C1NK 3PUXA 4KTAA 4BS9A 1O7YA 2D9UA 2ENBA 5ELBA 5EKIA 2F3WA 1JWMD 4XQQA 3HOVB 1Y8NB 5E1FA 1JCKB 1Q8IA 3MTSA 1DXMA 1GUGA 2WP8J 1KABA 2RA4A 4IFDH 4DNRB 2SOBA 1H9KA 3QG1A 3E6ZX 3ND9A 3SXHA 4NMZA 1A2TA 4HSVA 4UDUC 2EXZA 5F2DA 2B8FA 2NVYB 1PRTF 3A55A 2KJXA 4M1UB 3VYSA 1HUNA 1UAPA 2Z4IA 2RDFA 1QNKA 1ET6A 1G291 1WD0A 2B2TA 2YYZA 3MA2B 4RGMA 2IJ0A 3DXJC 1RTOA 5EPJA 1L0XB 3NTKA 3A8KE 2KECA 1EFID 3VYUA 2F0MA 2A73B 3H09A 2ZXPA 2CQAA 5A2QL 1LLRD 1T5EA 5M5XB 3L7ZC 4A3GB 3R3OA 4K14A 2JEBI 5K36H 3HS0C 4NDXA 4PMBA 2K03A 4AYBB 1VF5C 1LTID 1U4MA 5ELFA 3U9OA 1STYA 4JBWA 3TSSA 2K32A 3HOZB 4FF3A 3I3CA 2Q8RE 1GUNA 1OXTA 5I2YA 4IFDG 1PFMA 1EYAA 2VNUD 4FO2A 4C3JG 3CQZB 1B3AA 1TS5A 1X32A 4Y7NB 4Q5VA 2E2JB 4RKBA 1JWUD 3NE5B 5IOCA 3R93A 2V4DA 4ZRZA 2R7ZB 4BA1I 3T56B 1ILQA 5FLXL 5JEAG 2E2HB 4DFAA 1C48A 2IWHA 1WTXA 4HSPA 2WINB 4OGQC 2A74C 1HTLD 2Z8LA 4A93B 4K8JA 3CHBD 1CHPD 1DJRD 1ESFA 3MXUA 4K2KA 1FNUA 2EYHA 5IGDA 3FPPA 4HMJA 4RCNA 3SHLA 1LTRD 3S1RB 1V43A 1STEA 5E3FA 3KLSX 1LACA 1KTKA 3S14B 3NTIA 4B08A 3TZUA 4C56C 3K5OA 3OPOA 1GXDC 2PW7A 1EQVA 4J6HA 4KD4A 1HCZA 5KNCA 4RHRA 4QUCA 3EVQA 1LT4D 2R61A 4RGOS 1EWCA 2BDNA 1HPCA 1FGBD 2PZWA 2VB3X 4KN7C 3GTJB 1I4RA 5C3WA 1BCPB 3S2DB 4DK1A 1BUVT 1BR9A 3AU7A 2B2VA 1V1PA 1XX8A 5DEHA 3LWEA 4RWSC 1B4OA 1KLUD 2QDBA 5LL6S 1PTOH 1MD2D 3RZDB 3Q24A 2Z1CA 2YU9B 4OHJA 3K58A 4HN7A 2EYPA 3PUZA 3EFXD 2NN6H 2MP1A 2OF1A 4DU9A 4FYDA 3MC0B 1AZPA 2QKIC 1JOQA 2PMZB 3MZ5A 3BG3A 4V190 2F0GA 4RAUC 2FJ2A 3TZDA 3W3AA 2NN6I 4IQZA 3FPUB 2K6AA 3EQLC 1STNA 4X3SA 1HA6A 1ESRA 5ELDA 1KLGD 3DHQA 4OO1G 1SDFA 1F9SA 1QNUA 4L6TB 5JVH3 2EE1A 5D14A 3BYYB 3KLRA 5JEAJ 2HUGA 1ZXTA 2RKSA 2NTTA 2JYOA 5J1ZA 2B63B 3H91A 4ID6A 3NBIA 3SK8A 1NR2A 2K04A 2JA8B 2F0KA 4HTHA 4EVOA 2K33A 1H9SA 5ELEA 1K8MA 2EY1A 3NXWA 1GUTA 4E6IA 1LV9A 1EWHA 1PZJD 1JC7A 2B2YA 3V96A 2A68C 2IL8A 2Z4HA 1U9RA 1NUCA 2XVSA 5DM73 1BDOA 1PTOB 1OXXK 3OSOA 4R8IA 5IODA 4A3BB 1E2WA 1PZKD 1NCVA 5CV6A 4OIKA 3OWFA 4G7ZC 4DA2A 4F87A 4K2LA 3M85A 2DNCA 2SNMA 1ZEQX 1TWAB 2DN8A 3URYA 3FRPB 2R6GA 4ULLA 1HHVA 3I8ZA 2F4IA 2H4OA 5EBDA 3NHHA 5T1IA 2HCIA 2F0DA 3GTQB 3K5LA 1PFBA 4EGVA 3I73A 5ELCA 2B2UA 2PZTA 4F7XA 2B2WA 1HTPA 3IL8A 3N52A 1D1IA 3DUZA 3H94A 5FKAC 1EEFD 3DWPA 1V1OA 3MAQA 3FVQA 3BS1A 1STHA 2C5CA 3A8IE 3SDZA 1F2YA 2B39A 1I4XA 1TR5A 1D6EC 1S4ZA 3PUWA 1S5BD 2KEEA 4Z9CB 2EZVA 2E2DC 1F2LA 2F0UA 2NWGA 1RHPA 3P20A 2F0WA 4OO1H 1GUSA 1GUOA 1XWEA 3PIO3 1DZ1A 4XXEA 1RDPD 5DAUA 4KJNA 1C8CA 1H9RA 1IKMA 2FFKB 3P7JA 4K5XA 1F77A 2AQ2B 4KN4C 1KDCA 1DONA 2EYFA 5EBCA 5FK9C 3CU7A 1UUPA 4HCSA 5K36G 4P2CB 2L55A 1G8ZD 3VA7A 3HKZB 1RKNA 2HCCA 1WTOA 2I07B 4NW2A 1PTOD 2WKDA 3RMHA 1G6ZA 2DNEA 5CMDA 3K0YA 1UEAB 2E75C 3SK4A 2KOLA 2KA7A 4CGYB 1C4QA 4CJ0B 1MBYA 1YNJD 3K57A 3MXNA 5C5MA 3BDOA 1M4VA 3TN2A 1PRTB 4H7BA 2F0LA 5I6YA 3D4DA 1LABA 4XQNA 1SXTA 4N9TA 2KHSA 3G6JB 5M3FB 1SYFA 1A3TA 2AWOA 1YNND 3FMCA 3PO3B 4MHEA 2I46A 3I4LA 1DOMA 3GTKB 1R4QB 3NWTA 4IFDI 3NK9A 2PW5A 3GTOB 4C2MB 2AUKA 5CBAE 2EY5A 1WTPA 2PQEA 2GA4B 4C1NI 2EDGA 1R4PB 1SNOA 4IUVA 5K5PA 3NBHA 2JA6B 1TKWB 1H9SB 1E0BA 2F0SA 5JPNC 2PPBC 2LY7A 4RA8A 3J7AV 1X3PA 4ZKCB 5I6WA 4PMWA 3BVGA 5HURA 2D5DA 1Q1EA 3QIAA 1TWHB 1RCVD 3TMEA 3VA5A 1CT1D 5LHY1 5M3MB 1PYWD 1SAPA 4LMQD 1TS4A 1U4RA 3U9SA 4DAVA 5IT9E 4C3HG 4BY7B 2JA5B 2A69C 1SYCA 3J7YW 1OXUA 2E2IB 3GTGB 4KKUA 4B9XA 3A54A 2SNSA 1JB3A 1B9MA 1SE4A 4MN3A 4FP5D 2EYOA 4CKCA 1WVLA 3K5MA 3SR1A 3M4YA 3PO2B 1F2MA 1MGSA 3DWQA 4XIGS 2KUMA 1BCPC 3D3RA 1EYDA 5CV5A 3TDQA 2XIWA 1K83B 2SDFA 4TSSA 3I4MB 3NUCA 4ABNA 4FNFA 1O7ZA 2AWNA 1IKLA 5CV7A 2QF7A 4X3UA 2KVMA 3HOWB 1X3QA 3W2DA 1TWFB 1Z47A 4JK1C 3GTPB 2LMCB 5G3LD 1O78A 3H0GB 4IALA 2J4XA 3QOLA 1SSOA 2B2YC 1R9TB 4A3EB 1ZYRC 1V1PB 1S5DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK1 C;  1Q90 A;  5K36 G;  2JXM B;  3VR2 A;  1E2W A;  1G29 1;  2BE5 D;  3PV0 A;  2YYZ A;  3IFT A;  3PUZ A;  4KKT A;  2NN6 H;  3MXU A;  3A7L A;  3VA7 A;  5A35 A;  5KND A;  2CW0 C;  3DXJ C;  1GHJ A;  1YNN C;  2D5D A;  1Y69 U;  1Q1E A;  3QIA A;  4G7Z C;  3FPP A;  3SE0 A;  4DK0 A;  4RCN A;  3M85 A;  1OXS C;  1QJO A;  1Z7T A;  2DNC A;  1I6V C;  1V43 A;  4G7O C;  1IYV A;  1IW7 C;  2DNE A;  3A8K E;  1LAC A;  2BA1 A;  2DN8 A;  3A7A B;  3BG3 A;  3IKJ A;  2R6G A;  1FR3 A;  2BE5 C;  2E75 C;  5C0X H;  3U9S A;  2O5I C;  2O5J C;  1GHK A;  2A6E C;  3TZU A;  1ONL A;  2KA7 A;  3W3A A;  4BA2 I;  2JE6 I;  5JEA H;  1T5E A;  2A69 C;  2NN6 I;  1E2V A;  1OXU A;  2BDO A;  2A6H D;  2K7V A;  3L7Z C;  3OPO A;  4KKU A;  1YNJ C;  2JEB I;  4IQZ A;  3VR6 A;  2IT1 A;  1HQM C;  5K36 H;  3CRL C;  3BDO A;  3I73 A;  2KCC A;  1HCZ A;  3EQL C;  1K8O A;  1Z6H A;  5KNC A;  1CFM A;  2E74 C;  2JEA I;  1VCI A;  1CI3 M;  1B9M A;  2EVB A;  4H44 C;  1H9M A;  1VF5 C;  1Q12 A;  2EJF C;  3GD7 A;  1LAB A;  3LWU A;  3ND8 A;  1HPC A;  1H9J A;  1HTP A;  4KHZ A;  3QJY A;  4JBW A;  4TKO B;  4LJZ C;  1IW7 D;  2EJG C;  2K32 A;  3VR5 A;  4KN7 C;  1VF7 A;  2L5T A;  3GQB A;  3M4Y A;  3OW7 A;  3T51 B;  3VR3 A;  1A6X A;  2D2C C;  1IYU A;  3H94 A;  1B9N A;  4OO1 G;  3I72 A;  1Q1B A;  2AWO A;  1GUN A;  1OXT A;  3FMC A;  3PUV A;  3PUY A;  2ZT9 C;  3N6R A;  4XIG S;  4DK1 A;  2D62 A;  3A8I E;  3SDZ A;  5BN3 A;  1V8Q A;  3A8J E;  3KLR A;  3OOC A;  1O7L A;  4KI0 A;  4IFD G;  2A6H C;  3PUW A;  2PCF B;  3T53 B;  1SMY C;  3I4L A;  3RLF A;  3WDN A;  3PUX A;  1CTM A;  2F1M A;  1DD2 A;  4KKS A;  1OXV A;  4TQU S;  4H0L C;  4PV1 C;  1Y8N B;  1VDZ A;  3HGB A;  3P20 A;  4I7Z C;  3VR4 A;  3D4R A;  5KNB A;  2A69 D;  4L8J A;  5BN5 A;  1DCZ A;  2AUK A;  4GZY C;  1DXM A;  4OO1 H;  3MFY A;  1GUS A;  1GUG A;  1H9S A;  2K33 A;  2QF7 A;  1K8M A;  3NE5 B;  4G7H C;  1GUO A;  4IFD H;  4DNT B;  4HR7 B;  2V4D A;  1GUT A;  2EDG A;  4DNR B;  2E76 C;  3M7N A;  1GJX A;  4BA1 I;  2AUJ D;  1H9K A;  3T56 B;  1EWH A;  3QG1 A;  2Q8I B;  4JK1 C;  1E2Z A;  1TKW B;  1TU2 B;  3LNN A;  1PMR A;  2LMC B;  3ND9 A;  5JEA G;  3CRK C;  1O78 A;  2A68 D;  2A68 C;  1H9R A;  1H9S B;  5C0X G;  1Y8P B;  1Y8O B;  4XTC S;  2A6E D;  2B8F A;  4KMU C;  5BN4 A;  3AB9 A;  4OGQ C;  4KN4 C;  1BDO A;  1ZYR C;  2B8G A;  3D31 A;  2PNR C;  2PPB C;  1OXX K;  1ZKO A;  2NN6 G;  4H13 C;  2BA0 A;  1FYC A;  2EJM A; 
#chains in the Genus database with same CATH topology
 3L0O A;  2NTS A;  1NJI C;  2PI2 E;  2BE5 D;  3U4Z A;  3PV0 A;  1XYI A;  2F03 A;  5FOB B;  5A35 A;  2HHH L;  1N36 Q;  4A3F B;  2MPM A;  3S1N H;  1KAA A;  5KEE A;  5C6A A;  4CBV A;  4HID A;  1EOT A;  1YIT A;  2N8N A;  3TP7 A;  5JJZ A;  1EL0 A;  1I6V C;  4IUU A;  3ONA B;  1PYB A;  4DR4 Q;  1UE7 A;  3T4A C;  1PH5 A;  1K3R A;  1SJE D;  4R4I A;  4B3R L;  2BE5 C;  4ILW A;  1Y1W B;  3Q8D A;  5C4X B;  5JEA H;  3NQT A;  3TRE A;  3ULL A;  2XWB B;  1D7Q A;  1JJ2 A;  2VW9 A;  3R2T A;  1BCP D;  2JA5 G;  5C4Z A;  4KLK A;  2MUY A;  4HJ7 A;  2KCC A;  1XTD A;  1K8O A;  4RGT A;  1EIY B;  2ZJQ A;  3S16 B;  4DUZ Q;  1EYG A;  2SEB D;  2EVB A;  2KHI A;  1J8I A;  3GD7 A;  2I5M X;  4WOR A;  4EQ5 A;  3JAM i;  4HCE A;  4KY6 A;  3T51 B;  3VR3 A;  3KJP A;  4LF6 L;  5IYD H;  4WJ3 M;  5FJ8 H;  3TQY A;  3PUY A;  3ULJ A;  3BU2 A;  4N8X 1;  5BN3 A;  1ENC A;  4QIW B;  4KI0 A;  4JV5 L;  4V0B A;  3HOZ G;  5C3E B;  3WDN A;  2ID0 A;  5JJL A;  1BOS A;  4KKS A;  3AMU A;  1SMY D;  1I3Q B;  4HJ9 A;  4XQJ A;  2K5W A;  4K5W A;  3B6Y A;  4DK6 C;  2N55 A;  3BVZ A;  5LL6 X;  3W5O A;  1IBK Q;  3F2U A;  1I4H A;  1VQ4 A;  1SEB D;  4CKE A;  1QE6 A;  1SR3 A;  3NEM A;  3RN5 A;  4DAY A;  2CW0 D;  4PQX A;  4DV2 Q;  4KY7 A;  4QUF A;  2HHH Q;  1VQH A;  4YY3 Q;  4J15 A;  2JA7 H;  2WII B;  4IUT A;  3KLS A;  5D3D A;  2AQ1 B;  2F0F A;  1EQT A;  4B3M Q;  1SNC A;  2EYL A;  5FLX E;  1B44 D;  2K5H A;  4DR3 L;  4OEL B;  2WB1 E;  4CDF C;  4FXK C;  4HJ5 A;  1GOZ A;  4QB4 A;  5E4W C;  1SJH D;  5CGK A;  1GM5 A;  2EPB A;  3KK7 A;  3KF8 A;  1N34 Q;  2KQ3 A;  4JI4 L;  1Y69 U;  1IBM L;  4R8N A;  1IZ6 A;  5IYB G;  1NR4 A;  1QJO A;  3IAY A;  4G7O C;  1AEX A;  3ZJY C;  4DK3 C;  4GLV B;  3W1B A;  4LF7 Q;  5DNF A;  3CCR A;  3HOU H;  3HZX A;  4K0K Q;  2MHV A;  2RCF A;  1EUJ A;  4A3L G;  1MIU A;  4ZQ3 A;  1IYJ B;  1X3F A;  1UE1 A;  2MQH A;  3VR6 A;  3T1H L;  3WOF A;  4GN4 B;  4DV4 Q;  1LTA D;  3ICE A;  4UP9 A;  1DOL A;  2NVQ B;  3TBI B;  1HZA A;  1AH9 A;  1CKM A;  4GKJ Q;  1EU3 A;  1EY5 A;  4DPG A;  2GVA A;  4ME3 A;  5GAD C;  2N88 A;  2DGY A;  1JIC A;  1ML0 D;  1KNE A;  4B3S Q;  1ROD A;  3A5Z B;  3S9W A;  3OOC A;  1N32 Q;  1QCB D;  3M4O H;  4MTK A;  2BH8 A;  1VQ9 A;  3HKZ E;  1OXV A;  2ASB A;  4R4T A;  3T16 A;  3D8G A;  3J80 L;  1A62 A;  2JSO A;  5KNB A;  1KXL A;  3GTQ H;  4JI5 L;  4JBK A;  1XTC D;  1DCZ A;  1NMF A;  4GZY C;  4JVZ A;  4WJ4 A;  4G7H C;  1JOR A;  1L1O A;  2JA8 H;  3MXG A;  3GTM B;  4EQP A;  5C4J B;  3RD4 A;  4YWM A;  1ICW A;  1LTG D;  3DWA A;  5EQ0 A;  1PH8 A;  2Q2T A;  2F0I A;  4U68 A;  1E2Z A;  4HMI A;  3EA6 A;  2MFI A;  2LS0 1;  4KMU C;  2F0O A;  5IE8 A;  2TMP A;  4X3T A;  4C3H B;  2K01 A;  3D31 A;  4IJH A;  1K8A C;  3TP8 A;  3CCQ A;  1KRS A;  4YWL A;  3OMC A;  1ZKO A;  2WKC A;  2X6L A;  3K81 C;  1NAP A;  2B2W C;  2NVX B;  1FNV A;  2M00 A;  4KHV A;  5GRO A;  2UUB Q;  3SVM A;  3J81 E;  1XPO A;  3K0X A;  2J7Z A;  1O80 A;  4EQN A;  3R2I A;  3O13 A;  4CKB A;  4DR2 L;  3M3Y B;  4RFB A;  2WFW A;  4FDB A;  1W6K A;  1OTC A;  1B70 B;  1KC8 C;  4A3C G;  5M5W B;  2WV6 D;  2ZJP A;  3GTK H;  3OHX C;  2Z6K A;  2K50 A;  3S1Q H;  4JI6 Q;  1HZ9 A;  1GHK A;  2TSS A;  1CQV A;  2JE6 I;  2BDO A;  2QEJ C;  1PH2 A;  5GAH C;  5COR A;  3D4W A;  2NUC A;  2IT1 A;  1SYD A;  1K8G A;  3KF6 B;  5IT9 L;  5IY0 A;  2PYK A;  5I9O A;  4A3I B;  4K5V A;  2A5H A;  1PFN A;  1EY6 A;  1TII D;  2AQ3 B;  3PO2 H;  2L12 A;  3NP8 A;  1H9J A;  3AFQ A;  1QZH A;  2HQL A;  4LJZ C;  4A3D B;  1NMG A;  1Q8K A;  3OW7 A;  1LTB D;  4LF4 L;  1IYU A;  2UXD L;  5LMN W;  1PVO A;  1Q1B A;  4DXG A;  1PRT C;  3ZYY X;  1K83 H;  1PTO F;  1F9P A;  2F0H A;  3GP7 A;  1HRJ A;  2B2U C;  2XGT A;  2PCF B;  3G48 A;  5EKL A;  1VQF A;  1SE3 A;  1SE8 A;  2F1M A;  2YTY A;  5KYL A;  4MIU A;  1WTR A;  1CM9 A;  5JVG 3;  3M9B A;  2N78 A;  2A8V A;  4A93 G;  3HG9 A;  5D65 A;  1PRT D;  1I94 L;  4NXM Q;  1HFN A;  5BN5 A;  3QOJ A;  3L2P A;  3HOV H;  3FHW A;  2K05 A;  4IUQ A;  4K8I A;  1TWF H;  3BYT B;  3C1F A;  5I9P A;  2EIF A;  2E76 C;  5ELN A;  4BY7 H;  3S17 B;  1SYB A;  1BKB A;  2NYZ D;  1AP0 A;  1VQ7 A;  5C5L A;  2R92 H;  1ILP A;  3UE0 A;  5C0X G;  2DY7 A;  1NBW A;  3R8B A;  2QDL A;  2UU9 Q;  1MHW C;  1Y1V G;  3D6C A;  4OWT B;  2MO1 A;  2PNR C;  3SEB A;  1SYE A;  2VS1 A;  1EY0 A;  2EJM A;  3NTH A;  1B53 A;  1Q90 A;  4KHP Q;  1JQY D;  3S1N B;  2WAQ B;  2ZTD A;  3IFT A;  2YTX A;  3A7L A;  1MI2 A;  2CW0 C;  1TT2 A;  2H5X A;  3BJU A;  4RG1 A;  4IUR A;  3UDG A;  3CMA A;  4BBR G;  3SK5 A;  2FXQ A;  3HOU G;  2EYJ A;  2VXW A;  3HOX B;  4OON A;  2L0C A;  1QZG A;  3E3X A;  3VYR A;  2QCP X;  2XRS D;  3HEJ A;  2O5I C;  2ICI A;  1WTW A;  2R93 H;  4P71 A;  2YTV A;  3JAM E;  4FXG C;  2KCN A;  2NBF A;  2L11 A;  1L1O C;  2HDL A;  4PZ7 A;  4AH6 A;  4X65 L;  1KAW A;  5H1S E;  4L5Q A;  4DAM A;  1WYD A;  3GO5 A;  1HXY D;  1KHI A;  3ERQ A;  3J81 c;  3V05 A;  3MVV A;  4ZUJ A;  2UUA Q;  1NSN S;  4A3I H;  1D5M C;  3J7A F;  3KBX A;  3GTL B;  3NPP A;  3I7F A;  1A6X A;  1JOK A;  5KYI A;  4DR7 L;  3PUV A;  4A3D H;  4A3K B;  5C3E H;  4FF4 A;  3RZO B;  1A63 A;  2EY6 A;  4OIJ A;  4RCO A;  1PZI D;  3PMF A;  1U4P A;  3U50 C;  4FXD A;  1CQF A;  3PIO A;  1STB A;  4A3F H;  2F0T A;  2K5V A;  4TQU S;  3G4S A;  1VQP A;  1UE5 A;  1BNZ A;  1EIH A;  3ITP A;  1D2B A;  1PLF A;  1QWY A;  3RUZ A;  5CR3 A;  3JAM L;  4KK7 A;  2M2L A;  1TVX A;  3CCJ A;  2HQE A;  1BF4 A;  4JOI C;  1C7Y A;  1LT5 D;  2NVT B;  1K3B C;  3S15 H;  4C3I G;  4OWW B;  1RTN A;  1GUW A;  1Y8P B;  1G2S A;  4BBS G;  1X55 A;  4CJ1 B;  4DGZ A;  2RCN A;  4DV6 L;  2RDG A;  1BCP F;  2F3I A;  1BQQ T;  2CWP A;  2BA0 A;  1UWV A;  3KBG A;  3J80 c;  3RZO H;  1X9N A;  1P16 A;  2OT2 A;  2O4X A;  4LK1 C;  3FP9 A;  1JE5 A;  4KKT A;  3M7G A;  1QB5 D;  4BBS B;  1K0S A;  1J5E L;  4JI5 Q;  2JP1 A;  3I4M H;  4LF8 L;  1UNS A;  1U4L A;  2F0N A;  4DNI A;  3I90 A;  2FIN B;  3BZC A;  2XWJ B;  4DK0 A;  1FD7 D;  4QJF A;  3KUP A;  4KY5 A;  4LFA Q;  1PTO C;  5KGU A;  3I91 A;  2G9D A;  2MJ8 A;  1TWG B;  3HKS A;  4S3S A;  2UUA L;  1M90 C;  2BA1 A;  1MSG A;  4BBR B;  1S5F D;  1AE2 A;  2KED A;  4DUY L;  3KF6 A;  5C4H A;  2V1C C;  3STB D;  3C2P A;  5IYC H;  1HZB A;  4XT3 B;  4O1N A;  4NB3 A;  1LT6 D;  1YNJ C;  1C0A A;  3OWE B;  4JI3 L;  3GV3 A;  1HQM C;  4QCL A;  3UI2 A;  1B1Z A;  2F0J A;  2RSN A;  4F8M A;  1CFM A;  3P1H A;  5IGB A;  2OXP A;  4KD3 A;  4ODG A;  4H44 C;  2A19 A;  5J39 A;  5I2X A;  3DM1 A;  4TKO B;  1IW7 D;  2N49 A;  4JI0 L;  4C3I H;  4R4Q A;  4UAI A;  1WTV A;  4FF2 A;  2XTI A;  2WB1 B;  1JOO A;  5C0X J;  2K4K A;  5CV4 A;  4A3B H;  1O7L A;  5LMU L;  2Y0S B;  3T53 B;  4K6L A;  3TS2 A;  3D0F A;  4UY8 C;  4LF5 Q;  4ALP A;  4A3E G;  4L63 B;  2CH4 W;  2VUM B;  2L9H A;  1VQK A;  3HOW G;  4DR5 L;  1KDA A;  1F2Z A;  4PV1 C;  4LNQ A;  2L1B A;  3S2H H;  3RLN A;  3EJI A;  1PH3 A;  2CVR A;  3CC2 A;  2O2L D;  4XT1 B;  4PNY A;  1SNQ A;  4HR7 B;  3M7N A;  1GJX A;  5E4X A;  4KJO A;  5IYD G;  3EN2 A;  3VYT A;  3K7A H;  1B2T A;  1TU2 B;  3LNN A;  1Q7Y C;  1LTT D;  2F52 A;  4C3I B;  3K6O A;  1DM0 B;  1RJT A;  3AB9 A;  4LF9 Q;  2ZXR A;  2NVQ H;  4A3L H;  1TS2 A;  2NN6 G;  1MKH A;  1ET9 A;  4QIW E;  2KCT A;  3NSW A;  5T1G A;  1N8R C;  2ZJR A;  2F0Q A;  2HDM A;  4B3R Q;  5IP9 G;  3DM3 A;  3IFD A;  4K0K L;  1EU4 A;  4JC0 A;  3K5N A;  3PIP A;  5HGT A;  1IYV A;  3JC6 6;  4AYB G;  5IIF A;  2WAC A;  3DLL A;  2OTL A;  5CBE E;  4J1M A;  4PMC A;  2I0Q A;  1STG A;  1XMO L;  4I65 A;  5M5X H;  5C0X H;  1YJN A;  5M5Y B;  4JCV E;  4BBR H;  1ONL A;  1AW7 A;  3TP6 A;  1HR0 Q;  3GV6 A;  1AFP A;  2MGS A;  4NXN L;  5JPM C;  1PH6 A;  4OX9 Q;  4YIJ A;  1EY9 A;  2BOS A;  1A2U A;  1HA5 A;  2NZH A;  5IGC A;  2FMM A;  4R4O A;  4X62 L;  1PXU A;  1YI2 A;  3L3O C;  1Q12 A;  4LF8 Q;  1Q46 A;  3CD6 A;  3S16 H;  1V1Q A;  1EEI D;  4A3J H;  4A3M H;  2M9V A;  4GN5 A;  1VMP A;  4WJW A;  4ZAI A;  3VR5 A;  5DM6 3;  1XJV A;  4OX9 L;  3BVM A;  3PO3 H;  2RHS B;  2F0P A;  3CKI B;  2D0O A;  3CF5 A;  1D5X C;  1TS3 A;  2UXC Q;  3I4N B;  2XSC A;  4JBJ A;  1KDB A;  3A56 A;  4QQB X;  2NVX H;  1SBB B;  1EFW A;  1CZW A;  5M9O A;  1SNP A;  5ISR A;  3RLF A;  1EY8 A;  1S5E D;  4YHH Q;  3L9A X;  3HOU B;  3C46 A;  1MSH A;  3NQI A;  5JOB A;  5KRU A;  4A3B G;  3T1H Q;  1TWC H;  2Q8T A;  4U67 3;  1WCM G;  3MFY A;  3CCM A;  1W3S A;  2WB1 G;  3ERO A;  3BDC A;  1PYS B;  2IX1 A;  4FVM A;  2ZXO A;  4ZKB B;  2R92 B;  1XNR Q;  4JI2 L;  2JJQ A;  2Q8I B;  4A3G H;  1AE3 A;  1PMR A;  4F88 A;  3V2T A;  3SK6 A;  2NZ1 D;  2CQO A;  4A3M B;  4JI7 L;  1EWI A;  2HD3 A;  4B9W A;  1IL8 A;  2OWO A;  3BZK A;  1SYG A;  1F9Q A;  3FDT A;  2IW3 A;  5GQO A;  1HFG A;  1HR0 L;  4DV7 L;  1CA5 A;  5LMU Q;  2H1E A;  2L15 A;  4BXX H;  1N9W A;  1XMO Q;  5FLX c;  5M3F H;  4NXN Q;  1MJC A;  3RNU A;  4BY1 B;  4OXP A;  2K75 A;  1GHJ A;  4L5T A;  1YNN C;  2OCE A;  1CHQ D;  1I4P A;  1KL9 A;  2K5D A;  3SE0 A;  2RBM A;  3H15 A;  4IFD J;  4ME5 A;  4CDC C;  1Z7T A;  1M1K C;  2F4V L;  3S14 H;  1IW7 C;  4R1J A;  5CV9 A;  3H0G G;  1EOV A;  4IZ8 A;  1II3 A;  1TY2 A;  2F3V A;  2JQO A;  4JI1 Q;  1TWA H;  2A6E C;  4BA2 I;  1E1T A;  2FMC A;  4LUO A;  1G51 A;  1Y1V H;  2ICE C;  4RH6 A;  3C3L A;  4K6D A;  3CRL C;  3S24 A;  4ZYS A;  1B50 A;  1SND A;  5C0X I;  2XNA C;  4N9P A;  2NB0 A;  4GNX C;  1Z6H A;  1OO9 B;  3G6E A;  4JI8 L;  2K5Q A;  2B2V C;  3ND8 A;  3LWU A;  1LUZ A;  1A0I A;  2JK8 A;  3QJY A;  1I50 H;  2UUC Q;  2BCO A;  2IX0 A;  3X3N A;  2LFN A;  3LX0 A;  1KRT A;  4BY1 H;  1B9N A;  3I72 A;  2K1B A;  2Z9H A;  5EJW A;  4G57 A;  4LF6 Q;  5IP7 H;  2D62 A;  1HR0 W;  3E0J A;  2KCM A;  4ZLT F;  3Q6S A;  1SE2 A;  2L4N A;  4B3S L;  1E24 A;  1QIL A;  5EGT A;  4OL7 A;  3D6W A;  2OEO A;  4XDX A;  1WTQ A;  1S5C D;  1T5X D;  3FKI B;  3F2B A;  3M4O B;  4DN4 M;  4IUP A;  4H0L C;  1VMC A;  1HNW Q;  4BWG B;  1CZG A;  4DAP A;  3VR4 A;  5C3E G;  1EZ6 A;  3AFP A;  4L8J A;  2XRQ D;  3WOE A;  1YZ6 A;  3I4N G;  5KIX A;  2RVL A;  4RKL A;  1VQC A;  1X3E A;  4G4K A;  3H3V I;  2A68 D;  1D5Z C;  4LFB Q;  4GKJ L;  1I50 B;  1HNW L;  4R9W A;  1ZYR D;  4IUN A;  5CC4 A;  3MFG A;  5IGF A;  1BXT A;  5JAV A;  3C1E A;  5TSS A;  3KDF A;  1SFO B;  3KF8 B;  4JOI A;  4H13 C;  1ENF A;  1FYC A;  2B2T C;  3GDE A;  4C3H H;  3WWV A;  3GTL H;  1E1O A;  4HAE A;  5JJK A;  3TP5 A;  4M8A A;  5CYU A;  4EX5 A;  1EZ8 A;  4DKA C;  3ERS X;  3S2D H;  2RSO A;  5FO9 B;  3PIP 3;  1LO5 D;  3MEH A;  4LFC Q;  3HP3 A;  5ELO A;  2IX3 A;  5C44 B;  1I4Q A;  5EPK A;  4P72 A;  3GTO H;  5IGG A;  2Q2I A;  3IKJ A;  2PZU A;  4NP5 A;  1VQI A;  1CK1 A;  4GOP B;  1FR3 A;  1QUQ A;  4DF7 A;  3UDF A;  2B29 A;  3I70 A;  1I6H B;  3S1Q B;  1K0R A;  4UPA A;  2K7V A;  3H3V C;  1IHZ A;  2CHB D;  2RF4 A;  1WD1 A;  3F2C A;  3KFU A;  3FEW X;  4J8Q A;  1JMC A;  3JAM c;  2EOT A;  4HJA A;  4DV5 Q;  1P8L A;  1VCI A;  1CI3 M;  1WOC A;  5EPL A;  3Q22 A;  4WRD A;  4KHZ A;  4QF4 A;  2JA8 G;  1FJG L;  4KHP L;  3GQB A;  2QA4 A;  1BBX C;  2ES2 A;  2D2C C;  4QY7 A;  4A3F G;  2ZM6 Q;  2DY8 A;  3MXP A;  1TQO A;  4RHS A;  3HOY B;  2ZT9 C;  3N6R A;  4RGN A;  3H6M A;  3A8J E;  5FO8 B;  3S1R H;  1I3Q H;  2A6H C;  1JE4 A;  1SMY C;  2QW7 A;  1IBK L;  1QOH A;  1RD9 D;  4OO1 I;  3A74 A;  4DAY B;  2EYM A;  2G9H D;  4CJ2 C;  1CA6 A;  2R93 B;  2QIL A;  1ICF B;  3OTO L;  2VB2 X;  4I7Z C;  1G2T A;  2A69 D;  1I5F A;  3NWS A;  4IPC A;  1S40 A;  3A0J A;  4NXM L;  3K7A B;  1BBW A;  1W6J A;  2AUJ D;  1EY4 A;  1J5E Q;  2GN5 A;  2C9O A;  1VQE A;  4CHT B;  1JWS D;  2OQ0 A;  1J6Q A;  3CRK C;  1TXY A;  1G91 A;  2A6E D;  1F9R A;  5BN4 A;  3K59 A;  3DEO A;  1YBY A;  1RIP A;  2B8G A;  1XXG A;  2AHO B;  4XYO A;  5AFW A;  3OMG A;  3T13 A;  3BDL A;  3CCS A;  1WCM B;  4KV6 A;  5KND A;  4I7A A;  2R7F A;  2HIV A;  5IGE A;  5A2Q E;  5EKK A;  3J80 E;  1M8A A;  1OXS C;  4GNX B;  2F0V A;  3HRZ C;  4PZ8 A;  3CME A;  1PDQ A;  2PQA A;  1J9O A;  4JG2 A;  3CPF A;  1LTS D;  1A3V A;  4MNO A;  2O5J C;  3OIQ A;  2G5D A;  2K28 A;  1CKN A;  2X69 A;  1AZQ A;  2Z6K C;  1C9O A;  1E2V A;  1VQJ A;  5FO7 B;  3NEN A;  3Q23 A;  3QB3 A;  4IO9 A;  4IN3 A;  2OQK A;  5D3I B;  4JYA Q;  1STA A;  4OWX B;  1LT3 D;  2VQE Q;  4ZUI A;  3RR5 A;  2JEA I;  4A3E H;  1LTL A;  4Q0F A;  2PQA B;  1LYL A;  2YU9 H;  4MTN A;  4DXF A;  3OW2 A;  2J0T D;  4GNX A;  2RDH A;  3EBE A;  3U4V A;  4LUV A;  4QMG A;  2L5T A;  3J81 L;  2IPK D;  4HED A;  1BVS A;  4X3K A;  1HH2 P;  4NKL A;  2EXD A;  3CAM A;  5LMN Q;  1KNA A;  3HOY H;  4A3D G;  1QG7 A;  1CTM A;  1DD2 A;  1K9M C;  4GKK L;  5NUC A;  3DMU A;  2IY5 B;  1N33 L;  2FHT A;  4LAA A;  1TWC B;  1RF2 D;  2VQF Q;  1EYC A;  4A3I G;  5C4X H;  4O42 A;  1DOK A;  1VDZ A;  3HGB A;  5C3X A;  5AJ3 Q;  3D4R A;  2LSS A;  2X6G A;  2ATW A;  1X6O A;  2R3Z A;  4H02 A;  3X3M A;  4DNT B;  2A1A A;  1L2F A;  5BR8 L;  3ER0 A;  3DEP A;  4LF4 Q;  2UXD Q;  4TRD A;  4FF1 A;  1GO3 E;  1EIG A;  3OYY A;  3BZD B;  3QWN A;  4IOC A;  1GKH A;  1Y8O B;  4XTC S;  3S15 B;  2Y0S E;  4EQO A;  1AN8 A;  5I4D A;  3S1M B;  3M4P A;  1MJE A;  2RQX A;  3PCO B;  3MWY W;  1R9T H;  1A3U A;  4A3J B;  2JXM B;  3VR2 A;  4CDD C;  3PQI A;  1SNM A;  4DUY Q;  4WFN 3;  1HQR D;  4X6A H;  2XN9 C;  2VZA A;  4BBS H;  1EY7 A;  2VQE L;  1DYQ A;  4UP8 A;  3P75 A;  3S2H B;  1JR0 D;  3E5S A;  3PGZ A;  3A7A B;  3Q0A A;  5COY A;  3TRZ A;  5J22 A;  4ZK9 B;  5G3L F;  5JJI A;  1BO0 A;  2LKV A;  1Y1V B;  3G7L A;  2PO4 A;  2A6H D;  2F0E A;  4B3T L;  2JA7 B;  4C3J B;  4JI0 Q;  1YHA A;  2JN4 A;  3KLW A;  1Q3L A;  1FL0 A;  5CV8 A;  1HUM A;  1TY0 A;  2E74 C;  3QR8 A;  2UXB L;  2JA7 G;  1ENA A;  1KIX A;  1H9M A;  2EJF C;  3OIP A;  4ZCK A;  1VQ6 A;  3F1Z A;  4GS3 A;  1I4G A;  2EJG C;  1KQS A;  2NVY H;  1VF7 A;  1N33 Q;  4XYQ A;  1D1K A;  1B8A A;  1WI5 A;  2LXK A;  2EY2 A;  4PG3 A;  1L0Y B;  1Q86 C;  3NEL A;  1FNW A;  3QO2 A;  2K14 A;  3MHB A;  1V8Q A;  1A15 A;  3NBH B;  4C1N K;  3T1Y Q;  4A75 A;  3PUX A;  1CSQ A;  4KTA A;  4YCW A;  4BS9 A;  3J7Z C;  1O7Y A;  1HNX Q;  2D9U A;  5C44 G;  1XNQ Q;  2MNA A;  2ENB A;  5M5Y H;  5ELB A;  5EKI A;  2F3W A;  1JWM D;  4XQQ A;  3HOV B;  1Y8N B;  5E1F A;  1JB7 A;  5J3B A;  1JCK B;  1NE3 A;  1Q8I A;  3MTS A;  1DXM A;  2CCZ A;  1GUG A;  2WP8 J;  1KAB A;  4POF A;  2R7Z H;  3S17 H;  1JJG A;  2RA4 A;  4IFD H;  2R93 G;  4DNR B;  2SOB A;  3A5U A;  3CCE A;  1H9K A;  2DUD A;  3QG1 A;  3E6Z X;  3MEF A;  3ND9 A;  3SXH A;  4NMZ A;  1A2T A;  4HSV A;  1X56 A;  4APV A;  4UDU C;  2EXZ A;  4DR1 Q;  5F2D A;  2B8F A;  2NVY B;  1SFO H;  1XPR A;  3E9H A;  1PRT F;  3A55 A;  4OEM B;  3F8T A;  3CXC A;  2KJX A;  4M1U B;  3VYS A;  2F4V Q;  1HUN A;  1UAP A;  2Z4I A;  2RDF A;  1QNK A;  1ET6 A;  1G29 1;  5M3M G;  1WD0 A;  2B2T A;  2YYZ A;  3MA2 B;  4B3T Q;  4RGM A;  5IP9 H;  2IJ0 A;  3DXJ C;  3J80 i;  4HIM A;  1RTO A;  2VQF L;  5EPJ A;  1L0X B;  1VQA A;  1YIJ A;  3NTK A;  2VY3 A;  3A8K E;  2KEC A;  1EFI D;  4X62 Q;  4A3G G;  1E22 A;  4QL5 A;  3VYU A;  3CCV A;  2F0M A;  2A73 B;  4BY7 G;  3FKI H;  3GTM H;  1E3P A;  2ZXP A;  3H09 A;  1PHJ A;  2CQA A;  3STB C;  5A2Q L;  4GN3 B;  1LLR D;  1T5E A;  4UHV A;  5M5X B;  3L7Z C;  1XMQ Q;  2E2J H;  4YY3 L;  2E5L Q;  1BBU A;  3R3O A;  4K14 A;  1XNR L;  3AEV A;  4A76 A;  2JEB I;  4A3G B;  3TEH B;  1I94 Q;  5K36 H;  2PI2 A;  3HS0 C;  4NDX A;  4LUZ A;  4PMB A;  2K03 A;  2CFM A;  4AYB B;  1VF5 C;  1LTI D;  1U4M A;  5AJ3 L;  2E2H H;  5ELF A;  3U9O A;  1STY A;  4GOP A;  4JBW A;  3TSS A;  2K32 A;  3HOZ B;  1SMX A;  1Q82 C;  4FF3 A;  3I4O A;  2C35 B;  2YV5 A;  1SRO A;  3I3C A;  1Z9F A;  1YJ9 A;  2QGQ A;  2Q8R E;  1GUN A;  1OXT A;  2P5Z X;  1X65 A;  4A93 H;  5I2Y A;  4IFD G;  1PFM A;  3I4N H;  1EYA A;  2VNU D;  4FO2 A;  4JW0 A;  4R4C A;  4C3J G;  3CQZ B;  1B3A A;  4HJ8 A;  3HOX G;  1TS5 A;  1X32 A;  4Y7N B;  1YVC A;  4JI1 L;  4Y52 H;  2KBN A;  4Q5V A;  2E2J B;  4DR4 L;  4RKB A;  1EIF A;  1EQR A;  1JWU D;  3NE5 B;  5IOC A;  4HIO A;  3CC7 A;  3R93 A;  1JT8 A;  2V4D A;  3GTP H;  1HNZ L;  4ZRZ A;  4QGU A;  3PO2 G;  4BA1 I;  2R7Z B;  3T56 B;  1ILQ A;  3H0G H;  5FLX L;  5JEA G;  2I5H A;  2E2H B;  4DFA A;  1C48 A;  2IWH A;  1ASY A;  1WTX A;  4HSP A;  1U5K A;  2WIN B;  4OGQ C;  2A74 C;  4POG A;  1HTL D;  4IOA A;  2Z8L A;  4AYB E;  5M3F G;  1NNX A;  1H95 A;  4A93 B;  4K8J A;  3CHB D;  5E7N A;  1CHP D;  1DJR D;  4GLX A;  1ESF A;  3MXU A;  3I4M G;  4K2K A;  1FNU A;  5HY6 A;  2EYH A;  5IGD A;  2DJF C;  3FPP A;  1HJP A;  4HMJ A;  4Y7N H;  4RCN A;  3SHL A;  1LTR D;  3S1R B;  1V43 A;  5GAE C;  4GLA C;  1STE A;  3M3Y H;  5E3F A;  3KLS X;  1L1O B;  1LAC A;  3UDX A;  4C2M H;  1KTK A;  3S14 B;  3NTI A;  1FGU A;  4DV3 L;  4B08 A;  3TZU A;  4IPH A;  1YNX A;  4C56 C;  3K5O A;  2EQS A;  2ZM6 L;  2JA6 H;  3OPO A;  1GXD C;  2PW7 A;  4DR1 L;  1EQV A;  2AMC B;  4J6H A;  4KD4 A;  1HCZ A;  3HOW H;  5KNC A;  4RHR A;  4QUC A;  3EVQ A;  1LT4 D;  2R61 A;  2UU9 L;  4RGO S;  1EWC A;  2BDN A;  2AKW B;  1GVP A;  1HPC A;  1FGB D;  2PZW A;  2VB3 X;  4KN7 C;  5EAY A;  3GTJ B;  1I4R A;  5C3W A;  1TWH H;  1BCP B;  3HOZ H;  1HNZ Q;  3S2D B;  4DK1 A;  2PMZ E;  4A3J G;  2B63 H;  1IXR A;  2IHE A;  1BUV T;  1BR9 A;  3AU7 A;  3HOX H;  3LGJ A;  4PZ6 A;  2B2V A;  3PF5 A;  1V1P A;  1XX8 A;  5DEH A;  1QUQ B;  3KJO A;  3I2Z A;  3LWE A;  2UXB Q;  3G71 A;  4DV5 L;  5IYC G;  4RWS C;  1B4O A;  1KLU D;  1Y1W H;  4DR6 L;  1Y14 B;  4AQY L;  3K7U C;  2QDB A;  4LF9 L;  5LL6 S;  3PO3 G;  4DV4 L;  1DGS A;  1PTO H;  1MD2 D;  3SGI A;  3RZD B;  3Q24 A;  3CCL A;  4JI3 Q;  1V9P A;  3GTJ H;  2Z0S A;  2Z1C A;  2YU9 B;  1VQ8 A;  4OHJ A;  3CC4 A;  3K58 A;  4HN7 A;  2EYP A;  3K8A A;  3PUZ A;  3EFX D;  2NN6 H;  4RMF A;  2MP1 A;  2OF1 A;  4DU9 A;  4FYD A;  3MC0 B;  1AZP A;  2QKI C;  1JOQ A;  1CUK A;  4DR3 Q;  3E9I A;  1K28 A;  2PMZ B;  3MZ5 A;  2DJG C;  3BG3 A;  4V19 0;  1CKO A;  2F0G A;  4RAU C;  2FJ2 A;  2VUM H;  3TZD A;  3UDI A;  5M3M H;  4LFB L;  3W3A A;  1G6P A;  2NN6 I;  2NZO A;  3RLO A;  3U58 A;  1UE6 A;  1YHQ A;  1I6H H;  1VQB A;  4DV1 L;  4IQZ A;  3FPU B;  2CKZ B;  1Y1W G;  2K6A A;  2LXJ A;  3RZD H;  3EQL C;  1STN A;  4X3S A;  3HOV G;  1HA6 A;  1ESR A;  1PH9 A;  1RL2 A;  2MO0 A;  5FLM G;  4GKK Q;  4IPG A;  5ELD A;  2ALY B;  3K80 C;  3PSI A;  4X65 Q;  4JI8 Q;  4DV1 Q;  1QVG A;  1KLG D;  1SN8 A;  3DHQ A;  4OO1 G;  1SDF A;  1F9S A;  1QNU A;  1UEB A;  4L6T B;  2B63 G;  4DV0 Q;  5JVH 3;  2EE1 A;  3AYH B;  5D14 A;  4DR6 Q;  3BYY B;  3KLR A;  1WJJ A;  5JEA J;  2HUG A;  1ZXT A;  2RKS A;  1TWG H;  2NTT A;  4DR7 Q;  2JYO A;  5J1Z A;  2B63 B;  3H91 A;  3IRB A;  4ID6 A;  4P75 A;  3NBI A;  3SK8 A;  1NR2 A;  2K04 A;  2JA8 B;  2F0K A;  4HTH A;  3KDF B;  4EVO A;  1VQN A;  2K33 A;  1H9S A;  5ELE A;  1K8M A;  3HOY G;  2EY1 A;  3NXW A;  1GUT A;  3W1G A;  4AIM A;  4E6I A;  1LV9 A;  1NTG A;  3TS0 A;  1EWH A;  2N3S A;  1PZJ D;  1JC7 A;  2B2Y A;  3V96 A;  2A68 C;  2IL8 A;  1WFQ A;  2Z4H A;  1U9R A;  1NUC A;  2XVS A;  5DM7 3;  1BDO A;  1PTO B;  2OTJ A;  1OXX K;  3OSO A;  3HKZ G;  2GVB A;  5IOD A;  4R8I A;  5GAG C;  4A3B B;  1E2W A;  1PZK D;  5IWA Q;  1NCV A;  1VQ5 A;  5CV6 A;  4OIK A;  3OWF A;  4G7Z C;  5M5W H;  4DA2 A;  4F87 A;  4K2L A;  3M85 A;  2DNC A;  3J81 i;  2SNM A;  2R92 G;  1ZEQ X;  1TWA B;  2DN8 A;  3URY A;  3FRP B;  2R6G A;  5IWA L;  1L0W A;  4ULL A;  1XMQ L;  1K73 C;  1HHV A;  3I8Z A;  2F4I A;  2H4O A;  3AQQ A;  3NHH A;  5EBD A;  5T1I A;  2HCI A;  2F0D A;  1N34 L;  4JI4 Q;  3GTQ B;  3K5L A;  4JV5 Q;  1PH1 A;  1PFB A;  4EGV A;  3I73 A;  5ELC A;  2B2U A;  2PZT A;  4F7X A;  3S1M H;  2UUC L;  2B2W A;  4X64 Q;  1A8V A;  4JI7 Q;  1FVI A;  1HTP A;  4X66 L;  1IBL Q;  3IL8 A;  4LFC L;  1XPU A;  3N52 A;  1D1I A;  2I5L X;  3CW2 C;  2E8G A;  3DUZ A;  3H94 A;  5FKA C;  1EEF D;  1QVC A;  3DWP A;  1V1O A;  3MAQ A;  3FVQ A;  3BS1 A;  1STH A;  2C5C A;  3A8I E;  3SDZ A;  5C4X G;  1F2Y A;  2B39 A;  1W2B A;  1I4X A;  1D6E C;  1TR5 A;  1S4Z A;  3PUW A;  3VDY A;  2Q2U A;  1S5B D;  2KEE A;  3KYH C;  3H3V H;  4Z9C B;  3OTO Q;  2EZV A;  4A4I A;  2E2D C;  1F2L A;  2F0U A;  2NWG A;  3PF4 A;  1RHP A;  3P20 A;  4JBM A;  4MZ9 A;  1N36 L;  2F0W A;  4C3J H;  4P73 A;  4OO1 H;  1GUS A;  1GUO A;  1XWE A;  2WAQ G;  4TVA B;  2KHJ A;  1PH4 A;  3PIO 3;  4CDE C;  3J7A 5;  4YWK A;  1DZ1 A;  4XXE A;  1RDP D;  5FLM H;  5DAU A;  4KJN A;  1VQG A;  1C8C A;  1H9R A;  1IKM A;  1SRU A;  3FKI G;  5IT9 c;  3I55 A;  2FFK B;  4L5S A;  3P7J A;  4K5X A;  1F77 A;  2AQ2 B;  4KN4 C;  1KDC A;  1DON A;  2EYF A;  2KEN A;  5EBC A;  5FK9 C;  3CU7 A;  1ASZ A;  2IHF A;  1UUP A;  5IYB H;  2VL6 A;  4HCS A;  5K36 G;  4P2C B;  2L55 A;  1VQL A;  1G8Z D;  4UP7 A;  3VA7 A;  3HKZ B;  1RKN A;  2HCC A;  1WTO A;  2I07 B;  4NW2 A;  1PTO D;  2WKD A;  5DLQ E;  3I56 A;  3RMH A;  1G6Z A;  2DNE A;  3HFZ B;  3CQZ H;  5CMD A;  3K0Y A;  4GOP C;  1UEA B;  1X3G A;  2E75 C;  1SLJ A;  3SK4 A;  5BR8 Q;  4DR2 Q;  2KOL A;  2KA7 A;  3E0E A;  4DV0 L;  1O7I A;  4CGY B;  1C4Q A;  4CJ0 B;  1MBY A;  4YCU A;  1WTH A;  1PV4 A;  1YNJ D;  4LF7 L;  2HT1 A;  3K57 A;  4P74 A;  3MXN A;  4BXX G;  5C5M A;  3BDO A;  1M4V A;  3TN2 A;  1PRT B;  4H7B A;  2ZTC A;  3ULP A;  2F0L A;  1HNX L;  1FJG Q;  5I6Y A;  3D4D A;  1LAB A;  3T1Y L;  4XQN A;  1SXT A;  4N9T A;  1GD7 A;  2KHS A;  2Y0S G;  4N8F A;  3G6J B;  4A3K H;  1XNQ L;  5M3F B;  1SYF A;  2R7D A;  1A3T A;  2AWO A;  1YNN D;  3FMC A;  4DV6 Q;  3PO3 B;  4MHE A;  2I46 A;  3EIV A;  4A3M G;  4B3M L;  3I4L A;  1DOM A;  3GTK B;  3MXN B;  1R4Q B;  1NY4 A;  2ZTE A;  4DUZ L;  1PH7 A;  5HGQ A;  4LFA L;  1VS0 A;  3NWT A;  4IFD I;  3NK9 A;  2K52 A;  2PW5 A;  2WAQ E;  5C44 H;  1E7Z A;  4YCV A;  2QEX A;  3GTO B;  4C2M B;  2AUK A;  5CBA E;  2EY5 A;  1WTP A;  2CH4 A;  2PQE A;  2UUB L;  2GA4 B;  4A3K G;  1B3Q A;  1JJC B;  4C1N I;  2EDG A;  5IP7 G;  1R4P B;  1SNO A;  4IUV A;  5K5P A;  3NBH A;  1S3O A;  2JA6 B;  4O0A A;  1TKW B;  5C4J H;  2PNH A;  4HIK A;  1YJW A;  1T9H A;  1H9S B;  4NPS A;  1E0B A;  2F0S A;  4O2D A;  2JA6 G;  5JPN C;  2UXC L;  2PPB C;  2LY7 A;  4RA8 A;  2CWA A;  3J7A V;  1X3P A;  4ZKC B;  5I6W A;  2D0P A;  4PMW A;  4DV7 Q;  1QVF A;  3BVG A;  5HUR A;  4JPB W;  4AQY Q;  2D5D A;  1Q1E A;  3QIA A;  1TWH B;  1RCV D;  4LWC A;  3TME A;  3VA5 A;  1CT1 D;  1CSP A;  4IJL A;  1U0L A;  4LW1 A;  5LHY 1;  4X64 L;  5M3M B;  1PFS A;  1PYW D;  1SAP A;  4LMQ D;  4A3C H;  1TS4 A;  1U4R A;  3U9S A;  3RN2 A;  4DAV A;  4JYA L;  5IT9 E;  3F2D A;  4C3H G;  4BY7 B;  2HIX A;  2A69 C;  1SYC A;  3J7Y W;  1OXU A;  1KD1 C;  1B7Y B;  2JA5 B;  2E2I B;  3GTG B;  4KKU A;  1N32 L;  4B9X A;  3A54 A;  3M4Q A;  3CCU A;  2SNS A;  1JB3 A;  1B9M A;  1IL2 A;  2NVT H;  1SE4 A;  4MN3 A;  4FP5 D;  2EYO A;  4CKC A;  1WVL A;  1HZC A;  3K5M A;  2BH2 A;  1YHB A;  3SR1 A;  5LMN L;  3M4Y A;  1Q81 C;  2R7Z G;  1F2M A;  4JI2 Q;  3PO2 B;  1MGS A;  5FJ8 G;  3DWQ A;  4XIG S;  2KUM A;  1BCP C;  2JA9 A;  3D3R A;  1EYD A;  5CV5 A;  3KOJ A;  3TDQ A;  1S72 A;  2XIW A;  4YHH L;  1WCM H;  2K5N A;  1K83 B;  2SDF A;  4TSS A;  3J81 j;  3CP0 A;  3I4M B;  2Z6B A;  3NUC A;  4IPD A;  4L5R C;  4ABN A;  1PA6 A;  4FNF A;  1O7Z A;  4DV3 Q;  2AWN A;  1IBM Q;  1VQO A;  1IKL A;  2JA5 H;  2E2I H;  3CPW A;  5CV7 A;  3GTG H;  2E5L L;  4BY1 G;  2QF7 A;  4X3U A;  5L37 A;  2Q2H A;  1D8L A;  1LM0 A;  2KVM A;  4X66 Q;  1CKN B;  1VQD A;  1IBL L;  3HOW B;  1X3Q A;  3W2D A;  1YEZ A;  1VQM A;  1TWF B;  1Z47 A;  4JK1 C;  3GTP B;  2LMC B;  4LF5 L;  5G3L D;  2B3G A;  1O78 A;  3H0G B;  4IAL A;  3UE1 A;  2J4X A;  3QOL A;  2VUM G;  4DR5 Q;  1SSO A;  2B2Y C;  4JI6 L;  2RHQ B;  1R9T B;  4A3E B;  1ZYR C;  1X54 A;  4DV2 L;  1EQQ A;  1V1P B;  1S5D D; 
#chains in the Genus database with same CATH homology
 2NTS A;  2BE5 D;  3PV0 A;  1XYI A;  2F03 A;  5FOB B;  5A35 A;  4A3F B;  2MPM A;  1KAA A;  5KEE A;  5C6A A;  4CBV A;  1EOT A;  3TP7 A;  5JJZ A;  1EL0 A;  1I6V C;  4IUU A;  3ONA B;  3T4A C;  1SJE D;  2BE5 C;  4ILW A;  1Y1W B;  5C4X B;  5JEA H;  3NQT A;  2XWB B;  3R2T A;  1BCP D;  5C4Z A;  2MUY A;  2KCC A;  1K8O A;  4RGT A;  3S16 B;  2SEB D;  2EVB A;  1J8I A;  3GD7 A;  4WOR A;  4HCE A;  4KY6 A;  3T51 B;  3VR3 A;  3PUY A;  5BN3 A;  1ENC A;  4QIW B;  4KI0 A;  4V0B A;  5C3E B;  3WDN A;  2ID0 A;  3AMU A;  1BOS A;  4KKS A;  1SMY D;  1I3Q B;  4XQJ A;  2K5W A;  4K5W A;  2N55 A;  3BVZ A;  5LL6 X;  3F2U A;  1I4H A;  1SEB D;  4CKE A;  1QE6 A;  4DAY A;  2CW0 D;  4PQX A;  4KY7 A;  4QUF A;  2WII B;  4IUT A;  3KLS A;  5D3D A;  2AQ1 B;  2F0F A;  1EQT A;  1SNC A;  2EYL A;  5FLX E;  1B44 D;  4FXK C;  1GOZ A;  4QB4 A;  5E4W C;  1SJH D;  5CGK A;  2EPB A;  3KK7 A;  3KF8 A;  2KQ3 A;  1Y69 U;  4R8N A;  1NR4 A;  1QJO A;  3IAY A;  4G7O C;  1AEX A;  5DNF A;  3HZX A;  2MHV A;  4ZQ3 A;  3VR6 A;  3WOF A;  1LTA D;  1DOL A;  2NVQ B;  3TBI B;  1EU3 A;  1EY5 A;  2N88 A;  1JIC A;  1ML0 D;  1KNE A;  1ROD A;  3S9W A;  3OOC A;  1QCB D;  1OXV A;  3T16 A;  3D8G A;  3J80 L;  2JSO A;  5KNB A;  1XTC D;  1DCZ A;  4GZY C;  4G7H C;  1JOR A;  3MXG A;  3GTM B;  4EQP A;  5C4J B;  3RD4 A;  1ICW A;  1LTG D;  3DWA A;  5EQ0 A;  2F0I A;  4U68 A;  1E2Z A;  4HMI A;  3EA6 A;  2LS0 1;  4KMU C;  2F0O A;  2TMP A;  4X3T A;  4C3H B;  2K01 A;  3D31 A;  3TP8 A;  3OMC A;  1ZKO A;  2WKC A;  2X6L A;  1NAP A;  2B2W C;  2NVX B;  1FNV A;  2M00 A;  4KHV A;  3SVM A;  3J81 E;  2J7Z A;  1O80 A;  4EQN A;  3R2I A;  3O13 A;  4CKB A;  3M3Y B;  4RFB A;  1W6K A;  5M5W B;  2WV6 D;  3OHX C;  1GHK A;  2TSS A;  1CQV A;  2JE6 I;  2BDO A;  2QEJ C;  5COR A;  3D4W A;  2NUC A;  2IT1 A;  1SYD A;  5IT9 L;  2PYK A;  5I9O A;  4A3I B;  4K5V A;  2A5H A;  1PFN A;  1EY6 A;  1TII D;  2AQ3 B;  2L12 A;  3NP8 A;  1H9J A;  4LJZ C;  4A3D B;  3OW7 A;  1LTB D;  1IYU A;  4DXG A;  1Q1B A;  1PRT C;  3ZYY X;  1PTO F;  1F9P A;  2F0H A;  3GP7 A;  1HRJ A;  2B2U C;  2PCF B;  5EKL A;  1SE3 A;  2F1M A;  5KYL A;  4MIU A;  1WTR A;  1CM9 A;  5JVG 3;  3HG9 A;  5D65 A;  1PRT D;  1HFN A;  5BN5 A;  3QOJ A;  2K05 A;  4IUQ A;  4K8I A;  3BYT B;  3C1F A;  5I9P A;  2E76 C;  3S17 B;  1SYB A;  2NYZ D;  1AP0 A;  5C5L A;  1ILP A;  5C0X G;  2DY7 A;  3R8B A;  3D6C A;  2PNR C;  3SEB A;  1SYE A;  1EY0 A;  2EJM A;  3NTH A;  1B53 A;  1Q90 A;  1JQY D;  3S1N B;  2WAQ B;  3IFT A;  3A7L A;  1MI2 A;  2CW0 C;  1TT2 A;  4IUR A;  3SK5 A;  2EYJ A;  2VXW A;  3HOX B;  2L0C A;  3VYR A;  2QCP X;  2XRS D;  3HEJ A;  2O5I C;  2ICI A;  1WTW A;  3JAM E;  4FXG C;  2KCN A;  2NBF A;  2L11 A;  2HDL A;  3GO5 A;  1HXY D;  3ERQ A;  3V05 A;  3MVV A;  4ZUJ A;  1NSN S;  1D5M C;  3J7A F;  3KBX A;  3GTL B;  3NPP A;  1A6X A;  1JOK A;  5KYI A;  3PUV A;  4A3K B;  4FF4 A;  3RZO B;  2EY6 A;  4OIJ A;  4RCO A;  1PZI D;  3PMF A;  1U4P A;  4FXD A;  1CQF A;  1STB A;  2F0T A;  4TQU S;  1BNZ A;  1EIH A;  3ITP A;  1D2B A;  1PLF A;  1QWY A;  3RUZ A;  5CR3 A;  3JAM L;  2M2L A;  4KK7 A;  1TVX A;  2HQE A;  1BF4 A;  1LT5 D;  2NVT B;  4C3I G;  1RTN A;  1GUW A;  1Y8P B;  1G2S A;  4CJ1 B;  4DGZ A;  2RDG A;  1BCP F;  1BQQ T;  2BA0 A;  3KBG A;  2OT2 A;  2O4X A;  4LK1 C;  4KKT A;  3M7G A;  1QB5 D;  4BBS B;  2JP1 A;  1UNS A;  1U4L A;  2F0N A;  3I90 A;  2FIN B;  4DK0 A;  2XWJ B;  1FD7 D;  3KUP A;  4KY5 A;  1PTO C;  5KGU A;  3I91 A;  2G9D A;  2MJ8 A;  1TWG B;  4S3S A;  2BA1 A;  1MSG A;  4BBR B;  1S5F D;  2KED A;  5C4H A;  3C2P A;  4XT3 B;  4O1N A;  1LT6 D;  1YNJ C;  3OWE B;  3GV3 A;  1HQM C;  4QCL A;  3UI2 A;  1B1Z A;  2F0J A;  2RSN A;  4F8M A;  1CFM A;  3P1H A;  5IGB A;  2OXP A;  4KD3 A;  4ODG A;  4H44 C;  5J39 A;  5I2X A;  3DM1 A;  4TKO B;  1IW7 D;  4UAI A;  1WTV A;  4FF2 A;  2WB1 B;  1JOO A;  5C0X J;  5CV4 A;  1O7L A;  2Y0S B;  3T53 B;  4K6L A;  4L63 B;  2VUM B;  2L9H A;  1KDA A;  1F2Z A;  4PV1 C;  2L1B A;  3EJI A;  2CVR A;  2O2L D;  4XT1 B;  4PNY A;  1SNQ A;  4HR7 B;  3M7N A;  1GJX A;  5E4X A;  4KJO A;  3VYT A;  1B2T A;  1TU2 B;  3LNN A;  1LTT D;  4C3I B;  3K6O A;  1DM0 B;  1RJT A;  3AB9 A;  2ZXR A;  1TS2 A;  2NN6 G;  1ET9 A;  3NSW A;  5T1G A;  2F0Q A;  2HDM A;  3IFD A;  1EU4 A;  3K5N A;  5HGT A;  1IYV A;  5IIF A;  2WAC A;  5CBE E;  4J1M A;  4PMC A;  1STG A;  4I65 A;  5C0X H;  5M5Y B;  1ONL A;  1AW7 A;  3TP6 A;  3GV6 A;  1AFP A;  2MGS A;  5JPM C;  4YIJ A;  1EY9 A;  2BOS A;  1A2U A;  1HA5 A;  5IGC A;  2FMM A;  1PXU A;  3L3O C;  1Q12 A;  1EEI D;  2M9V A;  4ZAI A;  1VMP A;  4WJW A;  3VR5 A;  5DM6 3;  3BVM A;  2F0P A;  3CKI B;  1D5X C;  1TS3 A;  3I4N B;  2XSC A;  1KDB A;  3A56 A;  1SBB B;  1CZW A;  5M9O A;  1SNP A;  5ISR A;  3RLF A;  1EY8 A;  1S5E D;  3L9A X;  3HOU B;  3C46 A;  1MSH A;  3NQI A;  5JOB A;  5KRU A;  2Q8T A;  4U67 3;  3MFY A;  3ERO A;  3BDC A;  2IX1 A;  4FVM A;  2ZXO A;  4ZKB B;  2R92 B;  2Q8I B;  1PMR A;  4F88 A;  3V2T A;  3SK6 A;  2NZ1 D;  4A3M B;  4B9W A;  1IL8 A;  1SYG A;  1F9Q A;  3FDT A;  2IW3 A;  1HFG A;  1CA5 A;  2H1E A;  4BY1 B;  1GHJ A;  1YNN C;  1CHQ D;  1I4P A;  2K5D A;  3SE0 A;  2RBM A;  4IFD J;  4ME5 A;  1Z7T A;  1IW7 C;  5CV9 A;  4IZ8 A;  1II3 A;  1TY2 A;  2F3V A;  2A6E C;  4BA2 I;  2FMC A;  2ICE C;  4RH6 A;  3C3L A;  4K6D A;  3CRL C;  4ZYS A;  1B50 A;  1SND A;  5C0X I;  2XNA C;  4N9P A;  2NB0 A;  1Z6H A;  1OO9 B;  2K5Q A;  2B2V C;  3LWU A;  3ND8 A;  3QJY A;  2BCO A;  2IX0 A;  3X3N A;  2LFN A;  3LX0 A;  1B9N A;  3I72 A;  2K1B A;  5EJW A;  4G57 A;  2D62 A;  3E0J A;  4ZLT F;  3Q6S A;  1SE2 A;  2L4N A;  1QIL A;  5EGT A;  4OL7 A;  3D6W A;  2OEO A;  4XDX A;  1WTQ A;  1S5C D;  1T5X D;  3FKI B;  3M4O B;  4DN4 M;  4IUP A;  4H0L C;  1VMC A;  4BWG B;  1CZG A;  4DAP A;  3VR4 A;  1EZ6 A;  4L8J A;  2XRQ D;  3WOE A;  5KIX A;  2RVL A;  4RKL A;  4G4K A;  2A68 D;  1D5Z C;  1I50 B;  4R9W A;  1ZYR D;  4IUN A;  5CC4 A;  3MFG A;  5IGF A;  1BXT A;  5JAV A;  3C1E A;  5TSS A;  1SFO B;  4H13 C;  1ENF A;  1FYC A;  2B2T C;  4HAE A;  3TP5 A;  4M8A A;  5CYU A;  1EZ8 A;  2RSO A;  5FO9 B;  3PIP 3;  1LO5 D;  3MEH A;  3HP3 A;  2IX3 A;  5C44 B;  1I4Q A;  5EPK A;  5IGG A;  3IKJ A;  2PZU A;  4NP5 A;  1CK1 A;  1FR3 A;  4DF7 A;  3I70 A;  1I6H B;  3S1Q B;  2K7V A;  3H3V C;  1IHZ A;  2CHB D;  1WD1 A;  3FEW X;  4J8Q A;  2EOT A;  1VCI A;  1CI3 M;  5EPL A;  3Q22 A;  4WRD A;  4KHZ A;  4QF4 A;  3GQB A;  1BBX C;  2D2C C;  2DY8 A;  3MXP A;  1TQO A;  4RHS A;  3HOY B;  2ZT9 C;  3N6R A;  4RGN A;  3H6M A;  3A8J E;  5FO8 B;  2A6H C;  1JE4 A;  1SMY C;  1QOH A;  1RD9 D;  4OO1 I;  2EYM A;  2G9H D;  4CJ2 C;  1CA6 A;  2R93 B;  2QIL A;  2VB2 X;  4I7Z C;  1G2T A;  2A69 D;  3NWS A;  3K7A B;  1W6J A;  2AUJ D;  1EY4 A;  2C9O A;  4CHT B;  1JWS D;  3CRK C;  1G91 A;  2A6E D;  1F9R A;  5BN4 A;  3K59 A;  3DEO A;  2B8G A;  1XXG A;  4XYO A;  5AFW A;  3OMG A;  3T13 A;  3BDL A;  1WCM B;  4KV6 A;  5KND A;  5IGE A;  5A2Q E;  5EKK A;  3J80 E;  1M8A A;  1OXS C;  2F0V A;  3HRZ C;  1PDQ A;  1J9O A;  1LTS D;  1A3V A;  2O5J C;  3OIQ A;  2K28 A;  2X69 A;  1AZQ A;  1E2V A;  5FO7 B;  3Q23 A;  3QB3 A;  4IN3 A;  5D3I B;  1STA A;  1LT3 D;  4ZUI A;  2JEA I;  4Q0F A;  4DXF A;  2J0T D;  2RDH A;  4QMG A;  2L5T A;  3J81 L;  2IPK D;  4HED A;  4X3K A;  4NKL A;  1KNA A;  1QG7 A;  1CTM A;  1DD2 A;  5NUC A;  3DMU A;  2FHT A;  4LAA A;  1TWC B;  1RF2 D;  1EYC A;  4O42 A;  1DOK A;  1VDZ A;  3HGB A;  5C3X A;  3D4R A;  2X6G A;  2R3Z A;  3X3M A;  4DNT B;  3DEP A;  4TRD A;  4FF1 A;  1EIG A;  3BZD B;  3QWN A;  1Y8O B;  4XTC S;  3S15 B;  4EQO A;  1AN8 A;  5I4D A;  3S1M B;  2RQX A;  3MWY W;  1A3U A;  4A3J B;  2JXM B;  3VR2 A;  1SNM A;  4WFN 3;  1HQR D;  2XN9 C;  1EY7 A;  1DYQ A;  3P75 A;  3S2H B;  1JR0 D;  3E5S A;  3A7A B;  3Q0A A;  5COY A;  5J22 A;  4ZK9 B;  5G3L F;  1BO0 A;  2LKV A;  1Y1V B;  3G7L A;  2PO4 A;  2A6H D;  2F0E A;  2JA7 B;  4C3J B;  1Q3L A;  5CV8 A;  1HUM A;  1TY0 A;  2E74 C;  1ENA A;  1H9M A;  2EJF C;  3OIP A;  1I4G A;  2EJG C;  1VF7 A;  4XYQ A;  1D1K A;  2EY2 A;  1L0Y B;  1FNW A;  3QO2 A;  3MHB A;  1V8Q A;  1A15 A;  4C1N K;  3PUX A;  4KTA A;  4BS9 A;  1O7Y A;  2D9U A;  2ENB A;  5ELB A;  5EKI A;  2F3W A;  1JWM D;  4XQQ A;  3HOV B;  1Y8N B;  5E1F A;  1JCK B;  1Q8I A;  3MTS A;  1DXM A;  1GUG A;  2WP8 J;  1KAB A;  2RA4 A;  4IFD H;  4DNR B;  2SOB A;  1H9K A;  3QG1 A;  3E6Z X;  3ND9 A;  3SXH A;  4NMZ A;  1A2T A;  4HSV A;  4UDU C;  2EXZ A;  5F2D A;  2B8F A;  2NVY B;  1PRT F;  3A55 A;  2KJX A;  4M1U B;  3VYS A;  1HUN A;  1UAP A;  2Z4I A;  2RDF A;  1QNK A;  1ET6 A;  1G29 1;  1WD0 A;  2B2T A;  2YYZ A;  3MA2 B;  4RGM A;  2IJ0 A;  3DXJ C;  1RTO A;  5EPJ A;  1L0X B;  3NTK A;  3A8K E;  2KEC A;  1EFI D;  3VYU A;  2F0M A;  2A73 B;  3H09 A;  2ZXP A;  2CQA A;  5A2Q L;  1LLR D;  1T5E A;  5M5X B;  3L7Z C;  4A3G B;  3R3O A;  4K14 A;  2JEB I;  5K36 H;  3HS0 C;  4NDX A;  4PMB A;  2K03 A;  4AYB B;  1VF5 C;  1LTI D;  1U4M A;  5ELF A;  3U9O A;  1STY A;  4JBW A;  3TSS A;  2K32 A;  3HOZ B;  4FF3 A;  3I3C A;  2Q8R E;  1GUN A;  1OXT A;  5I2Y A;  4IFD G;  1PFM A;  1EYA A;  2VNU D;  4FO2 A;  4C3J G;  3CQZ B;  1B3A A;  1TS5 A;  1X32 A;  4Y7N B;  4Q5V A;  2E2J B;  4RKB A;  1JWU D;  3NE5 B;  5IOC A;  3R93 A;  2V4D A;  4ZRZ A;  2R7Z B;  4BA1 I;  3T56 B;  1ILQ A;  5FLX L;  5JEA G;  2E2H B;  4DFA A;  1C48 A;  2IWH A;  1WTX A;  4HSP A;  2WIN B;  4OGQ C;  2A74 C;  1HTL D;  2Z8L A;  4A93 B;  4K8J A;  3CHB D;  1CHP D;  1DJR D;  1ESF A;  3MXU A;  4K2K A;  1FNU A;  2EYH A;  5IGD A;  3FPP A;  4HMJ A;  4RCN A;  3SHL A;  1LTR D;  3S1R B;  1V43 A;  1STE A;  5E3F A;  3KLS X;  1LAC A;  1KTK A;  3S14 B;  3NTI A;  4B08 A;  3TZU A;  4C56 C;  3K5O A;  3OPO A;  1GXD C;  2PW7 A;  1EQV A;  4J6H A;  4KD4 A;  1HCZ A;  5KNC A;  4RHR A;  4QUC A;  3EVQ A;  1LT4 D;  2R61 A;  4RGO S;  1EWC A;  2BDN A;  1HPC A;  1FGB D;  2PZW A;  2VB3 X;  4KN7 C;  3GTJ B;  1I4R A;  5C3W A;  1BCP B;  3S2D B;  4DK1 A;  1BUV T;  1BR9 A;  3AU7 A;  2B2V A;  1V1P A;  1XX8 A;  5DEH A;  3LWE A;  4RWS C;  1B4O A;  1KLU D;  2QDB A;  5LL6 S;  1PTO H;  1MD2 D;  3RZD B;  3Q24 A;  2Z1C A;  2YU9 B;  4OHJ A;  3K58 A;  4HN7 A;  2EYP A;  3PUZ A;  3EFX D;  2NN6 H;  2MP1 A;  2OF1 A;  4DU9 A;  4FYD A;  3MC0 B;  1AZP A;  2QKI C;  1JOQ A;  2PMZ B;  3MZ5 A;  3BG3 A;  4V19 0;  2F0G A;  4RAU C;  2FJ2 A;  3TZD A;  3W3A A;  2NN6 I;  4IQZ A;  3FPU B;  2K6A A;  3EQL C;  1STN A;  4X3S A;  1HA6 A;  1ESR A;  5ELD A;  1KLG D;  3DHQ A;  4OO1 G;  1SDF A;  1F9S A;  1QNU A;  4L6T B;  5JVH 3;  2EE1 A;  5D14 A;  3BYY B;  3KLR A;  5JEA J;  2HUG A;  1ZXT A;  2RKS A;  2NTT A;  2JYO A;  5J1Z A;  2B63 B;  3H91 A;  4ID6 A;  3NBI A;  3SK8 A;  1NR2 A;  2K04 A;  2JA8 B;  2F0K A;  4HTH A;  4EVO A;  2K33 A;  1H9S A;  5ELE A;  1K8M A;  2EY1 A;  3NXW A;  1GUT A;  4E6I A;  1LV9 A;  1EWH A;  1PZJ D;  1JC7 A;  2B2Y A;  3V96 A;  2A68 C;  2IL8 A;  2Z4H A;  1U9R A;  1NUC A;  2XVS A;  5DM7 3;  1BDO A;  1PTO B;  1OXX K;  3OSO A;  4R8I A;  5IOD A;  4A3B B;  1E2W A;  1PZK D;  1NCV A;  5CV6 A;  4OIK A;  3OWF A;  4G7Z C;  4DA2 A;  4F87 A;  4K2L A;  3M85 A;  2DNC A;  2SNM A;  1ZEQ X;  1TWA B;  2DN8 A;  3URY A;  3FRP B;  2R6G A;  4ULL A;  1HHV A;  3I8Z A;  2F4I A;  2H4O A;  5EBD A;  3NHH A;  5T1I A;  2HCI A;  2F0D A;  3GTQ B;  3K5L A;  1PFB A;  4EGV A;  3I73 A;  5ELC A;  2B2U A;  2PZT A;  4F7X A;  2B2W A;  1HTP A;  3IL8 A;  3N52 A;  1D1I A;  3DUZ A;  3H94 A;  5FKA C;  1EEF D;  3DWP A;  1V1O A;  3MAQ A;  3FVQ A;  3BS1 A;  1STH A;  2C5C A;  3A8I E;  3SDZ A;  1F2Y A;  2B39 A;  1I4X A;  1TR5 A;  1D6E C;  1S4Z A;  3PUW A;  1S5B D;  2KEE A;  4Z9C B;  2EZV A;  2E2D C;  1F2L A;  2F0U A;  2NWG A;  1RHP A;  3P20 A;  2F0W A;  4OO1 H;  1GUS A;  1GUO A;  1XWE A;  3PIO 3;  1DZ1 A;  4XXE A;  1RDP D;  5DAU A;  4KJN A;  1C8C A;  1H9R A;  1IKM A;  2FFK B;  3P7J A;  4K5X A;  1F77 A;  2AQ2 B;  4KN4 C;  1KDC A;  1DON A;  2EYF A;  5EBC A;  5FK9 C;  3CU7 A;  1UUP A;  4HCS A;  5K36 G;  4P2C B;  2L55 A;  1G8Z D;  3VA7 A;  3HKZ B;  1RKN A;  2HCC A;  1WTO A;  2I07 B;  4NW2 A;  1PTO D;  2WKD A;  3RMH A;  1G6Z A;  2DNE A;  5CMD A;  3K0Y A;  1UEA B;  2E75 C;  3SK4 A;  2KOL A;  2KA7 A;  4CGY B;  1C4Q A;  4CJ0 B;  1MBY A;  1YNJ D;  3K57 A;  3MXN A;  5C5M A;  3BDO A;  1M4V A;  3TN2 A;  1PRT B;  4H7B A;  2F0L A;  5I6Y A;  3D4D A;  1LAB A;  4XQN A;  1SXT A;  4N9T A;  2KHS A;  3G6J B;  5M3F B;  1SYF A;  1A3T A;  2AWO A;  1YNN D;  3FMC A;  3PO3 B;  4MHE A;  2I46 A;  3I4L A;  1DOM A;  3GTK B;  1R4Q B;  3NWT A;  4IFD I;  3NK9 A;  2PW5 A;  3GTO B;  4C2M B;  2AUK A;  5CBA E;  2EY5 A;  1WTP A;  2PQE A;  2GA4 B;  4C1N I;  2EDG A;  1R4P B;  1SNO A;  4IUV A;  5K5P A;  3NBH A;  2JA6 B;  1TKW B;  1H9S B;  1E0B A;  2F0S A;  5JPN C;  2PPB C;  2LY7 A;  4RA8 A;  3J7A V;  1X3P A;  4ZKC B;  5I6W A;  4PMW A;  3BVG A;  5HUR A;  2D5D A;  1Q1E A;  3QIA A;  1TWH B;  1RCV D;  3TME A;  3VA5 A;  1CT1 D;  5LHY 1;  5M3M B;  1PYW D;  1SAP A;  4LMQ D;  1TS4 A;  1U4R A;  3U9S A;  4DAV A;  5IT9 E;  4C3H G;  4BY7 B;  2JA5 B;  2A69 C;  1SYC A;  3J7Y W;  1OXU A;  2E2I B;  3GTG B;  4KKU A;  4B9X A;  3A54 A;  2SNS A;  1JB3 A;  1B9M A;  1SE4 A;  4MN3 A;  4FP5 D;  2EYO A;  4CKC A;  1WVL A;  3K5M A;  3SR1 A;  3M4Y A;  3PO2 B;  1F2M A;  1MGS A;  3DWQ A;  4XIG S;  2KUM A;  1BCP C;  3D3R A;  1EYD A;  5CV5 A;  3TDQ A;  2XIW A;  1K83 B;  2SDF A;  4TSS A;  3I4M B;  3NUC A;  4ABN A;  4FNF A;  1O7Z A;  2AWN A;  1IKL A;  5CV7 A;  2QF7 A;  4X3U A;  2KVM A;  3HOW B;  1X3Q A;  3W2D A;  1TWF B;  1Z47 A;  4JK1 C;  3GTP B;  2LMC B;  5G3L D;  1O78 A;  3H0G B;  4IAL A;  2J4X A;  3QOL A;  1SSO A;  2B2Y C;  1R9T B;  4A3E B;  1ZYR C;  1V1P B;  1S5D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...