1PMTA

Glutathione transferase from proteus mirabilis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
201
structure length
201
Chain Sequence
MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE TRANSFERASE
publication title A mixed disulfide bond in bacterial glutathione transferase: functional and evolutionary implications.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Transferase
total genus 66
structure length 201
sequence length 201
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pmtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pmtA01
4TXVA 1O8WA 1JHBA 3UBLA 2CVBA 2DJ0A 5B6NA 1GNEA 2VL3A 3GYKA 5G1KA 3UJ1A 1M2BA 2PVQA 2R6KA 1ON4A 1A2LA 4TR3A 3Q6OA 5IMDA 5AIVA 1N8JA 4ILFA 2I4AA 1EV4A 3I6AA 1KEBA 2ZUPA 2L57A 2L4QA 2B5YA 3LXTA 2LEGA 4TVEA 1MDIA 1WIKA 4WEYA 1GL8A 1NHOA 2VCXA 3FR3A 3IK9A 4ZBAA 1AQWA 2MYGA 6GSUA 2FWHA 2GSRA 3TUEA 3QAGA 5H5SA 1MTCA 3DXBA 2MMZA 3JCML 5JCUA 4V1Ag 2XBIA 2V41A 4EO3A 4MH2A 2OE3A 3ZIVA 2GQLA 5EY6A 3M9JA 2FWEA 5J41A 1DE1A 2C3NA 5J5NA 3VPQA 3GTUA 4KSMA 2AJQB 3F4SA 4IP6A 2IN3A 1R7HA 5CO3A 4PQ1A 3LORA 3TOUA 3LYKA 3VPTA 3P2AA 3VK9A 2CAIA 5KN2A 2JL4A 2VLUA 1TK0B 4OD7A 1G6YA 2YNXA 1O81A 3EU3A 3H93A 1PSQA 1K0NA 5G2ZA 4JE1A 5KN0A 2FY6A 2ZNMA 2ON5A 5JWQB 4K8MA 1TJDA 2YWNA 3IXRA 4BL7B 5EL8A 2DMMA 1R4WA 1TDIA 4KDYA 3D22A 4AJ7A 2B1KA 2TRCP 3KCMA 17GSA 2B7JA 2GQMA 3PINA 5D93A 4KCAA 1SENA 3D5JA 4HEA2 1OC8A 4OCFA 4OO4A 1E6BA 3LFLA 4ECCA 1SYRA 4ECIA 3HJOA 3A2WA 3ISOA 4WR4A 1M0UA 3L78A 2G2QA 3UL3A 1PX7A 4G10A 4KNDA 3ZYWA 1QXHA 4PQHA 2OE0A 2DJ2A 5AN1A 1J9BA 1ERWA 1X9SB 4HQZA 1T8EB 3KIJA 5KN1A 3C7MA 4QQ7A 4MZWA 4WETA 4ZB9A 3A3TA 4V2MA 1YF1A 1PD21 3DVXA 2HQTA 3ERGA 2H1AA 4TXOA 1T4ZA 3BD2A 4GTUA 1ABAA 3ZITA 4YQVA 3V1WA 2I3YA 1PMTA 4MJEA 5L71A 5HFGA 4IBPA 2H6ZA 4WF4A 3FYGA 5FT3A 1O73A 3GNJA 5DAKB 3M8NA 3TJJA 5ECMB 1XVWA 4O5RA 4AGSA 2I1UA 2LRTA 2L4CA 2AB6A 4JEDA 4N30A 2XHFA 2HE3A 1PA3A 4KSOA 4ID0A 3BOAA 3D6IA 4LLRA 3CXGA 1G6WA 2H70A 1G7EA 2DIZA 2VCZA 3TKQA 2MMAA 1GULA 1EZKA 1V2AA 4GSSA 1ERTA 2YZHA 2IWTA 5ECIB 1OE8A 1I5GA 1XXUA 4EF0A 5CAXA 3CRTA 1ZGNA 4EUYA 2KUCA 4ZBBA 2BMXA 5D8IA 3VWVA 5G5EA 2L6DA 5D9XA 1F6MC 2YV9A 1VF4A 4NMUA 1A0RP 3UVTA 4E8EA 4D73A 1FG4A 2NPBA 3I43A 1AW9A 2YV7A 2CAQA 3MWHA 1GTBA 5JWOB 4K2DA 1R26A 2CX3A 4IS0A 3KD0A 2HRKA 1A8LA 2GZYA 2LRNA 2ZCTA 1K3LA 3UARA 16GSA 2E2GA 1K0BA 1JZOA 2VOCA 3CSIA 1PRXA 5A5KA 2F9SA 3KJYA 5ELGA 5IMFA 4USSA 4IVFA 4DSSB 5JCWA 4K7NA 2GLRA 2M46A 1EP7A 4N10A 1S3DA 2LJAA 3N5OA 3FHKA 1YEXA 4PTSA 2V32A 1TRVA 3EMXA 5D9VA 5DDLA 1G7OA 3EINA 1SD9A 4I97A 4FYUA 5A4WA 3FK8A 4F0BA 2H0GA 2AHEA 2KOKA 1G0TA 2LV3A 3F3RA 1ML6A 1GRXA 1KTEA 5J9BA 4IN0A 1SYXA 4F82A 2O85A 1F37A 2GVPA 5IMZA 1HNBA 3KXOA 4MA9A 4POLA 1PKWA 2MMOA 5HR0A 2GQKA 1YY7A 5C00A 2FHEA 3I9V2 3IAM2 4ACSA 5E59A 4WBJA 3GH9A 2K6VA 3QDNA 4TR1A 1DSBA 3IRAA 2KP2A 1PGTA 3SWLA 3RDWA 3TJFA 4MJBA 2EIRA 2J23A 5B8AA 3FR6A 5J3RA 1F3AA 4PXOA 4Q5RA 2QKEA 4TR0A 2CZ3A 3D4MA 3CTGA 3GA4A 1M99A 4GSTA 3WD6A 2WRTA 1SK2A 3TKSC 2H75A 2PMTA 3GIXA 5ABRA 2ALBA 1T4YA 2H71A 4F9ZA 1PQNA 2HRFA 4BVYB 3LEFA 6GSTA 4NHZA 3LQ7A 2BTOT 1A24A 4ECJA 1LU4A 1SL1B 1VF2A 1FHEA 2F8FA 3GKKA 4IELA 5DALA 1M9AA 4G0IA 1A0FA 2EIQA 4F2IA 2IPAA 5ECKB 3EVIA 1Z5YE 4EXJA 2CVDA 3Q19A 4ISDA 4H86A 5G30A 1SL2B 2M72A 2LQQA 2WS2A 3ERFA 1TKDB 5DJMA 5KEJA 2M80A 1PX6A 5DVBA 2I81A 4YAPA 2N5FA 3BBYA 2HZEA 5A4UA 4G19A 3Q18A 3RPNA 2LNTA 5IMAA 1YJ6A 2IJYA 3LJRA 2RLIA 1V9WA 1NW2A 2DJ3A 4MABA 1TXXA 4POKA 1JZDA 5GSTA 2GZPA 2X64A 3CMIA 1T7PB 4MF5A 2IMKA 3U5RE 5DQYA 5D73A 1EEJA 3ZMKA 2WFCA 4KB3A 2NVLA 3A2VA 1HQOA 3TOTA 3HKRA 2FGXA 2HSYA 1XW9A 3MSZA 2YANA 4LMVA 4DEJA 5HFIA 1XWGA 1GNWA 3ME7A 5HR3A 1K0DA 1Q98A 3QD9A 1XWCA 4XS6A 22GSA 1TU8A 3F6FA 1F2EA 2IFQB 4GQCA 1XWKA 5G31A 4XTSA 3RPPA 4XRAA 1V58A 2R4VA 1AXDA 1RQMA 2MBSA 3CSHA 4KCEA 1U3AA 3G7JA 2HSMB 2VCQA 2YPMA 2H1GA 4NHWA 1OKDA 4K0NA 5KN3A 4YH2A 9GSSA 3KTBA 2EIOA 3TDGA 13GSA 3C73A 4PQIA 1V40A 1GSFA 4TN8A 2AV4A 3EE2A 4X43A 1SKSB 1OC9A 2OBIA 3MAKA 4XCSA 1X5EA 2KLXA 4WKWA 2R37A 1MDKA 3CBUA 4RQXA 3O3TA 5IO0A 4WXTA 1THXA 2DLXA 2V6OA 1M9BA 4ML6A 5D9WA 2WZ9A 1NSWA 4AF2A 2CZ2A 3BJ5A 2FUG2 4XS1A 4MF6A 4KW6A 1TK8B 4OO5A 2V6KA 1YF0A 3WT1A 4ULXA 2VO4A 5IPGA 3EURA 5DCHA 2YZUA 5GZZB 5IPHA 3RAZA 4L5OA 3CRUA 3A2XA 5COHA 4TR4A 5IOWA 1O8XA 2K9FA 4IP1A 1GUMA 2KHPA 4Q5FA 2HNLA 4DVCA 2DMLA 2X99A 3BCKA 3WGEA 5ENUA 1LJRA 5H5RA 1A2MA 2VCTA 4N11A 4ZXGA 3G9BA 4Q5NA 3F4RA 4DSQA 2H6XA 2CQ9A 2GZZA 4LA1A 4O7HA 3HHVA 2A2RA 5AIXA 2P0GA 3TRXA 3GMFA 2FNOA 3QPMA 4HDEA 2N5AA 1SU9A 3VI7A 3TRQA 1U6TA 4EVMA 3IC4A 5CRWA 3OR5A 2B5XA 2WDUA 1TRUA 4HU7A 4K1FA 5F8BA 3FY7A 5ELAA 1EWXA 2H0IA 2CV4A 4PNGA 2PU9C 2PERA 4MZBA 3ZVJD 3KMOA 3KEBA 4IGJA 2LKUA 3GSSA 4ZIJA 5JWRB 4EE0A 3IE3A 2B7KA 2MBTA 2GTUA 1GUKA 4HQSA 2PVOC 1FAAA 2PBJA 1AQVA 2FA8A 4Z7XA 5C04A 4KX4A 1A2JA 3GTUB 5F06A 3TKRA 4J56E 2QSIA 3S9FA 1RW1A 4K7IA 1YQ1A 3HZ8A 2HSHA 1FW1A 4PUFC 1YKAA 4ML1A 4KDXA 1H4OA 2WJUA 2F3MA 2A4VA 4TRXA 2O8VB 2R3XA 2WULA 1YDKA 3CYNA 4GCIA 3HY2A 1YZXA 1WPIA 3KM6A 2PPTA 2OADA 4GWRA 5H5QA 5ECHB 1WRYA 2JSYA 1BG5A 1FVJA 5JCGA 3TJBA 4QL9A 4ECBA 3ME8A 3FW2A 4LL4B 4XRDA 2K8SA 5IM9A 3HVVA 3HA9A 2ON7A 1W89A 1XIYA 3PH9A 2H30A 3O76A 4GRFA 2YWOA 3P90A 3QMXA 1X9MB 1DUGA 4CDOA 3DD3A 5B8BA 3DRNA 4RQRA 4Q5QA 4POMA 1HYUA 3GX0A 2PUKC 4DSSA 4NWYA 3ZIJA 4TKYA 3EMPA 3ZZXA 2MMNA 3IBHA 2OBKA 3ZL5A 2DJJA 4OFMA 3ZTLA 5EVOA 1GSEA 1QUWA 3VFIA 1Q4JA 1GSYA 1GUHA 3DYRA 1GTAA 2FA4A 4PGTA 1H75A 2IMIA 2HI7A 3HDCA 1PKZA 1WMJA 3RBTA 5CRGA 3IC8A 4TXOB 4HZ2A 3UIWA 2P5QA 1ILOA 4PX1A 4BVXA 2QC7A 4LMWA 3IK7A 4L5LA 3N9JA 1YEPA 3QCPA 1AQXA 3Q74A 20GSA 1U87A 5FWGA 2O87A 3L0HA 3RHCA 2K8VA 1R5AA 3ED3A 3TRPA 3U6VA 2VAFA 2FCHA 18GSA 6GSYA 2VL2C 4MH3A 1MEKA 3G7IA 3GRXA 3C8EA 1TRSA 3C1RA 5F0GA 3GX8A 1X0RA 4MJAA 1WWJA 3DVWA 5J9CA 1SK1A 2Z9SA 1Z7PA 2L6CA 4IJ3A 1SKWB 5HFKA 3LGCA 5ID2A 5F05A 3F9UA 5CRHA 1XW5A 3CSJA 6GSWA 4E8HA 1ERVA 4XHMA 4L0UA 3QFAC 2HRAA 5CNWA 3R2QA 4XS4A 1JLVA 4I2UA 4MF7A 3TJKA 2L5OA 5ECSA 2XC2A 3UVHA 1CQGA 5ECNB 2HRKB 3LG6A 4MPFA 2FWFA 2OJLA 2RUEA 5LNKe 3L9VA 5D96A 5IQYA 3GURA 2DJ1A 4LL1B 1OVNA 1FOVA 4HZ4A 1UN2A 1XPVA 1T3BA 4EL1A 1EOGA 2C8UA 3HJMA 3GKNA 3VI5A 1T1VA 3M0FA 3VWUA 1MD3A 1S3CA 4ZILA 4MPGA 3DMLA 4KF9A 1URMA 2IMFA 6GSSA 2C0EA 3VLNA 4TOPA 4YQUA 1ZZYA 5IOXA 2GSSA 1AIUA 1XW6A 3F0IA 1AC1A 1K0AA 3GKXA 1K0MA 4OCEA 4L8EA 1J08A 4OWYA 5AISA 1TW9A 1EP8A 1SJIA 1B4PA 1CQHA 4OMVA 2YWIA 5CYYA 2DIYA 2XBQA 5INYA 3R3EA 3VWWA 2B6MA 3M9KA 3GV1A 4BWSA 3F63A 2H72A 4BA7A 2VLVA 2H1BA 1EGRA 4IKHA 1OYJA 2HT9A 3EC3A 4TR1B 4RI7A 3APQA 1B9YC 1C72A 4NAXA 3ZRDA 3TCOA 4MCUA 3L9UA 4HJ2A 3NZNA 19GSA 2JACA 4F0CA 1ZCPA 3QAWA 4HI7A 4DSRA 1BX9A 1GP1A 4G0LA 2HFDA 2E7PA 5HR1A 2VM2A 3MNGA 5A4VA 2GGTA 1JZWA 2NBSA 4MZCA 1AUCA 3HZ4A 4NV2A 1JZRA 4JR4A 4WR5A 3F3QA 5J4UA 3KTLA 3QR6A 3KGKA 3W8JA 2RM6A 6GSVA 3DWVA 4NPBA 4RI6A 2UZ8A 2LQOA 5D9TA 3DGQA 2VL9A 1K0OA 4K7OA 5DALB 5F07A 2H76A 1V98A 2LRCA 4QL7A 3LXZA 5IIZA 1TTZA 3IPZA 1WJKA 2NTOA 4V1Ap 3EYTA 4K9ZA 1RK4A 4OFTA 3I69A 1V57A 2YOIA 4K6XA 1B48A 3KMNA 2JZTA 1M7TA 4HUAA 4ZL8A 1GSDA 1Z9HA 4GXZA 3CTFA 4POBA 2IMDA 3D4TA 2HZEB 1ERUA 1SK0A 1QQ2A 1B9XC 1T00A 3IOSA 1XFLA 1TK5B 1XZOA 2X8HA 2FWGA 1LBKA 2JU5A 1VGLA 1X5DA 3D21A 3NIVA 3F8UA 2H19A 1ACVA 3FEUA 1ZYQB 1QGVA 3UMAA 3GHAA 3ZREA 3TB2A 1USBA 3TKSA 8GSSA 2OACA 3AY8A 5GAPD 1R5PA 1BQ7A 2HRNA 5CP1A 3KZQA 3FZAA 1EV9A 1XWBA 2C4JA 2LNSA 2GS3A 4X1UA 4IQAA 1GTUA 4G0KA 3IV4A 1ZOFA 3QAVA 4KDUA 3KP9A 12GSA 2DSAA 3QFBC 4BL7A 4JRRA 2L59A 2H01A 1YKCA 3ERWA 2LTKA 5GSSA 2O89A 3ZFLA 1IYHA 3DEXA 2B1LA 3PGTA 3IA1A 1PN9A 3GL5A 2HZFA 5DCGA 1FB0A 2E0QA 3J7Yk 2VM1A 4NV5A 3FZ5A 3LSZA 2RUFA 1OC9B 3C71A 1QK8A 4KAEA 2JZSA 1GSSA 3VURA 2JZRA 3P7XA 2WB9A 1UVZA 1THOA 2QGVA 5CREA 5HR2A 4O32A 2GSQA 2AAWA 2NDOA 2YP6A 4V2LA 2PN8A 3E0UA 4KGIA 3GN3A 1VF3A 3HVSA 2C1YA 1UA5A 2C80A 1I9DA 2RIIA 3IR4A 2LJKA 2HXKA 2JADA 1O85A 3US3A 2OKAA 3EWLA 4MLYA 2LUSA 4KH7A 2C0DA 5E4WA 2YCDA 2AUVA 1TI3A 1A8YA 4F03A 3F6DA 4ZL9A 4WF5A 5B6MA 1BYEA 1O7UA 1FVKA 4TW5A 5DAKA 1MDJA 2VUPA 4CW9A 1O6JA 2P5RA 2LS5A 3WGDA 1VF1A 5BMUA 2H8LA 5ECRB 3D0ZA 4G2EA 5ECOB 4IJIA 4I5QA 1XOAA 4IW9A 3GSTA 1SJZA 4HU9A 1GSQA 4IQ1A 1WE0A 3MDKA 2LJRA 1UC7A 2REMA 4K0GA 2GSTA 2VCVA 1OC3A 2C0GA 2GDRA 4HS1A 2X8GA 4MJCA 1TP9A 4V2NA 3UOMA 4ZBDA 2DC5A 1OAZA 2H66A 1N2AA 1GLQA 2VCWA 1EEMA 1IYIA 5G5FA 2EC4A 2YN1A 3ZLPA 1TU7A 2VIMA 4EDZA 3H1NA 1F9MA 4N0ZA 2N5BA 3WYWA 1B8XA 2CX4A 2OA7A 3DKSA 7GSSA 2H6YA 3APSA 1VRSD 3UAPA 3G7YA 3ZMLA 2C0FA 4HOJA 2KP1A 2WCIA 1BEDA 3M3MA 1NM3A 3M1GA 4YQMA 4ZB6A 4FYBA 4MDCA 1KBNA 1M2AA 3PR8A 4P3YB 3UBKA 2RM5A 2WGRA 2MZCA 2V1MA 1Z6NA 1F3BA 10GSA 2V2GA 4AJ8A 3HCZA 4PURA 2G0FA 2GT5A 4EKZA 5ECPB 1AAZA 5DQSA 2CVKA 3ZVJA 5GAND 3W6GA 4OFNA 3QOUA 4JBBA 2B5EA 1PL2A 4NXIA 1QFNA 5IMCA 4PUAA 1K0CA 2R2JA 3FRCA 4KA0A 3L9SA 1DBYA 3GH6A 3H8QA 2L5LA 3APOA 14GSA 1ST9A 2FLSA 3PPUA 3IHQA 3TKPA 3HYPA 4FO5A 1TI1A 3C1SA 4FQUA 4GQFA 4J2FA 1J0FA 1GWCA 2J9HA 2DBCA 2CA8A 2XPEA 1FB6A 1OKTA 2YWMA 3L4NA 1GTIA 1U3IA 2H0HA 1EGOA 1JLWA 4O92A 1XVQA 1HD2A 4BPYA 2H73A 5ECQB 4KE3A 4BVYA 1MD4A 2C3TA 4N0VA 4D73B 5EPFA 2CT6A 3FZ4A 3HVXA 2IIYA 1X9WB 4BVXB 4FIWA 4KUNA 2D2ZA 3ZFBA 1S3AA 2DJKA 4BWQA 1ZYEA 2H1DA 2ES7A 2P31A 1OE7A 5IO2A 1XBSA 4JR6A 2HSNB 4EC0A 2YJHA 2YJ7A 1WOUA 2PWJA 1FO5A 4GLTA 3IDVA 1HNAA 4I8BA 4WBRD 2H74A 2F8AA 5IMVA 3O6TA 1Y25A 3KP8A 3TGZA 2VLTA 3GFKA 3H79A 4JZQA 2X8CA 4G9HA 2JSZA 3GL3A 1NHYA 4GSNA 1M2DA 3VWXA 1GH2A 3WT2A 4GF0A 3UEMA 3E3EA 3F4TA 5ID2B 3K8NA 4L0WA 2E2MA 1ZL9A 1EOHA 2AYTA 3DIEA 2XPDA 3TJGA 4AJ6A 4YAVA 3LYPA 3EU4A 4XS4B 1SKRB 4XIHA 5LD0A 1B4QA 2IFQA 1TOFA 1A23A 4MMMA 1BAYA 4I6XA 3HXSA 1XOBA 1K3YA 3IAS2 2HSMA 3HD5A 3WGXA 2I9HA 2HYXA 1GSUA 1JFUA 5ECLB 4J57E 3TKSE 1Y6EA 11GSA 1SD8A 1WP0A 3W8SA 1GLPA 3FZ9A 2O7KA 2C3QA 4RUVA 3GKMA 2VD1A 5B7CA 1XWAA 1XCCA 2VD0A 4MP4A 2IMEA 5FHIA 4ZB8A 1QMVA 3NOFA 1PL1A 3FR9A 4FYCA 3HJPA 6GSXA 5DJLA 5HQPA 2VL2A 3J7Yb 4IHUA 1TRWA 3LWAA 1DE2A 5AGYA 1HNCA 5DBQA 2F51A 1SJ6A 4EDYA 3KH7A 4FH8A 2GT6A 2R5GA 3RHBA 2HLSA 2K18A 5LCZA 2PGTA 3P8WA 2A2SA 1BJXA 1Z3EA 3H4KA 4I2TA 1ZMAA 5CRDA 2TRXA 1E2YA 3A5WA 1SL0B 3E9JB 2B3SA 2OE1A 1K3OA 3FKFA 4ZL7A 2IL3A 1Z7RA 4MK3A 3KH9A 2LSTA 2TIRA 1X5CA 4X0XA 2BJXA 3GUSA 4HJMA 4PNFA 1Z6MA 5G1LA 1W4VA 3BCIA 1U88A 2FD3A 1KNGA 4JU5A 3SBCA 4CHSA
chains in the Genus database with same CATH superfamily
4TXVA 1O8WA 1JHBA 3UBLA 2CVBA 2DJ0A 5B6NA 1GNEA 2VL3A 3GYKA 5G1KA 3UJ1A 1M2BA 2PVQA 2R6KA 1ON4A 1ZYPA 1A2LA 4TR3A 3Q6OA 5IMDA 5AIVA 1N8JA 4ILFA 2I4AA 1EV4A 3I6AA 1KEBA 2ZUPA 2L57A 2L4QA 2B5YA 3LXTA 2LEGA 4TVEA 1MDIA 1WIKA 4WEYA 1GL8A 1NHOA 2VCXA 3FR3A 3IK9A 4ZBAA 1AQWA 2MYGA 6GSUA 2FWHA 2GSRA 3TUEA 3QAGA 5H5SA 1MTCA 3DXBA 2MMZA 3JCML 5JCUA 5A34B 4V1Ag 2XBIA 2V41A 4EO3A 4MH2A 2OE3A 3ZIVA 2GQLA 5EY6A 3M9JA 2FWEA 5J41A 1DE1A 2C3NA 5J5NA 3VPQA 3GTUA 2WW0A 4KSMA 5BRTA 2AJQB 3F4SA 4IP6A 2IN3A 1R7HA 5CO3A 4PQ1A 3LORA 3TOUA 3LYKA 3VPTA 3P2AA 3VK9A 2CAIA 5KN2A 2JL4A 2VLUA 1TK0B 4OD7A 1G6YA 2YNXA 1O81A 3EU3A 3H93A 1PSQA 1K0NA 4N3ZA 5G2ZA 4JE1A 2X49A 5KN0A 2FY6A 2WW3A 2ZNMA 2ON5A 5JWQB 4K8MA 1TJDA 2YWNA 3IXRA 4BL7B 5EL8A 2DMMA 1R4WA 1TDIA 4KDYA 3D22A 4AJ7A 2B1KA 2TRCP 3KCMA 17GSA 2B7JA 2GQMA 3PINA 5D93A 4KCAA 1SENA 3D5JA 4HEA2 1OC8A 4OCFA 2WVYA 4OO4A 1E6BA 3LFLA 4ECCA 1SYRA 4ECIA 3HJOA 3A2WA 3ISOA 4WR4A 1M0UA 3L78A 2G2QA 3UL3A 1PX7A 4G10A 4KNDA 3ZYWA 1QXHA 4PQHA 2OE0A 2DJ2A 5AN1A 1J9BA 1ERWA 1X9SB 4HQZA 1T8EB 3KIJA 5KN1A 3C7MA 4QQ7A 4MZWA 4WETA 4ZB9A 3A3TA 4V2MA 1YF1A 1PD21 3DVXA 2HQTA 3ERGA 2H1AA 2WW1A 4TXOA 1ZYNA 1T4ZA 3BD2A 4GTUA 1ABAA 3ZITA 4YQVA 3V1WA 2I3YA 1PMTA 4MJEA 5L71A 5HFGA 4IBPA 2H6ZA 4WF4A 3FYGA 5FT3A 1O73A 3GNJA 5DAKB 3M8NA 3TJJA 5ECMB 1XVWA 4O5RA 4AGSA 2I1UA 2LRTA 2L4CA 2AB6A 5BMUB 4JEDA 4N30A 5J40A 2XHFA 2HE3A 1PA3A 4KSOA 4ID0A 3HMJG 3BOAA 3D6IA 4LLRA 2VKZG 3CXGA 1G6WA 2H70A 1G7EA 2DIZA 2VCZA 3TKQA 2MMAA 1GULA 1EZKA 1V2AA 4GSSA 1ERTA 2YZHA 4K5RA 2IWTA 5KOWA 5ECIB 1OE8A 1I5GA 1XXUA 4EF0A 5CAXA 3CRTA 1ZGNA 4EUYA 2KUCA 4ZBBA 2BMXA 5D8IA 3VWVA 5G5EA 2L6DA 5D9XA 1F6MC 2YV9A 1VF4A 4NMUA 1A0RP 2A4HA 3UVTA 4E8EA 4D73A 1FG4A 2NPBA 3I43A 1AW9A 2YV7A 2CAQA 3MWHA 1GTBA 5JWOB 4K2DA 1R26A 2CX3A 4IS0A 3KD0A 2HRKA 1A8LA 1YEWC 2GZYA 2LRNA 2WVZA 2ZCTA 1K3LA 3UARA 16GSA 2E2GA 1K0BA 1JZOA 4CY8A 2VOCA 3CSIA 1PRXA 5J4VA 5A5KA 2F9SA 3KJYA 5ELGA 5IMFA 4USSA 4IVFA 4DSSB 5JCWA 4K7NA 2GLRA 2M46A 3RFRC 1EP7A 4N10A 1S3DA 2LJAA 3N5OA 3FHKA 1YEXA 4PTSA 2V32A 1TRVA 3EMXA 5D9VA 5DDLA 1G7OA 3EINA 1SD9A 4I97A 4FYUA 5A4WA 3FK8A 4F0BA 2H0GA 2AHEA 2KOKA 1G0TA 2LV3A 3F3RA 1ML6A 1GRXA 1KTEA 5J9BA 4IN0A 1SYXA 4F82A 2O85A 1F37A 2GVPA 5IMZA 1HNBA 3KXOA 4MA9A 2R0GA 4POLA 1PKWA 2MMOA 5HR0A 2GQKA 1YY7A 5C00A 2FHEA 3I9V2 3IAM2 4ACSA 4AKXB 5E59A 4WBJA 3RGBC 3GH9A 2K6VA 3QDNA 4TR1A 1DSBA 4A5PA 3IRAA 2KP2A 1PGTA 3SWLA 3RDWA 3TJFA 4MJBA 2EIRA 2J23A 5B8AA 3FR6A 5J3RA 1F3AA 4PXOA 4Q5RA 2QKEA 4TR0A 2CZ3A 3D4MA 3CTGA 3GA4A 1M99A 4GSTA 3WD6A 1S4BP 2WRTA 1SK2A 3TKSC 2H75A 2PMTA 3GIXA 5ABRA 2ALBA 1T4YA 4BIKA 2H71A 4F9ZA 1PQNA 2HRFA 4AKHA 4BVYB 3LEFA 6GSTA 4NHZA 3LQ7A 2BTOT 1A24A 4ECJA 1LU4A 4AI6A 1SL1B 1VF2A 1FHEA 2F8FA 3GKKA 4IELA 5DALA 1M9AA 4G0IA 1A0FA 2EIQA 4F2IA 2IPAA 5ECKB 3EVIA 1Z5YE 4EXJA 2CVDA 3Q19A 4ISDA 4H86A 5G30A 1SL2B 2M72A 2LQQA 2WS2A 3ERFA 1TKDB 5DJMA 5KEJA 2M80A 1PX6A 5DVBA 2I81A 4YAPA 2N5FA 3BBYA 2HZEA 5A4UA 4G19A 3Q18A 4PI2C 3RPNA 2LNTA 5IMAA 1YJ6A 2IJYA 3LJRA 2RLIA 1V9WA 1NW2A 2DJ3A 4MABA 1TXXA 4POKA 1JZDA 5GSTA 2GZPA 2X64A 3CMIA 1T7PB 4MF5A 2IMKA 3U5RE 5DQYA 5D73A 1EEJA 3ZMKA 2WFCA 4KB3A 2NVLA 3A2VA 1HQOA 1YVLA 3TOTA 3HKRA 2FGXA 2HSYA 1XW9A 3MSZA 2YANA 4LMVA 4DEJA 5HFIA 4K5SA 1XWGA 1GNWA 3ME7A 5HR3A 1K0DA 1Q98A 3QD9A 1XWCA 4XS6A 22GSA 1TU8A 3F6FA 1F2EA 4YKGA 2IFQB 4GQCA 1XWKA 5G31A 4XTSA 3RPPA 4XRAA 1V58A 2R4VA 1AXDA 1RQMA 2MBSA 3CSHA 4KCEA 1U3AA 3G7JA 2HSMB 2VCQA 2YPMA 2H1GA 4NHWA 1OKDA 4K0NA 4HSCX 5KN3A 4YH2A 9GSSA 5A34A 3KTBA 2EIOA 3TDGA 13GSA 3C73A 1N25A 4PQIA 1V40A 1GSFA 4TN8A 2AV4A 3EE2A 4X43A 1SKSB 1OC9A 2OBIA 3MAKA 4XCSA 1X5EA 2KLXA 4WKWA 2R37A 2O5VA 1MDKA 3CBUA 4RQXA 1SVMA 3O3TA 5IO0A 3IHGA 4WXTA 1THXA 2DLXA 2V6OA 1M9BA 4ML6A 5D9WA 2WZ9A 1NSWA 4AF2A 2CZ2A 3BJ5A 2FUG2 4XS1A 1I1IP 4MF6A 4ZB7A 4KW6A 1TK8B 4OO5A 2V6KA 4G01A 1YF0A 3WT1A 4ULXA 2VO4A 5IPGA 3EURA 3CHXC 5A1NB 5DCHA 2YZUA 5GZZB 5IPHA 3RAZA 4L5OA 2EFCA 3CRUA 3A2XA 5COHA 4Z2UA 4TR4A 5IOWA 1O8XA 2K9FA 4IP1A 1GUMA 2KHPA 4Q5FA 2HNLA 4DVCA 2DMLA 2X99A 3BCKA 3WGEA 5ENUA 1LJRA 5H5RA 1A2MA 2VCTA 4N11A 4ZXGA 3G9BA 4Q5NA 3F4RA 4DSQA 2H6XA 1FOHA 2CQ9A 2GZZA 4LA1A 4O7HA 3HHVA 2A2RA 5AIXA 2P0GA 3TRXA 3GMFA 2FNOA 3QPMA 4HDEA 2N5AA 1SU9A 3VI7A 3TRQA 1U6TA 4EVMA 3IC4A 5CRWA 3OR5A 2B5XA 2WDUA 1TRUA 4HU7A 4K1FA 5F8BA 3FY7A 5ELAA 1EWXA 2H0IA 2CV4A 4PNGA 2PU9C 5J47A 2PERA 4MZBA 3ZVJD 3KMOA 3KEBA 4IGJA 2LKUA 3GSSA 3MYDA 4ZIJA 5JWRB 4EE0A 3IE3A 2B7KA 2MBTA 2GTUA 1GUKA 4HQSA 2PVOC 1FAAA 2PBJA 1AQVA 2FA8A 4Z7XA 5C04A 4KX4A 1A2JA 3GTUB 5F06A 3TKRA 4J56E 2QSIA 3S9FA 1RW1A 4K7IA 1YQ1A 3HZ8A 2HSHA 1FW1A 4PUFC 1YKAA 4ML1A 4KDXA 1Y1UA 1H4OA 2WJUA 2F3MA 2A4VA 4TRXA 2O8VB 2R0PA 2R3XA 4W66A 2WULA 1YDKA 3CYNA 4GCIA 3HY2A 1YZXA 1WPIA 4AKGA 3KM6A 2PPTA 2OADA 4GWRA 5H5QA 5ECHB 1WRYA 2JSYA 1BG5A 1FVJA 5JCGA 3TJBA 4QL9A 4ECBA 3ME8A 3FW2A 4LL4B 4XRDA 2K8SA 5IM9A 3HVVA 3HA9A 2ON7A 1W89A 1XIYA 3PH9A 2H30A 3O76A 4GRFA 2YWOA 3P90A 3QMXA 1X9MB 1DUGA 4CDOA 3DD3A 5B8BA 3DRNA 4RQRA 2H1LA 4Q5QA 4POMA 1HYUA 3GX0A 2PUKC 4DSSA 4NWYA 3ZIJA 4TKYA 3LW9A 3EMPA 3ZZXA 2MMNA 3IBHA 2OBKA 3ZL5A 2DJJA 4OFMA 3ZTLA 5EVOA 1GSEA 1QUWA 3VFIA 1Q4JA 1GSYA 2R0CA 1GUHA 3DYRA 1GTAA 2O36A 2FA4A 4AKIA 4PGTA 1H75A 2IMIA 2HI7A 3HDCA 1PKZA 1WMJA 3RBTA 5CRGA 3IC8A 4TXOB 4HZ2A 3UIWA 2P5QA 1ILOA 4PX1A 4BVXA 2QC7A 4LMWA 3IK7A 4L5LA 3N9JA 1YEPA 3QCPA 1AQXA 3Q74A 20GSA 1U87A 2HSNA 5FWGA 2O87A 3L0HA 3RHCA 2K8VA 1R5AA 3ED3A 3TRPA 3U6VA 2VAFA 2FCHA 18GSA 6GSYA 2VL2C 4MH3A 1MEKA 3G7IA 3GRXA 3C8EA 1TRSA 3C1RA 5F0GA 3GX8A 1X0RA 4MJAA 1WWJA 3DVWA 4PHZC 1SK1A 5J9CA 2Z9SA 1Z7PA 2L6CA 1M3JA 4IJ3A 1SKWB 5HFKA 3LGCA 5ID2A 5F05A 3F9UA 5CRHA 1XW5A 3CSJA 6GSWA 4E8HA 1ERVA 4XHMA 4L0UA 3QFAC 2HRAA 5CNWA 3R2QA 4XS4A 1JLVA 4I2UA 4MF7A 3TJKA 2WVXB 2L5OA 5ECSA 2XC2A 3UVHA 1CQGA 5ECNB 2HRKB 3LG6A 4MPFA 2FWFA 2OJLA 2RUEA 5LNKe 3L9VA 5D96A 5IQYA 3GURA 2DJ1A 4LL1B 1OVNA 1FOVA 4HZ4A 1UN2A 1XPVA 3HVNA 1T3BA 4EL1A 1EOGA 3GKNA 2C8UA 3HJMA 3VI5A 1T1VA 3M0FA 4O5QA 3VWUA 1MD3A 1S3CA 4ZILA 4MPGA 3DMLA 4KF9A 1URMA 2IMFA 6GSSA 2C0EA 3VLNA 4TOPA 4YQUA 1ZZYA 5IOXA 2GSSA 1AIUA 1XW6A 3F0IA 1AC1A 1K0AA 3GKXA 1K0MA 4OCEA 4L8EA 1J08A 4OWYA 5AISA 1TW9A 1EP8A 1SJIA 1B4PA 1CQHA 4OMVA 2YWIA 5CYYA 2DIYA 2XBQA 5INYA 3R3EA 3VWWA 2B6MA 3M9KA 4X4JA 3GV1A 4BWSA 3F63A 2H72A 4BA7A 2VLVA 2H1BA 1EGRA 4IKHA 1OYJA 5A5HA 2HT9A 3EC3A 4TR1B 4RI7A 3APQA 1B9YC 4YKFA 1C72A 4NAXA 3ZRDA 3TCOA 4MCUA 4MNNA 3L9UA 4HJ2A 3NZNA 19GSA 2JACA 4F0CA 4PI0C 1ZCPA 3QAWA 4HI7A 4DSRA 1BX9A 1GP1A 4G0LA 2HFDA 4EIPA 2E7PA 5HR1A 2VM2A 3MNGA 3FMWA 5A4VA 2GGTA 1JZWA 2NBSA 4MZCA 1AUCA 3HZ4A 4NV2A 1JZRA 1M3IA 4E68A 4JR4A 3MIXA 4WR5A 3F3QA 5J4UA 3KTLA 3QR6A 3KGKA 3W8JA 5KOXA 2RM6A 6GSVA 3DWVA 4NPBA 4RI6A 2UZ8A 2LQOA 5D9TA 3DGQA 2VL9A 1K0OA 4K7OA 5DALB 5F07A 2H76A 1V98A 2LRCA 4QL7A 3LXZA 5IIZA 4QMKA 1TTZA 3IPZA 1WJKA 2NTOA 1TXUA 4V1Ap 3EYTA 2DKHA 4K9ZA 1RK4A 4OFTA 3I69A 1V57A 2YOIA 4K6XA 1B48A 3KMNA 2JZTA 1M7TA 4HUAA 4ZL8A 1GSDA 1Z9HA 4GXZA 3CTFA 4POBA 2IMDA 3D4TA 2HZEB 1ERUA 1SK0A 1QQ2A 1B9XC 1T00A 4ICYA 3IOSA 1XFLA 1TK5B 1XZOA 2X8HA 2FWGA 1LBKA 2JU5A 1VGLA 1X5DA 3D21A 3NIVA 3F8UA 2H19A 1ACVA 3FEUA 4K2XA 1ZYQB 1QGVA 3UMAA 3GHAA 3ZREA 3TB2A 1USBA 3TKSA 8GSSA 2OACA 3AY8A 5GAPD 1R5PA 1BQ7A 2HRNA 4O5UA 5CP1A 3KZQA 3FZAA 1EV9A 1XWBA 2C4JA 2LNSA 2GS3A 4X1UA 4IQAA 1GTUA 4G0KA 3CWGA 3TU3B 3IV4A 5J4YA 1ZOFA 3QAVA 4KDUA 3KP9A 12GSA 2DSAA 3QFBC 4BL7A 4JRRA 2L59A 2H01A 1YKCA 3ERWA 2LTKA 5GSSA 2QA1A 2O89A 3ZFLA 1IYHA 3DEXA 2B1LA 1SVOA 3PGTA 3IA1A 1PN9A 3GL5A 2HZFA 5DCGA 1FB0A 2E0QA 3J7Yk 2VM1A 4NV5A 3FZ5A 3LSZA 2RUFA 1OC9B 3C71A 1QK8A 4KAEA 2JZSA 1GSSA 3VURA 2JZRA 4EIQA 3P7XA 2WB9A 1UVZA 1THOA 2QGVA 5CREA 5HR2A 4O32A 2GSQA 2AAWA 2NDOA 2YP6A 4V2LA 2PN8A 3E0UA 4KGIA 3GN3A 1VF3A 3HVSA 2C1YA 1UA5A 2C80A 1I9DA 2RIIA 3IR4A 2LJKA 2HXKA 2JADA 1O85A 3US3A 2OKAA 3EWLA 4MLYA 2LUSA 4KH7A 2C0DA 5E4WA 2YCDA 2AUVA 1TI3A 1A8YA 4F03A 3F6DA 4ZL9A 4WF5A 5B6MA 1BYEA 1O7UA 1FVKA 4TW5A 5DAKA 1XG8A 2WW2A 1MDJA 2VUPA 4CW9A 1O6JA 2P5RA 2LS5A 3WGDA 1VF1A 5BMUA 2H8LA 5ECRB 3D0ZA 2O3EA 4G2EA 5ECOB 4IJIA 4I5QA 1XOAA 4IW9A 3GSTA 1SJZA 4HU9A 1GSQA 4IQ1A 1WE0A 3MDKA 2LJRA 1UC7A 2REMA 4K0GA 2GSTA 2VCVA 2OT3A 1OC3A 2C0GA 2GDRA 4HS1A 2X8GA 4MJCA 1TP9A 4V2NA 3UOMA 4ZBDA 2DC5A 1OAZA 2H66A 4GDFA 1N2AA 1GLQA 2VCWA 1EEMA 1IYIA 5G5FA 2EC4A 2YN1A 3ZLPA 1TU7A 2VIMA 4EDZA 3H1NA 1F9MA 4N0ZA 2N5BA 3WYWA 1B8XA 2CX4A 2OA7A 3DKSA 2QA2A 7GSSA 2H6YA 3APSA 1VRSD 3UAPA 3G7YA 3ZMLA 2C0FA 4HOJA 2KP1A 2WCIA 1BEDA 3M3MA 1NM3A 3M1GA 4YQMA 4ZB6A 4FYBA 4MDCA 1KBNA 1M2AA 3PR8A 4P3YB 3UBKA 2RM5A 2WGRA 2MZCA 2V1MA 1Z6NA 1F3BA 3A5IA 10GSA 2V2GA 1PFOA 4AJ8A 3HCZA 4PURA 2G0FA 2GT5A 4EKZA 5ECPB 1AAZA 5DQSA 2CVKA 1SVLA 3ZVJA 5GAND 3W6GA 4OFNA 3QOUA 4JBBA 2B5EA 1PL2A 4NXIA 1QFNA 5IMCA 4PUAA 1K0CA 2R2JA 3FRCA 4KA0A 3L9SA 1DBYA 3GH6A 4FXYP 2WVXA 3H8QA 2L5LA 3APOA 14GSA 1ST9A 2FLSA 3PPUA 2EFDA 3IHQA 3TKPA 3HYPA 4FO5A 1TI1A 3C1SA 4FQUA 4GQFA 4J2FA 1J0FA 1GWCA 2J9HA 2DBCA 2CA8A 2XPEA 1FB6A 1OKTA 2YWMA 3L4NA 1GTIA 1U3IA 2H0HA 1EGOA 1JLWA 4O92A 1XVQA 1HD2A 4BPYA 2H73A 5ECQB 4KE3A 4BVYA 1MD4A 2C3TA 4N0VA 4D73B 5EPFA 2WZSA 2CT6A 3FZ4A 3HVXA 2IIYA 1X9WB 4BVXB 4FIWA 4KUNA 2D2ZA 3ZFBA 1S3AA 2DJKA 4BWQA 1ZYEA 2H1DA 2ES7A 2P31A 1OE7A 5IO2A 1XBSA 1BG1A 4JR6A 2HSNB 4EC0A 4Z2RA 2DKIA 2YJHA 2YJ7A 1WOUA 2PWJA 1FO5A 4GLTA 3IDVA 1HNAA 4I8BA 4WBRD 2H74A 2F8AA 5IMVA 3O6TA 1Y25A 3KP8A 3TGZA 2VLTA 3GFKA 3H79A 4JZQA 2X8CA 4G9HA 2JSZA 3GL3A 1NHYA 4GSNA 4CY6A 1M2DA 3VWXA 4Z2TA 1GH2A 2EFEA 3WT2A 4GF0A 3UEMA 3E3EA 3F4TA 5ID2B 2A2PA 3K8NA 4L0WA 2E2MA 1ZL9A 1EOHA 2AYTA 3DIEA 2XPDA 3TJGA 4AJ6A 4YAVA 3LYPA 3EU4A 4XS4B 1SKRB 4XIHA 5LD0A 1B4QA 2IFQA 1TOFA 1A23A 4MMMA 1BAYA 4I6XA 3HXSA 1XOBA 1K3YA 3IAS2 2HSMA 3HD5A 3WGXA 2I9HA 2HYXA 1PN0A 1GSUA 1JFUA 5ECLB 4J57E 3TKSE 1Y6EA 11GSA 1SD8A 1WP0A 3W8SA 1GLPA 3FZ9A 2O7KA 2C3QA 4RUVA 3GKMA 2VD1A 5B7CA 1XWAA 1XCCA 2VD0A 2UV8G 4MP4A 2IMEA 2EFHA 5FHIA 4ZB8A 1BF5A 1QMVA 3NOFA 1S3RA 1PL1A 3FR9A 4FYCA 3HJPA 6GSXA 5DJLA 5HQPA 2VL2A 3J7Yb 4IHUA 1TRWA 3LWAA 1DE2A 5AGYA 1HNCA 5DBQA 2F51A 1SJ6A 4EDYA 3KH7A 4FH8A 2GT6A 2X4AA 2R5GA 3RHBA 2HLSA 2K18A 5LCZA 2PGTA 3P8WA 2A2SA 1BJXA 1Z3EA 3H4KA 4I2TA 1ZMAA 5CRDA 2TRXA 1E2YA 3A5WA 1SL0B 5A1NA 3E9JB 2B3SA 2OE1A 1K3OA 3FKFA 4ZL7A 3EPTA 2IL3A 1Z7RA 5A5HB 4MK3A 3KH9A 2LSTA 2TIRA 1X5CA 4X0XA 2BJXA 3GUSA 4HJMA 4PNFA 1Z6MA 5G1LA 3CQFA 1W4VA 3BCIA 1U88A 2FD3A 1KNGA 4JU5A 3SBCA 4CHSA
chains in the Genus database with same CATH topology
4TXVA 1O8WA 1JHBA 3UBLA 2CVBA 2DJ0A 5B6NA 1GNEA 2VL3A 3GYKA 5G1KA 3UJ1A 1M2BA 2PVQA 2R6KA 1ON4A 1ZYPA 1A2LA 4TR3A 3Q6OA 5IMDA 5AIVA 1N8JA 4ILFA 2I4AA 1EV4A 3I6AA 1KEBA 2ZUPA 2L57A 2L4QA 2B5YA 3LXTA 2LEGA 4TVEA 1MDIA 1WIKA 4WEYA 1GL8A 1NHOA 2VCXA 3FR3A 3IK9A 4ZBAA 1AQWA 2MYGA 6GSUA 2FWHA 2GSRA 3TUEA 3QAGA 5H5SA 1MTCA 3DXBA 2MMZA 3JCML 5JCUA 5A34B 4V1Ag 2XBIA 2V41A 4EO3A 4MH2A 2OE3A 3ZIVA 2GQLA 5EY6A 3M9JA 2FWEA 5J41A 1DE1A 2C3NA 5J5NA 3VPQA 3GTUA 4KSMA 5BRTA 2AJQB 3F4SA 4IP6A 2IN3A 1R7HA 5CO3A 4PQ1A 3LORA 3TOUA 3LYKA 3VPTA 3P2AA 3VK9A 2CAIA 5KN2A 2JL4A 2VLUA 1TK0B 4OD7A 1G6YA 2YNXA 1O81A 3EU3A 3H93A 1PSQA 1K0NA 4N3ZA 5G2ZA 4JE1A 2X49A 5KN0A 2FY6A 2ZNMA 2ON5A 5JWQB 4K8MA 1TJDA 2YWNA 3IXRA 4BL7B 5EL8A 2DMMA 1R4WA 1TDIA 4KDYA 3D22A 4AJ7A 2B1KA 2TRCP 3KCMA 17GSA 2B7JA 2GQMA 3PINA 5D93A 4KCAA 1SENA 3D5JA 4HEA2 1OC8A 4OCFA 4OO4A 1E6BA 3LFLA 4ECCA 1SYRA 4ECIA 3HJOA 3A2WA 3ISOA 4WR4A 1M0UA 3L78A 2G2QA 3UL3A 1PX7A 4G10A 4KNDA 3ZYWA 1QXHA 4PQHA 2OE0A 2DJ2A 5AN1A 1J9BA 1ERWA 1X9SB 4HQZA 1T8EB 3KIJA 5KN1A 3C7MA 4QQ7A 4MZWA 4WETA 4ZB9A 3A3TA 4V2MA 1YF1A 1PD21 3DVXA 2HQTA 3ERGA 2H1AA 4TXOA 1ZYNA 1T4ZA 3BD2A 4GTUA 1ABAA 3ZITA 4YQVA 3V1WA 2I3YA 1PMTA 4MJEA 5L71A 5HFGA 4IBPA 2H6ZA 4WF4A 3FYGA 5FT3A 1O73A 3GNJA 5DAKB 3M8NA 3TJJA 5ECMB 1XVWA 4O5RA 4AGSA 2I1UA 2LRTA 2L4CA 2AB6A 5BMUB 4JEDA 4N30A 5J40A 2XHFA 2HE3A 1PA3A 4KSOA 4ID0A 3HMJG 3BOAA 3D6IA 4LLRA 2VKZG 3CXGA 1G6WA 2H70A 1G7EA 2DIZA 2VCZA 3TKQA 2MMAA 1GULA 1EZKA 1V2AA 4GSSA 1ERTA 2YZHA 4K5RA 2IWTA 5KOWA 5ECIB 1OE8A 1I5GA 1XXUA 4EF0A 5CAXA 3CRTA 1ZGNA 4EUYA 2KUCA 4ZBBA 2BMXA 5D8IA 3VWVA 5G5EA 2L6DA 5D9XA 1F6MC 2YV9A 1VF4A 4NMUA 1A0RP 2A4HA 3UVTA 4E8EA 4D73A 1FG4A 2NPBA 3I43A 1AW9A 2YV7A 2CAQA 3MWHA 1GTBA 5JWOB 4K2DA 1R26A 2CX3A 4IS0A 3KD0A 2HRKA 1A8LA 2GZYA 2LRNA 2ZCTA 1K3LA 3UARA 16GSA 2E2GA 1K0BA 1JZOA 4CY8A 2VOCA 3CSIA 1PRXA 5J4VA 5A5KA 2F9SA 3KJYA 5ELGA 5IMFA 4USSA 4IVFA 4DSSB 5JCWA 4K7NA 2GLRA 2M46A 1EP7A 4N10A 1S3DA 2LJAA 3N5OA 3FHKA 1YEXA 4PTSA 2V32A 1TRVA 3EMXA 5D9VA 5DDLA 1G7OA 3EINA 1SD9A 4I97A 4FYUA 5A4WA 3FK8A 4F0BA 2H0GA 2AHEA 2KOKA 1G0TA 2LV3A 3F3RA 1ML6A 1GRXA 1KTEA 5J9BA 4IN0A 1SYXA 4F82A 2O85A 1F37A 2GVPA 5IMZA 1HNBA 3KXOA 4MA9A 2R0GA 4POLA 1PKWA 2MMOA 5HR0A 2GQKA 1YY7A 5C00A 2FHEA 3I9V2 3IAM2 4ACSA 4AKXB 5E59A 4WBJA 3GH9A 2K6VA 3QDNA 4TR1A 1DSBA 4A5PA 3IRAA 2KP2A 1PGTA 3SWLA 3RDWA 3TJFA 4MJBA 2EIRA 2J23A 5B8AA 3FR6A 5J3RA 1F3AA 4PXOA 4Q5RA 2QKEA 4TR0A 2CZ3A 3D4MA 3CTGA 3GA4A 1M99A 4GSTA 3WD6A 2WRTA 1SK2A 3TKSC 2H75A 2PMTA 3GIXA 5ABRA 2ALBA 1T4YA 2H71A 4F9ZA 1PQNA 2HRFA 4AKHA 4BVYB 3LEFA 6GSTA 4NHZA 3LQ7A 2BTOT 1A24A 4ECJA 1LU4A 4AI6A 1SL1B 1VF2A 1FHEA 2F8FA 3GKKA 4IELA 5DALA 1M9AA 4G0IA 1A0FA 2EIQA 4F2IA 2IPAA 5ECKB 3EVIA 1Z5YE 4EXJA 2CVDA 3Q19A 4ISDA 4H86A 5G30A 1SL2B 2M72A 2LQQA 2WS2A 3ERFA 1TKDB 5DJMA 5KEJA 2M80A 1PX6A 5DVBA 2I81A 4YAPA 2N5FA 3BBYA 2HZEA 5A4UA 4G19A 3Q18A 3RPNA 2LNTA 5IMAA 1YJ6A 2IJYA 3LJRA 2RLIA 1V9WA 1NW2A 2DJ3A 4MABA 1TXXA 4POKA 1JZDA 5GSTA 2GZPA 2X64A 3CMIA 1T7PB 4MF5A 2IMKA 3U5RE 5DQYA 5D73A 1EEJA 3ZMKA 2WFCA 4KB3A 2NVLA 3A2VA 1HQOA 1YVLA 3TOTA 3HKRA 2FGXA 2HSYA 1XW9A 3MSZA 2YANA 4LMVA 4DEJA 5HFIA 4K5SA 1XWGA 1GNWA 3ME7A 5HR3A 1K0DA 1Q98A 3QD9A 1XWCA 4XS6A 22GSA 1TU8A 3F6FA 1F2EA 4YKGA 2IFQB 4GQCA 1XWKA 5G31A 4XTSA 3RPPA 4XRAA 1V58A 2R4VA 1AXDA 1RQMA 2MBSA 3CSHA 4KCEA 1U3AA 3G7JA 2HSMB 2VCQA 2YPMA 2H1GA 4NHWA 1OKDA 4K0NA 5KN3A 4YH2A 9GSSA 5A34A 3KTBA 2EIOA 3TDGA 13GSA 3C73A 1N25A 4PQIA 1V40A 1GSFA 4TN8A 2AV4A 3EE2A 4X43A 1SKSB 1OC9A 2OBIA 3MAKA 4XCSA 1X5EA 2KLXA 4WKWA 2R37A 2O5VA 1MDKA 3CBUA 4RQXA 1SVMA 3O3TA 5IO0A 3IHGA 4WXTA 1THXA 2DLXA 2V6OA 1M9BA 4ML6A 5D9WA 2WZ9A 1NSWA 4AF2A 2CZ2A 3BJ5A 2FUG2 4XS1A 4MF6A 4ZB7A 4KW6A 1TK8B 4OO5A 2V6KA 4G01A 1YF0A 3WT1A 4ULXA 2VO4A 5IPGA 3EURA 5A1NB 5DCHA 2YZUA 5GZZB 5IPHA 3RAZA 4L5OA 2EFCA 3CRUA 3A2XA 5COHA 4Z2UA 4TR4A 5IOWA 1O8XA 2K9FA 4IP1A 1GUMA 2KHPA 4Q5FA 2HNLA 4DVCA 2DMLA 2X99A 3BCKA 3WGEA 5ENUA 1LJRA 5H5RA 1A2MA 2VCTA 4N11A 4ZXGA 3G9BA 4Q5NA 3F4RA 4DSQA 2H6XA 1FOHA 2CQ9A 2GZZA 4LA1A 4O7HA 3HHVA 2A2RA 5AIXA 2P0GA 3TRXA 3GMFA 2FNOA 3QPMA 4HDEA 2N5AA 1SU9A 3VI7A 3TRQA 1U6TA 4EVMA 3IC4A 5CRWA 3OR5A 2B5XA 2WDUA 1TRUA 4HU7A 4K1FA 5F8BA 3FY7A 5ELAA 1EWXA 2H0IA 2CV4A 4PNGA 2PU9C 5J47A 2PERA 4MZBA 3ZVJD 3KMOA 3KEBA 4IGJA 2LKUA 3GSSA 3MYDA 4ZIJA 5JWRB 4EE0A 3IE3A 2B7KA 2MBTA 2GTUA 1GUKA 4HQSA 2PVOC 1FAAA 2PBJA 1AQVA 2FA8A 4Z7XA 5C04A 4KX4A 1A2JA 3GTUB 5F06A 3TKRA 4J56E 2QSIA 3S9FA 1RW1A 4K7IA 1YQ1A 3HZ8A 2HSHA 1FW1A 4PUFC 1YKAA 4ML1A 4KDXA 1Y1UA 1H4OA 2WJUA 2F3MA 2A4VA 4TRXA 2O8VB 2R0PA 2R3XA 4W66A 2WULA 1YDKA 3CYNA 4GCIA 3HY2A 1YZXA 1WPIA 4AKGA 3KM6A 2PPTA 2OADA 4GWRA 5H5QA 5ECHB 1WRYA 2JSYA 1BG5A 1FVJA 5JCGA 3TJBA 4QL9A 4ECBA 3ME8A 3FW2A 4LL4B 4XRDA 2K8SA 5IM9A 3HVVA 3HA9A 2ON7A 1W89A 1XIYA 3PH9A 2H30A 3O76A 4GRFA 2YWOA 3P90A 3QMXA 1X9MB 1DUGA 4CDOA 3DD3A 5B8BA 3DRNA 4RQRA 2H1LA 4Q5QA 4POMA 1HYUA 3GX0A 2PUKC 4DSSA 4NWYA 3ZIJA 4TKYA 3LW9A 3EMPA 3ZZXA 2MMNA 3IBHA 2OBKA 3ZL5A 2DJJA 4OFMA 3ZTLA 5EVOA 1GSEA 1QUWA 3VFIA 1Q4JA 1GSYA 2R0CA 1GUHA 3DYRA 1GTAA 2FA4A 4AKIA 4PGTA 1H75A 2IMIA 2HI7A 3HDCA 1PKZA 1WMJA 3RBTA 5CRGA 3IC8A 4TXOB 4HZ2A 3UIWA 2P5QA 1ILOA 4PX1A 4BVXA 2QC7A 4LMWA 3IK7A 4L5LA 3N9JA 1YEPA 3QCPA 1AQXA 3Q74A 20GSA 1U87A 2HSNA 5FWGA 2O87A 3L0HA 3RHCA 2K8VA 1R5AA 3ED3A 3TRPA 3U6VA 2VAFA 2FCHA 18GSA 6GSYA 2VL2C 4MH3A 1MEKA 3G7IA 3GRXA 3C8EA 1TRSA 3C1RA 5F0GA 3GX8A 1X0RA 4MJAA 1WWJA 3DVWA 5J9CA 1SK1A 2Z9SA 1Z7PA 2L6CA 4IJ3A 1SKWB 5HFKA 3LGCA 5ID2A 5F05A 3F9UA 5CRHA 1XW5A 3CSJA 6GSWA 4E8HA 1ERVA 4XHMA 4L0UA 3QFAC 2HRAA 5CNWA 3R2QA 4XS4A 1JLVA 4I2UA 4MF7A 3TJKA 2L5OA 5ECSA 2XC2A 3UVHA 1CQGA 5ECNB 2HRKB 3LG6A 4MPFA 2FWFA 2OJLA 2RUEA 5LNKe 3L9VA 5D96A 5IQYA 3GURA 2DJ1A 4LL1B 1OVNA 1FOVA 4HZ4A 1UN2A 1XPVA 1T3BA 4EL1A 1EOGA 3GKNA 2C8UA 3HJMA 3VI5A 1T1VA 3M0FA 4O5QA 3VWUA 1MD3A 1S3CA 4ZILA 4MPGA 3DMLA 4KF9A 1URMA 2IMFA 6GSSA 2C0EA 3VLNA 4TOPA 4YQUA 1ZZYA 5IOXA 2GSSA 1AIUA 1XW6A 3F0IA 1AC1A 1K0AA 3GKXA 1K0MA 4OCEA 4L8EA 1J08A 4OWYA 5AISA 1TW9A 1EP8A 1SJIA 1B4PA 1CQHA 4OMVA 2YWIA 5CYYA 2DIYA 2XBQA 5INYA 3R3EA 3VWWA 2B6MA 3M9KA 4X4JA 3GV1A 4BWSA 3F63A 2H72A 4BA7A 2VLVA 2H1BA 1EGRA 4IKHA 1OYJA 5A5HA 2HT9A 3EC3A 4TR1B 4RI7A 3APQA 1B9YC 4YKFA 1C72A 4NAXA 3ZRDA 3TCOA 4MCUA 4MNNA 3L9UA 4HJ2A 3NZNA 19GSA 2JACA 4F0CA 1ZCPA 3QAWA 4HI7A 4DSRA 1BX9A 1GP1A 4G0LA 2HFDA 4EIPA 2E7PA 5HR1A 2VM2A 3MNGA 3FMWA 5A4VA 2GGTA 1JZWA 2NBSA 4MZCA 1AUCA 3HZ4A 4NV2A 1JZRA 4E68A 4JR4A 3MIXA 4WR5A 3F3QA 5J4UA 3KTLA 3QR6A 3KGKA 3W8JA 5KOXA 2RM6A 6GSVA 3DWVA 4NPBA 4RI6A 2UZ8A 2LQOA 5D9TA 3DGQA 2VL9A 1K0OA 4K7OA 5DALB 5F07A 2H76A 1V98A 2LRCA 4QL7A 3LXZA 5IIZA 4QMKA 1TTZA 3IPZA 1WJKA 2NTOA 1TXUA 4V1Ap 3EYTA 2DKHA 4K9ZA 1RK4A 4OFTA 3I69A 1V57A 2YOIA 4K6XA 1B48A 3KMNA 2JZTA 1M7TA 4HUAA 4ZL8A 1GSDA 1Z9HA 4GXZA 3CTFA 4POBA 2IMDA 3D4TA 2HZEB 1ERUA 1SK0A 1QQ2A 1B9XC 1T00A 4ICYA 3IOSA 1XFLA 1TK5B 1XZOA 2X8HA 2FWGA 1LBKA 2JU5A 1VGLA 1X5DA 3D21A 3NIVA 3F8UA 2H19A 1ACVA 3FEUA 4K2XA 1ZYQB 1QGVA 3UMAA 3GHAA 3ZREA 3TB2A 1USBA 3TKSA 8GSSA 2OACA 3AY8A 5GAPD 1R5PA 1BQ7A 2HRNA 4O5UA 5CP1A 3KZQA 3FZAA 1EV9A 1XWBA 2C4JA 2LNSA 2GS3A 4X1UA 4IQAA 1GTUA 4G0KA 3CWGA 3TU3B 3IV4A 5J4YA 1ZOFA 3QAVA 4KDUA 3KP9A 12GSA 2DSAA 3QFBC 4BL7A 4JRRA 2L59A 2H01A 1YKCA 3ERWA 2LTKA 5GSSA 2QA1A 2O89A 3ZFLA 1IYHA 3DEXA 2B1LA 1SVOA 3PGTA 3IA1A 1PN9A 3GL5A 2HZFA 5DCGA 1FB0A 2E0QA 3J7Yk 2VM1A 4NV5A 3FZ5A 3LSZA 2RUFA 1OC9B 3C71A 1QK8A 4KAEA 2JZSA 1GSSA 3VURA 2JZRA 4EIQA 3P7XA 2WB9A 1UVZA 1THOA 2QGVA 5CREA 5HR2A 4O32A 2GSQA 2AAWA 2NDOA 2YP6A 4V2LA 2PN8A 3E0UA 4KGIA 3GN3A 1VF3A 3HVSA 2C1YA 1UA5A 2C80A 1I9DA 2RIIA 3IR4A 2LJKA 2HXKA 2JADA 1O85A 3US3A 2OKAA 3EWLA 4MLYA 2LUSA 4KH7A 2C0DA 5E4WA 2YCDA 2AUVA 1TI3A 1A8YA 4F03A 3F6DA 4ZL9A 4WF5A 5B6MA 1BYEA 1O7UA 1FVKA 4TW5A 5DAKA 1MDJA 2VUPA 4CW9A 1O6JA 2P5RA 2LS5A 3WGDA 1VF1A 5BMUA 2H8LA 5ECRB 3D0ZA 4G2EA 5ECOB 4IJIA 4I5QA 1XOAA 4IW9A 3GSTA 1SJZA 4HU9A 1GSQA 4IQ1A 1WE0A 3MDKA 2LJRA 1UC7A 2REMA 4K0GA 2GSTA 2VCVA 2OT3A 1OC3A 2C0GA 2GDRA 4HS1A 2X8GA 4MJCA 1TP9A 4V2NA 3UOMA 4ZBDA 2DC5A 1OAZA 2H66A 4GDFA 1N2AA 1GLQA 2VCWA 1EEMA 1IYIA 5G5FA 2EC4A 2YN1A 3ZLPA 1TU7A 2VIMA 4EDZA 3H1NA 1F9MA 4N0ZA 2N5BA 3WYWA 1B8XA 2CX4A 2OA7A 3DKSA 2QA2A 7GSSA 2H6YA 3APSA 1VRSD 3UAPA 3G7YA 3ZMLA 2C0FA 4HOJA 2KP1A 2WCIA 1BEDA 3M3MA 1NM3A 3M1GA 4YQMA 4ZB6A 4FYBA 4MDCA 1KBNA 1M2AA 3PR8A 4P3YB 3UBKA 2RM5A 2WGRA 2MZCA 2V1MA 1Z6NA 1F3BA 3A5IA 10GSA 2V2GA 4AJ8A 3HCZA 4PURA 2G0FA 2GT5A 4EKZA 5ECPB 1AAZA 5DQSA 2CVKA 1SVLA 3ZVJA 5GAND 3W6GA 4OFNA 3QOUA 4JBBA 2B5EA 1PL2A 4NXIA 1QFNA 5IMCA 4PUAA 1K0CA 2R2JA 3FRCA 4KA0A 3L9SA 1DBYA 3GH6A 3H8QA 2L5LA 3APOA 14GSA 1ST9A 2FLSA 3PPUA 2EFDA 3IHQA 3TKPA 3HYPA 4FO5A 1TI1A 3C1SA 4FQUA 4GQFA 4J2FA 1J0FA 1GWCA 2J9HA 2DBCA 2CA8A 2XPEA 1FB6A 1OKTA 2YWMA 3L4NA 1GTIA 1U3IA 2H0HA 1EGOA 1JLWA 4O92A 1XVQA 1HD2A 4BPYA 2H73A 5ECQB 4KE3A 4BVYA 1MD4A 2C3TA 4N0VA 4D73B 5EPFA 2CT6A 3FZ4A 3HVXA 2IIYA 1X9WB 4BVXB 4FIWA 4KUNA 2D2ZA 3ZFBA 1S3AA 2DJKA 4BWQA 1ZYEA 2H1DA 2ES7A 2P31A 1OE7A 5IO2A 1XBSA 1BG1A 4JR6A 2HSNB 4EC0A 4Z2RA 2DKIA 2YJHA 2YJ7A 1WOUA 2PWJA 1FO5A 4GLTA 3IDVA 1HNAA 4I8BA 4WBRD 2H74A 2F8AA 5IMVA 3O6TA 1Y25A 3KP8A 3TGZA 2VLTA 3GFKA 3H79A 4JZQA 2X8CA 4G9HA 2JSZA 3GL3A 1NHYA 4GSNA 4CY6A 1M2DA 3VWXA 4Z2TA 1GH2A 2EFEA 3WT2A 4GF0A 3UEMA 3E3EA 3F4TA 5ID2B 2A2PA 3K8NA 4L0WA 2E2MA 1ZL9A 1EOHA 2AYTA 3DIEA 2XPDA 3TJGA 4AJ6A 4YAVA 3LYPA 3EU4A 4XS4B 1SKRB 4XIHA 5LD0A 1B4QA 2IFQA 1TOFA 1A23A 4MMMA 1BAYA 4I6XA 3HXSA 1XOBA 1K3YA 3IAS2 2HSMA 3HD5A 3WGXA 2I9HA 2HYXA 1PN0A 1GSUA 1JFUA 5ECLB 4J57E 3TKSE 1Y6EA 11GSA 1SD8A 1WP0A 3W8SA 1GLPA 3FZ9A 2O7KA 2C3QA 4RUVA 3GKMA 2VD1A 5B7CA 1XWAA 1XCCA 2VD0A 2UV8G 4MP4A 2IMEA 2EFHA 5FHIA 4ZB8A 1BF5A 1QMVA 3NOFA 1PL1A 3FR9A 4FYCA 3HJPA 6GSXA 5DJLA 5HQPA 2VL2A 3J7Yb 4IHUA 1TRWA 3LWAA 1DE2A 5AGYA 1HNCA 5DBQA 2F51A 1SJ6A 4EDYA 3KH7A 4FH8A 2GT6A 2X4AA 2R5GA 3RHBA 2HLSA 2K18A 5LCZA 2PGTA 3P8WA 2A2SA 1BJXA 1Z3EA 3H4KA 4I2TA 1ZMAA 5CRDA 2TRXA 1E2YA 3A5WA 1SL0B 5A1NA 3E9JB 2B3SA 2OE1A 1K3OA 3FKFA 4ZL7A 3EPTA 2IL3A 1Z7RA 5A5HB 4MK3A 3KH9A 2LSTA 2TIRA 1X5CA 4X0XA 2BJXA 3GUSA 4HJMA 4PNFA 1Z6MA 5G1LA 1W4VA 3BCIA 1U88A 2FD3A 1KNGA 4JU5A 3SBCA 4CHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TXV A;  1O8W A;  1JHB A;  3UBL A;  2CVB A;  2DJ0 A;  5B6N A;  1GNE A;  2VL3 A;  3GYK A;  5G1K A;  3UJ1 A;  1M2B A;  2PVQ A;  2R6K A;  1ON4 A;  1A2L A;  4TR3 A;  3Q6O A;  5IMD A;  5AIV A;  1N8J A;  4ILF A;  2I4A A;  1EV4 A;  3I6A A;  1KEB A;  2ZUP A;  2L57 A;  2L4Q A;  2B5Y A;  3LXT A;  2LEG A;  4TVE A;  1MDI A;  1WIK A;  4WEY A;  1GL8 A;  1NHO A;  2VCX A;  3FR3 A;  3IK9 A;  4ZBA A;  1AQW A;  2MYG A;  6GSU A;  2FWH A;  2GSR A;  3TUE A;  3QAG A;  5H5S A;  1MTC A;  3DXB A;  2MMZ A;  3JCM L;  5JCU A;  4V1A g;  2XBI A;  2V41 A;  4EO3 A;  4MH2 A;  2OE3 A;  3ZIV A;  2GQL A;  5EY6 A;  3M9J A;  2FWE A;  5J41 A;  1DE1 A;  2C3N A;  5J5N A;  3VPQ A;  3GTU A;  4KSM A;  2AJQ B;  3F4S A;  4IP6 A;  2IN3 A;  1R7H A;  5CO3 A;  4PQ1 A;  3LOR A;  3TOU A;  3LYK A;  3VPT A;  3P2A A;  3VK9 A;  2CAI A;  5KN2 A;  2JL4 A;  2VLU A;  1TK0 B;  4OD7 A;  1G6Y A;  2YNX A;  1O81 A;  3EU3 A;  3H93 A;  1PSQ A;  1K0N A;  5G2Z A;  4JE1 A;  5KN0 A;  2FY6 A;  2ZNM A;  2ON5 A;  5JWQ B;  4K8M A;  1TJD A;  2YWN A;  3IXR A;  4BL7 B;  5EL8 A;  2DMM A;  1R4W A;  1TDI A;  4KDY A;  3D22 A;  4AJ7 A;  2B1K A;  2TRC P;  3KCM A;  17GS A;  2B7J A;  2GQM A;  3PIN A;  5D93 A;  4KCA A;  1SEN A;  3D5J A;  4HEA 2;  1OC8 A;  4OCF A;  4OO4 A;  1E6B A;  3LFL A;  4ECC A;  1SYR A;  4ECI A;  3HJO A;  3A2W A;  3ISO A;  4WR4 A;  1M0U A;  3L78 A;  2G2Q A;  3UL3 A;  1PX7 A;  4G10 A;  4KND A;  3ZYW A;  1QXH A;  4PQH A;  2OE0 A;  2DJ2 A;  5AN1 A;  1J9B A;  1ERW A;  1X9S B;  4HQZ A;  1T8E B;  3KIJ A;  5KN1 A;  3C7M A;  4QQ7 A;  4MZW A;  4WET A;  4ZB9 A;  3A3T A;  4V2M A;  1YF1 A;  1PD2 1;  3DVX A;  2HQT A;  3ERG A;  2H1A A;  4TXO A;  1T4Z A;  3BD2 A;  4GTU A;  1ABA A;  3ZIT A;  4YQV A;  3V1W A;  2I3Y A;  1PMT A;  4MJE A;  5L71 A;  5HFG A;  4IBP A;  2H6Z A;  4WF4 A;  3FYG A;  5FT3 A;  1O73 A;  3GNJ A;  5DAK B;  3M8N A;  3TJJ A;  5ECM B;  1XVW A;  4O5R A;  4AGS A;  2I1U A;  2LRT A;  2L4C A;  2AB6 A;  4JED A;  4N30 A;  2XHF A;  2HE3 A;  1PA3 A;  4KSO A;  4ID0 A;  3BOA A;  3D6I A;  4LLR A;  3CXG A;  1G6W A;  2H70 A;  1G7E A;  2DIZ A;  2VCZ A;  3TKQ A;  2MMA A;  1GUL A;  1EZK A;  1V2A A;  4GSS A;  1ERT A;  2YZH A;  2IWT A;  5ECI B;  1OE8 A;  1I5G A;  1XXU A;  4EF0 A;  5CAX A;  3CRT A;  1ZGN A;  4EUY A;  2KUC A;  4ZBB A;  2BMX A;  5D8I A;  3VWV A;  5G5E A;  2L6D A;  5D9X A;  1F6M C;  2YV9 A;  1VF4 A;  4NMU A;  1A0R P;  3UVT A;  4E8E A;  4D73 A;  1FG4 A;  2NPB A;  3I43 A;  1AW9 A;  2YV7 A;  2CAQ A;  3MWH A;  1GTB A;  5JWO B;  4K2D A;  1R26 A;  2CX3 A;  4IS0 A;  3KD0 A;  2HRK A;  1A8L A;  2GZY A;  2LRN A;  2ZCT A;  1K3L A;  3UAR A;  16GS A;  2E2G A;  1K0B A;  1JZO A;  2VOC A;  3CSI A;  1PRX A;  5A5K A;  2F9S A;  3KJY A;  5ELG A;  5IMF A;  4USS A;  4IVF A;  4DSS B;  5JCW A;  4K7N A;  2GLR A;  2M46 A;  1EP7 A;  4N10 A;  1S3D A;  2LJA A;  3N5O A;  3FHK A;  1YEX A;  4PTS A;  2V32 A;  1TRV A;  3EMX A;  5D9V A;  5DDL A;  1G7O A;  3EIN A;  1SD9 A;  4I97 A;  4FYU A;  5A4W A;  3FK8 A;  4F0B A;  2H0G A;  2AHE A;  2KOK A;  1G0T A;  2LV3 A;  3F3R A;  1ML6 A;  1GRX A;  1KTE A;  5J9B A;  4IN0 A;  1SYX A;  4F82 A;  2O85 A;  1F37 A;  2GVP A;  5IMZ A;  1HNB A;  3KXO A;  4MA9 A;  4POL A;  1PKW A;  2MMO A;  5HR0 A;  2GQK A;  1YY7 A;  5C00 A;  2FHE A;  3I9V 2;  3IAM 2;  4ACS A;  5E59 A;  4WBJ A;  3GH9 A;  2K6V A;  3QDN A;  4TR1 A;  1DSB A;  3IRA A;  2KP2 A;  1PGT A;  3SWL A;  3RDW A;  3TJF A;  4MJB A;  2EIR A;  2J23 A;  5B8A A;  3FR6 A;  5J3R A;  1F3A A;  4PXO A;  4Q5R A;  2QKE A;  4TR0 A;  2CZ3 A;  3D4M A;  3CTG A;  3GA4 A;  1M99 A;  4GST A;  3WD6 A;  2WRT A;  1SK2 A;  3TKS C;  2H75 A;  2PMT A;  3GIX A;  5ABR A;  2ALB A;  1T4Y A;  2H71 A;  4F9Z A;  1PQN A;  2HRF A;  4BVY B;  3LEF A;  6GST A;  4NHZ A;  3LQ7 A;  2BTO T;  1A24 A;  4ECJ A;  1LU4 A;  1SL1 B;  1VF2 A;  1FHE A;  2F8F A;  3GKK A;  4IEL A;  5DAL A;  1M9A A;  4G0I A;  1A0F A;  2EIQ A;  4F2I A;  2IPA A;  5ECK B;  3EVI A;  1Z5Y E;  4EXJ A;  2CVD A;  3Q19 A;  4ISD A;  4H86 A;  5G30 A;  1SL2 B;  2M72 A;  2LQQ A;  2WS2 A;  3ERF A;  1TKD B;  5DJM A;  5KEJ A;  2M80 A;  1PX6 A;  5DVB A;  2I81 A;  4YAP A;  2N5F A;  3BBY A;  2HZE A;  5A4U A;  4G19 A;  3Q18 A;  3RPN A;  2LNT A;  5IMA A;  1YJ6 A;  2IJY A;  3LJR A;  2RLI A;  1V9W A;  1NW2 A;  2DJ3 A;  4MAB A;  1TXX A;  4POK A;  1JZD A;  5GST A;  2GZP A;  2X64 A;  3CMI A;  1T7P B;  4MF5 A;  2IMK A;  3U5R E;  5DQY A;  5D73 A;  1EEJ A;  3ZMK A;  2WFC A;  4KB3 A;  2NVL A;  3A2V A;  1HQO A;  3TOT A;  3HKR A;  2FGX A;  2HSY A;  1XW9 A;  3MSZ A;  2YAN A;  4LMV A;  4DEJ A;  5HFI A;  1XWG A;  1GNW A;  3ME7 A;  5HR3 A;  1K0D A;  1Q98 A;  3QD9 A;  1XWC A;  4XS6 A;  22GS A;  1TU8 A;  3F6F A;  1F2E A;  2IFQ B;  4GQC A;  1XWK A;  5G31 A;  4XTS A;  3RPP A;  4XRA A;  1V58 A;  2R4V A;  1AXD A;  1RQM A;  2MBS A;  3CSH A;  4KCE A;  1U3A A;  3G7J A;  2HSM B;  2VCQ A;  2YPM A;  2H1G A;  4NHW A;  1OKD A;  4K0N A;  5KN3 A;  4YH2 A;  9GSS A;  3KTB A;  2EIO A;  3TDG A;  13GS A;  3C73 A;  4PQI A;  1V40 A;  1GSF A;  4TN8 A;  2AV4 A;  3EE2 A;  4X43 A;  1SKS B;  1OC9 A;  2OBI A;  3MAK A;  4XCS A;  1X5E A;  2KLX A;  4WKW A;  2R37 A;  1MDK A;  3CBU A;  4RQX A;  3O3T A;  5IO0 A;  4WXT A;  1THX A;  2DLX A;  2V6O A;  1M9B A;  4ML6 A;  5D9W A;  2WZ9 A;  1NSW A;  4AF2 A;  2CZ2 A;  3BJ5 A;  2FUG 2;  4XS1 A;  4MF6 A;  4KW6 A;  1TK8 B;  4OO5 A;  2V6K A;  1YF0 A;  3WT1 A;  4ULX A;  2VO4 A;  5IPG A;  3EUR A;  5DCH A;  2YZU A;  5GZZ B;  5IPH A;  3RAZ A;  4L5O A;  3CRU A;  3A2X A;  5COH A;  4TR4 A;  5IOW A;  1O8X A;  2K9F A;  4IP1 A;  1GUM A;  2KHP A;  4Q5F A;  2HNL A;  4DVC A;  2DML A;  2X99 A;  3BCK A;  3WGE A;  5ENU A;  1LJR A;  5H5R A;  1A2M A;  2VCT A;  4N11 A;  4ZXG A;  3G9B A;  4Q5N A;  3F4R A;  4DSQ A;  2H6X A;  2CQ9 A;  2GZZ A;  4LA1 A;  4O7H A;  3HHV A;  2A2R A;  5AIX A;  2P0G A;  3TRX A;  3GMF A;  2FNO A;  3QPM A;  4HDE A;  2N5A A;  1SU9 A;  3VI7 A;  3TRQ A;  1U6T A;  4EVM A;  3IC4 A;  5CRW A;  3OR5 A;  2B5X A;  2WDU A;  1TRU A;  4HU7 A;  4K1F A;  5F8B A;  3FY7 A;  5ELA A;  1EWX A;  2H0I A;  2CV4 A;  4PNG A;  2PU9 C;  2PER A;  4MZB A;  3ZVJ D;  3KMO A;  3KEB A;  4IGJ A;  2LKU A;  3GSS A;  4ZIJ A;  5JWR B;  4EE0 A;  3IE3 A;  2B7K A;  2MBT A;  2GTU A;  1GUK A;  4HQS A;  2PVO C;  1FAA A;  2PBJ A;  1AQV A;  2FA8 A;  4Z7X A;  5C04 A;  4KX4 A;  1A2J A;  3GTU B;  5F06 A;  3TKR A;  4J56 E;  2QSI A;  3S9F A;  1RW1 A;  4K7I A;  1YQ1 A;  3HZ8 A;  2HSH A;  1FW1 A;  4PUF C;  1YKA A;  4ML1 A;  4KDX A;  1H4O A;  2WJU A;  2F3M A;  2A4V A;  4TRX A;  2O8V B;  2R3X A;  2WUL A;  1YDK A;  3CYN A;  4GCI A;  3HY2 A;  1YZX A;  1WPI A;  3KM6 A;  2PPT A;  2OAD A;  4GWR A;  5H5Q A;  5ECH B;  1WRY A;  2JSY A;  1BG5 A;  1FVJ A;  5JCG A;  3TJB A;  4QL9 A;  4ECB A;  3ME8 A;  3FW2 A;  4LL4 B;  4XRD A;  2K8S A;  5IM9 A;  3HVV A;  3HA9 A;  2ON7 A;  1W89 A;  1XIY A;  3PH9 A;  2H30 A;  3O76 A;  4GRF A;  2YWO A;  3P90 A;  3QMX A;  1X9M B;  1DUG A;  4CDO A;  3DD3 A;  5B8B A;  3DRN A;  4RQR A;  4Q5Q A;  4POM A;  1HYU A;  3GX0 A;  2PUK C;  4DSS A;  4NWY A;  3ZIJ A;  4TKY A;  3EMP A;  3ZZX A;  2MMN A;  3IBH A;  2OBK A;  3ZL5 A;  2DJJ A;  4OFM A;  3ZTL A;  5EVO A;  1GSE A;  1QUW A;  3VFI A;  1Q4J A;  1GSY A;  1GUH A;  3DYR A;  1GTA A;  2FA4 A;  4PGT A;  1H75 A;  2IMI A;  2HI7 A;  3HDC A;  1PKZ A;  1WMJ A;  3RBT A;  5CRG A;  3IC8 A;  4TXO B;  4HZ2 A;  3UIW A;  2P5Q A;  1ILO A;  4PX1 A;  4BVX A;  2QC7 A;  4LMW A;  3IK7 A;  4L5L A;  3N9J A;  1YEP A;  3QCP A;  1AQX A;  3Q74 A;  20GS A;  1U87 A;  5FWG A;  2O87 A;  3L0H A;  3RHC A;  2K8V A;  1R5A A;  3ED3 A;  3TRP A;  3U6V A;  2VAF A;  2FCH A;  18GS A;  6GSY A;  2VL2 C;  4MH3 A;  1MEK A;  3G7I A;  3GRX A;  3C8E A;  1TRS A;  3C1R A;  5F0G A;  3GX8 A;  1X0R A;  4MJA A;  1WWJ A;  3DVW A;  5J9C A;  1SK1 A;  2Z9S A;  1Z7P A;  2L6C A;  4IJ3 A;  1SKW B;  5HFK A;  3LGC A;  5ID2 A;  5F05 A;  3F9U A;  5CRH A;  1XW5 A;  3CSJ A;  6GSW A;  4E8H A;  1ERV A;  4XHM A;  4L0U A;  3QFA C;  2HRA A;  5CNW A;  3R2Q A;  4XS4 A;  1JLV A;  4I2U A;  4MF7 A;  3TJK A;  2L5O A;  5ECS A;  2XC2 A;  3UVH A;  1CQG A;  5ECN B;  2HRK B;  3LG6 A;  4MPF A;  2FWF A;  2OJL A;  2RUE A;  5LNK e;  3L9V A;  5D96 A;  5IQY A;  3GUR A;  2DJ1 A;  4LL1 B;  1OVN A;  1FOV A;  4HZ4 A;  1UN2 A;  1XPV A;  1T3B A;  4EL1 A;  1EOG A;  2C8U A;  3HJM A;  3GKN A;  3VI5 A;  1T1V A;  3M0F A;  3VWU A;  1MD3 A;  1S3C A;  4ZIL A;  4MPG A;  3DML A;  4KF9 A;  1URM A;  2IMF A;  6GSS A;  2C0E A;  3VLN A;  4TOP A;  4YQU A;  1ZZY A;  5IOX A;  2GSS A;  1AIU A;  1XW6 A;  3F0I A;  1AC1 A;  1K0A A;  3GKX A;  1K0M A;  4OCE A;  4L8E A;  1J08 A;  4OWY A;  5AIS A;  1TW9 A;  1EP8 A;  1SJI A;  1B4P A;  1CQH A;  4OMV A;  2YWI A;  5CYY A;  2DIY A;  2XBQ A;  5INY A;  3R3E A;  3VWW A;  2B6M A;  3M9K A;  3GV1 A;  4BWS A;  3F63 A;  2H72 A;  4BA7 A;  2VLV A;  2H1B A;  1EGR A;  4IKH A;  1OYJ A;  2HT9 A;  3EC3 A;  4TR1 B;  4RI7 A;  3APQ A;  1B9Y C;  1C72 A;  4NAX A;  3ZRD A;  3TCO A;  4MCU A;  3L9U A;  4HJ2 A;  3NZN A;  19GS A;  2JAC A;  4F0C A;  1ZCP A;  3QAW A;  4HI7 A;  4DSR A;  1BX9 A;  1GP1 A;  4G0L A;  2HFD A;  2E7P A;  5HR1 A;  2VM2 A;  3MNG A;  5A4V A;  2GGT A;  1JZW A;  2NBS A;  4MZC A;  1AUC A;  3HZ4 A;  4NV2 A;  1JZR A;  4JR4 A;  4WR5 A;  3F3Q A;  5J4U A;  3KTL A;  3QR6 A;  3KGK A;  3W8J A;  2RM6 A;  6GSV A;  3DWV A;  4NPB A;  4RI6 A;  2UZ8 A;  2LQO A;  5D9T A;  3DGQ A;  2VL9 A;  1K0O A;  4K7O A;  5DAL B;  5F07 A;  2H76 A;  1V98 A;  2LRC A;  4QL7 A;  3LXZ A;  5IIZ A;  1TTZ A;  3IPZ A;  1WJK A;  2NTO A;  4V1A p;  3EYT A;  4K9Z A;  1RK4 A;  4OFT A;  3I69 A;  1V57 A;  2YOI A;  4K6X A;  1B48 A;  3KMN A;  2JZT A;  1M7T A;  4HUA A;  4ZL8 A;  1GSD A;  1Z9H A;  4GXZ A;  3CTF A;  4POB A;  2IMD A;  3D4T A;  2HZE B;  1ERU A;  1SK0 A;  1QQ2 A;  1B9X C;  1T00 A;  3IOS A;  1XFL A;  1TK5 B;  1XZO A;  2X8H A;  2FWG A;  1LBK A;  2JU5 A;  1VGL A;  1X5D A;  3D21 A;  3NIV A;  3F8U A;  2H19 A;  1ACV A;  3FEU A;  1ZYQ B;  1QGV A;  3UMA A;  3GHA A;  3ZRE A;  3TB2 A;  1USB A;  3TKS A;  8GSS A;  2OAC A;  3AY8 A;  5GAP D;  1R5P A;  1BQ7 A;  2HRN A;  5CP1 A;  3KZQ A;  3FZA A;  1EV9 A;  1XWB A;  2C4J A;  2LNS A;  2GS3 A;  4X1U A;  4IQA A;  1GTU A;  4G0K A;  3IV4 A;  1ZOF A;  3QAV A;  4KDU A;  3KP9 A;  12GS A;  2DSA A;  3QFB C;  4BL7 A;  4JRR A;  2L59 A;  2H01 A;  1YKC A;  3ERW A;  2LTK A;  5GSS A;  2O89 A;  3ZFL A;  1IYH A;  3DEX A;  2B1L A;  3PGT A;  3IA1 A;  1PN9 A;  3GL5 A;  2HZF A;  5DCG A;  1FB0 A;  2E0Q A;  3J7Y k;  2VM1 A;  4NV5 A;  3FZ5 A;  3LSZ A;  2RUF A;  1OC9 B;  3C71 A;  1QK8 A;  4KAE A;  2JZS A;  1GSS A;  3VUR A;  2JZR A;  3P7X A;  2WB9 A;  1UVZ A;  1THO A;  2QGV A;  5CRE A;  5HR2 A;  4O32 A;  2GSQ A;  2AAW A;  2NDO A;  2YP6 A;  4V2L A;  2PN8 A;  3E0U A;  4KGI A;  3GN3 A;  1VF3 A;  3HVS A;  2C1Y A;  1UA5 A;  2C80 A;  1I9D A;  2RII A;  3IR4 A;  2LJK A;  2HXK A;  2JAD A;  1O85 A;  3US3 A;  2OKA A;  3EWL A;  4MLY A;  2LUS A;  4KH7 A;  2C0D A;  5E4W A;  2YCD A;  2AUV A;  1TI3 A;  1A8Y A;  4F03 A;  3F6D A;  4ZL9 A;  4WF5 A;  5B6M A;  1BYE A;  1O7U A;  1FVK A;  4TW5 A;  5DAK A;  1MDJ A;  2VUP A;  4CW9 A;  1O6J A;  2P5R A;  2LS5 A;  3WGD A;  1VF1 A;  5BMU A;  2H8L A;  5ECR B;  3D0Z A;  4G2E A;  5ECO B;  4IJI A;  4I5Q A;  1XOA A;  4IW9 A;  3GST A;  1SJZ A;  4HU9 A;  1GSQ A;  4IQ1 A;  1WE0 A;  3MDK A;  2LJR A;  1UC7 A;  2REM A;  4K0G A;  2GST A;  2VCV A;  1OC3 A;  2C0G A;  2GDR A;  4HS1 A;  2X8G A;  4MJC A;  1TP9 A;  4V2N A;  3UOM A;  4ZBD A;  2DC5 A;  1OAZ A;  2H66 A;  1N2A A;  1GLQ A;  2VCW A;  1EEM A;  1IYI A;  5G5F A;  2EC4 A;  2YN1 A;  3ZLP A;  1TU7 A;  2VIM A;  4EDZ A;  3H1N A;  1F9M A;  4N0Z A;  2N5B A;  3WYW A;  1B8X A;  2CX4 A;  2OA7 A;  3DKS A;  7GSS A;  2H6Y A;  3APS A;  1VRS D;  3UAP A;  3G7Y A;  3ZML A;  2C0F A;  4HOJ A;  2KP1 A;  2WCI A;  1BED A;  3M3M A;  1NM3 A;  3M1G A;  4YQM A;  4ZB6 A;  4FYB A;  4MDC A;  1KBN A;  1M2A A;  3PR8 A;  4P3Y B;  3UBK A;  2RM5 A;  2WGR A;  2MZC A;  2V1M A;  1Z6N A;  1F3B A;  10GS A;  2V2G A;  4AJ8 A;  3HCZ A;  4PUR A;  2G0F A;  2GT5 A;  4EKZ A;  5ECP B;  1AAZ A;  5DQS A;  2CVK A;  3ZVJ A;  5GAN D;  3W6G A;  4OFN A;  3QOU A;  4JBB A;  2B5E A;  1PL2 A;  4NXI A;  1QFN A;  5IMC A;  4PUA A;  1K0C A;  2R2J A;  3FRC A;  4KA0 A;  3L9S A;  1DBY A;  3GH6 A;  3H8Q A;  2L5L A;  3APO A;  14GS A;  1ST9 A;  2FLS A;  3PPU A;  3IHQ A;  3TKP A;  3HYP A;  4FO5 A;  1TI1 A;  3C1S A;  4FQU A;  4GQF A;  4J2F A;  1J0F A;  1GWC A;  2J9H A;  2DBC A;  2CA8 A;  2XPE A;  1FB6 A;  1OKT A;  2YWM A;  3L4N A;  1GTI A;  1U3I A;  2H0H A;  1EGO A;  1JLW A;  4O92 A;  1XVQ A;  1HD2 A;  4BPY A;  2H73 A;  5ECQ B;  4KE3 A;  4BVY A;  1MD4 A;  2C3T A;  4N0V A;  4D73 B;  5EPF A;  2CT6 A;  3FZ4 A;  3HVX A;  2IIY A;  1X9W B;  4BVX B;  4FIW A;  4KUN A;  2D2Z A;  3ZFB A;  1S3A A;  2DJK A;  4BWQ A;  1ZYE A;  2H1D A;  2ES7 A;  2P31 A;  1OE7 A;  5IO2 A;  1XBS A;  4JR6 A;  2HSN B;  4EC0 A;  2YJH A;  2YJ7 A;  1WOU A;  2PWJ A;  1FO5 A;  4GLT A;  3IDV A;  1HNA A;  4I8B A;  4WBR D;  2H74 A;  2F8A A;  5IMV A;  3O6T A;  1Y25 A;  3KP8 A;  3TGZ A;  2VLT A;  3GFK A;  3H79 A;  4JZQ A;  2X8C A;  4G9H A;  2JSZ A;  3GL3 A;  1NHY A;  4GSN A;  1M2D A;  3VWX A;  1GH2 A;  3WT2 A;  4GF0 A;  3UEM A;  3E3E A;  3F4T A;  5ID2 B;  3K8N A;  4L0W A;  2E2M A;  1ZL9 A;  1EOH A;  2AYT A;  3DIE A;  2XPD A;  3TJG A;  4AJ6 A;  4YAV A;  3LYP A;  3EU4 A;  4XS4 B;  1SKR B;  4XIH A;  5LD0 A;  1B4Q A;  2IFQ A;  1TOF A;  1A23 A;  4MMM A;  1BAY A;  4I6X A;  3HXS A;  1XOB A;  1K3Y A;  3IAS 2;  2HSM A;  3HD5 A;  3WGX A;  2I9H A;  2HYX A;  1GSU A;  1JFU A;  5ECL B;  4J57 E;  3TKS E;  1Y6E A;  11GS A;  1SD8 A;  1WP0 A;  3W8S A;  1GLP A;  3FZ9 A;  2O7K A;  2C3Q A;  4RUV A;  3GKM A;  2VD1 A;  5B7C A;  1XWA A;  1XCC A;  2VD0 A;  4MP4 A;  2IME A;  5FHI A;  4ZB8 A;  1QMV A;  3NOF A;  1PL1 A;  3FR9 A;  4FYC A;  3HJP A;  6GSX A;  5DJL A;  5HQP A;  2VL2 A;  3J7Y b;  4IHU A;  1TRW A;  3LWA A;  1DE2 A;  5AGY A;  1HNC A;  5DBQ A;  2F51 A;  1SJ6 A;  4EDY A;  3KH7 A;  4FH8 A;  2GT6 A;  2R5G A;  3RHB A;  2HLS A;  2K18 A;  5LCZ A;  2PGT A;  3P8W A;  2A2S A;  1BJX A;  1Z3E A;  3H4K A;  4I2T A;  1ZMA A;  5CRD A;  2TRX A;  1E2Y A;  3A5W A;  1SL0 B;  3E9J B;  2B3S A;  2OE1 A;  1K3O A;  3FKF A;  4ZL7 A;  2IL3 A;  1Z7R A;  4MK3 A;  3KH9 A;  2LST A;  2TIR A;  1X5C A;  4X0X A;  2BJX A;  3GUS A;  4HJM A;  4PNF A;  1Z6M A;  5G1L A;  1W4V A;  3BCI A;  1U88 A;  2FD3 A;  1KNG A;  4JU5 A;  3SBC A;  4CHS A; 
#chains in the Genus database with same CATH topology
 4TXV A;  1O8W A;  1JHB A;  3UBL A;  2CVB A;  2DJ0 A;  5B6N A;  1GNE A;  2VL3 A;  3GYK A;  5G1K A;  3UJ1 A;  1M2B A;  2PVQ A;  2R6K A;  1ON4 A;  1ZYP A;  1A2L A;  4TR3 A;  3Q6O A;  5IMD A;  5AIV A;  1N8J A;  4ILF A;  2I4A A;  1EV4 A;  3I6A A;  1KEB A;  2ZUP A;  2L57 A;  2L4Q A;  2B5Y A;  3LXT A;  2LEG A;  4TVE A;  1MDI A;  1WIK A;  4WEY A;  1GL8 A;  1NHO A;  2VCX A;  3FR3 A;  3IK9 A;  4ZBA A;  1AQW A;  2MYG A;  6GSU A;  2FWH A;  2GSR A;  3TUE A;  3QAG A;  5H5S A;  1MTC A;  3DXB A;  2MMZ A;  3JCM L;  5JCU A;  5A34 B;  4V1A g;  2XBI A;  2V41 A;  4EO3 A;  4MH2 A;  2OE3 A;  3ZIV A;  2GQL A;  5EY6 A;  3M9J A;  2FWE A;  5J41 A;  1DE1 A;  2C3N A;  5J5N A;  3VPQ A;  3GTU A;  2WW0 A;  4KSM A;  5BRT A;  2AJQ B;  3F4S A;  4IP6 A;  2IN3 A;  1R7H A;  5CO3 A;  4PQ1 A;  3LOR A;  3TOU A;  3LYK A;  3VPT A;  3P2A A;  3VK9 A;  2CAI A;  5KN2 A;  2JL4 A;  2VLU A;  1TK0 B;  4OD7 A;  1G6Y A;  2YNX A;  1O81 A;  3EU3 A;  3H93 A;  1PSQ A;  1K0N A;  4N3Z A;  5G2Z A;  4JE1 A;  2X49 A;  5KN0 A;  2FY6 A;  2WW3 A;  2ZNM A;  2ON5 A;  5JWQ B;  4K8M A;  1TJD A;  2YWN A;  3IXR A;  4BL7 B;  5EL8 A;  2DMM A;  1R4W A;  1TDI A;  4KDY A;  3D22 A;  4AJ7 A;  2B1K A;  2TRC P;  3KCM A;  17GS A;  2B7J A;  2GQM A;  3PIN A;  5D93 A;  4KCA A;  1SEN A;  3D5J A;  4HEA 2;  1OC8 A;  4OCF A;  2WVY A;  4OO4 A;  1E6B A;  3LFL A;  4ECC A;  1SYR A;  4ECI A;  3HJO A;  3A2W A;  3ISO A;  4WR4 A;  1M0U A;  3L78 A;  2G2Q A;  3UL3 A;  1PX7 A;  4G10 A;  4KND A;  3ZYW A;  1QXH A;  4PQH A;  2OE0 A;  2DJ2 A;  5AN1 A;  1J9B A;  1ERW A;  1X9S B;  4HQZ A;  1T8E B;  3KIJ A;  5KN1 A;  3C7M A;  4QQ7 A;  4MZW A;  4WET A;  4ZB9 A;  3A3T A;  4V2M A;  1YF1 A;  1PD2 1;  3DVX A;  2HQT A;  3ERG A;  2H1A A;  2WW1 A;  4TXO A;  1ZYN A;  1T4Z A;  3BD2 A;  4GTU A;  1ABA A;  3ZIT A;  4YQV A;  3V1W A;  2I3Y A;  1PMT A;  4MJE A;  5L71 A;  5HFG A;  4IBP A;  2H6Z A;  4WF4 A;  3FYG A;  5FT3 A;  1O73 A;  3GNJ A;  5DAK B;  3M8N A;  3TJJ A;  5ECM B;  1XVW A;  4O5R A;  4AGS A;  2I1U A;  2LRT A;  2L4C A;  2AB6 A;  5BMU B;  4JED A;  4N30 A;  5J40 A;  2XHF A;  2HE3 A;  1PA3 A;  4KSO A;  4ID0 A;  3HMJ G;  3BOA A;  3D6I A;  4LLR A;  2VKZ G;  3CXG A;  1G6W A;  2H70 A;  1G7E A;  2DIZ A;  2VCZ A;  3TKQ A;  2MMA A;  1GUL A;  1EZK A;  1V2A A;  4GSS A;  1ERT A;  2YZH A;  4K5R A;  2IWT A;  5KOW A;  5ECI B;  1OE8 A;  1I5G A;  1XXU A;  4EF0 A;  5CAX A;  3CRT A;  1ZGN A;  4EUY A;  2KUC A;  4ZBB A;  2BMX A;  5D8I A;  3VWV A;  5G5E A;  2L6D A;  5D9X A;  1F6M C;  2YV9 A;  1VF4 A;  4NMU A;  1A0R P;  2A4H A;  3UVT A;  4E8E A;  4D73 A;  1FG4 A;  2NPB A;  3I43 A;  1AW9 A;  2YV7 A;  2CAQ A;  3MWH A;  1GTB A;  5JWO B;  4K2D A;  1R26 A;  2CX3 A;  4IS0 A;  3KD0 A;  2HRK A;  1A8L A;  1YEW C;  2GZY A;  2LRN A;  2WVZ A;  2ZCT A;  1K3L A;  3UAR A;  16GS A;  2E2G A;  1K0B A;  1JZO A;  4CY8 A;  2VOC A;  3CSI A;  1PRX A;  5J4V A;  5A5K A;  2F9S A;  3KJY A;  5ELG A;  5IMF A;  4USS A;  4IVF A;  4DSS B;  5JCW A;  4K7N A;  2GLR A;  2M46 A;  3RFR C;  1EP7 A;  4N10 A;  1S3D A;  2LJA A;  3N5O A;  3FHK A;  1YEX A;  4PTS A;  2V32 A;  1TRV A;  3EMX A;  5D9V A;  5DDL A;  1G7O A;  3EIN A;  1SD9 A;  4I97 A;  4FYU A;  5A4W A;  3FK8 A;  4F0B A;  2H0G A;  2AHE A;  2KOK A;  1G0T A;  2LV3 A;  3F3R A;  1ML6 A;  1GRX A;  1KTE A;  5J9B A;  4IN0 A;  1SYX A;  4F82 A;  2O85 A;  1F37 A;  2GVP A;  5IMZ A;  1HNB A;  3KXO A;  4MA9 A;  2R0G A;  4POL A;  1PKW A;  2MMO A;  5HR0 A;  2GQK A;  1YY7 A;  5C00 A;  2FHE A;  3I9V 2;  3IAM 2;  4ACS A;  4AKX B;  5E59 A;  4WBJ A;  3RGB C;  3GH9 A;  2K6V A;  3QDN A;  4TR1 A;  1DSB A;  4A5P A;  3IRA A;  2KP2 A;  1PGT A;  3SWL A;  3RDW A;  3TJF A;  4MJB A;  2EIR A;  2J23 A;  5B8A A;  3FR6 A;  5J3R A;  1F3A A;  4PXO A;  4Q5R A;  2QKE A;  4TR0 A;  2CZ3 A;  3D4M A;  3CTG A;  3GA4 A;  1M99 A;  4GST A;  3WD6 A;  1S4B P;  2WRT A;  1SK2 A;  3TKS C;  2H75 A;  2PMT A;  3GIX A;  5ABR A;  2ALB A;  1T4Y A;  4BIK A;  2H71 A;  4F9Z A;  1PQN A;  2HRF A;  4AKH A;  4BVY B;  3LEF A;  6GST A;  4NHZ A;  3LQ7 A;  2BTO T;  1A24 A;  4ECJ A;  1LU4 A;  4AI6 A;  1SL1 B;  1VF2 A;  1FHE A;  2F8F A;  3GKK A;  4IEL A;  5DAL A;  1M9A A;  4G0I A;  1A0F A;  2EIQ A;  4F2I A;  2IPA A;  5ECK B;  3EVI A;  1Z5Y E;  4EXJ A;  2CVD A;  3Q19 A;  4ISD A;  4H86 A;  5G30 A;  1SL2 B;  2M72 A;  2LQQ A;  2WS2 A;  3ERF A;  1TKD B;  5DJM A;  5KEJ A;  2M80 A;  1PX6 A;  5DVB A;  2I81 A;  4YAP A;  2N5F A;  3BBY A;  2HZE A;  5A4U A;  4G19 A;  3Q18 A;  4PI2 C;  3RPN A;  2LNT A;  5IMA A;  1YJ6 A;  2IJY A;  3LJR A;  2RLI A;  1V9W A;  1NW2 A;  2DJ3 A;  4MAB A;  1TXX A;  4POK A;  1JZD A;  5GST A;  2GZP A;  2X64 A;  3CMI A;  1T7P B;  4MF5 A;  2IMK A;  3U5R E;  5DQY A;  5D73 A;  1EEJ A;  3ZMK A;  2WFC A;  4KB3 A;  2NVL A;  3A2V A;  1HQO A;  1YVL A;  3TOT A;  3HKR A;  2FGX A;  2HSY A;  1XW9 A;  3MSZ A;  2YAN A;  4LMV A;  4DEJ A;  5HFI A;  4K5S A;  1XWG A;  1GNW A;  3ME7 A;  5HR3 A;  1K0D A;  1Q98 A;  3QD9 A;  1XWC A;  4XS6 A;  22GS A;  1TU8 A;  3F6F A;  1F2E A;  4YKG A;  2IFQ B;  4GQC A;  1XWK A;  5G31 A;  4XTS A;  3RPP A;  4XRA A;  1V58 A;  2R4V A;  1AXD A;  1RQM A;  2MBS A;  3CSH A;  4KCE A;  1U3A A;  3G7J A;  2HSM B;  2VCQ A;  2YPM A;  2H1G A;  4NHW A;  1OKD A;  4K0N A;  4HSC X;  5KN3 A;  4YH2 A;  9GSS A;  5A34 A;  3KTB A;  2EIO A;  3TDG A;  13GS A;  3C73 A;  1N25 A;  4PQI A;  1V40 A;  1GSF A;  4TN8 A;  2AV4 A;  3EE2 A;  4X43 A;  1SKS B;  1OC9 A;  2OBI A;  3MAK A;  4XCS A;  1X5E A;  2KLX A;  4WKW A;  2R37 A;  2O5V A;  1MDK A;  3CBU A;  4RQX A;  1SVM A;  3O3T A;  5IO0 A;  3IHG A;  4WXT A;  1THX A;  2DLX A;  2V6O A;  1M9B A;  4ML6 A;  5D9W A;  2WZ9 A;  1NSW A;  4AF2 A;  2CZ2 A;  3BJ5 A;  2FUG 2;  4XS1 A;  1I1I P;  4MF6 A;  4ZB7 A;  4KW6 A;  1TK8 B;  4OO5 A;  2V6K A;  4G01 A;  1YF0 A;  3WT1 A;  4ULX A;  2VO4 A;  5IPG A;  3EUR A;  3CHX C;  5A1N B;  5DCH A;  2YZU A;  5GZZ B;  5IPH A;  3RAZ A;  4L5O A;  2EFC A;  3CRU A;  3A2X A;  5COH A;  4Z2U A;  4TR4 A;  5IOW A;  1O8X A;  2K9F A;  4IP1 A;  1GUM A;  2KHP A;  4Q5F A;  2HNL A;  4DVC A;  2DML A;  2X99 A;  3BCK A;  3WGE A;  5ENU A;  1LJR A;  5H5R A;  1A2M A;  2VCT A;  4N11 A;  4ZXG A;  3G9B A;  4Q5N A;  3F4R A;  4DSQ A;  2H6X A;  1FOH A;  2CQ9 A;  2GZZ A;  4LA1 A;  4O7H A;  3HHV A;  2A2R A;  5AIX A;  2P0G A;  3TRX A;  3GMF A;  2FNO A;  3QPM A;  4HDE A;  2N5A A;  1SU9 A;  3VI7 A;  3TRQ A;  1U6T A;  4EVM A;  3IC4 A;  5CRW A;  3OR5 A;  2B5X A;  2WDU A;  1TRU A;  4HU7 A;  4K1F A;  5F8B A;  3FY7 A;  5ELA A;  1EWX A;  2H0I A;  2CV4 A;  4PNG A;  2PU9 C;  5J47 A;  2PER A;  4MZB A;  3ZVJ D;  3KMO A;  3KEB A;  4IGJ A;  2LKU A;  3GSS A;  3MYD A;  4ZIJ A;  5JWR B;  4EE0 A;  3IE3 A;  2B7K A;  2MBT A;  2GTU A;  1GUK A;  4HQS A;  2PVO C;  1FAA A;  2PBJ A;  1AQV A;  2FA8 A;  4Z7X A;  5C04 A;  4KX4 A;  1A2J A;  3GTU B;  5F06 A;  3TKR A;  4J56 E;  2QSI A;  3S9F A;  1RW1 A;  4K7I A;  1YQ1 A;  3HZ8 A;  2HSH A;  1FW1 A;  4PUF C;  1YKA A;  4ML1 A;  4KDX A;  1Y1U A;  1H4O A;  2WJU A;  2F3M A;  2A4V A;  4TRX A;  2O8V B;  2R0P A;  2R3X A;  4W66 A;  2WUL A;  1YDK A;  3CYN A;  4GCI A;  3HY2 A;  1YZX A;  1WPI A;  4AKG A;  3KM6 A;  2PPT A;  2OAD A;  4GWR A;  5H5Q A;  5ECH B;  1WRY A;  2JSY A;  1BG5 A;  1FVJ A;  5JCG A;  3TJB A;  4QL9 A;  4ECB A;  3ME8 A;  3FW2 A;  4LL4 B;  4XRD A;  2K8S A;  5IM9 A;  3HVV A;  3HA9 A;  2ON7 A;  1W89 A;  1XIY A;  3PH9 A;  2H30 A;  3O76 A;  4GRF A;  2YWO A;  3P90 A;  3QMX A;  1X9M B;  1DUG A;  4CDO A;  3DD3 A;  5B8B A;  3DRN A;  4RQR A;  2H1L A;  4Q5Q A;  4POM A;  1HYU A;  3GX0 A;  2PUK C;  4DSS A;  4NWY A;  3ZIJ A;  4TKY A;  3LW9 A;  3EMP A;  3ZZX A;  2MMN A;  3IBH A;  2OBK A;  3ZL5 A;  2DJJ A;  4OFM A;  3ZTL A;  5EVO A;  1GSE A;  1QUW A;  3VFI A;  1Q4J A;  1GSY A;  2R0C A;  1GUH A;  3DYR A;  1GTA A;  2O36 A;  2FA4 A;  4AKI A;  4PGT A;  1H75 A;  2IMI A;  2HI7 A;  3HDC A;  1PKZ A;  1WMJ A;  3RBT A;  5CRG A;  3IC8 A;  4TXO B;  4HZ2 A;  3UIW A;  2P5Q A;  1ILO A;  4PX1 A;  4BVX A;  2QC7 A;  4LMW A;  3IK7 A;  4L5L A;  3N9J A;  1YEP A;  3QCP A;  1AQX A;  3Q74 A;  20GS A;  1U87 A;  2HSN A;  5FWG A;  2O87 A;  3L0H A;  3RHC A;  2K8V A;  1R5A A;  3ED3 A;  3TRP A;  3U6V A;  2VAF A;  2FCH A;  18GS A;  6GSY A;  2VL2 C;  4MH3 A;  1MEK A;  3G7I A;  3GRX A;  3C8E A;  1TRS A;  3C1R A;  5F0G A;  3GX8 A;  1X0R A;  4MJA A;  1WWJ A;  3DVW A;  4PHZ C;  1SK1 A;  5J9C A;  2Z9S A;  1Z7P A;  2L6C A;  1M3J A;  4IJ3 A;  1SKW B;  5HFK A;  3LGC A;  5ID2 A;  5F05 A;  3F9U A;  5CRH A;  1XW5 A;  3CSJ A;  6GSW A;  4E8H A;  1ERV A;  4XHM A;  4L0U A;  3QFA C;  2HRA A;  5CNW A;  3R2Q A;  4XS4 A;  1JLV A;  4I2U A;  4MF7 A;  3TJK A;  2WVX B;  2L5O A;  5ECS A;  2XC2 A;  3UVH A;  1CQG A;  5ECN B;  2HRK B;  3LG6 A;  4MPF A;  2FWF A;  2OJL A;  2RUE A;  5LNK e;  3L9V A;  5D96 A;  5IQY A;  3GUR A;  2DJ1 A;  4LL1 B;  1OVN A;  1FOV A;  4HZ4 A;  1UN2 A;  1XPV A;  3HVN A;  1T3B A;  4EL1 A;  1EOG A;  3GKN A;  2C8U A;  3HJM A;  3VI5 A;  1T1V A;  3M0F A;  4O5Q A;  3VWU A;  1MD3 A;  1S3C A;  4ZIL A;  4MPG A;  3DML A;  4KF9 A;  1URM A;  2IMF A;  6GSS A;  2C0E A;  3VLN A;  4TOP A;  4YQU A;  1ZZY A;  5IOX A;  2GSS A;  1AIU A;  1XW6 A;  3F0I A;  1AC1 A;  1K0A A;  3GKX A;  1K0M A;  4OCE A;  4L8E A;  1J08 A;  4OWY A;  5AIS A;  1TW9 A;  1EP8 A;  1SJI A;  1B4P A;  1CQH A;  4OMV A;  2YWI A;  5CYY A;  2DIY A;  2XBQ A;  5INY A;  3R3E A;  3VWW A;  2B6M A;  3M9K A;  4X4J A;  3GV1 A;  4BWS A;  3F63 A;  2H72 A;  4BA7 A;  2VLV A;  2H1B A;  1EGR A;  4IKH A;  1OYJ A;  5A5H A;  2HT9 A;  3EC3 A;  4TR1 B;  4RI7 A;  3APQ A;  1B9Y C;  4YKF A;  1C72 A;  4NAX A;  3ZRD A;  3TCO A;  4MCU A;  4MNN A;  3L9U A;  4HJ2 A;  3NZN A;  19GS A;  2JAC A;  4F0C A;  4PI0 C;  1ZCP A;  3QAW A;  4HI7 A;  4DSR A;  1BX9 A;  1GP1 A;  4G0L A;  2HFD A;  4EIP A;  2E7P A;  5HR1 A;  2VM2 A;  3MNG A;  3FMW A;  5A4V A;  2GGT A;  1JZW A;  2NBS A;  4MZC A;  1AUC A;  3HZ4 A;  4NV2 A;  1JZR A;  1M3I A;  4E68 A;  4JR4 A;  3MIX A;  4WR5 A;  3F3Q A;  5J4U A;  3KTL A;  3QR6 A;  3KGK A;  3W8J A;  5KOX A;  2RM6 A;  6GSV A;  3DWV A;  4NPB A;  4RI6 A;  2UZ8 A;  2LQO A;  5D9T A;  3DGQ A;  2VL9 A;  1K0O A;  4K7O A;  5DAL B;  5F07 A;  2H76 A;  1V98 A;  2LRC A;  4QL7 A;  3LXZ A;  5IIZ A;  4QMK A;  1TTZ A;  3IPZ A;  1WJK A;  2NTO A;  1TXU A;  4V1A p;  3EYT A;  2DKH A;  4K9Z A;  1RK4 A;  4OFT A;  3I69 A;  1V57 A;  2YOI A;  4K6X A;  1B48 A;  3KMN A;  2JZT A;  1M7T A;  4HUA A;  4ZL8 A;  1GSD A;  1Z9H A;  4GXZ A;  3CTF A;  4POB A;  2IMD A;  3D4T A;  2HZE B;  1ERU A;  1SK0 A;  1QQ2 A;  1B9X C;  1T00 A;  4ICY A;  3IOS A;  1XFL A;  1TK5 B;  1XZO A;  2X8H A;  2FWG A;  1LBK A;  2JU5 A;  1VGL A;  1X5D A;  3D21 A;  3NIV A;  3F8U A;  2H19 A;  1ACV A;  3FEU A;  4K2X A;  1ZYQ B;  1QGV A;  3UMA A;  3GHA A;  3ZRE A;  3TB2 A;  1USB A;  3TKS A;  8GSS A;  2OAC A;  3AY8 A;  5GAP D;  1R5P A;  1BQ7 A;  2HRN A;  4O5U A;  5CP1 A;  3KZQ A;  3FZA A;  1EV9 A;  1XWB A;  2C4J A;  2LNS A;  2GS3 A;  4X1U A;  4IQA A;  1GTU A;  4G0K A;  3CWG A;  3TU3 B;  3IV4 A;  5J4Y A;  1ZOF A;  3QAV A;  4KDU A;  3KP9 A;  12GS A;  2DSA A;  3QFB C;  4BL7 A;  4JRR A;  2L59 A;  2H01 A;  1YKC A;  3ERW A;  2LTK A;  5GSS A;  2QA1 A;  2O89 A;  3ZFL A;  1IYH A;  3DEX A;  2B1L A;  1SVO A;  3PGT A;  3IA1 A;  1PN9 A;  3GL5 A;  2HZF A;  5DCG A;  1FB0 A;  2E0Q A;  3J7Y k;  2VM1 A;  4NV5 A;  3FZ5 A;  3LSZ A;  2RUF A;  1OC9 B;  3C71 A;  1QK8 A;  4KAE A;  2JZS A;  1GSS A;  3VUR A;  2JZR A;  4EIQ A;  3P7X A;  2WB9 A;  1UVZ A;  1THO A;  2QGV A;  5CRE A;  5HR2 A;  4O32 A;  2GSQ A;  2AAW A;  2NDO A;  2YP6 A;  4V2L A;  2PN8 A;  3E0U A;  4KGI A;  3GN3 A;  1VF3 A;  3HVS A;  2C1Y A;  1UA5 A;  2C80 A;  1I9D A;  2RII A;  3IR4 A;  2LJK A;  2HXK A;  2JAD A;  1O85 A;  3US3 A;  2OKA A;  3EWL A;  4MLY A;  2LUS A;  4KH7 A;  2C0D A;  5E4W A;  2YCD A;  2AUV A;  1TI3 A;  1A8Y A;  4F03 A;  3F6D A;  4ZL9 A;  4WF5 A;  5B6M A;  1BYE A;  1O7U A;  1FVK A;  4TW5 A;  5DAK A;  1XG8 A;  2WW2 A;  1MDJ A;  2VUP A;  4CW9 A;  1O6J A;  2P5R A;  2LS5 A;  3WGD A;  1VF1 A;  5BMU A;  2H8L A;  5ECR B;  3D0Z A;  2O3E A;  4G2E A;  5ECO B;  4IJI A;  4I5Q A;  1XOA A;  4IW9 A;  3GST A;  1SJZ A;  4HU9 A;  1GSQ A;  4IQ1 A;  1WE0 A;  3MDK A;  2LJR A;  1UC7 A;  2REM A;  4K0G A;  2GST A;  2VCV A;  2OT3 A;  1OC3 A;  2C0G A;  2GDR A;  4HS1 A;  2X8G A;  4MJC A;  1TP9 A;  4V2N A;  3UOM A;  4ZBD A;  2DC5 A;  1OAZ A;  2H66 A;  4GDF A;  1N2A A;  1GLQ A;  2VCW A;  1EEM A;  1IYI A;  5G5F A;  2EC4 A;  2YN1 A;  3ZLP A;  1TU7 A;  2VIM A;  4EDZ A;  3H1N A;  1F9M A;  4N0Z A;  2N5B A;  3WYW A;  1B8X A;  2CX4 A;  2OA7 A;  3DKS A;  2QA2 A;  7GSS A;  2H6Y A;  3APS A;  1VRS D;  3UAP A;  3G7Y A;  3ZML A;  2C0F A;  4HOJ A;  2KP1 A;  2WCI A;  1BED A;  3M3M A;  1NM3 A;  3M1G A;  4YQM A;  4ZB6 A;  4FYB A;  4MDC A;  1KBN A;  1M2A A;  3PR8 A;  4P3Y B;  3UBK A;  2RM5 A;  2WGR A;  2MZC A;  2V1M A;  1Z6N A;  1F3B A;  3A5I A;  10GS A;  2V2G A;  1PFO A;  4AJ8 A;  3HCZ A;  4PUR A;  2G0F A;  2GT5 A;  4EKZ A;  5ECP B;  1AAZ A;  5DQS A;  2CVK A;  1SVL A;  3ZVJ A;  5GAN D;  3W6G A;  4OFN A;  3QOU A;  4JBB A;  2B5E A;  1PL2 A;  4NXI A;  1QFN A;  5IMC A;  4PUA A;  1K0C A;  2R2J A;  3FRC A;  4KA0 A;  3L9S A;  1DBY A;  3GH6 A;  4FXY P;  2WVX A;  3H8Q A;  2L5L A;  3APO A;  14GS A;  1ST9 A;  2FLS A;  3PPU A;  2EFD A;  3IHQ A;  3TKP A;  3HYP A;  4FO5 A;  1TI1 A;  3C1S A;  4FQU A;  4GQF A;  4J2F A;  1J0F A;  1GWC A;  2J9H A;  2DBC A;  2CA8 A;  2XPE A;  1FB6 A;  1OKT A;  2YWM A;  3L4N A;  1GTI A;  1U3I A;  2H0H A;  1EGO A;  1JLW A;  4O92 A;  1XVQ A;  1HD2 A;  4BPY A;  2H73 A;  5ECQ B;  4KE3 A;  4BVY A;  1MD4 A;  2C3T A;  4N0V A;  4D73 B;  5EPF A;  2WZS A;  2CT6 A;  3FZ4 A;  3HVX A;  2IIY A;  1X9W B;  4BVX B;  4FIW A;  4KUN A;  2D2Z A;  3ZFB A;  1S3A A;  2DJK A;  4BWQ A;  1ZYE A;  2H1D A;  2ES7 A;  2P31 A;  1OE7 A;  5IO2 A;  1XBS A;  1BG1 A;  4JR6 A;  2HSN B;  4EC0 A;  4Z2R A;  2DKI A;  2YJH A;  2YJ7 A;  1WOU A;  2PWJ A;  1FO5 A;  4GLT A;  3IDV A;  1HNA A;  4I8B A;  4WBR D;  2H74 A;  2F8A A;  5IMV A;  3O6T A;  1Y25 A;  3KP8 A;  3TGZ A;  2VLT A;  3GFK A;  3H79 A;  4JZQ A;  2X8C A;  4G9H A;  2JSZ A;  3GL3 A;  1NHY A;  4GSN A;  4CY6 A;  1M2D A;  3VWX A;  4Z2T A;  1GH2 A;  2EFE A;  3WT2 A;  4GF0 A;  3UEM A;  3E3E A;  3F4T A;  5ID2 B;  2A2P A;  3K8N A;  4L0W A;  2E2M A;  1ZL9 A;  1EOH A;  2AYT A;  3DIE A;  2XPD A;  3TJG A;  4AJ6 A;  4YAV A;  3LYP A;  3EU4 A;  4XS4 B;  1SKR B;  4XIH A;  5LD0 A;  1B4Q A;  2IFQ A;  1TOF A;  1A23 A;  4MMM A;  1BAY A;  4I6X A;  3HXS A;  1XOB A;  1K3Y A;  3IAS 2;  2HSM A;  3HD5 A;  3WGX A;  2I9H A;  2HYX A;  1PN0 A;  1GSU A;  1JFU A;  5ECL B;  4J57 E;  3TKS E;  1Y6E A;  11GS A;  1SD8 A;  1WP0 A;  3W8S A;  1GLP A;  3FZ9 A;  2O7K A;  2C3Q A;  4RUV A;  3GKM A;  2VD1 A;  5B7C A;  1XWA A;  1XCC A;  2VD0 A;  2UV8 G;  4MP4 A;  2IME A;  2EFH A;  5FHI A;  4ZB8 A;  1BF5 A;  1QMV A;  3NOF A;  1S3R A;  1PL1 A;  3FR9 A;  4FYC A;  3HJP A;  6GSX A;  5DJL A;  5HQP A;  2VL2 A;  3J7Y b;  4IHU A;  1TRW A;  3LWA A;  1DE2 A;  5AGY A;  1HNC A;  5DBQ A;  2F51 A;  1SJ6 A;  4EDY A;  3KH7 A;  4FH8 A;  2GT6 A;  2X4A A;  2R5G A;  3RHB A;  2HLS A;  2K18 A;  5LCZ A;  2PGT A;  3P8W A;  2A2S A;  1BJX A;  1Z3E A;  3H4K A;  4I2T A;  1ZMA A;  5CRD A;  2TRX A;  1E2Y A;  3A5W A;  1SL0 B;  5A1N A;  3E9J B;  2B3S A;  2OE1 A;  1K3O A;  3FKF A;  4ZL7 A;  3EPT A;  2IL3 A;  1Z7R A;  5A5H B;  4MK3 A;  3KH9 A;  2LST A;  2TIR A;  1X5C A;  4X0X A;  2BJX A;  3GUS A;  4HJM A;  4PNF A;  1Z6M A;  5G1L A;  3CQF A;  1W4V A;  3BCI A;  1U88 A;  2FD3 A;  1KNG A;  4JU5 A;  3SBC A;  4CHS A; 
#chains in the Genus database with same CATH homology
 4TXV A;  1O8W A;  1JHB A;  3UBL A;  2CVB A;  2DJ0 A;  5B6N A;  1GNE A;  2VL3 A;  3GYK A;  5G1K A;  3UJ1 A;  1M2B A;  2PVQ A;  2R6K A;  1ON4 A;  1ZYP A;  1A2L A;  4TR3 A;  3Q6O A;  5IMD A;  5AIV A;  1N8J A;  4ILF A;  2I4A A;  1EV4 A;  3I6A A;  1KEB A;  2ZUP A;  2L57 A;  2L4Q A;  2B5Y A;  3LXT A;  2LEG A;  4TVE A;  1MDI A;  1WIK A;  4WEY A;  1GL8 A;  1NHO A;  2VCX A;  3FR3 A;  3IK9 A;  4ZBA A;  1AQW A;  2MYG A;  6GSU A;  2FWH A;  2GSR A;  3TUE A;  3QAG A;  5H5S A;  1MTC A;  3DXB A;  2MMZ A;  3JCM L;  5JCU A;  5A34 B;  4V1A g;  2XBI A;  2V41 A;  4EO3 A;  4MH2 A;  2OE3 A;  3ZIV A;  2GQL A;  5EY6 A;  3M9J A;  2FWE A;  5J41 A;  1DE1 A;  2C3N A;  5J5N A;  3VPQ A;  3GTU A;  4KSM A;  5BRT A;  2AJQ B;  3F4S A;  4IP6 A;  2IN3 A;  1R7H A;  5CO3 A;  4PQ1 A;  3LOR A;  3TOU A;  3LYK A;  3VPT A;  3P2A A;  3VK9 A;  2CAI A;  5KN2 A;  2JL4 A;  2VLU A;  1TK0 B;  4OD7 A;  1G6Y A;  2YNX A;  1O81 A;  3EU3 A;  3H93 A;  1PSQ A;  1K0N A;  4N3Z A;  5G2Z A;  4JE1 A;  2X49 A;  5KN0 A;  2FY6 A;  2ZNM A;  2ON5 A;  5JWQ B;  4K8M A;  1TJD A;  2YWN A;  3IXR A;  4BL7 B;  5EL8 A;  2DMM A;  1R4W A;  1TDI A;  4KDY A;  3D22 A;  4AJ7 A;  2B1K A;  2TRC P;  3KCM A;  17GS A;  2B7J A;  2GQM A;  3PIN A;  5D93 A;  4KCA A;  1SEN A;  3D5J A;  4HEA 2;  1OC8 A;  4OCF A;  4OO4 A;  1E6B A;  3LFL A;  4ECC A;  1SYR A;  4ECI A;  3HJO A;  3A2W A;  3ISO A;  4WR4 A;  1M0U A;  3L78 A;  2G2Q A;  3UL3 A;  1PX7 A;  4G10 A;  4KND A;  3ZYW A;  1QXH A;  4PQH A;  2OE0 A;  2DJ2 A;  5AN1 A;  1J9B A;  1ERW A;  1X9S B;  4HQZ A;  1T8E B;  3KIJ A;  5KN1 A;  3C7M A;  4QQ7 A;  4MZW A;  4WET A;  4ZB9 A;  3A3T A;  4V2M A;  1YF1 A;  1PD2 1;  3DVX A;  2HQT A;  3ERG A;  2H1A A;  4TXO A;  1ZYN A;  1T4Z A;  3BD2 A;  4GTU A;  1ABA A;  3ZIT A;  4YQV A;  3V1W A;  2I3Y A;  1PMT A;  4MJE A;  5L71 A;  5HFG A;  4IBP A;  2H6Z A;  4WF4 A;  3FYG A;  5FT3 A;  1O73 A;  3GNJ A;  5DAK B;  3M8N A;  3TJJ A;  5ECM B;  1XVW A;  4O5R A;  4AGS A;  2I1U A;  2LRT A;  2L4C A;  2AB6 A;  5BMU B;  4JED A;  4N30 A;  5J40 A;  2XHF A;  2HE3 A;  1PA3 A;  4KSO A;  4ID0 A;  3HMJ G;  3BOA A;  3D6I A;  4LLR A;  2VKZ G;  3CXG A;  1G6W A;  2H70 A;  1G7E A;  2DIZ A;  2VCZ A;  3TKQ A;  2MMA A;  1GUL A;  1EZK A;  1V2A A;  4GSS A;  1ERT A;  2YZH A;  4K5R A;  2IWT A;  5KOW A;  5ECI B;  1OE8 A;  1I5G A;  1XXU A;  4EF0 A;  5CAX A;  3CRT A;  1ZGN A;  4EUY A;  2KUC A;  4ZBB A;  2BMX A;  5D8I A;  3VWV A;  5G5E A;  2L6D A;  5D9X A;  1F6M C;  2YV9 A;  1VF4 A;  4NMU A;  1A0R P;  2A4H A;  3UVT A;  4E8E A;  4D73 A;  1FG4 A;  2NPB A;  3I43 A;  1AW9 A;  2YV7 A;  2CAQ A;  3MWH A;  1GTB A;  5JWO B;  4K2D A;  1R26 A;  2CX3 A;  4IS0 A;  3KD0 A;  2HRK A;  1A8L A;  2GZY A;  2LRN A;  2ZCT A;  1K3L A;  3UAR A;  16GS A;  2E2G A;  1K0B A;  1JZO A;  4CY8 A;  2VOC A;  3CSI A;  1PRX A;  5J4V A;  5A5K A;  2F9S A;  3KJY A;  5ELG A;  5IMF A;  4USS A;  4IVF A;  4DSS B;  5JCW A;  4K7N A;  2GLR A;  2M46 A;  1EP7 A;  4N10 A;  1S3D A;  2LJA A;  3N5O A;  3FHK A;  1YEX A;  4PTS A;  2V32 A;  1TRV A;  3EMX A;  5D9V A;  5DDL A;  1G7O A;  3EIN A;  1SD9 A;  4I97 A;  4FYU A;  5A4W A;  3FK8 A;  4F0B A;  2H0G A;  2AHE A;  2KOK A;  1G0T A;  2LV3 A;  3F3R A;  1ML6 A;  1GRX A;  1KTE A;  5J9B A;  4IN0 A;  1SYX A;  4F82 A;  2O85 A;  1F37 A;  2GVP A;  5IMZ A;  1HNB A;  3KXO A;  4MA9 A;  2R0G A;  4POL A;  1PKW A;  2MMO A;  5HR0 A;  2GQK A;  1YY7 A;  5C00 A;  2FHE A;  3I9V 2;  3IAM 2;  4ACS A;  4AKX B;  5E59 A;  4WBJ A;  3GH9 A;  2K6V A;  3QDN A;  4TR1 A;  1DSB A;  4A5P A;  3IRA A;  2KP2 A;  1PGT A;  3SWL A;  3RDW A;  3TJF A;  4MJB A;  2EIR A;  2J23 A;  5B8A A;  3FR6 A;  5J3R A;  1F3A A;  4PXO A;  4Q5R A;  2QKE A;  4TR0 A;  2CZ3 A;  3D4M A;  3CTG A;  3GA4 A;  1M99 A;  4GST A;  3WD6 A;  2WRT A;  1SK2 A;  3TKS C;  2H75 A;  2PMT A;  3GIX A;  5ABR A;  2ALB A;  1T4Y A;  2H71 A;  4F9Z A;  1PQN A;  2HRF A;  4AKH A;  4BVY B;  3LEF A;  6GST A;  4NHZ A;  3LQ7 A;  2BTO T;  1A24 A;  4ECJ A;  1LU4 A;  4AI6 A;  1SL1 B;  1VF2 A;  1FHE A;  2F8F A;  3GKK A;  4IEL A;  5DAL A;  1M9A A;  4G0I A;  1A0F A;  2EIQ A;  4F2I A;  2IPA A;  5ECK B;  3EVI A;  1Z5Y E;  4EXJ A;  2CVD A;  3Q19 A;  4ISD A;  4H86 A;  5G30 A;  1SL2 B;  2M72 A;  2LQQ A;  2WS2 A;  3ERF A;  1TKD B;  5DJM A;  5KEJ A;  2M80 A;  1PX6 A;  5DVB A;  2I81 A;  4YAP A;  2N5F A;  3BBY A;  2HZE A;  5A4U A;  4G19 A;  3Q18 A;  3RPN A;  2LNT A;  5IMA A;  1YJ6 A;  2IJY A;  3LJR A;  2RLI A;  1V9W A;  1NW2 A;  2DJ3 A;  4MAB A;  1TXX A;  4POK A;  1JZD A;  5GST A;  2GZP A;  2X64 A;  3CMI A;  1T7P B;  4MF5 A;  2IMK A;  3U5R E;  5DQY A;  5D73 A;  1EEJ A;  3ZMK A;  2WFC A;  4KB3 A;  2NVL A;  3A2V A;  1HQO A;  1YVL A;  3TOT A;  3HKR A;  2FGX A;  2HSY A;  1XW9 A;  3MSZ A;  2YAN A;  4LMV A;  4DEJ A;  5HFI A;  4K5S A;  1XWG A;  1GNW A;  3ME7 A;  5HR3 A;  1K0D A;  1Q98 A;  3QD9 A;  1XWC A;  4XS6 A;  22GS A;  1TU8 A;  3F6F A;  1F2E A;  4YKG A;  2IFQ B;  4GQC A;  1XWK A;  5G31 A;  4XTS A;  3RPP A;  4XRA A;  1V58 A;  2R4V A;  1AXD A;  1RQM A;  2MBS A;  3CSH A;  4KCE A;  1U3A A;  3G7J A;  2HSM B;  2VCQ A;  2YPM A;  2H1G A;  4NHW A;  1OKD A;  4K0N A;  5KN3 A;  4YH2 A;  9GSS A;  5A34 A;  3KTB A;  2EIO A;  3TDG A;  13GS A;  3C73 A;  1N25 A;  4PQI A;  1V40 A;  1GSF A;  4TN8 A;  2AV4 A;  3EE2 A;  4X43 A;  1SKS B;  1OC9 A;  2OBI A;  3MAK A;  4XCS A;  1X5E A;  2KLX A;  4WKW A;  2R37 A;  2O5V A;  1MDK A;  3CBU A;  4RQX A;  1SVM A;  3O3T A;  5IO0 A;  3IHG A;  4WXT A;  1THX A;  2DLX A;  2V6O A;  1M9B A;  4ML6 A;  5D9W A;  2WZ9 A;  1NSW A;  4AF2 A;  2CZ2 A;  3BJ5 A;  2FUG 2;  4XS1 A;  4MF6 A;  4ZB7 A;  4KW6 A;  1TK8 B;  4OO5 A;  2V6K A;  4G01 A;  1YF0 A;  3WT1 A;  4ULX A;  2VO4 A;  5IPG A;  3EUR A;  5A1N B;  5DCH A;  2YZU A;  5GZZ B;  5IPH A;  3RAZ A;  4L5O A;  2EFC A;  3CRU A;  3A2X A;  5COH A;  4Z2U A;  4TR4 A;  5IOW A;  1O8X A;  2K9F A;  4IP1 A;  1GUM A;  2KHP A;  4Q5F A;  2HNL A;  4DVC A;  2DML A;  2X99 A;  3BCK A;  3WGE A;  5ENU A;  1LJR A;  5H5R A;  1A2M A;  2VCT A;  4N11 A;  4ZXG A;  3G9B A;  4Q5N A;  3F4R A;  4DSQ A;  2H6X A;  1FOH A;  2CQ9 A;  2GZZ A;  4LA1 A;  4O7H A;  3HHV A;  2A2R A;  5AIX A;  2P0G A;  3TRX A;  3GMF A;  2FNO A;  3QPM A;  4HDE A;  2N5A A;  1SU9 A;  3VI7 A;  3TRQ A;  1U6T A;  4EVM A;  3IC4 A;  5CRW A;  3OR5 A;  2B5X A;  2WDU A;  1TRU A;  4HU7 A;  4K1F A;  5F8B A;  3FY7 A;  5ELA A;  1EWX A;  2H0I A;  2CV4 A;  4PNG A;  2PU9 C;  5J47 A;  2PER A;  4MZB A;  3ZVJ D;  3KMO A;  3KEB A;  4IGJ A;  2LKU A;  3GSS A;  3MYD A;  4ZIJ A;  5JWR B;  4EE0 A;  3IE3 A;  2B7K A;  2MBT A;  2GTU A;  1GUK A;  4HQS A;  2PVO C;  1FAA A;  2PBJ A;  1AQV A;  2FA8 A;  4Z7X A;  5C04 A;  4KX4 A;  1A2J A;  3GTU B;  5F06 A;  3TKR A;  4J56 E;  2QSI A;  3S9F A;  1RW1 A;  4K7I A;  1YQ1 A;  3HZ8 A;  2HSH A;  1FW1 A;  4PUF C;  1YKA A;  4ML1 A;  4KDX A;  1Y1U A;  1H4O A;  2WJU A;  2F3M A;  2A4V A;  4TRX A;  2O8V B;  2R0P A;  2R3X A;  4W66 A;  2WUL A;  1YDK A;  3CYN A;  4GCI A;  3HY2 A;  1YZX A;  1WPI A;  4AKG A;  3KM6 A;  2PPT A;  2OAD A;  4GWR A;  5H5Q A;  5ECH B;  1WRY A;  2JSY A;  1BG5 A;  1FVJ A;  5JCG A;  3TJB A;  4QL9 A;  4ECB A;  3ME8 A;  3FW2 A;  4LL4 B;  4XRD A;  2K8S A;  5IM9 A;  3HVV A;  3HA9 A;  2ON7 A;  1W89 A;  1XIY A;  3PH9 A;  2H30 A;  3O76 A;  4GRF A;  2YWO A;  3P90 A;  3QMX A;  1X9M B;  1DUG A;  4CDO A;  3DD3 A;  5B8B A;  3DRN A;  4RQR A;  2H1L A;  4Q5Q A;  4POM A;  1HYU A;  3GX0 A;  2PUK C;  4DSS A;  4NWY A;  3ZIJ A;  4TKY A;  3LW9 A;  3EMP A;  3ZZX A;  2MMN A;  3IBH A;  2OBK A;  3ZL5 A;  2DJJ A;  4OFM A;  3ZTL A;  5EVO A;  1GSE A;  1QUW A;  3VFI A;  1Q4J A;  1GSY A;  2R0C A;  1GUH A;  3DYR A;  1GTA A;  2FA4 A;  4AKI A;  4PGT A;  1H75 A;  2IMI A;  2HI7 A;  3HDC A;  1PKZ A;  1WMJ A;  3RBT A;  5CRG A;  3IC8 A;  4TXO B;  4HZ2 A;  3UIW A;  2P5Q A;  1ILO A;  4PX1 A;  4BVX A;  2QC7 A;  4LMW A;  3IK7 A;  4L5L A;  3N9J A;  1YEP A;  3QCP A;  1AQX A;  3Q74 A;  20GS A;  1U87 A;  2HSN A;  5FWG A;  2O87 A;  3L0H A;  3RHC A;  2K8V A;  1R5A A;  3ED3 A;  3TRP A;  3U6V A;  2VAF A;  2FCH A;  18GS A;  6GSY A;  2VL2 C;  4MH3 A;  1MEK A;  3G7I A;  3GRX A;  3C8E A;  1TRS A;  3C1R A;  5F0G A;  3GX8 A;  1X0R A;  4MJA A;  1WWJ A;  3DVW A;  5J9C A;  1SK1 A;  2Z9S A;  1Z7P A;  2L6C A;  4IJ3 A;  1SKW B;  5HFK A;  3LGC A;  5ID2 A;  5F05 A;  3F9U A;  5CRH A;  1XW5 A;  3CSJ A;  6GSW A;  4E8H A;  1ERV A;  4XHM A;  4L0U A;  3QFA C;  2HRA A;  5CNW A;  3R2Q A;  4XS4 A;  1JLV A;  4I2U A;  4MF7 A;  3TJK A;  2L5O A;  5ECS A;  2XC2 A;  3UVH A;  1CQG A;  5ECN B;  2HRK B;  3LG6 A;  4MPF A;  2FWF A;  2OJL A;  2RUE A;  5LNK e;  3L9V A;  5D96 A;  5IQY A;  3GUR A;  2DJ1 A;  4LL1 B;  1OVN A;  1FOV A;  4HZ4 A;  1UN2 A;  1XPV A;  1T3B A;  4EL1 A;  1EOG A;  3GKN A;  2C8U A;  3HJM A;  3VI5 A;  1T1V A;  3M0F A;  4O5Q A;  3VWU A;  1MD3 A;  1S3C A;  4ZIL A;  4MPG A;  3DML A;  4KF9 A;  1URM A;  2IMF A;  6GSS A;  2C0E A;  3VLN A;  4TOP A;  4YQU A;  1ZZY A;  5IOX A;  2GSS A;  1AIU A;  1XW6 A;  3F0I A;  1AC1 A;  1K0A A;  3GKX A;  1K0M A;  4OCE A;  4L8E A;  1J08 A;  4OWY A;  5AIS A;  1TW9 A;  1EP8 A;  1SJI A;  1B4P A;  1CQH A;  4OMV A;  2YWI A;  5CYY A;  2DIY A;  2XBQ A;  5INY A;  3R3E A;  3VWW A;  2B6M A;  3M9K A;  4X4J A;  3GV1 A;  4BWS A;  3F63 A;  2H72 A;  4BA7 A;  2VLV A;  2H1B A;  1EGR A;  4IKH A;  1OYJ A;  5A5H A;  2HT9 A;  3EC3 A;  4TR1 B;  4RI7 A;  3APQ A;  1B9Y C;  4YKF A;  1C72 A;  4NAX A;  3ZRD A;  3TCO A;  4MCU A;  4MNN A;  3L9U A;  4HJ2 A;  3NZN A;  19GS A;  2JAC A;  4F0C A;  1ZCP A;  3QAW A;  4HI7 A;  4DSR A;  1BX9 A;  1GP1 A;  4G0L A;  2HFD A;  4EIP A;  2E7P A;  5HR1 A;  2VM2 A;  3MNG A;  3FMW A;  5A4V A;  2GGT A;  1JZW A;  2NBS A;  4MZC A;  1AUC A;  3HZ4 A;  4NV2 A;  1JZR A;  4E68 A;  4JR4 A;  3MIX A;  4WR5 A;  3F3Q A;  5J4U A;  3KTL A;  3QR6 A;  3KGK A;  3W8J A;  5KOX A;  2RM6 A;  6GSV A;  3DWV A;  4NPB A;  4RI6 A;  2UZ8 A;  2LQO A;  5D9T A;  3DGQ A;  2VL9 A;  1K0O A;  4K7O A;  5DAL B;  5F07 A;  2H76 A;  1V98 A;  2LRC A;  4QL7 A;  3LXZ A;  5IIZ A;  4QMK A;  1TTZ A;  3IPZ A;  1WJK A;  2NTO A;  1TXU A;  4V1A p;  3EYT A;  2DKH A;  4K9Z A;  1RK4 A;  4OFT A;  3I69 A;  1V57 A;  2YOI A;  4K6X A;  1B48 A;  3KMN A;  2JZT A;  1M7T A;  4HUA A;  4ZL8 A;  1GSD A;  1Z9H A;  4GXZ A;  3CTF A;  4POB A;  2IMD A;  3D4T A;  2HZE B;  1ERU A;  1SK0 A;  1QQ2 A;  1B9X C;  1T00 A;  4ICY A;  3IOS A;  1XFL A;  1TK5 B;  1XZO A;  2X8H A;  2FWG A;  1LBK A;  2JU5 A;  1VGL A;  1X5D A;  3D21 A;  3NIV A;  3F8U A;  2H19 A;  1ACV A;  3FEU A;  4K2X A;  1ZYQ B;  1QGV A;  3UMA A;  3GHA A;  3ZRE A;  3TB2 A;  1USB A;  3TKS A;  8GSS A;  2OAC A;  3AY8 A;  5GAP D;  1R5P A;  1BQ7 A;  2HRN A;  4O5U A;  5CP1 A;  3KZQ A;  3FZA A;  1EV9 A;  1XWB A;  2C4J A;  2LNS A;  2GS3 A;  4X1U A;  4IQA A;  1GTU A;  4G0K A;  3CWG A;  3TU3 B;  3IV4 A;  5J4Y A;  1ZOF A;  3QAV A;  4KDU A;  3KP9 A;  12GS A;  2DSA A;  3QFB C;  4BL7 A;  4JRR A;  2L59 A;  2H01 A;  1YKC A;  3ERW A;  2LTK A;  5GSS A;  2QA1 A;  2O89 A;  3ZFL A;  1IYH A;  3DEX A;  2B1L A;  1SVO A;  3PGT A;  3IA1 A;  1PN9 A;  3GL5 A;  2HZF A;  5DCG A;  1FB0 A;  2E0Q A;  3J7Y k;  2VM1 A;  4NV5 A;  3FZ5 A;  3LSZ A;  2RUF A;  1OC9 B;  3C71 A;  1QK8 A;  4KAE A;  2JZS A;  1GSS A;  3VUR A;  2JZR A;  4EIQ A;  3P7X A;  2WB9 A;  1UVZ A;  1THO A;  2QGV A;  5CRE A;  5HR2 A;  4O32 A;  2GSQ A;  2AAW A;  2NDO A;  2YP6 A;  4V2L A;  2PN8 A;  3E0U A;  4KGI A;  3GN3 A;  1VF3 A;  3HVS A;  2C1Y A;  1UA5 A;  2C80 A;  1I9D A;  2RII A;  3IR4 A;  2LJK A;  2HXK A;  2JAD A;  1O85 A;  3US3 A;  2OKA A;  3EWL A;  4MLY A;  2LUS A;  4KH7 A;  2C0D A;  5E4W A;  2YCD A;  2AUV A;  1TI3 A;  1A8Y A;  4F03 A;  3F6D A;  4ZL9 A;  4WF5 A;  5B6M A;  1BYE A;  1O7U A;  1FVK A;  4TW5 A;  5DAK A;  1MDJ A;  2VUP A;  4CW9 A;  1O6J A;  2P5R A;  2LS5 A;  3WGD A;  1VF1 A;  5BMU A;  2H8L A;  5ECR B;  3D0Z A;  4G2E A;  5ECO B;  4IJI A;  4I5Q A;  1XOA A;  4IW9 A;  3GST A;  1SJZ A;  4HU9 A;  1GSQ A;  4IQ1 A;  1WE0 A;  3MDK A;  2LJR A;  1UC7 A;  2REM A;  4K0G A;  2GST A;  2VCV A;  2OT3 A;  1OC3 A;  2C0G A;  2GDR A;  4HS1 A;  2X8G A;  4MJC A;  1TP9 A;  4V2N A;  3UOM A;  4ZBD A;  2DC5 A;  1OAZ A;  2H66 A;  4GDF A;  1N2A A;  1GLQ A;  2VCW A;  1EEM A;  1IYI A;  5G5F A;  2EC4 A;  2YN1 A;  3ZLP A;  1TU7 A;  2VIM A;  4EDZ A;  3H1N A;  1F9M A;  4N0Z A;  2N5B A;  3WYW A;  1B8X A;  2CX4 A;  2OA7 A;  3DKS A;  2QA2 A;  7GSS A;  2H6Y A;  3APS A;  1VRS D;  3UAP A;  3G7Y A;  3ZML A;  2C0F A;  4HOJ A;  2KP1 A;  2WCI A;  1BED A;  3M3M A;  1NM3 A;  3M1G A;  4YQM A;  4ZB6 A;  4FYB A;  4MDC A;  1KBN A;  1M2A A;  3PR8 A;  4P3Y B;  3UBK A;  2RM5 A;  2WGR A;  2MZC A;  2V1M A;  1Z6N A;  1F3B A;  3A5I A;  10GS A;  2V2G A;  4AJ8 A;  3HCZ A;  4PUR A;  2G0F A;  2GT5 A;  4EKZ A;  5ECP B;  1AAZ A;  5DQS A;  2CVK A;  1SVL A;  3ZVJ A;  5GAN D;  3W6G A;  4OFN A;  3QOU A;  4JBB A;  2B5E A;  1PL2 A;  4NXI A;  1QFN A;  5IMC A;  4PUA A;  1K0C A;  2R2J A;  3FRC A;  4KA0 A;  3L9S A;  1DBY A;  3GH6 A;  3H8Q A;  2L5L A;  3APO A;  14GS A;  1ST9 A;  2FLS A;  3PPU A;  2EFD A;  3IHQ A;  3TKP A;  3HYP A;  4FO5 A;  1TI1 A;  3C1S A;  4FQU A;  4GQF A;  4J2F A;  1J0F A;  1GWC A;  2J9H A;  2DBC A;  2CA8 A;  2XPE A;  1FB6 A;  1OKT A;  2YWM A;  3L4N A;  1GTI A;  1U3I A;  2H0H A;  1EGO A;  1JLW A;  4O92 A;  1XVQ A;  1HD2 A;  4BPY A;  2H73 A;  5ECQ B;  4KE3 A;  4BVY A;  1MD4 A;  2C3T A;  4N0V A;  4D73 B;  5EPF A;  2CT6 A;  3FZ4 A;  3HVX A;  2IIY A;  1X9W B;  4BVX B;  4FIW A;  4KUN A;  2D2Z A;  3ZFB A;  1S3A A;  2DJK A;  4BWQ A;  1ZYE A;  2H1D A;  2ES7 A;  2P31 A;  1OE7 A;  5IO2 A;  1XBS A;  1BG1 A;  4JR6 A;  2HSN B;  4EC0 A;  4Z2R A;  2DKI A;  2YJH A;  2YJ7 A;  1WOU A;  2PWJ A;  1FO5 A;  4GLT A;  3IDV A;  1HNA A;  4I8B A;  4WBR D;  2H74 A;  2F8A A;  5IMV A;  3O6T A;  1Y25 A;  3KP8 A;  3TGZ A;  2VLT A;  3GFK A;  3H79 A;  4JZQ A;  2X8C A;  4G9H A;  2JSZ A;  3GL3 A;  1NHY A;  4GSN A;  4CY6 A;  1M2D A;  3VWX A;  4Z2T A;  1GH2 A;  2EFE A;  3WT2 A;  4GF0 A;  3UEM A;  3E3E A;  3F4T A;  5ID2 B;  2A2P A;  3K8N A;  4L0W A;  2E2M A;  1ZL9 A;  1EOH A;  2AYT A;  3DIE A;  2XPD A;  3TJG A;  4AJ6 A;  4YAV A;  3LYP A;  3EU4 A;  4XS4 B;  1SKR B;  4XIH A;  5LD0 A;  1B4Q A;  2IFQ A;  1TOF A;  1A23 A;  4MMM A;  1BAY A;  4I6X A;  3HXS A;  1XOB A;  1K3Y A;  3IAS 2;  2HSM A;  3HD5 A;  3WGX A;  2I9H A;  2HYX A;  1PN0 A;  1GSU A;  1JFU A;  5ECL B;  4J57 E;  3TKS E;  1Y6E A;  11GS A;  1SD8 A;  1WP0 A;  3W8S A;  1GLP A;  3FZ9 A;  2O7K A;  2C3Q A;  4RUV A;  3GKM A;  2VD1 A;  5B7C A;  1XWA A;  1XCC A;  2VD0 A;  2UV8 G;  4MP4 A;  2IME A;  2EFH A;  5FHI A;  4ZB8 A;  1BF5 A;  1QMV A;  3NOF A;  1PL1 A;  3FR9 A;  4FYC A;  3HJP A;  6GSX A;  5DJL A;  5HQP A;  2VL2 A;  3J7Y b;  4IHU A;  1TRW A;  3LWA A;  1DE2 A;  5AGY A;  1HNC A;  5DBQ A;  2F51 A;  1SJ6 A;  4EDY A;  3KH7 A;  4FH8 A;  2GT6 A;  2X4A A;  2R5G A;  3RHB A;  2HLS A;  2K18 A;  5LCZ A;  2PGT A;  3P8W A;  2A2S A;  1BJX A;  1Z3E A;  3H4K A;  4I2T A;  1ZMA A;  5CRD A;  2TRX A;  1E2Y A;  3A5W A;  1SL0 B;  5A1N A;  3E9J B;  2B3S A;  2OE1 A;  1K3O A;  3FKF A;  4ZL7 A;  3EPT A;  2IL3 A;  1Z7R A;  5A5H B;  4MK3 A;  3KH9 A;  2LST A;  2TIR A;  1X5C A;  4X0X A;  2BJX A;  3GUS A;  4HJM A;  4PNF A;  1Z6M A;  5G1L A;  1W4V A;  3BCI A;  1U88 A;  2FD3 A;  1KNG A;  4JU5 A;  3SBC A;  4CHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...