1PMRA

Lipoyl domain from the dihydrolipoyl succinyltransferase component of the 2-oxoglutarate dehydrogenase multienzyme complex of escherichia coli, nmr, 25 structures
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
80
structure length
80
Chain Sequence
b'SSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAVLEDEGTTVTSRQILGRLREGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOYL SUCCINYLTRANSFERASE
publication title Three-dimensional structure of the lipoyl domain from the dihydrolipoyl succinyltransferase component of the 2-oxoglutarate dehydrogenase multienzyme complex of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 2
structure length 80
sequence length 80
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pmrA00
2A6ED 2EJFC 3PUWA 5C0XH 3ND8A 1OXTA 1OXVA 1B9NA 1YNJC 3NE5B 1I6VC 4I7ZC 1TU2B 3SE0A 1HPCA 5BN5A 1G291 2EDGA 3VR2A 3A8JE 4IQZA 2A6HC 3CRKC 4DNTB 1DXMA 1Z6HA 5KNDA 4JK1C 1H9MA 3A7AB 4DK1A 1O7LA 2ZT9C 3CRLC 4KN4C 1LABA 3T56B 2EJMA 5KNCA 2AUJD 3VA7A 1CTMA 4GZYC 1V8QA 3PUZA 1ZYRC 3PUVA 1GUOA 5C0XG 3M85A 2A69C 4LJZC 3TZUA 3IFTA 5BN4A 3T53B 2B8GA 3GD7A 4H0LC 4TKOB 2Q8IB 2PPBC 1CI3M 4H44C 4IFDH 2DN8A 2JE6I 1SMYC 1H9RA 2EJGC 4KN7C 3VR3A 4G7ZC 3OOCA 4HR7B 1GJXA 2DNEA 3FMCA 4XIGS 2PNRC 4OO1G 5A35A 1ONLA 3PUXA 3H94A 3A8KE 2D2CC 3ND9A 2NN6I 4KKSA 2A6EC 3N6RA 2DNCA 3A8IE 1IYUA 1VDZA 1CFMA 1E2VA 1TKWB 3M4YA 1H9KA 1E2WA 1Q1BA 2L5TA 4IFDG 5K36G 2BE5D 2AWOA 2CW0C 3I73A 3MFYA 1Z7TA 1O78A 1IW7C 4BA2I 4OO1H 1Y8PB 1GUTA 1Y8OB 2EVBA 3I4LA 4TQUS 2JEBI 4KKUA 3OPOA 1OXXK 3QIAA 3DXJC 3LWUA 1Q90A 2LMCB 1B9MA 2JXMB 3A7LA 4KMUC 4JBWA 5K36H 2A6HD 2E75C 1BDOA 1ZKOA 3D31A 3MXUA 3OW7A 1T5EA 3RLFA 2BDOA 3U9SA 3SDZA 1HCZA 2YYZA 3PV0A 1H9JA 2NN6G 1E2ZA 3P20A 2KCCA 3HGBA 1FYCA 1IYVA 3GQBA 2AUKA 1OXUA 2O5IC 1HQMC 3VR4A 3KLRA 1Y8NB 3BDOA 2BA1A 1H9SA 3FPPA 3M7NA 2A68D 2JEAI 4KKTA 4G7OC 3EQLC 2NN6H 2D62A 2E76C 1DCZA 1GUGA 1GUNA 1OXSC 1YNNC 4LK1C 4RCNA 3VR5A 4DK0A 1GHKA 5JEAH 3T51B 4PV1C 2K33A 2BE5C 1HTPA 2K32A 1GHJA 2K7VA 4XTCS 4H13C 3QG1A 1Q12A 1PMRA 1DD2A 3WDNA 4BA1I 1H9SB 1VF5C 1A6XA 4OGQC 3D4RA 3L7ZC 5KNBA 1Y69U 4KHZA 4DNRB 1IW7D 2E74C 2R6GA 2QF7A 4KI0A 1Q1EA 1QJOA 5JEAG 1VCIA 3AB9A 1K8OA 2A69D 1VF7A 1EWHA 2PCFB 3QJYA 2F1MA 1FR3A 4L8JA 1LACA 3IKJA 2IT1A 3VR6A 3LNNA 3W3AA 2O5JC 1V43A 2V4DA 1GUSA 1K8MA 2KA7A 4G7HC 3BG3A 2D5DA 3PUYA 2A68C 5BN3A 2BA0A 2B8FA 3I72A
chains in the Genus database with same CATH superfamily
1PFBA 1OXTA 3HOXG 1WOCA 4RG1A 5LMNW 4DUZQ 1PRTC 2Z6BA 4YCVA 1U4LA 1X3GA 3VDYA 4R4OA 4FF2A 5HGQA 1EIFA 5KNCA 1SYGA 2ZJRA 1CTMA 1X3PA 3TZUA 4R9WA 3PIOA 4UPAA 3TBIB 3SVMA 3W1GA 1HZ9A 4R4CA 1PLFA 3KUPA 4NKLA 2EIFA 1I4HA 2MGSA 1I4QA 3H94A 4MTKA 2EY2A 5ELFA 2EYMA 1HNWL 3HOXB 3MAQA 2L5TA 5F2DA 1UE1A 4GKJQ 4JVZA 2EVBA 2MO1A 1R9TB 5FOBB 4KKUA 3E3XA 3D0FA 1EQTA 4IURA 5KEEA 1B9MA 1IL8A 4AQYQ 4K2LA 1Y1WG 1BDOA 1I4GA 3OTOL 1HCZA 1E2ZA 4DF7A 1F2MA 4CKBA 2R92B 5JJIA 1DJRD 1Y8NB 2X69A 3FKIG 3U58A 2F4IA 1JJGA 2Z6KC 4OIKA 5HY6A 1GUNA 4C3JG 4RCNA 2JP1A 3BVZA 1CA6A 3T51B 3GTQH 4LMQD 1M8AA 2BE5C 1GHJA 2KEEA 4N8FA 3Q23A 1O7YA 1I3QB 3DUZA 1DD2A 4HJ7A 4BA1I 1A62A 3NTKA 1QB5D 4DUYQ 3FRPB 3L7ZC 5EKIA 3UE0A 3RD4A 1JB7A 2BOSA 3IAYA 1Y1WB 1Q1EA 1VCIA 1VF7A 1UE5A 3ZYYX 1UAPA 3S2HH 2IT1A 1MD2D 4IUVA 4JBKA 3FKIB 2A68C 4A93G 3BDCA 3I72A 4C3JB 3HG9A 2R93G 3G48A 5GROA 1YNJC 1I6HB 3SEBA 1KL9A 1YNND 1IZ6A 1FGUA 1FNWA 4KY7A 5FLXc 1EYCA 1QZHA 3K7UC 4X6AH 2NVYH 1PYWD 3VA7A 1HTLD 1V8QA 3NHHA 3D4WA 2MQHA 2MO0A 2NUCA 3CW2C 4GLAC 1AE2A 1ML0D 2WKCA 2NWGA 3PIPA 3RZDB 3GV6A 1P16A 4N8X1 2M00A 3OMCA 4DV5Q 2JSOA 3FMCA 1ICFB 2B63G 3PO2H 1S4ZA 4DAMA 2D2CC 2A6EC 2HCIA 1HHVA 3A8IE 1IYUA 2WACA 2R93B 3E0EA 1PHJA 1PFSA 4DV7L 3H91A 2WAQG 3UDGA 1AH9A 1IHZA 4DV4L 1J8IA 5IWAQ 2JA6H 1JJCB 1HH2P 3TEHB 2XRSD 1AEXA 1STAA 5CYUA 1LT4D 4DNIA 4BY1H 1WTRA 5EAYA 2IWHA 2N55A 1O80A 2QEJC 4L5TA 1SBBB 1HQMC 3AU7A 3BDOA 3W5OA 2B63B 1PH8A 3MWYW 2L11A 3MC0B 4NDXA 5IP9G 1CA5A 2UU9Q 1S3OA 2B2TA 1OXSC 5ELOA 4YHHL 2K05A 2E8GA 4U68A 3CF5A 1HJPA 2K5DA 3MFGA 1B53A 2K33A 1HTPA 4KY5A 2JYOA 5GAHC 1W6KA 1PRTD 1BBWA 1AE3A 4IFDJ 5C44H 1PH5A 3A56A 1CHQD 5C3EH 5C4JH 2VUMH 2F0FA 2PQAB 3FPUB 1PH4A 5EJWA 2VXWA 4L63B 3GTOH 1I5FA 1PTOH 3EA6A 1VQIA 1GO3E 2CQAA 4TVAB 4BBSG 1WTOA 2G9DA 2KUMA 2JA5G 2ICIA 2R7DA 4IUPA 3MEFA 1K8MA 3PF5A 1IXRA 1SJHD 3PUYA 3T1YL 1JQYD 3KYHC 3SE0A 1TY2A 3J7A5 4HN7A 1U4PA 3PUWA 1DZ1A 1WTPA 3B6YA 3GTPH 4OO1I 4DNTB 2B2WA 3JAML 1TWAB 5J1ZA 4DA2A 2FJ2A 4G57A 5DNFA 4JI0Q 4UP8A 4YWMA 2AUJD 2FXQA 1I4XA 2L4NA 5G3LF 1WVLA 1K8AC 3TP6A 4JBMA 3MA2B 3M85A 5IT9L 2B2YA 1F2YA 3CQZH 1UUPA 2B8GA 3GD7A 4WJ4A 4GN5A 3J7ZC 1CI3M 2JA5B 1XYIA 1TWHB 2XNAC 3VYTA 3T4AC 2ZXOA 1V1PA 3J81E 2CCZA 1QNKA 3A8KE 2VZAA 4CDCC 1YNXA 3CKIB 2L15A 2OEOA 4GNXB 4IPGA 2BE5D 2Z0SA 1HNXL 1FJGL 2R61A 4IUQA 1B8AA 5ISRA 4DR5Q 1I4PA 3K0XA 2SOBA 3RR5A 3JAMi 2KHJA 4A3KH 1Q90A 3HOYG 3DWAA 2EYLA 3F8TA 3KF6A 4JOIA 4DV1Q 3WWVA 1G2TA 1XMQL 2HQEA 3VA5A 3CMAA 2NZ1D 5I4DA 3AFPA 1T5EA 1LT3D 1H9JA 5IYCH 4QL5A 1A63A 1B1ZA 4A3EH 3S1RH 1ZYRD 2UXCL 1MJCA 3I4OA 3SK5A 2FMMA 2RA4A 4V190 5IGDA 3S17B 5LMNL 3M7NA 2A68D 1Q3LA 2K14A 4DR1Q 3CAMA 3QB3A 2ES2A 1KNEA 1VS0A 4K2KA 1YNJD 5M3FG 2F0DA 1NUCA 4FF1A 4BXXH 5DAUA 4IJLA 4FO2A 5M5YH 2BH8A 1H9SB 3OW2A 5FJ8H 3C2PA 4XDXA 3HOYB 1N9WA 2R6GA 2DGYA 1D5MC 4BBRH 1C9OA 3HOWH 3I4MG 4Z9CB 1VQOA 1D1IA 2K01A 3GTQB 4X66L 1QZGA 1B70B 1GUSA 4JI4Q 1FVIA 1EYDA 1X56A 2MP1A 1N32Q 4A3BG 4A3MH 1WFQA 3WOFA 2A6ED 4DV5L 4ZLTF 4X3TA 5A2QE 1EL0A 1TU2B 1VMCA 5BN5A 1G291 1KDAA 4EX5A 4ZRZA 3CRKC 4LAAA 4POGA 3EBEA 1QG7A 1IL2A 4Q5VA 1EY0A 3NTIA 1RHPA 4IFDI 1NY4A 4C56C 3I4MB 4JI6L 5C0XG 2ID0A 4OWWB 2N78A 3RLNA 4POFA 3N52A 5IGBA 2G5DA 2XVSA 4OHJA 3NWSA 1XNQQ 1PH2A 5IE8A 4RMFA 3K81C 4JI5L 4DKAC 3PCOB 1TS3A 1VDZA 1ESRA 1HRJA 3G71A 3FEWX 1V1QA 4OXPA 1ASZA 1Y8OB 3HKZE 3RN2A 5I6WA 1PH1A 3CCMA 4NXMQ 3H0GG 4C3HH 4IPCA 4IOAA 1I94L 4KV6A 2K28A 5GAGC 4IJHA 5M3MH 4IZ8A 2Z8LA 2ZXPA 2A74C 3WOEA 4DK6C 4PQXA 1IKMA 2IPKD 1SYEA 1L2FA 2KCCA 4AIMA 1N8RC 2QEXA 2AUKA 4K5VA 1QCBD 4ILWA 1HR0Q 2BA1A 2K5VA 2NVXH 3FPPA 1CKOA 2NN6H 2D62A 4IO9A 4Y52H 4ULLA 1PFMA 4K6LA 5KRUA 4JI7Q 4XTCS 2NBFA 3HKZB 3BJUA 1Q12A 3K5NA 4BY1B 1G91A 2MJ8A 3U4VA 4UHVA 1LLRD 3D4RA 1MKHA 1U5KA 2VS1A 1ASYA 2AHOB 3NEMA 2E2DC 2E74C 3C1FA 5CR3A 2IX3A 1K8OA 1A15A 1HNWQ 1QUQA 1KAAA 1CT1D 1FR3A 2PZWA 4GOPA 3DM1A 4NB3A 1S5CD 4NW2A 1TIID 2KA7A 4JPBW 5FK9C 2NVQB 3URYA 1IKLA 2LFNA 2VQEL 2K75A 2EZVA 3GTGH 2DY8A 4YCWA 2EJFC 1SLJA 3ULPA 4X62L 3KJOA 5M5WH 3OTOQ 4R4QA 1WD1A 4A3JH 3DLLA 1IBML 1BVSA 1P8LA 1Z47A 4JBJA 3RLOA 2PPBC 4IFDH 4B3MQ 1SAPA 1H9RA 4KLKA 4KN7C 3V05A 5IGEA 2AQ2B 1JR0D 4A3GG 5C4ZA 1GJXA 1EY4A 5A35A 4C3IG 5E3FA 1J6QA 2FFKB 1QNUA 2KCTA 4A3IH 1FNUA 1H9KA 3J81j 1WTHA 1L0YB 1U4MA 1ESFA 4P74A 1AN8A 4DR1L 2EQSA 1KAWA 4GNXC 4WJWA 1A2UA 5DEHA 5EQ0A 3BZCA 1PH6A 1B4OA 2F0UA 1TS4A 2IW3A 1NR2A 3H6MA 3SDZA 2YYZA 3R2TA 3LGJA 1ICWA 4A3DG 3NBIA 3P1HA 4A3GB 5L37A 4DV3L 4DR6Q 4C3IB 3P7JA 4BY7H 5EPLA 1OO9B 1DCZA 1YNNC 2A73B 2JA8G 4A3KB 4LF8L 1X6OA 5JPNC 2O4XA 2F0TA 3AQQA 2DUDA 3ERSX 4BBRG 2AKWB 4B9XA 1EWIA 2F0LA 2X6GA 1KLUD 5JAVA 3CP0A 5DM73 2J7ZA 4OIJA 4DV2Q 4S3SA 4QIWE 2UUCL 1F2ZA 4J15A 1Y1VG 1JCKB 4LUOA 3I8ZA 4DV7Q 1NR4A 3VR6A 4DV4Q 1MHWC 1JJ2A 5M5YB 4QMGA 2I5HA 4LUZA 4QJFA 1XNQL 1DOMA 3M4OH 1HFGA 1KC8C 3NSWA 2B29A 4BBRB 3H3VC 2KOLA 3HOWB 2CWPA 4F7XA 5FLMH 5KNDA 1CUKA 2DY7A 1H9MA 3A7AB 5CC4A 3CRLC 4KN4C 2AMCB 2NZOA 4WORA 3NPPA 1DONA 4QUCA 4QIWB 2R7ZG 2MNAA 4NXML 1Y1VB 3TDQA 4A76A 2EXZA 3RUZA 4DN4M 4B3SL 4YY3L 4K6DA 3NWTA 3PUXA 1QVCA 2PQEA 5D3IB 4EQ5A 1XPOA 4U673 3X3NA 1TKWB 3PSIA 4P75A 1HR0L 2PO4A 5IGCA 3G6JB 4N9TA 1TQOA 2F0GA 1EU4A 5IP7G 4KJNA 1V1PB 5ELCA 1EY5A 1WCMG 4JI7L 3S24A 1SXTA 4ZK9B 1SFOH 2KVMA 4XYOA 2H4OA 2R7ZB 2K5WA 3E9IA 4JCVE 3T1YQ 5K36H 3S1QH 2NZHA 5JJZA 2R92G 4K8IA 2E2HB 4K0KL 3G7LA 1LM0A 3KDFA 3NXWA 1CM9A 2BCOA 3A5ZB 4R8IA 2NN6G 3I3CA 5JPMC 1BOSA 3Q6SA 1SNQA 1PVOA 3VR4A 3KF6B 2GA4B 1D2BA 1BO0A 1U0LA 1YJ9A 1WTWA 4DR7Q 4DK0A 4C3HB 4P71A 5D14A 2L0CA 4DR3L 4ZYSA 2OQKA 2G9HD 1PXUA 1PZID 1EY8A 1E0BA 5JJKA 1WCMB 1VF5C 4OGQC 3HEJA 3U50C 3TN2A 1AP0A 4Y7NH 4F87A 3ULLA 4JI1L 5H1SE 2NVXB 2EPBA 3SGIA 2J0TD 1LT6D 4J8QA 2UUAL 2JN4A 3IKJA 5IYDG 3LNNA 1HNXQ 1FJGQ 1GOZA 4LWCA 3KF8A 2E5LL 3EN2A 1YEZA 4B3ML 4A3JG 2BA0A 2Q8RE 4JI2L 5FKAC 1K83B 1XMQQ 2DJGC 3Q24A 4FXKC 1PH3A 3FDTA 2EDGA 2K52A 1IBKL 4HSVA 2C5CA 3S2DH 1B2TA 2UXCQ 3RN5A 3FHWA 5T1IA 2ZT9C 4ZQ3A 3T56B 4B08A 2EJMA 5I9PA 5LMNQ 1ZYRC 3AEVA 1I50H 1R4QB 1CKNB 3NTHA 4XQJA 1VQEA 4PZ7A 4LF4L 1D5XC 3I55A 3VYUA 2F0JA 2DNEA 2OXPA 1X54A 2F0PA 4LF7Q 4JYAQ 3J81L 4A3JB 2XWJB 4B3RQ 5C4HA 2DNCA 2VB2X 3M4YA 2NYZD 4DR6L 2R3ZA 3CCRA 2BH2A 1LTID 2CW0C 3MFYA 4OWTB 3C46A 1MI2A 1TS2A 2XGTA 2JEBI 4X66Q 1OTCA 2EXDA 3KLWA 1XPRA 2XWBB 2AQ1B 3LWUA 3I7FA 5CV4A 2SNMA 5CV8A 3QWNA 3CCVA 4LF5L 3HZXA 2M9VA 4IN3A 4LFCL 4BY7G 1VQNA 2KBNA 3BZKA 2IHFA 4DV2L 4A3IB 4RGTA 2F0HA 4CKEA 1N36L 4B3TL 2UXDL 1A0IA 4MNOA 2QDLA 2MFIA 5EKKA 3J81i 1CZWA 1KIXA 3K57A 4A3FH 3RZOH 3ONAB 4IALA 5CBEE 1ENCA 2DJFC 5JEAH 4JI6Q 3M4QA 4EQPA 3NUCA 1E22A 1D1KA 1QVGA 1ET6A 1ENAA 5COYA 1E7ZA 1K0RA 1F9PA 4RGOS 4C2MB 3EVQA 3TQYA 1QE6A 5T1GA 1M90C 4JI5Q 4X3KA 5C4XH 1VQBA 3EJIA 2B2TC 3HOUG 1YHQA 4BY7B 4L8JA 3MVVA 2HHHL 2RBMA 3JAMc 3V96A 5CBAE 2O5JC 5HGTA 1PDQA 2F0NA 1SNPA 2D5DA 2F0IA 4G4KA 2ZM6L 5M9OA 5FLMG 2XRQD 4AH6A 3CPWA 1QUQB 3UDFA 5IT9c 1YI2A 5A2QL 1I94Q 3M7GA 4WFN3 4GOPB 4L5QA 1C7YA 3J80E 4HMIA 1D5ZC 2VW9A 4IQZA 2NVTB 2JA7H 5GAEC 1TY0A 1HNZL 3GTKB 4JK1C 5IOCA 2JA9A 3GTJB 1EY9A 1HA6A 2O2LD 4H02A 1VQPA 3C3LA 3S16B 1AFPA 3D8GA 2OQ0A 1UE6A 1VQ8A 1S72A 1SSOA 1NTGA 3PMFA 2SEBD 3HOUB 3DMUA 2QW7A 4GN3B 5BN4A 5E7NA 4H0LC 3M4OB 1Q8IA 1XMOL 4HR7B 1PH9A 5JJLA 3CMEA 4RGNA 3PO3H 5JOBA 4O0AA 3S15H 3N6RA 3HOZH 4HJ9A 4JC0A 1PTOF 2CWAA 3O13A 3OHXC 5K36G 2B2YC 4MN3A 4DR7L 4HCSA 3PQIA 2N49A 2ZXRA 4AYBE 3T1HL 2WB1G 2CQOA 2WB1E 4R8NA 2QCPX 3DXJC 1K28A 4HAEA 3T16A 4XQQA 3CU7A 3A5UA 1F9SA 3MHBA 2VQEQ 1ZKOA 1AW7A 3H09A 2A8VA 2BDOA 3CC4A 1BCPF 4X62Q 3K80C 1FYCA 1TVXA 1NBWA 4MTNA 1PFNA 4A3CH 2F0OA 1MIUA 1IBMQ 2HUGA 3U9OA 1EQQA 4KKTA 4JOIC 4KHPQ 4EQNA 1EFWA 4F8MA 1SFOB 2K7VA 3BU2A 3NELA 4PZ8A 4J6HA 3S1QB 5EBDA 3UI2A 4AYBB 3GO5A 4Q0FA 5I9OA 3TP5A 2WB1B 1VQ9A 1EEFD 1LV9A 5KNBA 1D7QA 1MSHA 1Z9FA 3DEPA 1IW7D 4RFBA 4PMCA 3L3OC 4KI0A 2RF4A 5G3LD 2F0SA 1KDCA 1SYFA 1RCVD 3QJYA 4KD3A 2GN5A 4PG3A 2NTSA 1XWEA 1V43A 5CV5A 1SE8A 1RIPA 3DM3A 3STBD 2F4VL 4RHRA 3TS0A 4CGYB 1IYJB 2F52A 3M4PA 2ASBA 1CSQA 1OXVA 4LF7L 1B9NA 2IX0A 4NXNQ 4BA2I 4JYAL 4UY8C 1KXLA 1HPCA 4Y7NB 3VR2A 2CW0D 3RNUA 2D0PA 4B3RL 1NJIC 1TWFH 2B39A 4ME5A 2PW7A 2B2VA 2LY7A 4FF4A 3I4NH 4DV3Q 1Y14B 4EQOA 1CKMA 4JW0A 1VQDA 4P72A 4OWXB 5JVH3 3T53B 4LF8Q 1E1TA 4K5WA 1SMYC 4PMBA 1RJTA 3BVMA 2JQOA 5FLXE 4G7ZC 4JG2A 1NNXA 1EY6A 4DXFA 4QF4A 4CJ1B 1CKNA 3DEOA 5D65A 2HCCA 2UUCQ 2RQXA 3S2HB 2N88A 1Z7TA 1O78A 4OO1H 5I2YA 3D6WA 5C3WA 3S1MH 5C5MA 3TS2A 4FP5D 3PO2G 1ILPA 2LMCB 2N8NA 1WTVA 2RCNA 4KMUC 3CC7A 3TP8A 1X3EA 1L1OA 1RD9D 3MXUA 5IY0A 5NUCA 1EY7A 1IYVA 1FNVA 2I07B 2JA6G 2YTXA 2ZTDA 2P5ZX 3ER0A 2NVYB 2K04A 1NMGA 1MSGA 1SNMA 3KDFB 2ATWA 3HKZG 3GDEA 4NMZA 2KCNA 4BY1G 1UEBA 3U4ZA 3UDXA 5EPKA 5LMUL 3QG1A 2NTTA 4YWLA 2PZUA 3DWQA 3PO2B 1Q81C 4B3SQ 4YY3Q 3A74A 1TWGH 1M4VA 1WYDA 3K7AH 5IYBH 3AB9A 2YU9H 4DK3C 1HZBA 4FNFA 2PCFB 2EYOA 3HOXH 4A3FB 1XJVA 2BDNA 2JA6B 1BF4A 5C44G 1N33L 1R9TH 2FMCA 4G7HC 5C3EG 1VQKA 2F0WA 2VUMG 4OELB 3X3MA 2JA7G 3R93A 3IRBA 3KLSA 2VQFL 1Q86C 4K0KQ 5C4XB 1PH7A 4PMWA 3KF8B 1PYSB 4P2CB 3ICEA 3H15A 1K9MC 3EFXD 4DK1A 2UUBL 3JC66 1W2BA 1HUNA 4XQNA 1MGSA 4GZYC 3E5SA 1GUOA 2Z4IA 2A69C 4LJZC 1LYLA 4DR3Q 1O7ZA 4DR2L 4MZ9A 3P75A 4H44C 3GP7A 4IPHA 2D9UA 4ZUIA 5C44B 1PZJD 1I3QH 4ZAIA 3VR3A 1YJWA 4TSSA 5ELBA 5C4JB 5C3EB 2EY6A 2VUMB 2JA7B 4CJ0B 1S40A 3GTOB 1PTOB 2YV5A 4LW1A 1K73C 1CFMA 1SJED 1Y1WH 1BBXC 4JI1Q 3KOJA 3NENA 1CK1A 4XT1B 5IGFA 3PGZA 2F0MA 3OWFA 3HFZB 2UUAQ 1X3FA 1QVFA 2CH4W 3K58A 4KHPL 5KGUA 4TQUS 1J5EL 2QKIC 5AFWA 1EYAA 5I2XA 1HXYD 2E5LQ 3PF4A 4BS9A 4XYQA 1BCPB 3OW7A 4JI2Q 2LKVA 3U9SA 5BR8L 3S15B 1JWUD 5E4WC 1LTAD 1B7YB 4KD4A 4DAVA 3GTPB 5C0XJ 1F77A 1IBKQ 3S9WA 1XNRL 2A19A 4A3KG 1RF2D 4DAYA 4DR4L 2E76C 4LK1C 2KEDA 4BWGB 2TMPA 1XPUA 3CQZB 4L6TB 3Q22A 5IYCG 1XTDA 4A3EG 3OSOA 1JMCA 2UXBL 4LF4Q 1C8CA 4NXNL 1Y69U 3S14H 3QOJA 1X32A 1K3RA 2C9OA 4DNRB 5AJ3L 4A93H 3TMEA 2ZTEA 3KBGA 3BVGA 1B3QA 2R93H 4LNQA 4BXXG 3TZDA 2NB0A 1EU3A 1LACA 1SMYD 1F2LA 1QWYA 4LF6L 5FJ8G 3E0JA 3F2DA 1SR3A 3DHQA 1W3SA 1B44D 3BG3A 1E3PA 1LT5D 3R2IA 5BN3A 2B2UA 4I7AA 1VMPA 3HOWG 1LO5D 4LF5Q 2PW5A 3NE5B 4DV6L 1XTCD 3MXPA 4A3EB 3S1RB 3NP8A 4LFCQ 2A1AA 1A3TA 3UDIA 2RHQB 5IIFA 1JOQA 1N36Q 4B3TQ 2UXDQ 1G6PA 4A3MG 2B63H 3NBHA 2E2IH 1EFID 4L5SA 4RH6A 1J9OA 2TSSA 3MXNA 2LS01 1B50A 1LTBD 3TP7A 1JT8A 3K5LA 1O7IA 2EJGC 1ZXTA 1TT2A 4CDDC 4HMJA 2PNRC 2RSNA 4OO1G 1CZGA 1TWFB 3IL8A 1CSPA 3ND9A 1LTGD 4OONA 2HDLA 4HEDA 2KHIA 3I73A 1SROA 3I90A 1GUTA 2ALYB 3I4LA 2HHHQ 3H3VI 3OPOA 4UDUC 2CH4A 4A3MB 1L0WA 2OWOA 5IP9H 2ZM6Q 2A6HD 4GS3A 2IX1A 4X65Q 1KDBA 4HCEA 4UP7A 3K59A 1NAPA 4QY7A 3HGBA 4ZUJA 4JV5L 2LSSA 2MUYA 1TWAH 4C3HG 1HNZQ 2IY5B 3MZ5A 5M3MG 1JORA 3S1MB 3IFDA 3GTMH 1GHKA 1NCVA 1DGSA 2MHVA 2Z9HA 5M5XH 4BBSH 2EY1A 4FVMA 3HKSA 1UNSA 3I2ZA 1N34L 3L2PA 4RWSC 2JA5H 3ZJYC 4L5RC 2K5QA 2N3SA 1JB3A 1TWHH 3AFQA 2F0KA 1XMOQ 1Q8KA 1C48A 4ID6A 1TXYA 2A69D 4APVA 2F1MA 1EUJA 2IL8A 3F1ZA 1D6EC 2ZJPA 5C0XI 3T1HQ 4KJOA 3ULJA 4CHTB 5M3MB 1MBYA 2OF1A 3CPFA 1YIJA 4O2DA 1TWGB 3J80L 3K7AB 5E4XA 5ELDA 5KYIA 2YU9B 1KRSA 1Z6HA 3I70A 3K0YA 4ZKCB 1EQVA 1VQ7A 1O7LA 4YIJA 3J81c 5CGKA 3S17H 2FINB 1UEAB 4QB4A 5E1FA 3KBXA 1KABA 3OWEB 2JE6I 1XX8A 2PI2A 3I91A 4XXEA 1JWMD 3KLSX 1JC7A 2LXJA 1GD7A 1RTOA 3HOYH 3M3YH 1EEID 1STNA 3F2BA 3T13A 2EY5A 3HOVH 4QUFA 4JI8L 4IFDG 2AWOA 1PTOC 2EOTA 2EYHA 4YCUA 1IW7C 4XT3B 3J80i 1E1OA 4PZ6A 1M1KC 1SMXA 2F4VQ 2Z6KA 4A3LH 2KHSA 3BDLA 1EZ8A 3GTGB 4X3UA 4A3IG 3H3VH 2WINB 3D31A 3STBC 5M5WB 1X3QA 2C35B 2EE1A 5M3FH 3J7YW 1BCPC 1RL2A 2K50A 5CORA 1EYGA 3OMGA 4FXDA 2HT1A 1K0SA 4DFAA 2OTLA 1H95A 1EQRA 2GVAA 1L1OB 2EYFA 1WI5A 5EKLA 2WIIB 3I4MH 3CHBD 4QCLA 1LTLA 1D8LA 2PYKA 4X64L 1A8VA 3OIQA 5CV7A 4R4TA 4ODGA 3GTLH 3V2TA 2VY3A 1SN8A 1PA6A 5J3BA 4LUVA 4A3BH 2K6AA 2K5HA 2I5MX 3G4SA 4LFBL 1VQAA 4B9WA 2Z4HA 1G51A 3S1NH 3W3AA 3F2UA 2ZJQA 4HJ5A 4HJAA 2PMZE 1AZPA 1S5FD 1JWSD 2ENBA 4ABNA 1WD0A 1NE3A 4LFAL 3HRZC 4HJ8A 1W6JA 4HSPA 3S14B 5EBCA 5CMDA 5C0XH 1STBA 4A93B 2WKDA 4LF9Q 1JE5A 1PRTF 3SHLA 3RMHA 3A8JE 3E6ZX 3QR8A 1STYA 1SYDA 4X3SA 1LUZA 5CV9A 5EGTA 1GVPA 1CQVA 1STGA 2WAQE 3J7AV 1VQJA 3PUVA 5GADC 4WRDA 4JI3L 1BKBA 1UWVA 5HURA 5CV6A 1SE2A 2PMZB 5LL6X 2XN9C 5LMUQ 4E6IA 4DV0L 4OX9L 1SEBD 5FLXL 5IGGA 3W1BA 4X65L 1VQMA 1G8ZD 3H0GH 2GVBA 1YBYA 1VQFA 2AWNA 1E2VA 2E2IB 2Q2HA 2XTIA 5TSSA 1VQ6A 2RDHA 1F9QA 3QOLA 4GLXA 5C3XA 2MPMA 3CD6A 3BYTB 2WAQB 1N33Q 1LTRD 4YWKA 2NVQH 2K4KA 1ILQA 5J39A 4JBWA 2F03A 2CKZB 5D3DA 4C1NK 4A75A 2Q8TA 3HS0C 3RLFA 1A2TA 4DUZL 2B2WC 2VQFQ 4WJ3M 4O42A 1QOHA 1ENFA 4NPSA 4IPDA 2OCEA 4GKKQ 2OT2A 2L12A 2UUBQ 1SE3A 4G7OC 1UE7A 2EYPA 1HZCA 2QDBA 3D4DA 3FP9A 5GQOA 1K8GA 4AYBG 2ZTCA 4IUNA 3KFUA 1EOTA 5ELEA 4DR2Q 3NQIA 4CDEC 1SE4A 3K8AA 2PNHA 4DAYB 2H1EA 3CC2A 2Q2UA 1AZQA 1E24A 3LWEA 1QJOA 2RSOA 4RKBA 1U9RA 4GKJL 3GTMB 4I65A 1QILA 2F0VA 2I5LX 5M5XB 4BBSB 2RKSA 4TRDA 1J5EQ 1BR9A 4AQYL 2H5XA 4P73A 4R4IA 1TWCH 4RHSA 3AYHB 4CBVA 4QGUA 1I6VC 5BR8Q 1SNOA 1PTOD 4NP5A 1DXMA 4MHEA 2XIWA 4R1JA 4A3GH 1XNRQ 1GUWA 1ZEQX 5J22A 3CCQA 4FXGC 4C3IH 1TS5A 2Z1CA 3A55A 4DR4Q 2AQ3B 1LTTD 2E2JH 1S5DD 2RHSB 2WP8J 2CHBD 4A4IA 1BCPD 1Q7YC 3HOVG 4DUYL 5EPJA 1FGBD 1Q46A 2J4XA 2UXBQ 3NBHB 4RKLA 4XIGS 2M2LA 1B3AA 2D0OA 5K5PA 1ONLA 2B2VC 1RKNA 4K8JA 3MXNB 1CQFA 2NN6I 5AJ3Q 4ALPA 3A0JA 3BZDB 4A3LG 1BUVT 3K5OA 1BBUA 2F3IA 1KD1C 4A3DH 2QA4A 1Y8PB 4MIUA 1YJNA 4LF6Q 1XXGA 4RAUC 3G6EA 3ITPA 1DYQA 5ELNA 2JJQA 2WV6D 2YTVA 2JA8H 1HR0W 4F88A 1BNZA 1IBLQ 3Q0AA 3M3YB 3PV0A 4DV6Q 5C5LA 3S2DB 5JVG3 3HOVB 2K03A 3KLRA 1DOLA 2L9HA 1T9HA 1I50B 1RTNA 1Q82C 1L1OC 1DM0B 1Y1VH 3OIPA 1C0AA 1KLGD 3KK7A 5M3FB 4LF9L 4HIOA 3SR1A 2CFMA 2L1BA 2ICEC 4A3FG 3I56A 4V0BA 5JEAG 4HIMA 2FHTA 4ZCKA 2HDMA 1A3UA 5IWAL 2XSCA 3F2CA 4CKCA 4CDFC 1JOOA 1JOKA 2QILA 1YZ6A 3TSSA 4GLVB 5C4XG 3GTLB 2B8FA 4GN4B 1PRTB 2R7ZH 3ND8A 2E2HH 4A3BB 4I7ZC 1TR5A 2PI2E 2I0QA 2A6HC 3JAME 4JV5Q 1V9PA 3Q8DA 3S1NB 2UU9L 1LABA 3CCLA 3RZOB 2RDFA 2A5HA 5IT9E 1YHBA 3IFTA 4N9PA 2PZTA 4TKOB 2Q8IB 1T5XD 1S5ED 5IODA 4IOCA 1EZ6A 1N34Q 1V1OA 5IP7H 3OYYA 1WCMH 1L0XB 2KENA 4K14A 4HIKA 4KKSA 1PV4A 1VQHA 4GOPC 4GKKL 3SK4A 1ET9A 4DXGA 2Q2IA 2R92H 1E2WA 2SNSA 1NSNS 2L55A 5LL6S 2F0QA 4ZKBB 2HQLA 3C1EA 1VQCA 2RVLA 1KQSA 3QIAA 3PO3G 3LX0A 4UP9A 1EIYB 2JXMB 3J7AF 3A7LA 3D6CA 3HOZG 3UE1A 3H0GB 2IJ0A 4DU9A 2YTYA 2X6LA 1K83H 4RA8A 2VNUD 2HIVA 3P20A 4KY6A 1C4QA 3GQBA 1OXUA 5DLQE 4JI0L 3PIO3 2I46A 4OEMB 4RCOA 4FF3A 4H7BA 4O1NA 2JEAI 2HIXA 2F0EA 2QGQA 3EQLC 2SDFA 1HZAA 1EOVA 1BQQT 1GUGA 3VR5A 3SXHA 2PQAA 4PV1C 1KTKA 4EGVA 1SYBA 2VL6A 1YHAA 2K5NA 3FKIH 3TREA 5IYDH 1FL0A 1HQRD 1WTQA 4A3CG 2HD3A 1KHIA 1II3A 1A6XA 3K5MA 1KRTA 4C3JH 3PO3B 1R4PB 1VQLA 4KHZA 1I6HH 2CVRA 3HOZB 2QF7A 1VQ4A 3MXGA 4IUUA 1X9NA 1CHPD 1X65A 2B3GA 1EWHA 1RDPD 1JE4A 4QQBX 2VB3X 4JI8Q 4DR5L 3HP3A 2Y0SG 4UAIA 2Y0SE 1SNDA 4KHVA 4DV1L 5FO7B 2OTJA 5JEAJ 5LHY1 1X55A 3RZDH 3A54A 1PZKD 1HUMA 2JK8A 3CCEA 4FYDA 1F9RA 4PNYA 1NMFA 4EVOA 1G6ZA 1SDFA 4CJ2C 1GM5A 4KK7A 1K3BC 3PUZA 3CCSA 2Q2TA 2B2UC 1GXDC 3CCUA 4IUTA 1TWCB 2DN8A 2RDGA 4GNXA 4HTHA 1PYBA 3VYSA 1SYCA 4X64Q 2Y0SB 3TRZA 4HIDA 3CXCA 5KYLA 1EIHA 1GKHA 1G2SA 3OOCA 2KECA 1IBLL 3I4NG 1JICA 2K1BA 4C2MH 1U4RA 3NQTA 2KQ3A 3FVQA 3W2DA 1YVCA 1A3VA 1Q1BA 5C6AA 1MJEA 3SK8A 4LFBQ 3SK6A 4FDBA 2E2JB 4JI4L 3NK9A 3CCJA 2WFWA 1N32L 4DGZA 1FD7D 1OXXK 4DPGA 1EWCA 4DAPA 3DWPA 2R7FA 4LFAQ 2E75C 1LTSD 3BYYB 3M9BA 5I6YA 1RODA 3R3OA 4ME3A 1WTXA 5DM63 2NVTH 2O5IC 3I4NB 3GTKH 4A3DB 2EYJA 3PIP3 3GV3A 1KNAA 1H9SA 2KCMA 1SRUA 3L9AX 3QO2A 3GTJH 3S16H 1VQ5A 2RCFA 2V1CC 1HFNA 1STEA 3ERQA 4OL7A 3AMUA 3HOUH 3BS1A 2K32A 3KJPA 3R8BA 4JI3Q 1I4RA 4H13C 3L0OA 1PMRA 2JA8B 3WDNA 3K6OA 4RGMA 4DV0Q 4OX9Q 1STHA 3E9HA 1EIGA 1SNCA 2F3VA 3MTSA 5KIXA 5FO9B 1YITA 3MEHA 4KTAA 4C1NI 2LXKA 3EIVA 1BXTA 2KJXA 4J1MA 3D3RA 1VQGA 4M8AA 4M1UB 3J80c 3VYRA 2IHEA 3EROA 1HA5A 1WJJA 2F3WA 2V4DA 4YHHQ 5FO8B 4K5XA 1S5BD 1DOKA 5IYBG
chains in the Genus database with same CATH topology
1PFBA 1OXTA 1PRTC 1U4LA 4FF2A 5KNCA 1SYGA 1CTMA 1X3PA 3TZUA 4R9WA 3TBIB 3SVMA 1PLFA 3KUPA 4NKLA 1I4HA 2MGSA 1I4QA 3H94A 5ELFA 2EY2A 2EYMA 3HOXB 3MAQA 2L5TA 5F2DA 2EVBA 1R9TB 5FOBB 4KKUA 1EQTA 4IURA 5KEEA 1B9MA 1IL8A 4K2LA 1BDOA 1I4GA 1HCZA 1E2ZA 4DF7A 1F2MA 4CKBA 2R92B 1DJRD 1Y8NB 2X69A 2F4IA 4OIKA 1GUNA 4C3JG 4RCNA 2JP1A 3BVZA 1CA6A 3T51B 4LMQD 1M8AA 2BE5C 1GHJA 2KEEA 3Q23A 1O7YA 1I3QB 3DUZA 1DD2A 4BA1I 3NTKA 1QB5D 3FRPB 3L7ZC 5EKIA 3RD4A 2BOSA 3IAYA 1Y1WB 1Q1EA 1VCIA 1VF7A 3ZYYX 1UAPA 2IT1A 1MD2D 4IUVA 3FKIB 2A68C 3BDCA 3I72A 4C3JB 3HG9A 1I6HB 1YNJC 3SEBA 4KY7A 1YNND 1FNWA 1EYCA 1PYWD 3VA7A 1HTLD 1V8QA 3NHHA 3D4WA 2NUCA 1ML0D 2WKCA 2NWGA 3RZDB 3GV6A 2M00A 3OMCA 2JSOA 3FMCA 1S4ZA 2D2CC 2A6EC 2HCIA 1HHVA 3A8IE 1IYUA 2WACA 2R93B 3H91A 1IHZA 1J8IA 2XRSD 1AEXA 1STAA 5CYUA 1LT4D 1WTRA 2IWHA 2N55A 1O80A 2QEJC 1SBBB 1HQMC 3AU7A 3BDOA 2B63B 3MWYW 2L11A 3MC0B 4NDXA 1CA5A 2B2TA 1OXSC 2K05A 4U68A 2K5DA 3MFGA 1B53A 2K33A 1HTPA 4KY5A 2JYOA 1W6KA 1PRTD 4IFDJ 3A56A 1CHQD 2F0FA 3FPUB 5EJWA 2VXWA 4L63B 3EA6A 1PTOH 2CQAA 1WTOA 2G9DA 2KUMA 2ICIA 4IUPA 1K8MA 1SJHD 3PUYA 1JQYD 3SE0A 1TY2A 4HN7A 1U4PA 3PUWA 1DZ1A 1WTPA 4OO1I 4DNTB 2B2WA 3JAML 1TWAB 5J1ZA 4DA2A 2FJ2A 4G57A 5DNFA 2AUJD 2L4NA 1I4XA 5G3LF 1WVLA 3TP6A 3MA2B 3M85A 5IT9L 2B2YA 1F2YA 1UUPA 2B8GA 3GD7A 1CI3M 2JA5B 1XYIA 1TWHB 2XNAC 3VYTA 3T4AC 2ZXOA 1V1PA 3J81E 1QNKA 3A8KE 3CKIB 2OEOA 2BE5D 2R61A 4IUQA 5ISRA 1I4PA 2SOBA 1Q90A 3DWAA 2EYLA 1G2TA 2HQEA 3VA5A 2NZ1D 5I4DA 1T5EA 1LT3D 1H9JA 1B1ZA 1ZYRD 3SK5A 2FMMA 2RA4A 4V190 5IGDA 3S17B 3M7NA 2A68D 1Q3LA 3QB3A 1KNEA 4K2KA 1YNJD 2F0DA 1NUCA 4FF1A 5DAUA 4FO2A 1H9SB 3C2PA 4XDXA 3HOYB 2R6GA 1D5MC 4Z9CB 1D1IA 2K01A 3GTQB 1GUSA 1EYDA 2MP1A 3WOFA 2A6ED 4ZLTF 4X3TA 5A2QE 1EL0A 1TU2B 1VMCA 5BN5A 1G291 1KDAA 4ZRZA 3CRKC 4LAAA 1QG7A 4Q5VA 1EY0A 3NTIA 1RHPA 4IFDI 4C56C 3I4MB 5C0XG 2ID0A 3N52A 5IGBA 2XVSA 4OHJA 3NWSA 1TS3A 1VDZA 1ESRA 1HRJA 3FEWX 1Y8OB 5I6WA 4KV6A 2K28A 4IZ8A 2Z8LA 2ZXPA 2A74C 3WOEA 4PQXA 1IKMA 2IPKD 1SYEA 2KCCA 2AUKA 4K5VA 1QCBD 4ILWA 2BA1A 3FPPA 2NN6H 2D62A 4ULLA 1PFMA 4K6LA 5KRUA 4XTCS 2NBFA 3HKZB 1Q12A 3K5NA 4BY1B 1G91A 2MJ8A 1LLRD 3D4RA 2E2DC 2E74C 3C1FA 5CR3A 2IX3A 1K8OA 1A15A 1KAAA 1CT1D 1FR3A 2PZWA 3DM1A 1S5CD 4NW2A 1TIID 2KA7A 5FK9C 2NVQB 3URYA 1IKLA 2LFNA 2EZVA 2DY8A 2EJFC 1WD1A 1Z47A 2PPBC 4IFDH 1SAPA 1H9RA 3V05A 4KN7C 5IGEA 2AQ2B 1JR0D 1GJXA 5C4ZA 1EY4A 5A35A 4C3IG 5E3FA 2FFKB 1QNUA 1FNUA 1H9KA 1L0YB 1U4MA 1ESFA 1AN8A 4WJWA 1A2UA 5DEHA 5EQ0A 1B4OA 2F0UA 1TS4A 2IW3A 1NR2A 3H6MA 3SDZA 2YYZA 3R2TA 1ICWA 3NBIA 3P1HA 4A3GB 4C3IB 3P7JA 5EPLA 1OO9B 1DCZA 1YNNC 2A73B 4A3KB 5JPNC 2O4XA 2F0TA 4B9XA 2F0LA 2X6GA 1KLUD 5JAVA 5DM73 2J7ZA 4OIJA 4S3SA 1F2ZA 1JCKB 3I8ZA 1NR4A 3VR6A 5M5YB 4QMGA 1DOMA 1HFGA 3NSWA 4BBRB 3H3VC 2KOLA 3HOWB 4F7XA 5KNDA 2DY7A 1H9MA 3A7AB 5CC4A 3CRLC 4KN4C 4WORA 3NPPA 1DONA 4QUCA 4QIWB 1Y1VB 3TDQA 2EXZA 3RUZA 4DN4M 4K6DA 3NWTA 3PUXA 2PQEA 5D3IB 4U673 3X3NA 1TKWB 2PO4A 5IGCA 3G6JB 4N9TA 1TQOA 2F0GA 1EU4A 4KJNA 1V1PB 5ELCA 1EY5A 1SXTA 4ZK9B 2KVMA 4XYOA 2H4OA 2R7ZB 2K5WA 5K36H 5JJZA 2E2HB 4K8IA 3G7LA 3NXWA 1CM9A 2BCOA 4R8IA 2NN6G 3I3CA 5JPMC 1BOSA 3Q6SA 1SNQA 3VR4A 2GA4B 1D2BA 1BO0A 1WTWA 4DK0A 4C3HB 5D14A 2L0CA 4ZYSA 2G9HD 1PXUA 1PZID 1EY8A 1E0BA 1WCMB 1VF5C 4OGQC 3HEJA 3TN2A 1AP0A 4F87A 2NVXB 2EPBA 2J0TD 1LT6D 4J8QA 3IKJA 3LNNA 1GOZA 3KF8A 2BA0A 2Q8RE 5FKAC 1K83B 3Q24A 4FXKC 3FDTA 2EDGA 4HSVA 2C5CA 1B2TA 5T1IA 2ZT9C 4ZQ3A 3T56B 4B08A 2EJMA 5I9PA 1ZYRC 1R4QB 3NTHA 4XQJA 1D5XC 3VYUA 2F0JA 2DNEA 2OXPA 2F0PA 3J81L 4A3JB 2XWJB 5C4HA 2DNCA 2VB2X 3M4YA 2NYZD 2R3ZA 1LTID 2CW0C 3MFYA 3C46A 1MI2A 1TS2A 2JEBI 2XWBB 2AQ1B 3LWUA 5CV4A 2SNMA 5CV8A 3QWNA 3HZXA 2M9VA 4IN3A 4A3IB 4RGTA 2F0HA 4CKEA 5EKKA 1CZWA 3K57A 3ONAB 4IALA 5CBEE 1ENCA 5JEAH 4EQPA 3NUCA 1D1KA 1ET6A 1ENAA 5COYA 4RGOS 1F9PA 4C2MB 3EVQA 1QE6A 5T1GA 4X3KA 3EJIA 2B2TC 4BY7B 4L8JA 3MVVA 2RBMA 3V96A 5CBAE 2O5JC 5HGTA 1PDQA 2F0NA 1SNPA 2D5DA 2F0IA 4G4KA 5M9OA 2XRQD 5A2QL 3M7GA 4WFN3 3J80E 4HMIA 1D5ZC 4IQZA 2NVTB 1TY0A 3GTKB 4JK1C 5IOCA 3GTJB 1EY9A 1HA6A 2O2LD 3C3LA 3S16B 1AFPA 3D8GA 1SSOA 3PMFA 2SEBD 3HOUB 3DMUA 5BN4A 4H0LC 3M4OB 1Q8IA 4HR7B 4RGNA 5JOBA 3N6RA 1PTOF 3O13A 3OHXC 5K36G 2B2YC 4MN3A 4HCSA 2ZXRA 4R8NA 2QCPX 3DXJC 4HAEA 3T16A 4XQQA 3CU7A 1F9SA 3MHBA 1ZKOA 1AW7A 3H09A 2BDOA 1BCPF 1FYCA 1TVXA 1PFNA 2F0OA 2HUGA 3U9OA 4KKTA 4EQNA 4F8MA 1SFOB 2K7VA 3S1QB 4J6HA 5EBDA 3UI2A 4AYBB 3GO5A 4Q0FA 5I9OA 3TP5A 2WB1B 1EEFD 1LV9A 5KNBA 1MSHA 3DEPA 1IW7D 4RFBA 4PMCA 3L3OC 4KI0A 5G3LD 2F0SA 1KDCA 1SYFA 1RCVD 3QJYA 4KD3A 2NTSA 1XWEA 1V43A 5CV5A 4RHRA 4CGYB 1OXVA 4BA2I 1B9NA 2IX0A 1HPCA 4Y7NB 3VR2A 2CW0D 4ME5A 2B39A 2PW7A 2B2VA 2LY7A 4FF4A 4EQOA 5JVH3 3T53B 4K5WA 1SMYC 4PMBA 1RJTA 3BVMA 5FLXE 4G7ZC 1EY6A 4DXFA 4QF4A 4CJ1B 3DEOA 5D65A 2HCCA 2RQXA 3S2HB 2N88A 1Z7TA 1O78A 4OO1H 5I2YA 3D6WA 5C3WA 5C5MA 4FP5D 1ILPA 2LMCB 1WTVA 4KMUC 3TP8A 1RD9D 3MXUA 5NUCA 1EY7A 1IYVA 1FNVA 2I07B 2NVYB 2K04A 1MSGA 1SNMA 4NMZA 2KCNA 5EPKA 3QG1A 2NTTA 2PZUA 3DWQA 3PO2B 1M4VA 3AB9A 4FNFA 2PCFB 2EYOA 4A3FB 2BDNA 2JA6B 1BF4A 2FMCA 4G7HC 2F0WA 3X3MA 3R93A 3KLSA 5C4XB 4PMWA 4P2CB 3EFXD 4DK1A 1HUNA 4XQNA 1MGSA 4GZYC 3E5SA 1GUOA 2Z4IA 2A69C 4LJZC 1O7ZA 3P75A 4H44C 3GP7A 2D9UA 4ZUIA 5C44B 1PZJD 4ZAIA 3VR3A 4TSSA 5ELBA 5C4JB 5C3EB 2EY6A 2VUMB 2JA7B 4CJ0B 3GTOB 1PTOB 1SJED 1CFMA 1BBXC 4XT1B 1CK1A 5IGFA 2F0MA 3OWFA 3K58A 5KGUA 4TQUS 2QKIC 5AFWA 1EYAA 5I2XA 1HXYD 4BS9A 4XYQA 1BCPB 3OW7A 2LKVA 3U9SA 3S15B 1JWUD 5E4WC 1LTAD 4DAVA 4KD4A 3GTPB 5C0XJ 1F77A 3S9WA 1RF2D 4DAYA 2E76C 4LK1C 2KEDA 4BWGB 2TMPA 3CQZB 4L6TB 3Q22A 3OSOA 1C8CA 1Y69U 3QOJA 1X32A 2C9OA 4DNRB 3TMEA 3KBGA 3BVGA 3TZDA 2NB0A 1EU3A 1LACA 1SMYD 1F2LA 1QWYA 3E0JA 3DHQA 1B44D 3BG3A 1LT5D 3R2IA 5BN3A 2B2UA 1VMPA 1LO5D 2PW5A 3NE5B 1XTCD 3MXPA 4A3EB 3S1RB 3NP8A 1A3TA 5IIFA 1JOQA 3NBHA 1EFID 4RH6A 1J9OA 2TSSA 3MXNA 2LS01 1B50A 1LTBD 3TP7A 3K5LA 2EJGC 1ZXTA 1TT2A 4HMJA 2PNRC 2RSNA 4OO1G 1CZGA 1TWFB 3IL8A 3ND9A 1LTGD 2HDLA 4HEDA 3I73A 3I90A 1GUTA 3I4LA 3OPOA 4UDUC 4A3MB 2A6HD 2IX1A 1KDBA 4HCEA 3K59A 1NAPA 3HGBA 4ZUJA 2MUYA 4C3HG 3MZ5A 1JORA 3S1MB 3IFDA 1GHKA 1NCVA 2MHVA 2EY1A 4FVMA 1UNSA 4RWSC 2K5QA 1JB3A 2F0KA 1C48A 4ID6A 2A69D 2F1MA 2IL8A 1D6EC 5C0XI 4KJOA 4CHTB 5M3MB 1MBYA 2OF1A 1TWGB 3J80L 3K7AB 5E4XA 5ELDA 5KYIA 2YU9B 1Z6HA 3I70A 3K0YA 4ZKCB 1EQVA 1O7LA 4YIJA 5CGKA 2FINB 1UEAB 4QB4A 5E1FA 3KBXA 1KABA 3OWEB 2JE6I 1XX8A 3I91A 4XXEA 1JWMD 3KLSX 1JC7A 1RTOA 1EEID 1STNA 3T13A 2EY5A 4QUFA 4IFDG 2AWOA 1PTOC 2EOTA 2EYHA 1IW7C 4XT3B 2KHSA 3BDLA 1EZ8A 3GTGB 4X3UA 2WINB 3D31A 5M5WB 1X3QA 2EE1A 3J7YW 1BCPC 5CORA 3OMGA 4FXDA 4DFAA 2EYFA 5EKLA 2WIIB 3CHBD 4QCLA 2PYKA 3OIQA 5CV7A 4ODGA 3V2TA 2K6AA 4B9WA 2Z4HA 3W3AA 3F2UA 1AZPA 1S5FD 1JWSD 2ENBA 4ABNA 1WD0A 3HRZC 1W6JA 4HSPA 3S14B 5EBCA 5CMDA 5C0XH 1STBA 4A93B 2WKDA 1PRTF 3SHLA 3RMHA 3A8JE 3E6ZX 1STYA 1SYDA 4X3SA 5CV9A 5EGTA 1CQVA 1STGA 3J7AV 3PUVA 4WRDA 5HURA 5CV6A 1SE2A 2PMZB 5LL6X 2XN9C 4E6IA 1SEBD 5FLXL 5IGGA 1G8ZD 2AWNA 1E2VA 2E2IB 5TSSA 2RDHA 1F9QA 3QOLA 5C3XA 2MPMA 3BYTB 2WAQB 1LTRD 1ILQA 5J39A 4JBWA 2F03A 5D3DA 4C1NK 2Q8TA 3HS0C 3RLFA 1A2TA 2B2WC 4O42A 1QOHA 1ENFA 2OT2A 2L12A 1SE3A 4G7OC 2EYPA 2QDBA 3D4DA 4IUNA 1EOTA 5ELEA 3NQIA 1SE4A 2H1EA 1AZQA 3LWEA 1QJOA 2RSOA 4RKBA 1U9RA 3GTMB 4I65A 1QILA 2F0VA 5M5XB 4BBSB 2RKSA 4TRDA 1BR9A 4RHSA 4CBVA 1I6VC 1SNOA 1PTOD 4NP5A 1DXMA 4MHEA 2XIWA 1GUWA 1ZEQX 5J22A 4FXGC 1TS5A 2Z1CA 3A55A 2AQ3B 1LTTD 1S5DD 2WP8J 2CHBD 1BCPD 5EPJA 1FGBD 2J4XA 4RKLA 4XIGS 2M2LA 1B3AA 5K5PA 1ONLA 2B2VC 1RKNA 4K8JA 1CQFA 2NN6I 3BZDB 1BUVT 3K5OA 1Y8PB 4MIUA 1XXGA 4RAUC 3ITPA 1DYQA 2WV6D 4F88A 1BNZA 3Q0AA 3M3YB 3PV0A 5C5LA 3S2DB 5JVG3 3HOVB 2K03A 3KLRA 1DOLA 2L9HA 1I50B 1RTNA 1DM0B 3OIPA 1KLGD 3KK7A 5M3FB 3SR1A 2L1BA 2ICEC 4V0BA 5JEAG 2FHTA 2HDMA 1A3UA 2XSCA 4CKCA 1JOOA 1JOKA 2QILA 3TSSA 3GTLB 2B8FA 1PRTB 3ND8A 4A3BB 4I7ZC 1TR5A 2A6HC 3JAME 3S1NB 1LABA 3RZOB 2RDFA 2A5HA 5IT9E 3IFTA 4N9PA 2PZTA 4TKOB 2Q8IB 1T5XD 1S5ED 5IODA 1EZ6A 1V1OA 1L0XB 4K14A 4KKSA 3SK4A 1ET9A 4DXGA 1E2WA 2SNSA 1NSNS 2L55A 5LL6S 2F0QA 4ZKBB 3C1EA 2RVLA 3QIAA 3LX0A 3J7AF 2JXMB 3A7LA 3D6CA 3H0GB 2IJ0A 4DU9A 2X6LA 4RA8A 2VNUD 3P20A 4KY6A 1C4QA 3GQBA 1OXUA 3PIO3 2I46A 4RCOA 4FF3A 4H7BA 4O1NA 2JEAI 2F0EA 3EQLC 2SDFA 1GUGA 1BQQT 3VR5A 3SXHA 4PV1C 1KTKA 4EGVA 1SYBA 1HQRD 1WTQA 1II3A 1A6XA 3K5MA 3PO3B 1R4PB 4KHZA 2CVRA 3HOZB 2QF7A 3MXGA 4IUUA 1CHPD 1EWHA 1RDPD 1JE4A 2VB3X 3HP3A 4UAIA 1SNDA 4KHVA 5FO7B 5JEAJ 5LHY1 3A54A 1PZKD 1HUMA 4FYDA 1F9RA 4PNYA 4EVOA 1G6ZA 1SDFA 4CJ2C 4KK7A 3PUZA 2B2UC 1GXDC 4IUTA 1TWCB 2DN8A 2RDGA 4HTHA 3VYSA 1SYCA 2Y0SB 5KYLA 1EIHA 1G2SA 3OOCA 2KECA 1JICA 2K1BA 1U4RA 3NQTA 2KQ3A 3FVQA 3W2DA 1A3VA 1Q1BA 5C6AA 3SK8A 3SK6A 2E2JB 3NK9A 4DGZA 1FD7D 1OXXK 1EWCA 4DAPA 3DWPA 2E75C 1LTSD 3BYYB 5I6YA 1RODA 3R3OA 1WTXA 5DM63 2O5IC 3I4NB 4A3DB 2EYJA 3PIP3 1KNAA 1H9SA 3GV3A 3L9AX 3QO2A 1HFNA 1STEA 3ERQA 4OL7A 3AMUA 3BS1A 2K32A 3R8BA 1I4RA 4H13C 1PMRA 2JA8B 3WDNA 3K6OA 4RGMA 1STHA 1EIGA 1SNCA 2F3VA 3MTSA 5KIXA 5FO9B 3MEHA 4KTAA 4C1NI 1BXTA 2KJXA 4J1MA 3D3RA 4M8AA 4M1UB 3VYRA 3EROA 1HA5A 2F3WA 2V4DA 5FO8B 4K5XA 1S5BD 1DOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6E D;  2EJF C;  3PUW A;  5C0X H;  3ND8 A;  1OXT A;  1OXV A;  1B9N A;  1YNJ C;  3NE5 B;  1I6V C;  4I7Z C;  1TU2 B;  3SE0 A;  1HPC A;  5BN5 A;  1G29 1;  2EDG A;  3VR2 A;  3A8J E;  4IQZ A;  2A6H C;  3CRK C;  4DNT B;  1DXM A;  1Z6H A;  5KND A;  4JK1 C;  1H9M A;  3A7A B;  4DK1 A;  1O7L A;  2ZT9 C;  3CRL C;  4KN4 C;  1LAB A;  3T56 B;  2EJM A;  5KNC A;  2AUJ D;  3VA7 A;  1CTM A;  4GZY C;  1V8Q A;  3PUZ A;  1ZYR C;  3PUV A;  1GUO A;  5C0X G;  3M85 A;  2A69 C;  4LJZ C;  3TZU A;  3IFT A;  5BN4 A;  3T53 B;  2B8G A;  3GD7 A;  4H0L C;  4TKO B;  2Q8I B;  2PPB C;  1CI3 M;  4H44 C;  4IFD H;  2DN8 A;  2JE6 I;  1SMY C;  1H9R A;  2EJG C;  4KN7 C;  3VR3 A;  4G7Z C;  3OOC A;  4HR7 B;  1GJX A;  2DNE A;  3FMC A;  4XIG S;  2PNR C;  4OO1 G;  5A35 A;  1ONL A;  3PUX A;  3H94 A;  3A8K E;  2D2C C;  3ND9 A;  2NN6 I;  4KKS A;  2A6E C;  3N6R A;  2DNC A;  3A8I E;  1IYU A;  1VDZ A;  1CFM A;  1E2V A;  1TKW B;  3M4Y A;  1H9K A;  1E2W A;  1Q1B A;  2L5T A;  4IFD G;  5K36 G;  2BE5 D;  2AWO A;  2CW0 C;  3I73 A;  3MFY A;  1Z7T A;  1O78 A;  1IW7 C;  4BA2 I;  4OO1 H;  1Y8P B;  1GUT A;  1Y8O B;  2EVB A;  3I4L A;  4TQU S;  2JEB I;  4KKU A;  3OPO A;  1OXX K;  3QIA A;  3DXJ C;  3LWU A;  1Q90 A;  2LMC B;  1B9M A;  2JXM B;  3A7L A;  4KMU C;  4JBW A;  5K36 H;  2A6H D;  2E75 C;  1BDO A;  1ZKO A;  3D31 A;  3MXU A;  3OW7 A;  1T5E A;  3RLF A;  2BDO A;  3U9S A;  3SDZ A;  1HCZ A;  2YYZ A;  3PV0 A;  1H9J A;  2NN6 G;  1E2Z A;  3P20 A;  2KCC A;  3HGB A;  1FYC A;  1IYV A;  3GQB A;  2AUK A;  1OXU A;  2O5I C;  1HQM C;  3VR4 A;  3KLR A;  1Y8N B;  3BDO A;  2BA1 A;  1H9S A;  3FPP A;  3M7N A;  2A68 D;  2JEA I;  4KKT A;  4G7O C;  3EQL C;  2NN6 H;  2D62 A;  2E76 C;  1DCZ A;  1GUG A;  1GUN A;  1OXS C;  1YNN C;  4LK1 C;  4RCN A;  3VR5 A;  4DK0 A;  1GHK A;  5JEA H;  3T51 B;  4PV1 C;  2K33 A;  2BE5 C;  1HTP A;  2K32 A;  1GHJ A;  2K7V A;  4XTC S;  4H13 C;  3QG1 A;  1Q12 A;  1PMR A;  1DD2 A;  3WDN A;  4BA1 I;  1H9S B;  1VF5 C;  1A6X A;  4OGQ C;  3D4R A;  3L7Z C;  5KNB A;  1Y69 U;  4KHZ A;  4DNR B;  1IW7 D;  2E74 C;  2R6G A;  2QF7 A;  4KI0 A;  1Q1E A;  1QJO A;  5JEA G;  1VCI A;  3AB9 A;  1K8O A;  2A69 D;  1VF7 A;  1EWH A;  2PCF B;  3QJY A;  2F1M A;  1FR3 A;  4L8J A;  1LAC A;  3IKJ A;  2IT1 A;  3VR6 A;  3LNN A;  3W3A A;  2O5J C;  1V43 A;  2V4D A;  1GUS A;  1K8M A;  2KA7 A;  4G7H C;  3BG3 A;  2D5D A;  3PUY A;  2A68 C;  5BN3 A;  2BA0 A;  2B8F A;  3I72 A; 
#chains in the Genus database with same CATH topology
 1PFB A;  1OXT A;  3HOX G;  1WOC A;  4RG1 A;  5LMN W;  4DUZ Q;  1PRT C;  2Z6B A;  4YCV A;  1U4L A;  1X3G A;  3VDY A;  4R4O A;  4FF2 A;  5HGQ A;  1EIF A;  5KNC A;  1SYG A;  2ZJR A;  1CTM A;  1X3P A;  3TZU A;  4R9W A;  3PIO A;  4UPA A;  3TBI B;  3SVM A;  3W1G A;  1HZ9 A;  4R4C A;  1PLF A;  3KUP A;  4NKL A;  2EIF A;  1I4H A;  2MGS A;  1I4Q A;  3H94 A;  4MTK A;  2EY2 A;  5ELF A;  2EYM A;  1HNW L;  3HOX B;  3MAQ A;  2L5T A;  5F2D A;  1UE1 A;  4GKJ Q;  4JVZ A;  2EVB A;  2MO1 A;  1R9T B;  5FOB B;  4KKU A;  3E3X A;  3D0F A;  1EQT A;  4IUR A;  5KEE A;  1B9M A;  1IL8 A;  4AQY Q;  4K2L A;  1Y1W G;  1BDO A;  1I4G A;  3OTO L;  1HCZ A;  1E2Z A;  4DF7 A;  1F2M A;  4CKB A;  2R92 B;  5JJI A;  1DJR D;  1Y8N B;  2X69 A;  3FKI G;  3U58 A;  2F4I A;  1JJG A;  2Z6K C;  4OIK A;  5HY6 A;  1GUN A;  4C3J G;  4RCN A;  2JP1 A;  3BVZ A;  1CA6 A;  3T51 B;  3GTQ H;  4LMQ D;  1M8A A;  2BE5 C;  1GHJ A;  2KEE A;  4N8F A;  3Q23 A;  1O7Y A;  1I3Q B;  3DUZ A;  1DD2 A;  4HJ7 A;  4BA1 I;  1A62 A;  3NTK A;  1QB5 D;  4DUY Q;  3FRP B;  3L7Z C;  5EKI A;  3UE0 A;  3RD4 A;  1JB7 A;  2BOS A;  3IAY A;  1Y1W B;  1Q1E A;  1VCI A;  1VF7 A;  1UE5 A;  3ZYY X;  1UAP A;  3S2H H;  2IT1 A;  1MD2 D;  4IUV A;  4JBK A;  3FKI B;  2A68 C;  4A93 G;  3BDC A;  3I72 A;  4C3J B;  3HG9 A;  2R93 G;  3G48 A;  5GRO A;  1YNJ C;  1I6H B;  3SEB A;  1KL9 A;  1YNN D;  1IZ6 A;  1FGU A;  1FNW A;  4KY7 A;  5FLX c;  1EYC A;  1QZH A;  3K7U C;  4X6A H;  2NVY H;  1PYW D;  3VA7 A;  1HTL D;  1V8Q A;  3NHH A;  3D4W A;  2MQH A;  2MO0 A;  2NUC A;  3CW2 C;  4GLA C;  1AE2 A;  1ML0 D;  2WKC A;  2NWG A;  3PIP A;  3RZD B;  3GV6 A;  1P16 A;  4N8X 1;  2M00 A;  3OMC A;  4DV5 Q;  2JSO A;  3FMC A;  1ICF B;  2B63 G;  3PO2 H;  1S4Z A;  4DAM A;  2D2C C;  2A6E C;  2HCI A;  1HHV A;  3A8I E;  1IYU A;  2WAC A;  2R93 B;  3E0E A;  1PHJ A;  1PFS A;  4DV7 L;  3H91 A;  2WAQ G;  3UDG A;  1AH9 A;  1IHZ A;  4DV4 L;  1J8I A;  5IWA Q;  2JA6 H;  1JJC B;  1HH2 P;  3TEH B;  2XRS D;  1AEX A;  1STA A;  5CYU A;  1LT4 D;  4DNI A;  4BY1 H;  1WTR A;  5EAY A;  2IWH A;  2N55 A;  1O80 A;  2QEJ C;  4L5T A;  1SBB B;  1HQM C;  3AU7 A;  3BDO A;  3W5O A;  2B63 B;  1PH8 A;  3MWY W;  2L11 A;  3MC0 B;  4NDX A;  5IP9 G;  1CA5 A;  2UU9 Q;  1S3O A;  2B2T A;  1OXS C;  5ELO A;  4YHH L;  2K05 A;  2E8G A;  4U68 A;  3CF5 A;  1HJP A;  2K5D A;  3MFG A;  1B53 A;  2K33 A;  1HTP A;  4KY5 A;  2JYO A;  5GAH C;  1W6K A;  1PRT D;  1BBW A;  1AE3 A;  4IFD J;  5C44 H;  1PH5 A;  3A56 A;  1CHQ D;  5C3E H;  5C4J H;  2VUM H;  2F0F A;  2PQA B;  3FPU B;  1PH4 A;  5EJW A;  2VXW A;  4L63 B;  3GTO H;  1I5F A;  1PTO H;  3EA6 A;  1VQI A;  1GO3 E;  2CQA A;  4TVA B;  4BBS G;  1WTO A;  2G9D A;  2KUM A;  2JA5 G;  2ICI A;  2R7D A;  4IUP A;  3MEF A;  1K8M A;  3PF5 A;  1IXR A;  1SJH D;  3PUY A;  3T1Y L;  1JQY D;  3KYH C;  3SE0 A;  1TY2 A;  3J7A 5;  4HN7 A;  1U4P A;  3PUW A;  1DZ1 A;  1WTP A;  3B6Y A;  3GTP H;  4OO1 I;  4DNT B;  2B2W A;  3JAM L;  1TWA B;  5J1Z A;  4DA2 A;  2FJ2 A;  4G57 A;  5DNF A;  4JI0 Q;  4UP8 A;  4YWM A;  2AUJ D;  2FXQ A;  1I4X A;  2L4N A;  5G3L F;  1WVL A;  1K8A C;  3TP6 A;  4JBM A;  3MA2 B;  3M85 A;  5IT9 L;  2B2Y A;  1F2Y A;  3CQZ H;  1UUP A;  2B8G A;  3GD7 A;  4WJ4 A;  4GN5 A;  3J7Z C;  1CI3 M;  2JA5 B;  1XYI A;  1TWH B;  2XNA C;  3VYT A;  3T4A C;  2ZXO A;  1V1P A;  3J81 E;  2CCZ A;  1QNK A;  3A8K E;  2VZA A;  4CDC C;  1YNX A;  3CKI B;  2L15 A;  2OEO A;  4GNX B;  4IPG A;  2BE5 D;  2Z0S A;  1HNX L;  1FJG L;  2R61 A;  4IUQ A;  1B8A A;  5ISR A;  4DR5 Q;  1I4P A;  3K0X A;  2SOB A;  3RR5 A;  3JAM i;  2KHJ A;  4A3K H;  1Q90 A;  3HOY G;  3DWA A;  2EYL A;  3F8T A;  3KF6 A;  4JOI A;  4DV1 Q;  3WWV A;  1G2T A;  1XMQ L;  2HQE A;  3VA5 A;  3CMA A;  2NZ1 D;  5I4D A;  3AFP A;  1T5E A;  1LT3 D;  1H9J A;  5IYC H;  4QL5 A;  1A63 A;  1B1Z A;  4A3E H;  3S1R H;  1ZYR D;  2UXC L;  1MJC A;  3I4O A;  3SK5 A;  2FMM A;  2RA4 A;  4V19 0;  5IGD A;  3S17 B;  5LMN L;  3M7N A;  2A68 D;  1Q3L A;  2K14 A;  4DR1 Q;  3CAM A;  3QB3 A;  2ES2 A;  1KNE A;  1VS0 A;  4K2K A;  1YNJ D;  5M3F G;  2F0D A;  1NUC A;  4FF1 A;  4BXX H;  5DAU A;  4IJL A;  4FO2 A;  5M5Y H;  2BH8 A;  1H9S B;  3OW2 A;  5FJ8 H;  3C2P A;  4XDX A;  3HOY B;  1N9W A;  2R6G A;  2DGY A;  1D5M C;  4BBR H;  1C9O A;  3HOW H;  3I4M G;  4Z9C B;  1VQO A;  1D1I A;  2K01 A;  3GTQ B;  4X66 L;  1QZG A;  1B70 B;  1GUS A;  4JI4 Q;  1FVI A;  1EYD A;  1X56 A;  2MP1 A;  1N32 Q;  4A3B G;  4A3M H;  1WFQ A;  3WOF A;  2A6E D;  4DV5 L;  4ZLT F;  4X3T A;  5A2Q E;  1EL0 A;  1TU2 B;  1VMC A;  5BN5 A;  1G29 1;  1KDA A;  4EX5 A;  4ZRZ A;  3CRK C;  4LAA A;  4POG A;  3EBE A;  1QG7 A;  1IL2 A;  4Q5V A;  1EY0 A;  3NTI A;  1RHP A;  4IFD I;  1NY4 A;  4C56 C;  3I4M B;  4JI6 L;  5C0X G;  2ID0 A;  4OWW B;  2N78 A;  3RLN A;  4POF A;  3N52 A;  5IGB A;  2G5D A;  2XVS A;  4OHJ A;  3NWS A;  1XNQ Q;  1PH2 A;  5IE8 A;  4RMF A;  3K81 C;  4JI5 L;  4DKA C;  3PCO B;  1TS3 A;  1VDZ A;  1ESR A;  1HRJ A;  3G71 A;  3FEW X;  1V1Q A;  4OXP A;  1ASZ A;  1Y8O B;  3HKZ E;  3RN2 A;  5I6W A;  1PH1 A;  3CCM A;  4NXM Q;  3H0G G;  4C3H H;  4IPC A;  4IOA A;  1I94 L;  4KV6 A;  2K28 A;  5GAG C;  4IJH A;  5M3M H;  4IZ8 A;  2Z8L A;  2ZXP A;  2A74 C;  3WOE A;  4DK6 C;  4PQX A;  1IKM A;  2IPK D;  1SYE A;  1L2F A;  2KCC A;  4AIM A;  1N8R C;  2QEX A;  2AUK A;  4K5V A;  1QCB D;  4ILW A;  1HR0 Q;  2BA1 A;  2K5V A;  2NVX H;  3FPP A;  1CKO A;  2NN6 H;  2D62 A;  4IO9 A;  4Y52 H;  4ULL A;  1PFM A;  4K6L A;  5KRU A;  4JI7 Q;  4XTC S;  2NBF A;  3HKZ B;  3BJU A;  1Q12 A;  3K5N A;  4BY1 B;  1G91 A;  2MJ8 A;  3U4V A;  4UHV A;  1LLR D;  3D4R A;  1MKH A;  1U5K A;  2VS1 A;  1ASY A;  2AHO B;  3NEM A;  2E2D C;  2E74 C;  3C1F A;  5CR3 A;  2IX3 A;  1K8O A;  1A15 A;  1HNW Q;  1QUQ A;  1KAA A;  1CT1 D;  1FR3 A;  2PZW A;  4GOP A;  3DM1 A;  4NB3 A;  1S5C D;  4NW2 A;  1TII D;  2KA7 A;  4JPB W;  5FK9 C;  2NVQ B;  3URY A;  1IKL A;  2LFN A;  2VQE L;  2K75 A;  2EZV A;  3GTG H;  2DY8 A;  4YCW A;  2EJF C;  1SLJ A;  3ULP A;  4X62 L;  3KJO A;  5M5W H;  3OTO Q;  4R4Q A;  1WD1 A;  4A3J H;  3DLL A;  1IBM L;  1BVS A;  1P8L A;  1Z47 A;  4JBJ A;  3RLO A;  2PPB C;  4IFD H;  4B3M Q;  1SAP A;  1H9R A;  4KLK A;  4KN7 C;  3V05 A;  5IGE A;  2AQ2 B;  1JR0 D;  4A3G G;  5C4Z A;  1GJX A;  1EY4 A;  5A35 A;  4C3I G;  5E3F A;  1J6Q A;  2FFK B;  1QNU A;  2KCT A;  4A3I H;  1FNU A;  1H9K A;  3J81 j;  1WTH A;  1L0Y B;  1U4M A;  1ESF A;  4P74 A;  1AN8 A;  4DR1 L;  2EQS A;  1KAW A;  4GNX C;  4WJW A;  1A2U A;  5DEH A;  5EQ0 A;  3BZC A;  1PH6 A;  1B4O A;  2F0U A;  1TS4 A;  2IW3 A;  1NR2 A;  3H6M A;  3SDZ A;  2YYZ A;  3R2T A;  3LGJ A;  1ICW A;  4A3D G;  3NBI A;  3P1H A;  4A3G B;  5L37 A;  4DV3 L;  4DR6 Q;  4C3I B;  3P7J A;  4BY7 H;  5EPL A;  1OO9 B;  1DCZ A;  1YNN C;  2A73 B;  2JA8 G;  4A3K B;  4LF8 L;  1X6O A;  5JPN C;  2O4X A;  2F0T A;  3AQQ A;  2DUD A;  3ERS X;  4BBR G;  2AKW B;  4B9X A;  1EWI A;  2F0L A;  2X6G A;  1KLU D;  5JAV A;  3CP0 A;  5DM7 3;  2J7Z A;  4OIJ A;  4DV2 Q;  4S3S A;  4QIW E;  2UUC L;  1F2Z A;  4J15 A;  1Y1V G;  1JCK B;  4LUO A;  3I8Z A;  4DV7 Q;  1NR4 A;  3VR6 A;  4DV4 Q;  1MHW C;  1JJ2 A;  5M5Y B;  4QMG A;  2I5H A;  4LUZ A;  4QJF A;  1XNQ L;  1DOM A;  3M4O H;  1HFG A;  1KC8 C;  3NSW A;  2B29 A;  4BBR B;  3H3V C;  2KOL A;  3HOW B;  2CWP A;  4F7X A;  5FLM H;  5KND A;  1CUK A;  2DY7 A;  1H9M A;  3A7A B;  5CC4 A;  3CRL C;  4KN4 C;  2AMC B;  2NZO A;  4WOR A;  3NPP A;  1DON A;  4QUC A;  4QIW B;  2R7Z G;  2MNA A;  4NXM L;  1Y1V B;  3TDQ A;  4A76 A;  2EXZ A;  3RUZ A;  4DN4 M;  4B3S L;  4YY3 L;  4K6D A;  3NWT A;  3PUX A;  1QVC A;  2PQE A;  5D3I B;  4EQ5 A;  1XPO A;  4U67 3;  3X3N A;  1TKW B;  3PSI A;  4P75 A;  1HR0 L;  2PO4 A;  5IGC A;  3G6J B;  4N9T A;  1TQO A;  2F0G A;  1EU4 A;  5IP7 G;  4KJN A;  1V1P B;  5ELC A;  1EY5 A;  1WCM G;  4JI7 L;  3S24 A;  1SXT A;  4ZK9 B;  1SFO H;  2KVM A;  4XYO A;  2H4O A;  2R7Z B;  2K5W A;  3E9I A;  4JCV E;  3T1Y Q;  5K36 H;  3S1Q H;  2NZH A;  5JJZ A;  2R92 G;  4K8I A;  2E2H B;  4K0K L;  3G7L A;  1LM0 A;  3KDF A;  3NXW A;  1CM9 A;  2BCO A;  3A5Z B;  4R8I A;  2NN6 G;  3I3C A;  5JPM C;  1BOS A;  3Q6S A;  1SNQ A;  1PVO A;  3VR4 A;  3KF6 B;  2GA4 B;  1D2B A;  1BO0 A;  1U0L A;  1YJ9 A;  1WTW A;  4DR7 Q;  4DK0 A;  4C3H B;  4P71 A;  5D14 A;  2L0C A;  4DR3 L;  4ZYS A;  2OQK A;  2G9H D;  1PXU A;  1PZI D;  1EY8 A;  1E0B A;  5JJK A;  1WCM B;  1VF5 C;  4OGQ C;  3HEJ A;  3U50 C;  3TN2 A;  1AP0 A;  4Y7N H;  4F87 A;  3ULL A;  4JI1 L;  5H1S E;  2NVX B;  2EPB A;  3SGI A;  2J0T D;  1LT6 D;  4J8Q A;  2UUA L;  2JN4 A;  3IKJ A;  5IYD G;  3LNN A;  1HNX Q;  1FJG Q;  1GOZ A;  4LWC A;  3KF8 A;  2E5L L;  3EN2 A;  1YEZ A;  4B3M L;  4A3J G;  2BA0 A;  2Q8R E;  4JI2 L;  5FKA C;  1K83 B;  1XMQ Q;  2DJG C;  3Q24 A;  4FXK C;  1PH3 A;  3FDT A;  2EDG A;  2K52 A;  1IBK L;  4HSV A;  2C5C A;  3S2D H;  1B2T A;  2UXC Q;  3RN5 A;  3FHW A;  5T1I A;  2ZT9 C;  4ZQ3 A;  3T56 B;  4B08 A;  2EJM A;  5I9P A;  5LMN Q;  1ZYR C;  3AEV A;  1I50 H;  1R4Q B;  1CKN B;  3NTH A;  4XQJ A;  1VQE A;  4PZ7 A;  4LF4 L;  1D5X C;  3I55 A;  3VYU A;  2F0J A;  2DNE A;  2OXP A;  1X54 A;  2F0P A;  4LF7 Q;  4JYA Q;  3J81 L;  4A3J B;  2XWJ B;  4B3R Q;  5C4H A;  2DNC A;  2VB2 X;  3M4Y A;  2NYZ D;  4DR6 L;  2R3Z A;  3CCR A;  2BH2 A;  1LTI D;  2CW0 C;  3MFY A;  4OWT B;  3C46 A;  1MI2 A;  1TS2 A;  2XGT A;  2JEB I;  4X66 Q;  1OTC A;  2EXD A;  3KLW A;  1XPR A;  2XWB B;  2AQ1 B;  3LWU A;  3I7F A;  5CV4 A;  2SNM A;  5CV8 A;  3QWN A;  3CCV A;  4LF5 L;  3HZX A;  2M9V A;  4IN3 A;  4LFC L;  4BY7 G;  1VQN A;  2KBN A;  3BZK A;  2IHF A;  4DV2 L;  4A3I B;  4RGT A;  2F0H A;  4CKE A;  1N36 L;  4B3T L;  2UXD L;  1A0I A;  4MNO A;  2QDL A;  2MFI A;  5EKK A;  3J81 i;  1CZW A;  1KIX A;  3K57 A;  4A3F H;  3RZO H;  3ONA B;  4IAL A;  5CBE E;  1ENC A;  2DJF C;  5JEA H;  4JI6 Q;  3M4Q A;  4EQP A;  3NUC A;  1E22 A;  1D1K A;  1QVG A;  1ET6 A;  1ENA A;  5COY A;  1E7Z A;  1K0R A;  1F9P A;  4RGO S;  4C2M B;  3EVQ A;  3TQY A;  1QE6 A;  5T1G A;  1M90 C;  4JI5 Q;  4X3K A;  5C4X H;  1VQB A;  3EJI A;  2B2T C;  3HOU G;  1YHQ A;  4BY7 B;  4L8J A;  3MVV A;  2HHH L;  2RBM A;  3JAM c;  3V96 A;  5CBA E;  2O5J C;  5HGT A;  1PDQ A;  2F0N A;  1SNP A;  2D5D A;  2F0I A;  4G4K A;  2ZM6 L;  5M9O A;  5FLM G;  2XRQ D;  4AH6 A;  3CPW A;  1QUQ B;  3UDF A;  5IT9 c;  1YI2 A;  5A2Q L;  1I94 Q;  3M7G A;  4WFN 3;  4GOP B;  4L5Q A;  1C7Y A;  3J80 E;  4HMI A;  1D5Z C;  2VW9 A;  4IQZ A;  2NVT B;  2JA7 H;  5GAE C;  1TY0 A;  1HNZ L;  3GTK B;  4JK1 C;  5IOC A;  2JA9 A;  3GTJ B;  1EY9 A;  1HA6 A;  2O2L D;  4H02 A;  1VQP A;  3C3L A;  3S16 B;  1AFP A;  3D8G A;  2OQ0 A;  1UE6 A;  1VQ8 A;  1S72 A;  1SSO A;  1NTG A;  3PMF A;  2SEB D;  3HOU B;  3DMU A;  2QW7 A;  4GN3 B;  5BN4 A;  5E7N A;  4H0L C;  3M4O B;  1Q8I A;  1XMO L;  4HR7 B;  1PH9 A;  5JJL A;  3CME A;  4RGN A;  3PO3 H;  5JOB A;  4O0A A;  3S15 H;  3N6R A;  3HOZ H;  4HJ9 A;  4JC0 A;  1PTO F;  2CWA A;  3O13 A;  3OHX C;  5K36 G;  2B2Y C;  4MN3 A;  4DR7 L;  4HCS A;  3PQI A;  2N49 A;  2ZXR A;  4AYB E;  3T1H L;  2WB1 G;  2CQO A;  2WB1 E;  4R8N A;  2QCP X;  3DXJ C;  1K28 A;  4HAE A;  3T16 A;  4XQQ A;  3CU7 A;  3A5U A;  1F9S A;  3MHB A;  2VQE Q;  1ZKO A;  1AW7 A;  3H09 A;  2A8V A;  2BDO A;  3CC4 A;  1BCP F;  4X62 Q;  3K80 C;  1FYC A;  1TVX A;  1NBW A;  4MTN A;  1PFN A;  4A3C H;  2F0O A;  1MIU A;  1IBM Q;  2HUG A;  3U9O A;  1EQQ A;  4KKT A;  4JOI C;  4KHP Q;  4EQN A;  1EFW A;  4F8M A;  1SFO B;  2K7V A;  3BU2 A;  3NEL A;  4PZ8 A;  4J6H A;  3S1Q B;  5EBD A;  3UI2 A;  4AYB B;  3GO5 A;  4Q0F A;  5I9O A;  3TP5 A;  2WB1 B;  1VQ9 A;  1EEF D;  1LV9 A;  5KNB A;  1D7Q A;  1MSH A;  1Z9F A;  3DEP A;  1IW7 D;  4RFB A;  4PMC A;  3L3O C;  4KI0 A;  2RF4 A;  5G3L D;  2F0S A;  1KDC A;  1SYF A;  1RCV D;  3QJY A;  4KD3 A;  2GN5 A;  4PG3 A;  2NTS A;  1XWE A;  1V43 A;  5CV5 A;  1SE8 A;  1RIP A;  3DM3 A;  3STB D;  2F4V L;  4RHR A;  3TS0 A;  4CGY B;  1IYJ B;  2F52 A;  3M4P A;  2ASB A;  1CSQ A;  1OXV A;  4LF7 L;  1B9N A;  2IX0 A;  4NXN Q;  4BA2 I;  4JYA L;  4UY8 C;  1KXL A;  1HPC A;  4Y7N B;  3VR2 A;  2CW0 D;  3RNU A;  2D0P A;  4B3R L;  1NJI C;  1TWF H;  2B39 A;  4ME5 A;  2PW7 A;  2B2V A;  2LY7 A;  4FF4 A;  3I4N H;  4DV3 Q;  1Y14 B;  4EQO A;  1CKM A;  4JW0 A;  1VQD A;  4P72 A;  4OWX B;  5JVH 3;  3T53 B;  4LF8 Q;  1E1T A;  4K5W A;  1SMY C;  4PMB A;  1RJT A;  3BVM A;  2JQO A;  5FLX E;  4G7Z C;  4JG2 A;  1NNX A;  1EY6 A;  4DXF A;  4QF4 A;  4CJ1 B;  1CKN A;  3DEO A;  5D65 A;  2HCC A;  2UUC Q;  2RQX A;  3S2H B;  2N88 A;  1Z7T A;  1O78 A;  4OO1 H;  5I2Y A;  3D6W A;  5C3W A;  3S1M H;  5C5M A;  3TS2 A;  4FP5 D;  3PO2 G;  1ILP A;  2LMC B;  2N8N A;  1WTV A;  2RCN A;  4KMU C;  3CC7 A;  3TP8 A;  1X3E A;  1L1O A;  1RD9 D;  3MXU A;  5IY0 A;  5NUC A;  1EY7 A;  1IYV A;  1FNV A;  2I07 B;  2JA6 G;  2YTX A;  2ZTD A;  2P5Z X;  3ER0 A;  2NVY B;  2K04 A;  1NMG A;  1MSG A;  1SNM A;  3KDF B;  2ATW A;  3HKZ G;  3GDE A;  4NMZ A;  2KCN A;  4BY1 G;  1UEB A;  3U4Z A;  3UDX A;  5EPK A;  5LMU L;  3QG1 A;  2NTT A;  4YWL A;  2PZU A;  3DWQ A;  3PO2 B;  1Q81 C;  4B3S Q;  4YY3 Q;  3A74 A;  1TWG H;  1M4V A;  1WYD A;  3K7A H;  5IYB H;  3AB9 A;  2YU9 H;  4DK3 C;  1HZB A;  4FNF A;  2PCF B;  2EYO A;  3HOX H;  4A3F B;  1XJV A;  2BDN A;  2JA6 B;  1BF4 A;  5C44 G;  1N33 L;  1R9T H;  2FMC A;  4G7H C;  5C3E G;  1VQK A;  2F0W A;  2VUM G;  4OEL B;  3X3M A;  2JA7 G;  3R93 A;  3IRB A;  3KLS A;  2VQF L;  1Q86 C;  4K0K Q;  5C4X B;  1PH7 A;  4PMW A;  3KF8 B;  1PYS B;  4P2C B;  3ICE A;  3H15 A;  1K9M C;  3EFX D;  4DK1 A;  2UUB L;  3JC6 6;  1W2B A;  1HUN A;  4XQN A;  1MGS A;  4GZY C;  3E5S A;  1GUO A;  2Z4I A;  2A69 C;  4LJZ C;  1LYL A;  4DR3 Q;  1O7Z A;  4DR2 L;  4MZ9 A;  3P75 A;  4H44 C;  3GP7 A;  4IPH A;  2D9U A;  4ZUI A;  5C44 B;  1PZJ D;  1I3Q H;  4ZAI A;  3VR3 A;  1YJW A;  4TSS A;  5ELB A;  5C4J B;  5C3E B;  2EY6 A;  2VUM B;  2JA7 B;  4CJ0 B;  1S40 A;  3GTO B;  1PTO B;  2YV5 A;  4LW1 A;  1K73 C;  1CFM A;  1SJE D;  1Y1W H;  1BBX C;  4JI1 Q;  3KOJ A;  3NEN A;  1CK1 A;  4XT1 B;  5IGF A;  3PGZ A;  2F0M A;  3OWF A;  3HFZ B;  2UUA Q;  1X3F A;  1QVF A;  2CH4 W;  3K58 A;  4KHP L;  5KGU A;  4TQU S;  1J5E L;  2QKI C;  5AFW A;  1EYA A;  5I2X A;  1HXY D;  2E5L Q;  3PF4 A;  4BS9 A;  4XYQ A;  1BCP B;  3OW7 A;  4JI2 Q;  2LKV A;  3U9S A;  5BR8 L;  3S15 B;  1JWU D;  5E4W C;  1LTA D;  1B7Y B;  4KD4 A;  4DAV A;  3GTP B;  5C0X J;  1F77 A;  1IBK Q;  3S9W A;  1XNR L;  2A19 A;  4A3K G;  1RF2 D;  4DAY A;  4DR4 L;  2E76 C;  4LK1 C;  2KED A;  4BWG B;  2TMP A;  1XPU A;  3CQZ B;  4L6T B;  3Q22 A;  5IYC G;  1XTD A;  4A3E G;  3OSO A;  1JMC A;  2UXB L;  4LF4 Q;  1C8C A;  4NXN L;  1Y69 U;  3S14 H;  3QOJ A;  1X32 A;  1K3R A;  2C9O A;  4DNR B;  5AJ3 L;  4A93 H;  3TME A;  2ZTE A;  3KBG A;  3BVG A;  1B3Q A;  2R93 H;  4LNQ A;  4BXX G;  3TZD A;  2NB0 A;  1EU3 A;  1LAC A;  1SMY D;  1F2L A;  1QWY A;  4LF6 L;  5FJ8 G;  3E0J A;  3F2D A;  1SR3 A;  3DHQ A;  1W3S A;  1B44 D;  3BG3 A;  1E3P A;  1LT5 D;  3R2I A;  5BN3 A;  2B2U A;  4I7A A;  1VMP A;  3HOW G;  1LO5 D;  4LF5 Q;  2PW5 A;  3NE5 B;  4DV6 L;  1XTC D;  3MXP A;  4A3E B;  3S1R B;  3NP8 A;  4LFC Q;  2A1A A;  1A3T A;  3UDI A;  2RHQ B;  5IIF A;  1JOQ A;  1N36 Q;  4B3T Q;  2UXD Q;  1G6P A;  4A3M G;  2B63 H;  3NBH A;  2E2I H;  1EFI D;  4L5S A;  4RH6 A;  1J9O A;  2TSS A;  3MXN A;  2LS0 1;  1B50 A;  1LTB D;  3TP7 A;  1JT8 A;  3K5L A;  1O7I A;  2EJG C;  1ZXT A;  1TT2 A;  4CDD C;  4HMJ A;  2PNR C;  2RSN A;  4OO1 G;  1CZG A;  1TWF B;  3IL8 A;  1CSP A;  3ND9 A;  1LTG D;  4OON A;  2HDL A;  4HED A;  2KHI A;  3I73 A;  1SRO A;  3I90 A;  1GUT A;  2ALY B;  3I4L A;  2HHH Q;  3H3V I;  3OPO A;  4UDU C;  2CH4 A;  4A3M B;  1L0W A;  2OWO A;  5IP9 H;  2ZM6 Q;  2A6H D;  4GS3 A;  2IX1 A;  4X65 Q;  1KDB A;  4HCE A;  4UP7 A;  3K59 A;  1NAP A;  4QY7 A;  3HGB A;  4ZUJ A;  4JV5 L;  2LSS A;  2MUY A;  1TWA H;  4C3H G;  1HNZ Q;  2IY5 B;  3MZ5 A;  5M3M G;  1JOR A;  3S1M B;  3IFD A;  3GTM H;  1GHK A;  1NCV A;  1DGS A;  2MHV A;  2Z9H A;  5M5X H;  4BBS H;  2EY1 A;  4FVM A;  3HKS A;  1UNS A;  3I2Z A;  1N34 L;  3L2P A;  4RWS C;  2JA5 H;  3ZJY C;  4L5R C;  2K5Q A;  2N3S A;  1JB3 A;  1TWH H;  3AFQ A;  2F0K A;  1XMO Q;  1Q8K A;  1C48 A;  4ID6 A;  1TXY A;  2A69 D;  4APV A;  2F1M A;  1EUJ A;  2IL8 A;  3F1Z A;  1D6E C;  2ZJP A;  5C0X I;  3T1H Q;  4KJO A;  3ULJ A;  4CHT B;  5M3M B;  1MBY A;  2OF1 A;  3CPF A;  1YIJ A;  4O2D A;  1TWG B;  3J80 L;  3K7A B;  5E4X A;  5ELD A;  5KYI A;  2YU9 B;  1KRS A;  1Z6H A;  3I70 A;  3K0Y A;  4ZKC B;  1EQV A;  1VQ7 A;  1O7L A;  4YIJ A;  3J81 c;  5CGK A;  3S17 H;  2FIN B;  1UEA B;  4QB4 A;  5E1F A;  3KBX A;  1KAB A;  3OWE B;  2JE6 I;  1XX8 A;  2PI2 A;  3I91 A;  4XXE A;  1JWM D;  3KLS X;  1JC7 A;  2LXJ A;  1GD7 A;  1RTO A;  3HOY H;  3M3Y H;  1EEI D;  1STN A;  3F2B A;  3T13 A;  2EY5 A;  3HOV H;  4QUF A;  4JI8 L;  4IFD G;  2AWO A;  1PTO C;  2EOT A;  2EYH A;  4YCU A;  1IW7 C;  4XT3 B;  3J80 i;  1E1O A;  4PZ6 A;  1M1K C;  1SMX A;  2F4V Q;  2Z6K A;  4A3L H;  2KHS A;  3BDL A;  1EZ8 A;  3GTG B;  4X3U A;  4A3I G;  3H3V H;  2WIN B;  3D31 A;  3STB C;  5M5W B;  1X3Q A;  2C35 B;  2EE1 A;  5M3F H;  3J7Y W;  1BCP C;  1RL2 A;  2K50 A;  5COR A;  1EYG A;  3OMG A;  4FXD A;  2HT1 A;  1K0S A;  4DFA A;  2OTL A;  1H95 A;  1EQR A;  2GVA A;  1L1O B;  2EYF A;  1WI5 A;  5EKL A;  2WII B;  3I4M H;  3CHB D;  4QCL A;  1LTL A;  1D8L A;  2PYK A;  4X64 L;  1A8V A;  3OIQ A;  5CV7 A;  4R4T A;  4ODG A;  3GTL H;  3V2T A;  2VY3 A;  1SN8 A;  1PA6 A;  5J3B A;  4LUV A;  4A3B H;  2K6A A;  2K5H A;  2I5M X;  3G4S A;  4LFB L;  1VQA A;  4B9W A;  2Z4H A;  1G51 A;  3S1N H;  3W3A A;  3F2U A;  2ZJQ A;  4HJ5 A;  4HJA A;  2PMZ E;  1AZP A;  1S5F D;  1JWS D;  2ENB A;  4ABN A;  1WD0 A;  1NE3 A;  4LFA L;  3HRZ C;  4HJ8 A;  1W6J A;  4HSP A;  3S14 B;  5EBC A;  5CMD A;  5C0X H;  1STB A;  4A93 B;  2WKD A;  4LF9 Q;  1JE5 A;  1PRT F;  3SHL A;  3RMH A;  3A8J E;  3E6Z X;  3QR8 A;  1STY A;  1SYD A;  4X3S A;  1LUZ A;  5CV9 A;  5EGT A;  1GVP A;  1CQV A;  1STG A;  2WAQ E;  3J7A V;  1VQJ A;  3PUV A;  5GAD C;  4WRD A;  4JI3 L;  1BKB A;  1UWV A;  5HUR A;  5CV6 A;  1SE2 A;  2PMZ B;  5LL6 X;  2XN9 C;  5LMU Q;  4E6I A;  4DV0 L;  4OX9 L;  1SEB D;  5FLX L;  5IGG A;  3W1B A;  4X65 L;  1VQM A;  1G8Z D;  3H0G H;  2GVB A;  1YBY A;  1VQF A;  2AWN A;  1E2V A;  2E2I B;  2Q2H A;  2XTI A;  5TSS A;  1VQ6 A;  2RDH A;  1F9Q A;  3QOL A;  4GLX A;  5C3X A;  2MPM A;  3CD6 A;  3BYT B;  2WAQ B;  1N33 Q;  1LTR D;  4YWK A;  2NVQ H;  2K4K A;  1ILQ A;  5J39 A;  4JBW A;  2F03 A;  2CKZ B;  5D3D A;  4C1N K;  4A75 A;  2Q8T A;  3HS0 C;  3RLF A;  1A2T A;  4DUZ L;  2B2W C;  2VQF Q;  4WJ3 M;  4O42 A;  1QOH A;  1ENF A;  4NPS A;  4IPD A;  2OCE A;  4GKK Q;  2OT2 A;  2L12 A;  2UUB Q;  1SE3 A;  4G7O C;  1UE7 A;  2EYP A;  1HZC A;  2QDB A;  3D4D A;  3FP9 A;  5GQO A;  1K8G A;  4AYB G;  2ZTC A;  4IUN A;  3KFU A;  1EOT A;  5ELE A;  4DR2 Q;  3NQI A;  4CDE C;  1SE4 A;  3K8A A;  2PNH A;  4DAY B;  2H1E A;  3CC2 A;  2Q2U A;  1AZQ A;  1E24 A;  3LWE A;  1QJO A;  2RSO A;  4RKB A;  1U9R A;  4GKJ L;  3GTM B;  4I65 A;  1QIL A;  2F0V A;  2I5L X;  5M5X B;  4BBS B;  2RKS A;  4TRD A;  1J5E Q;  1BR9 A;  4AQY L;  2H5X A;  4P73 A;  4R4I A;  1TWC H;  4RHS A;  3AYH B;  4CBV A;  4QGU A;  1I6V C;  5BR8 Q;  1SNO A;  1PTO D;  4NP5 A;  1DXM A;  4MHE A;  2XIW A;  4R1J A;  4A3G H;  1XNR Q;  1GUW A;  1ZEQ X;  5J22 A;  3CCQ A;  4FXG C;  4C3I H;  1TS5 A;  2Z1C A;  3A55 A;  4DR4 Q;  2AQ3 B;  1LTT D;  2E2J H;  1S5D D;  2RHS B;  2WP8 J;  2CHB D;  4A4I A;  1BCP D;  1Q7Y C;  3HOV G;  4DUY L;  5EPJ A;  1FGB D;  1Q46 A;  2J4X A;  2UXB Q;  3NBH B;  4RKL A;  4XIG S;  2M2L A;  1B3A A;  2D0O A;  5K5P A;  1ONL A;  2B2V C;  1RKN A;  4K8J A;  3MXN B;  1CQF A;  2NN6 I;  5AJ3 Q;  4ALP A;  3A0J A;  3BZD B;  4A3L G;  1BUV T;  3K5O A;  1BBU A;  2F3I A;  1KD1 C;  4A3D H;  2QA4 A;  1Y8P B;  4MIU A;  1YJN A;  4LF6 Q;  1XXG A;  4RAU C;  3G6E A;  3ITP A;  1DYQ A;  5ELN A;  2JJQ A;  2WV6 D;  2YTV A;  2JA8 H;  1HR0 W;  4F88 A;  1BNZ A;  1IBL Q;  3Q0A A;  3M3Y B;  3PV0 A;  4DV6 Q;  5C5L A;  3S2D B;  5JVG 3;  3HOV B;  2K03 A;  3KLR A;  1DOL A;  2L9H A;  1T9H A;  1I50 B;  1RTN A;  1Q82 C;  1L1O C;  1DM0 B;  1Y1V H;  3OIP A;  1C0A A;  1KLG D;  3KK7 A;  5M3F B;  4LF9 L;  4HIO A;  3SR1 A;  2CFM A;  2L1B A;  2ICE C;  4A3F G;  3I56 A;  4V0B A;  5JEA G;  4HIM A;  2FHT A;  4ZCK A;  2HDM A;  1A3U A;  5IWA L;  2XSC A;  3F2C A;  4CKC A;  4CDF C;  1JOO A;  1JOK A;  2QIL A;  1YZ6 A;  3TSS A;  4GLV B;  5C4X G;  3GTL B;  2B8F A;  4GN4 B;  1PRT B;  2R7Z H;  3ND8 A;  2E2H H;  4A3B B;  4I7Z C;  1TR5 A;  2PI2 E;  2I0Q A;  2A6H C;  3JAM E;  4JV5 Q;  1V9P A;  3Q8D A;  3S1N B;  2UU9 L;  1LAB A;  3CCL A;  3RZO B;  2RDF A;  2A5H A;  5IT9 E;  1YHB A;  3IFT A;  4N9P A;  2PZT A;  4TKO B;  2Q8I B;  1T5X D;  1S5E D;  5IOD A;  4IOC A;  1EZ6 A;  1N34 Q;  1V1O A;  5IP7 H;  3OYY A;  1WCM H;  1L0X B;  2KEN A;  4K14 A;  4HIK A;  4KKS A;  1PV4 A;  1VQH A;  4GOP C;  4GKK L;  3SK4 A;  1ET9 A;  4DXG A;  2Q2I A;  2R92 H;  1E2W A;  2SNS A;  1NSN S;  2L55 A;  5LL6 S;  2F0Q A;  4ZKB B;  2HQL A;  3C1E A;  1VQC A;  2RVL A;  1KQS A;  3QIA A;  3PO3 G;  3LX0 A;  4UP9 A;  1EIY B;  2JXM B;  3J7A F;  3A7L A;  3D6C A;  3HOZ G;  3UE1 A;  3H0G B;  2IJ0 A;  4DU9 A;  2YTY A;  2X6L A;  1K83 H;  4RA8 A;  2VNU D;  2HIV A;  3P20 A;  4KY6 A;  1C4Q A;  3GQB A;  1OXU A;  5DLQ E;  4JI0 L;  3PIO 3;  2I46 A;  4OEM B;  4RCO A;  4FF3 A;  4H7B A;  4O1N A;  2JEA I;  2HIX A;  2F0E A;  2QGQ A;  3EQL C;  2SDF A;  1HZA A;  1EOV A;  1BQQ T;  1GUG A;  3VR5 A;  3SXH A;  2PQA A;  4PV1 C;  1KTK A;  4EGV A;  1SYB A;  2VL6 A;  1YHA A;  2K5N A;  3FKI H;  3TRE A;  5IYD H;  1FL0 A;  1HQR D;  1WTQ A;  4A3C G;  2HD3 A;  1KHI A;  1II3 A;  1A6X A;  3K5M A;  1KRT A;  4C3J H;  3PO3 B;  1R4P B;  1VQL A;  4KHZ A;  1I6H H;  2CVR A;  3HOZ B;  2QF7 A;  1VQ4 A;  3MXG A;  4IUU A;  1X9N A;  1CHP D;  1X65 A;  2B3G A;  1EWH A;  1RDP D;  1JE4 A;  4QQB X;  2VB3 X;  4JI8 Q;  4DR5 L;  3HP3 A;  2Y0S G;  4UAI A;  2Y0S E;  1SND A;  4KHV A;  4DV1 L;  5FO7 B;  2OTJ A;  5JEA J;  5LHY 1;  1X55 A;  3RZD H;  3A54 A;  1PZK D;  1HUM A;  2JK8 A;  3CCE A;  4FYD A;  1F9R A;  4PNY A;  1NMF A;  4EVO A;  1G6Z A;  1SDF A;  4CJ2 C;  1GM5 A;  4KK7 A;  1K3B C;  3PUZ A;  3CCS A;  2Q2T A;  2B2U C;  1GXD C;  3CCU A;  4IUT A;  1TWC B;  2DN8 A;  2RDG A;  4GNX A;  4HTH A;  1PYB A;  3VYS A;  1SYC A;  4X64 Q;  2Y0S B;  3TRZ A;  4HID A;  3CXC A;  5KYL A;  1EIH A;  1GKH A;  1G2S A;  3OOC A;  2KEC A;  1IBL L;  3I4N G;  1JIC A;  2K1B A;  4C2M H;  1U4R A;  3NQT A;  2KQ3 A;  3FVQ A;  3W2D A;  1YVC A;  1A3V A;  1Q1B A;  5C6A A;  1MJE A;  3SK8 A;  4LFB Q;  3SK6 A;  4FDB A;  2E2J B;  4JI4 L;  3NK9 A;  3CCJ A;  2WFW A;  1N32 L;  4DGZ A;  1FD7 D;  1OXX K;  4DPG A;  1EWC A;  4DAP A;  3DWP A;  2R7F A;  4LFA Q;  2E75 C;  1LTS D;  3BYY B;  3M9B A;  5I6Y A;  1ROD A;  3R3O A;  4ME3 A;  1WTX A;  5DM6 3;  2NVT H;  2O5I C;  3I4N B;  3GTK H;  4A3D B;  2EYJ A;  3PIP 3;  3GV3 A;  1KNA A;  1H9S A;  2KCM A;  1SRU A;  3L9A X;  3QO2 A;  3GTJ H;  3S16 H;  1VQ5 A;  2RCF A;  2V1C C;  1HFN A;  1STE A;  3ERQ A;  4OL7 A;  3AMU A;  3HOU H;  3BS1 A;  2K32 A;  3KJP A;  3R8B A;  4JI3 Q;  1I4R A;  4H13 C;  3L0O A;  1PMR A;  2JA8 B;  3WDN A;  3K6O A;  4RGM A;  4DV0 Q;  4OX9 Q;  1STH A;  3E9H A;  1EIG A;  1SNC A;  2F3V A;  3MTS A;  5KIX A;  5FO9 B;  1YIT A;  3MEH A;  4KTA A;  4C1N I;  2LXK A;  3EIV A;  1BXT A;  2KJX A;  4J1M A;  3D3R A;  1VQG A;  4M8A A;  4M1U B;  3J80 c;  3VYR A;  2IHE A;  3ERO A;  1HA5 A;  1WJJ A;  2F3W A;  2V4D A;  4YHH Q;  5FO8 B;  4K5X A;  1S5B D;  1DOK A;  5IYB G; 
#chains in the Genus database with same CATH homology
 1PFB A;  1OXT A;  1PRT C;  1U4L A;  4FF2 A;  5KNC A;  1SYG A;  1CTM A;  1X3P A;  3TZU A;  4R9W A;  3TBI B;  3SVM A;  1PLF A;  3KUP A;  4NKL A;  1I4H A;  2MGS A;  1I4Q A;  3H94 A;  5ELF A;  2EY2 A;  2EYM A;  3HOX B;  3MAQ A;  2L5T A;  5F2D A;  2EVB A;  1R9T B;  5FOB B;  4KKU A;  1EQT A;  4IUR A;  5KEE A;  1B9M A;  1IL8 A;  4K2L A;  1BDO A;  1I4G A;  1HCZ A;  1E2Z A;  4DF7 A;  1F2M A;  4CKB A;  2R92 B;  1DJR D;  1Y8N B;  2X69 A;  2F4I A;  4OIK A;  1GUN A;  4C3J G;  4RCN A;  2JP1 A;  3BVZ A;  1CA6 A;  3T51 B;  4LMQ D;  1M8A A;  2BE5 C;  1GHJ A;  2KEE A;  3Q23 A;  1O7Y A;  1I3Q B;  3DUZ A;  1DD2 A;  4BA1 I;  3NTK A;  1QB5 D;  3FRP B;  3L7Z C;  5EKI A;  3RD4 A;  2BOS A;  3IAY A;  1Y1W B;  1Q1E A;  1VCI A;  1VF7 A;  3ZYY X;  1UAP A;  2IT1 A;  1MD2 D;  4IUV A;  3FKI B;  2A68 C;  3BDC A;  3I72 A;  4C3J B;  3HG9 A;  1I6H B;  1YNJ C;  3SEB A;  4KY7 A;  1YNN D;  1FNW A;  1EYC A;  1PYW D;  3VA7 A;  1HTL D;  1V8Q A;  3NHH A;  3D4W A;  2NUC A;  1ML0 D;  2WKC A;  2NWG A;  3RZD B;  3GV6 A;  2M00 A;  3OMC A;  2JSO A;  3FMC A;  1S4Z A;  2D2C C;  2A6E C;  2HCI A;  1HHV A;  3A8I E;  1IYU A;  2WAC A;  2R93 B;  3H91 A;  1IHZ A;  1J8I A;  2XRS D;  1AEX A;  1STA A;  5CYU A;  1LT4 D;  1WTR A;  2IWH A;  2N55 A;  1O80 A;  2QEJ C;  1SBB B;  1HQM C;  3AU7 A;  3BDO A;  2B63 B;  3MWY W;  2L11 A;  3MC0 B;  4NDX A;  1CA5 A;  2B2T A;  1OXS C;  2K05 A;  4U68 A;  2K5D A;  3MFG A;  1B53 A;  2K33 A;  1HTP A;  4KY5 A;  2JYO A;  1W6K A;  1PRT D;  4IFD J;  3A56 A;  1CHQ D;  2F0F A;  3FPU B;  5EJW A;  2VXW A;  4L63 B;  3EA6 A;  1PTO H;  2CQA A;  1WTO A;  2G9D A;  2KUM A;  2ICI A;  4IUP A;  1K8M A;  1SJH D;  3PUY A;  1JQY D;  3SE0 A;  1TY2 A;  4HN7 A;  1U4P A;  3PUW A;  1DZ1 A;  1WTP A;  4OO1 I;  4DNT B;  2B2W A;  3JAM L;  1TWA B;  5J1Z A;  4DA2 A;  2FJ2 A;  4G57 A;  5DNF A;  2AUJ D;  2L4N A;  1I4X A;  5G3L F;  1WVL A;  3TP6 A;  3MA2 B;  3M85 A;  5IT9 L;  2B2Y A;  1F2Y A;  1UUP A;  2B8G A;  3GD7 A;  1CI3 M;  2JA5 B;  1XYI A;  1TWH B;  2XNA C;  3VYT A;  3T4A C;  2ZXO A;  1V1P A;  3J81 E;  1QNK A;  3A8K E;  3CKI B;  2OEO A;  2BE5 D;  2R61 A;  4IUQ A;  5ISR A;  1I4P A;  2SOB A;  1Q90 A;  3DWA A;  2EYL A;  1G2T A;  2HQE A;  3VA5 A;  2NZ1 D;  5I4D A;  1T5E A;  1LT3 D;  1H9J A;  1B1Z A;  1ZYR D;  3SK5 A;  2FMM A;  2RA4 A;  4V19 0;  5IGD A;  3S17 B;  3M7N A;  2A68 D;  1Q3L A;  3QB3 A;  1KNE A;  4K2K A;  1YNJ D;  2F0D A;  1NUC A;  4FF1 A;  5DAU A;  4FO2 A;  1H9S B;  3C2P A;  4XDX A;  3HOY B;  2R6G A;  1D5M C;  4Z9C B;  1D1I A;  2K01 A;  3GTQ B;  1GUS A;  1EYD A;  2MP1 A;  3WOF A;  2A6E D;  4ZLT F;  4X3T A;  5A2Q E;  1EL0 A;  1TU2 B;  1VMC A;  5BN5 A;  1G29 1;  1KDA A;  4ZRZ A;  3CRK C;  4LAA A;  1QG7 A;  4Q5V A;  1EY0 A;  3NTI A;  1RHP A;  4IFD I;  4C56 C;  3I4M B;  5C0X G;  2ID0 A;  3N52 A;  5IGB A;  2XVS A;  4OHJ A;  3NWS A;  1TS3 A;  1VDZ A;  1ESR A;  1HRJ A;  3FEW X;  1Y8O B;  5I6W A;  4KV6 A;  2K28 A;  4IZ8 A;  2Z8L A;  2ZXP A;  2A74 C;  3WOE A;  4PQX A;  1IKM A;  2IPK D;  1SYE A;  2KCC A;  2AUK A;  4K5V A;  1QCB D;  4ILW A;  2BA1 A;  3FPP A;  2NN6 H;  2D62 A;  4ULL A;  1PFM A;  4K6L A;  5KRU A;  4XTC S;  2NBF A;  3HKZ B;  1Q12 A;  3K5N A;  4BY1 B;  1G91 A;  2MJ8 A;  1LLR D;  3D4R A;  2E2D C;  2E74 C;  3C1F A;  5CR3 A;  2IX3 A;  1K8O A;  1A15 A;  1KAA A;  1CT1 D;  1FR3 A;  2PZW A;  3DM1 A;  1S5C D;  4NW2 A;  1TII D;  2KA7 A;  5FK9 C;  2NVQ B;  3URY A;  1IKL A;  2LFN A;  2EZV A;  2DY8 A;  2EJF C;  1WD1 A;  1Z47 A;  2PPB C;  4IFD H;  1SAP A;  1H9R A;  3V05 A;  4KN7 C;  5IGE A;  2AQ2 B;  1JR0 D;  1GJX A;  5C4Z A;  1EY4 A;  5A35 A;  4C3I G;  5E3F A;  2FFK B;  1QNU A;  1FNU A;  1H9K A;  1L0Y B;  1U4M A;  1ESF A;  1AN8 A;  4WJW A;  1A2U A;  5DEH A;  5EQ0 A;  1B4O A;  2F0U A;  1TS4 A;  2IW3 A;  1NR2 A;  3H6M A;  3SDZ A;  2YYZ A;  3R2T A;  1ICW A;  3NBI A;  3P1H A;  4A3G B;  4C3I B;  3P7J A;  5EPL A;  1OO9 B;  1DCZ A;  1YNN C;  2A73 B;  4A3K B;  5JPN C;  2O4X A;  2F0T A;  4B9X A;  2F0L A;  2X6G A;  1KLU D;  5JAV A;  5DM7 3;  2J7Z A;  4OIJ A;  4S3S A;  1F2Z A;  1JCK B;  3I8Z A;  1NR4 A;  3VR6 A;  5M5Y B;  4QMG A;  1DOM A;  1HFG A;  3NSW A;  4BBR B;  3H3V C;  2KOL A;  3HOW B;  4F7X A;  5KND A;  2DY7 A;  1H9M A;  3A7A B;  5CC4 A;  3CRL C;  4KN4 C;  4WOR A;  3NPP A;  1DON A;  4QUC A;  4QIW B;  1Y1V B;  3TDQ A;  2EXZ A;  3RUZ A;  4DN4 M;  4K6D A;  3NWT A;  3PUX A;  2PQE A;  5D3I B;  4U67 3;  3X3N A;  1TKW B;  2PO4 A;  5IGC A;  3G6J B;  4N9T A;  1TQO A;  2F0G A;  1EU4 A;  4KJN A;  1V1P B;  5ELC A;  1EY5 A;  1SXT A;  4ZK9 B;  2KVM A;  4XYO A;  2H4O A;  2R7Z B;  2K5W A;  5K36 H;  5JJZ A;  2E2H B;  4K8I A;  3G7L A;  3NXW A;  1CM9 A;  2BCO A;  4R8I A;  2NN6 G;  3I3C A;  5JPM C;  1BOS A;  3Q6S A;  1SNQ A;  3VR4 A;  2GA4 B;  1D2B A;  1BO0 A;  1WTW A;  4DK0 A;  4C3H B;  5D14 A;  2L0C A;  4ZYS A;  2G9H D;  1PXU A;  1PZI D;  1EY8 A;  1E0B A;  1WCM B;  1VF5 C;  4OGQ C;  3HEJ A;  3TN2 A;  1AP0 A;  4F87 A;  2NVX B;  2EPB A;  2J0T D;  1LT6 D;  4J8Q A;  3IKJ A;  3LNN A;  1GOZ A;  3KF8 A;  2BA0 A;  2Q8R E;  5FKA C;  1K83 B;  3Q24 A;  4FXK C;  3FDT A;  2EDG A;  4HSV A;  2C5C A;  1B2T A;  5T1I A;  2ZT9 C;  4ZQ3 A;  3T56 B;  4B08 A;  2EJM A;  5I9P A;  1ZYR C;  1R4Q B;  3NTH A;  4XQJ A;  1D5X C;  3VYU A;  2F0J A;  2DNE A;  2OXP A;  2F0P A;  3J81 L;  4A3J B;  2XWJ B;  5C4H A;  2DNC A;  2VB2 X;  3M4Y A;  2NYZ D;  2R3Z A;  1LTI D;  2CW0 C;  3MFY A;  3C46 A;  1MI2 A;  1TS2 A;  2JEB I;  2XWB B;  2AQ1 B;  3LWU A;  5CV4 A;  2SNM A;  5CV8 A;  3QWN A;  3HZX A;  2M9V A;  4IN3 A;  4A3I B;  4RGT A;  2F0H A;  4CKE A;  5EKK A;  1CZW A;  3K57 A;  3ONA B;  4IAL A;  5CBE E;  1ENC A;  5JEA H;  4EQP A;  3NUC A;  1D1K A;  1ET6 A;  1ENA A;  5COY A;  4RGO S;  1F9P A;  4C2M B;  3EVQ A;  1QE6 A;  5T1G A;  4X3K A;  3EJI A;  2B2T C;  4BY7 B;  4L8J A;  3MVV A;  2RBM A;  3V96 A;  5CBA E;  2O5J C;  5HGT A;  1PDQ A;  2F0N A;  1SNP A;  2D5D A;  2F0I A;  4G4K A;  5M9O A;  2XRQ D;  5A2Q L;  3M7G A;  4WFN 3;  3J80 E;  4HMI A;  1D5Z C;  4IQZ A;  2NVT B;  1TY0 A;  3GTK B;  4JK1 C;  5IOC A;  3GTJ B;  1EY9 A;  1HA6 A;  2O2L D;  3C3L A;  3S16 B;  1AFP A;  3D8G A;  1SSO A;  3PMF A;  2SEB D;  3HOU B;  3DMU A;  5BN4 A;  4H0L C;  3M4O B;  1Q8I A;  4HR7 B;  4RGN A;  5JOB A;  3N6R A;  1PTO F;  3O13 A;  3OHX C;  5K36 G;  2B2Y C;  4MN3 A;  4HCS A;  2ZXR A;  4R8N A;  2QCP X;  3DXJ C;  4HAE A;  3T16 A;  4XQQ A;  3CU7 A;  1F9S A;  3MHB A;  1ZKO A;  1AW7 A;  3H09 A;  2BDO A;  1BCP F;  1FYC A;  1TVX A;  1PFN A;  2F0O A;  2HUG A;  3U9O A;  4KKT A;  4EQN A;  4F8M A;  1SFO B;  2K7V A;  3S1Q B;  4J6H A;  5EBD A;  3UI2 A;  4AYB B;  3GO5 A;  4Q0F A;  5I9O A;  3TP5 A;  2WB1 B;  1EEF D;  1LV9 A;  5KNB A;  1MSH A;  3DEP A;  1IW7 D;  4RFB A;  4PMC A;  3L3O C;  4KI0 A;  5G3L D;  2F0S A;  1KDC A;  1SYF A;  1RCV D;  3QJY A;  4KD3 A;  2NTS A;  1XWE A;  1V43 A;  5CV5 A;  4RHR A;  4CGY B;  1OXV A;  4BA2 I;  1B9N A;  2IX0 A;  1HPC A;  4Y7N B;  3VR2 A;  2CW0 D;  4ME5 A;  2B39 A;  2PW7 A;  2B2V A;  2LY7 A;  4FF4 A;  4EQO A;  5JVH 3;  3T53 B;  4K5W A;  1SMY C;  4PMB A;  1RJT A;  3BVM A;  5FLX E;  4G7Z C;  1EY6 A;  4DXF A;  4QF4 A;  4CJ1 B;  3DEO A;  5D65 A;  2HCC A;  2RQX A;  3S2H B;  2N88 A;  1Z7T A;  1O78 A;  4OO1 H;  5I2Y A;  3D6W A;  5C3W A;  5C5M A;  4FP5 D;  1ILP A;  2LMC B;  1WTV A;  4KMU C;  3TP8 A;  1RD9 D;  3MXU A;  5NUC A;  1EY7 A;  1IYV A;  1FNV A;  2I07 B;  2NVY B;  2K04 A;  1MSG A;  1SNM A;  4NMZ A;  2KCN A;  5EPK A;  3QG1 A;  2NTT A;  2PZU A;  3DWQ A;  3PO2 B;  1M4V A;  3AB9 A;  4FNF A;  2PCF B;  2EYO A;  4A3F B;  2BDN A;  2JA6 B;  1BF4 A;  2FMC A;  4G7H C;  2F0W A;  3X3M A;  3R93 A;  3KLS A;  5C4X B;  4PMW A;  4P2C B;  3EFX D;  4DK1 A;  1HUN A;  4XQN A;  1MGS A;  4GZY C;  3E5S A;  1GUO A;  2Z4I A;  2A69 C;  4LJZ C;  1O7Z A;  3P75 A;  4H44 C;  3GP7 A;  2D9U A;  4ZUI A;  5C44 B;  1PZJ D;  4ZAI A;  3VR3 A;  4TSS A;  5ELB A;  5C4J B;  5C3E B;  2EY6 A;  2VUM B;  2JA7 B;  4CJ0 B;  3GTO B;  1PTO B;  1SJE D;  1CFM A;  1BBX C;  4XT1 B;  1CK1 A;  5IGF A;  2F0M A;  3OWF A;  3K58 A;  5KGU A;  4TQU S;  2QKI C;  5AFW A;  1EYA A;  5I2X A;  1HXY D;  4BS9 A;  4XYQ A;  1BCP B;  3OW7 A;  2LKV A;  3U9S A;  3S15 B;  1JWU D;  5E4W C;  1LTA D;  4DAV A;  4KD4 A;  3GTP B;  5C0X J;  1F77 A;  3S9W A;  1RF2 D;  4DAY A;  2E76 C;  4LK1 C;  2KED A;  4BWG B;  2TMP A;  3CQZ B;  4L6T B;  3Q22 A;  3OSO A;  1C8C A;  1Y69 U;  3QOJ A;  1X32 A;  2C9O A;  4DNR B;  3TME A;  3KBG A;  3BVG A;  3TZD A;  2NB0 A;  1EU3 A;  1LAC A;  1SMY D;  1F2L A;  1QWY A;  3E0J A;  3DHQ A;  1B44 D;  3BG3 A;  1LT5 D;  3R2I A;  5BN3 A;  2B2U A;  1VMP A;  1LO5 D;  2PW5 A;  3NE5 B;  1XTC D;  3MXP A;  4A3E B;  3S1R B;  3NP8 A;  1A3T A;  5IIF A;  1JOQ A;  3NBH A;  1EFI D;  4RH6 A;  1J9O A;  2TSS A;  3MXN A;  2LS0 1;  1B50 A;  1LTB D;  3TP7 A;  3K5L A;  2EJG C;  1ZXT A;  1TT2 A;  4HMJ A;  2PNR C;  2RSN A;  4OO1 G;  1CZG A;  1TWF B;  3IL8 A;  3ND9 A;  1LTG D;  2HDL A;  4HED A;  3I73 A;  3I90 A;  1GUT A;  3I4L A;  3OPO A;  4UDU C;  4A3M B;  2A6H D;  2IX1 A;  1KDB A;  4HCE A;  3K59 A;  1NAP A;  3HGB A;  4ZUJ A;  2MUY A;  4C3H G;  3MZ5 A;  1JOR A;  3S1M B;  3IFD A;  1GHK A;  1NCV A;  2MHV A;  2EY1 A;  4FVM A;  1UNS A;  4RWS C;  2K5Q A;  1JB3 A;  2F0K A;  1C48 A;  4ID6 A;  2A69 D;  2F1M A;  2IL8 A;  1D6E C;  5C0X I;  4KJO A;  4CHT B;  5M3M B;  1MBY A;  2OF1 A;  1TWG B;  3J80 L;  3K7A B;  5E4X A;  5ELD A;  5KYI A;  2YU9 B;  1Z6H A;  3I70 A;  3K0Y A;  4ZKC B;  1EQV A;  1O7L A;  4YIJ A;  5CGK A;  2FIN B;  1UEA B;  4QB4 A;  5E1F A;  3KBX A;  1KAB A;  3OWE B;  2JE6 I;  1XX8 A;  3I91 A;  4XXE A;  1JWM D;  3KLS X;  1JC7 A;  1RTO A;  1EEI D;  1STN A;  3T13 A;  2EY5 A;  4QUF A;  4IFD G;  2AWO A;  1PTO C;  2EOT A;  2EYH A;  1IW7 C;  4XT3 B;  2KHS A;  3BDL A;  1EZ8 A;  3GTG B;  4X3U A;  2WIN B;  3D31 A;  5M5W B;  1X3Q A;  2EE1 A;  3J7Y W;  1BCP C;  5COR A;  3OMG A;  4FXD A;  4DFA A;  2EYF A;  5EKL A;  2WII B;  3CHB D;  4QCL A;  2PYK A;  3OIQ A;  5CV7 A;  4ODG A;  3V2T A;  2K6A A;  4B9W A;  2Z4H A;  3W3A A;  3F2U A;  1AZP A;  1S5F D;  1JWS D;  2ENB A;  4ABN A;  1WD0 A;  3HRZ C;  1W6J A;  4HSP A;  3S14 B;  5EBC A;  5CMD A;  5C0X H;  1STB A;  4A93 B;  2WKD A;  1PRT F;  3SHL A;  3RMH A;  3A8J E;  3E6Z X;  1STY A;  1SYD A;  4X3S A;  5CV9 A;  5EGT A;  1CQV A;  1STG A;  3J7A V;  3PUV A;  4WRD A;  5HUR A;  5CV6 A;  1SE2 A;  2PMZ B;  5LL6 X;  2XN9 C;  4E6I A;  1SEB D;  5FLX L;  5IGG A;  1G8Z D;  2AWN A;  1E2V A;  2E2I B;  5TSS A;  2RDH A;  1F9Q A;  3QOL A;  5C3X A;  2MPM A;  3BYT B;  2WAQ B;  1LTR D;  1ILQ A;  5J39 A;  4JBW A;  2F03 A;  5D3D A;  4C1N K;  2Q8T A;  3HS0 C;  3RLF A;  1A2T A;  2B2W C;  4O42 A;  1QOH A;  1ENF A;  2OT2 A;  2L12 A;  1SE3 A;  4G7O C;  2EYP A;  2QDB A;  3D4D A;  4IUN A;  1EOT A;  5ELE A;  3NQI A;  1SE4 A;  2H1E A;  1AZQ A;  3LWE A;  1QJO A;  2RSO A;  4RKB A;  1U9R A;  3GTM B;  4I65 A;  1QIL A;  2F0V A;  5M5X B;  4BBS B;  2RKS A;  4TRD A;  1BR9 A;  4RHS A;  4CBV A;  1I6V C;  1SNO A;  1PTO D;  4NP5 A;  1DXM A;  4MHE A;  2XIW A;  1GUW A;  1ZEQ X;  5J22 A;  4FXG C;  1TS5 A;  2Z1C A;  3A55 A;  2AQ3 B;  1LTT D;  1S5D D;  2WP8 J;  2CHB D;  1BCP D;  5EPJ A;  1FGB D;  2J4X A;  4RKL A;  4XIG S;  2M2L A;  1B3A A;  5K5P A;  1ONL A;  2B2V C;  1RKN A;  4K8J A;  1CQF A;  2NN6 I;  3BZD B;  1BUV T;  3K5O A;  1Y8P B;  4MIU A;  1XXG A;  4RAU C;  3ITP A;  1DYQ A;  2WV6 D;  4F88 A;  1BNZ A;  3Q0A A;  3M3Y B;  3PV0 A;  5C5L A;  3S2D B;  5JVG 3;  3HOV B;  2K03 A;  3KLR A;  1DOL A;  2L9H A;  1I50 B;  1RTN A;  1DM0 B;  3OIP A;  1KLG D;  3KK7 A;  5M3F B;  3SR1 A;  2L1B A;  2ICE C;  4V0B A;  5JEA G;  2FHT A;  2HDM A;  1A3U A;  2XSC A;  4CKC A;  1JOO A;  1JOK A;  2QIL A;  3TSS A;  3GTL B;  2B8F A;  1PRT B;  3ND8 A;  4A3B B;  4I7Z C;  1TR5 A;  2A6H C;  3JAM E;  3S1N B;  1LAB A;  3RZO B;  2RDF A;  2A5H A;  5IT9 E;  3IFT A;  4N9P A;  2PZT A;  4TKO B;  2Q8I B;  1T5X D;  1S5E D;  5IOD A;  1EZ6 A;  1V1O A;  1L0X B;  4K14 A;  4KKS A;  3SK4 A;  1ET9 A;  4DXG A;  1E2W A;  2SNS A;  1NSN S;  2L55 A;  5LL6 S;  2F0Q A;  4ZKB B;  3C1E A;  2RVL A;  3QIA A;  3LX0 A;  3J7A F;  2JXM B;  3A7L A;  3D6C A;  3H0G B;  2IJ0 A;  4DU9 A;  2X6L A;  4RA8 A;  2VNU D;  3P20 A;  4KY6 A;  1C4Q A;  3GQB A;  1OXU A;  3PIO 3;  2I46 A;  4RCO A;  4FF3 A;  4H7B A;  4O1N A;  2JEA I;  2F0E A;  3EQL C;  2SDF A;  1GUG A;  1BQQ T;  3VR5 A;  3SXH A;  4PV1 C;  1KTK A;  4EGV A;  1SYB A;  1HQR D;  1WTQ A;  1II3 A;  1A6X A;  3K5M A;  3PO3 B;  1R4P B;  4KHZ A;  2CVR A;  3HOZ B;  2QF7 A;  3MXG A;  4IUU A;  1CHP D;  1EWH A;  1RDP D;  1JE4 A;  2VB3 X;  3HP3 A;  4UAI A;  1SND A;  4KHV A;  5FO7 B;  5JEA J;  5LHY 1;  3A54 A;  1PZK D;  1HUM A;  4FYD A;  1F9R A;  4PNY A;  4EVO A;  1G6Z A;  1SDF A;  4CJ2 C;  4KK7 A;  3PUZ A;  2B2U C;  1GXD C;  4IUT A;  1TWC B;  2DN8 A;  2RDG A;  4HTH A;  3VYS A;  1SYC A;  2Y0S B;  5KYL A;  1EIH A;  1G2S A;  3OOC A;  2KEC A;  1JIC A;  2K1B A;  1U4R A;  3NQT A;  2KQ3 A;  3FVQ A;  3W2D A;  1A3V A;  1Q1B A;  5C6A A;  3SK8 A;  3SK6 A;  2E2J B;  3NK9 A;  4DGZ A;  1FD7 D;  1OXX K;  1EWC A;  4DAP A;  3DWP A;  2E75 C;  1LTS D;  3BYY B;  5I6Y A;  1ROD A;  3R3O A;  1WTX A;  5DM6 3;  2O5I C;  3I4N B;  4A3D B;  2EYJ A;  3PIP 3;  1KNA A;  1H9S A;  3GV3 A;  3L9A X;  3QO2 A;  1HFN A;  1STE A;  3ERQ A;  4OL7 A;  3AMU A;  3BS1 A;  2K32 A;  3R8B A;  1I4R A;  4H13 C;  1PMR A;  2JA8 B;  3WDN A;  3K6O A;  4RGM A;  1STH A;  1EIG A;  1SNC A;  2F3V A;  3MTS A;  5KIX A;  5FO9 B;  3MEH A;  4KTA A;  4C1N I;  1BXT A;  2KJX A;  4J1M A;  3D3R A;  4M8A A;  4M1U B;  3VYR A;  3ERO A;  1HA5 A;  2F3W A;  2V4D A;  5FO8 B;  4K5X A;  1S5B D;  1DOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...