1PMTA

Glutathione transferase from proteus mirabilis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
201
structure length
201
Chain Sequence
MKLYYTPGSCSLSPHIVLRETGLDFSIERIDLRTKKTESGKDFLAINPKGQVPVLQLDNGDILTEGVAIVQYLADLKPDRNLIAPPKALERYHQIEWLNFLASEVHKGYSPLFSSDTPESYLPVVKNKLKSKFVYINDVLSKQKCVCGDHFTVADAYLFTLSQWAPHVALDLTDLSHLQDYLARIAQRPNVHSALVTEGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE TRANSFERASE
publication title A mixed disulfide bond in bacterial glutathione transferase: functional and evolutionary implications.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Transferase
total genus 66
structure length 201
sequence length 201
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pmtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pmtA01
5ECIB 4MMMA 4ZB6A 1DSBA 4I6XA 3C7MA 3G7YA 4ID0A 4NV2A 4E8HA 1EOGA 2C0GA 3LQ7A 2DJ0A 1FOVA 2I81A 4XRDA 2C0FA 3N9JA 1AC1A 5DDLA 1S3DA 3G7JA 2C3QA 3GKMA 2LQQA 2L6DA 4QL7A 3K8NA 4PQIA 2GQKA 2AJQB 4POBA 3ZITA 1OC8A 2AB6A 4HJMA 1YEPA 2GQMA 4WEYA 4MZWA 3VURA 4G0KA 2PPTA 4WR5A 5ECOB 4NHWA 4J56E 3QPMA 4J57E 2HRAA 2GT6A 1V40A 2IIYA 1RW1A 2DLXA 2D2ZA 1GSFA 2PVOC 2OBIA 3ZYWA 2TIRA 2E7PA 1XFLA 5G31A 5GSTA 1IYIA 12GSA 22GSA 5DAKA 3FRCA 2XBQA 3C8EA 5CRGA 2N5FA 2GSTA 5B7CA 1J08A 4OO5A 1X5DA 1F37A 1AW9A 2K18A 1R5PA 3TB2A 2YPMA 4Z7XA 5FHIA 1SK1A 5CP1A 4ZB9A 4G10A 4YH2A 3EU3A 5J41A 4K7NA 3MSZA 4TRXA 3N5OA 1GH2A 1W89A 1MDIA 2R3XA 2X99A 2JADA 3VWVA 1R4WA 4FO5A 1GUMA 2GQLA 3HXSA 4PURA 4JR4A 5ECMB 1XCCA 4IBPA 2IFQB 4EDYA 4MJCA 3LEFA 5KEJA 4AGSA 3ME7A 3FW2A 2IMDA 3ERWA 3TKPA 2B7JA 2WGRA 3LWAA 1M2AA 3TJGA 4D73B 1FB6A 1S3CA 3IV4A 2ZCTA 3UOMA 5D9TA 2GGTA 5JWQB 2VCVA 1GUKA 1WIKA 4YQMA 1ZYQB 1B9XC 4I5QA 2JACA 2EC4A 1VF2A 3D6IA 1PGTA 2VOCA 1G6YA 1Q98A 4G9HA 3HCZA 1B48A 4LA1A 2PBJA 1B4QA 2B1LA 3ME8A 1SL1B 2CAQA 3UVTA 1MD4A 3QFBC 1ABAA 1ST9A 2KOKA 4KX4A 3GNJA 3GN3A 2RM6A 4GCIA 2H76A 2XPEA 3FZ4A 4GXZA 1UVZA 3ERGA 3DYRA 1M2BA 4GSSA 1TK5B 1ACVA 2IN3A 4EXJA 1GNEA 2VCZA 2VD0A 4MZCA 2WS2A 4K7OA 1FAAA 5ECSA 2JZTA 3BCIA 4N0VA 4OFMA 3GKXA 2M72A 1T7PB 1NHOA 3D5JA 2AAWA 1G7EA 1PL1A 2H72A 1A2JA 2VL3A 5D96A 1XVQA 4KB3A 3UJ1A 2K8VA 2R6KA 4XS6A 5IQYA 2CQ9A 4F03A 2FA4A 2UZ8A 4DSSB 5DQSA 3F3QA 1WRYA 6GSXA 4AJ6A 1SD9A 6GSWA 3BCKA 4KDXA 1SKSB 5G1LA 1T3BA 2FD3A 4L5OA 4PX1A 4MH3A 2LJRA 3KD0A 4F2IA 4HQZA 2FA8A 1U87A 1G6WA 2WDUA 5CRHA 1G0TA 4NMUA 4EKZA 3DVWA 3BD2A 4KGIA 4BWSA 3A5WA 3PGTA 4ILFA 4MJEA 2R5GA 4OFNA 1BEDA 3KEBA 1E2YA 1ZYEA 2GVPA 4YQVA 3EMPA 3EE2A 4GSNA 3ZMKA 1O8WA 1BAYA 2FWEA 1WWJA 2PU9C 1Q4JA 3A3TA 1V57A 1X0RA 4LMWA 2LRNA 3TJKA 2FY6A 4KCAA 3UBLA 3TJBA 5B8BA 4K8MA 4BVXB 5BMUA 4I2UA 2F51A 3A2XA 2HNLA 1YJ6A 4PNGA 2FWFA 3UMAA 2LUSA 1PX7A 4JZQA 3D21A 2C4JA 2YWOA 5HR3A 1EGOA 3QDNA 3WT1A 1CQGA 1GSEA 3FHKA 1PRXA 3IK7A 2OADA 5IMFA 1PKWA 2ON7A 2YJHA 3Q6OA 1V9WA 4N10A 3O6TA 5A5KA 2WB9A 1VF3A 1K0AA 4F82A 4V2LA 5C04A 5ECHB 5J3RA 3UL3A 13GSA 3WYWA 2HSHA 3J7Yk 4AJ8A 3LXTA 1SKRB 2MBSA 3ZRDA 5JCGA 4YAVA 1XZOA 3GFKA 3L9VA 2YNXA 3KH7A 4IS0A 3APQA 3GIXA 1XWGA 5DQYA 2P5QA 4G2EA 16GSA 4MK3A 5ECKB 2E0QA 3ZVJA 2CA8A 3GYKA 1WP0A 3MNGA 2CVBA 1BQ7A 3ISOA 5EL8A 3EVIA 1NSWA 5G1KA 1THXA 4WR4A 2QGVA 3ZIVA 1N8JA 1CQHA 3WT2A 2VCXA 2HT9A 3PINA 5CRDA 1SL2B 3CTGA 1PQNA 3P7XA 3HVXA 3IA1A 5H5SA 5KN0A 2MBTA 3E9JB 4ZIJA 3CBUA 5IO0A 1Z6NA 4KA0A 1X9MB 1Z3EA 4KUNA 1FHEA 1T1VA 1THOA 3LORA 5H5RA 3FZAA 1EV4A 1TI3A 5DALA 4K0NA 1BYEA 5AN1A 4HU9A 2OBKA 1Z6MA 2NPBA 4F0BA 2BMXA 3QOUA 1FVJA 2YZHA 1TOFA 2GZYA 2FCHA 3D22A 2VCQA 1XBSA 1Z7RA 5ENUA 2YWIA 3HJOA 2RLIA 5IMZA 1X5EA 5FWGA 3V1WA 5IIZA 5J9CA 4O7HA 1GRXA 2IWTA 2K9FA 1FW1A 3ZFLA 1YKAA 3F6DA 3VI5A 2R4VA 2LRTA 4PUAA 4IW9A 5DJLA 3RPNA 2WCIA 4EL1A 4HU7A 2B6MA 3LSZA 4ZBDA 3W8SA 3NZNA 3HDCA 1YF1A 4BA7A 3M3MA 3C1RA 2CZ3A 1XW6A 2L57A 2REMA 1R26A 3FKFA 4RI6A 1SYRA 4EVMA 2GS3A 3IC4A 3GH9A 2XC2A 4MF5A 5E59A 1EGRA 1RK4A 5IOWA 3WD6A 1EWXA 2HRKB 3U5RE 3DEXA 2YP6A 1T4YA 2H0IA 4OMVA 2DJ2A 5IOXA 4HZ4A 1TTZA 3U6VA 5ELAA 2FLSA 1GSYA 4RI7A 2KLXA 1PN9A 4X0XA 3EINA 3RDWA 2MMAA 4EE0A 2HQTA 4GQFA 2MMNA 4NPBA 5B8AA 5F0GA 2DIZA 2DMLA 3CTFA 5DCHA 1XWCA 1A0RP 3L4NA 5F07A 2QC7A 5COHA 4ZBAA 4NAXA 5ID2A 5IM9A 2CAIA 1Z5YE 3I9V2 3KTBA 4KCEA 1ZOFA 5AISA 1ON4A 1ZCPA 1XPVA 1GULA 3GSTA 2HRFA 3GKKA 3KP9A 9GSSA 4MH2A 5D9WA 4JR6A 4HEA2 4TVEA 4HDEA 1O81A 1BX9A 1T4ZA 3W8JA 1GWCA 2A2RA 4N0ZA 1G7OA 1KTEA 1A2MA 4TR3A 3M0FA 1ERVA 1AUCA 3J7Yb 4BL7B 1E6BA 1GSDA 2L5LA 3LXZA 1OC9B 1Z9HA 2DBCA 4ZB8A 2MMZA 5G2ZA 4JU5A 4GLTA 5ECLB 1TRWA 1TU8A 4X43A 5IMVA 2YOIA 2LV3A 4H86A 4YQUA 4ML1A 4GRFA 1LBKA 1EEMA 2M80A 4TR1A 1TRUA 2LKUA 5IMDA 4ECBA 1KBNA 2ALBA 1SJZA 4FYUA 3ZFBA 1K0CA 2BJXA 3F4SA 2OJLA 5DVBA 5ECPB 4GF0A 4BWQA 1XVWA 2V6OA 3TUEA 3CSJA 2WRTA 4QQ7A 2O89A 4PXOA 1S3AA 1XOAA 1YZXA 1ZGNA 3M9KA 3QMXA 3H1NA 2VCTA 2C0DA 3VPQA 1DBYA 2HFDA 2A2SA 2LTKA 5EY6A 1V2AA 4L0WA 3RPPA 1XW5A 3D4MA 4K1FA 5GSSA 4POMA 1J9BA 2AUVA 1JLWA 1QFNA 4TOPA 3ERFA 3TOTA 4DEJA 3F9UA 4ZXGA 5D73A 4PGTA 3MWHA 1GUHA 2JZSA 1WJKA 4LLRA 1K0OA 2I9HA 2OE0A 3I69A 3L9UA 2MYGA 4L0UA 1U6TA 2HRKA 4TXOB 5HR1A 1NHYA 2FGXA 19GSA 2K6VA 1K3YA 2HXKA 1OYJA 3KXOA 3ED3A 3LYPA 2FNOA 3FR6A 4IQ1A 1T00A 1GSQA 2CV4A 1SENA 1JLVA 2LS5A 4NHZA 3C1SA 1PL2A 3IHQA 3CRUA 2C3TA 2WJUA 3NIVA 4ZBBA 10GSA 4TW5A 2H74A 4OWYA 3ZIJA 4ISDA 1O6JA 1VRSD 2L6CA 2HYXA 1EOHA 1J0FA 3TGZA 1ZMAA 4ACSA 5GAND 3GUSA 2N5AA 5HFIA 4TN8A 4O5RA 2ON5A 4MZBA 5JWRB 2HSMB 1VGLA 4XIHA 4USSA 4IP6A 1F2EA 2PVQA 4TR4A 3GMFA 4OD7A 1UA5A 1V98A 2I3YA 3TJFA 5J5NA 5F8BA 3DD3A 2VL2A 3GKNA 4K7IA 4FIWA 2G2QA 4IHUA 2C1YA 4IVFA 1LJRA 1FG4A 4GQCA 4FH8A 4IJ3A 1M0UA 2I4AA 3VPTA 1SJ6A 4K6XA 2VO4A 2V2GA 2B7KA 1JZWA 5HFKA 4ECJA 2E2GA 3CRTA 4POKA 4EDZA 4F9ZA 1DE1A 5A4UA 1K3OA 2LJKA 1TU7A 1X9WB 4MPFA 4KE3A 3GL5A 3UVHA 1XW9A 4BVYB 2VIMA 3LJRA 2VD1A 5D8IA 2YWNA 3DGQA 4KAEA 3KH9A 5ECQB 2AHEA 2IFQA 4HI7A 2C3NA 5D9XA 1XWKA 3LGCA 1XXUA 5CREA 3EYTA 3CYNA 4G19A 1EV9A 4HS1A 4FYCA 1DUGA 4D73A 5HR0A 2HZFA 3QD9A 4MP4A 4I8BA 2GTUA 2F9SA 4WF4A 3H8QA 2L59A 1N2AA 4CHSA 4V2NA 3GX0A 1O7UA 3UBKA 4WKWA 4IN0A 3F3RA 1AQVA 3QR6A 5DCGA 3F6FA 11GSA 2JZRA 2P31A 3PH9A 4ECCA 1FVKA 3IPZA 3KGKA 1NM3A 1A8LA 2CX4A 1QQ2A 1HNBA 2NVLA 2IPAA 4XHMA 3HHVA 3I43A 1TK8B 1WOUA 3EC3A 1GTBA 1GSUA 2CZ2A 3HKRA 3KM6A 4MJAA 5LCZA 2NBSA 4CDOA 4PQ1A 3D0ZA 3A2VA 1AIUA 2OE1A 2GDRA 2H6YA 3IXRA 4LL1B 2F3MA 1FO5A 2PUKC 4K2DA 1SJIA 1ERWA 4TXOA 3EU4A 2F8AA 3F0IA 3DWVA 5GAPD 4G0IA 1PD21 5DAKB 4DSQA 4WF5A 3UAPA 3O3TA 2CT6A 2XHFA 4F0CA 1U3AA 3TKRA 2V32A 4PNFA 1DE2A 3HD5A 3FYGA 2DSAA 1HNAA 1A8YA 4X1UA 2KHPA 3R2QA 2P0GA 5G5EA 2B5XA 1PX6A 4V1Ap 2KP1A 3IAS2 1HD2A 4K9ZA 1QMVA 2YN1A 2WFCA 3HZ4A 1TJDA 1GP1A 3ZTLA 4WXTA 3E3EA 1XWAA 3KP8A 2LRCA 1I5GA 4DSSA 1OVNA 4ULXA 2H19A 1M7TA 3P2AA 2LNSA 2GLRA 4JEDA 5B6MA 5AIVA 2C8UA 4ZL9A 3R3EA 2P5RA 3FY7A 1PMTA 4POLA 2H0GA 3Q18A 1X9SB 1TRVA 4N11A 3CSIA 2VL9A 2YV7A 2EIRA 2GZPA 3VWXA 4MJBA 3HYPA 5ABRA 3JCML 3CXGA 1OKTA 4O92A 2N5BA 1SL0B 1Z7PA 3FR9A 1UN2A 5KN2A 3QAVA 3GTUB 4K0GA 4Q5RA 1MEKA 4OFTA 3CSHA 3KMNA 3ZZXA 4EO3A 2CVKA 5HR2A 1SK2A 3VWUA 3P8WA 3TCOA 2O7KA 2ZUPA 3GHAA 2H66A 2PWJA 2VLTA 3HZ8A 3MDKA 4O32A 4KNDA 2O87A 2GSRA 5EPFA 4I2TA 3PPUA 4IQAA 4BVXA 3LG6A 1W4VA 5HQPA 2B3SA 2H71A 3EWLA 3WGEA 3VK9A 2H6ZA 1QXHA 1SU9A 3SWLA 1OE7A 1TK0B 3H79A 4L5LA 4QL9A 1VF1A 2H75A 18GSA 2C0EA 3F8UA 4LMVA 1PA3A 4P3YB 3KZQA 1AAZA 3QFAC 5D9VA 1UC7A 3VWWA 4ZL7A 2MZCA 2IJYA 2VLVA 3TRXA 1TKDB 4NV5A 3UIWA 3IR4A 3TKSA 2R2JA 2B1KA 1XOBA 2JSZA 1TRSA 2K8SA 4ML6A 5JCWA 1GSSA 1A0FA 3FK8A 7GSSA 2GT5A 2M46A 3TRPA 2VCWA 3HJMA 4TXVA 3D4TA 20GSA 2HSYA 1OKDA 2PMTA 5CRWA 4RQRA 4GSTA 1RQMA 3A2WA 1HQOA 6GSUA 3FEUA 1SD8A 2V41A 1B8XA 3W6GA 5CAXA 1QUWA 2VAFA 1TXXA 2O85A 4MLYA 5C00A 4KH7A 4TR0A 4IJIA 2VL2C 5JWOB 4WBJA 3NOFA 1EP8A 3FR3A 6GSTA 1JZOA 3L0HA 4NWYA 5A4VA 4KSMA 2X64A 3S9FA 3DKSA 3HVVA 3GURA 1I9DA 6GSSA 2TRCP 4RUVA 2DJKA 1B4PA 5LNKe 4PQHA 5J9BA 2OA7A 3H93A 1ZZYA 1OE8A 2H30A 1IYHA 4GTUA 3C71A 3GA4A 2WULA 4HZ2A 3G7IA 3M8NA 3F4RA 2X8CA 2V1MA 3KTLA 1M9AA 2JU5A 2BTOT 4XS4B 3RHBA 2ES7A 1MDJA 3IBHA 1K0BA 6GSVA 4HOJA 5IMAA 1R7HA 4JBBA 3KCMA 3GH6A 2IMKA 3GTUA 3IK9A 2VM2A 2QSIA 5LD0A 5A4WA 3LYKA 2X8GA 4LL4B 2FWHA 2YWMA 2C80A 5ECRB 2LJAA 4DVCA 4KW6A 1WMJA 1F6MC 2YANA 2GSQA 3ZL5A 3L9SA 3KJYA 5AIXA 2DJJA 4XS1A 2FWGA 1C72A 1HNCA 2H01A 2XBIA 5IPGA 3US3A 2H1BA 3VLNA 1SKWB 1MD3A 5JCUA 3KMOA 2YCDA 3C73A 2L4QA 4G0LA 1K0MA 2TRXA 1NW2A 1QK8A 4ZILA 5EVOA 3TDGA 2AV4A 1YKCA 2DMMA 1O73A 4IP1A 4N30A 3UEMA 2FUG2 1KNGA 1QGVA 4MA9A 4HQSA 8GSSA 2EIQA 2JSYA 2O8VB 1TI1A 3F63A 2E2MA 1MDKA 3HVSA 1EZKA 3GX8A 4Q5QA 3G9BA 1TP9A 3O76A 2HLSA 4XRAA 1Y6EA 2YV9A 3MAKA 1A2LA 5F06A 1ERUA 1V58A 3GV1A 5DALB 5KN3A 1T8EB 3GL3A 5F05A 4HJ2A 3E0UA 1PKZA 3ZVJD 4V2MA 1GLPA 4RQXA 4FQUA 5FT3A 5G5FA 1R5AA 14GSA 2EIOA 1ERTA 2AYTA 2CVDA 2R37A 3TJJA 2YZUA 3GSSA 2F8FA 2VM1A 3FZ9A 2B5EA 3VI7A 1XIYA 4OCFA 2IMIA 3BBYA 4KF9A 4BL7A 1WE0A 2L5OA 1OC9A 4OCEA 4Q5FA 2GSSA 2HZEB 2H0HA 1KEBA 5INYA 4I97A 2LSTA 3PR8A 1YDKA 3L78A 3TOUA 2ZNMA 2IMFA 2J9HA 2KP2A 2DIYA 2MMOA 1X5CA 2V6KA 1GTUA 3SBCA 3QCPA 4EC0A 5E4WA 2G0FA 2RUEA 2L4CA 5ELGA 2QKEA 3AY8A 2HI7A 2IMEA 1K3LA 1U3IA 2LQOA 4IKHA 2DJ3A 5DBQA 3QAGA 3M9JA 1FB0A 1AXDA 5IPHA 1SYXA 3TKQA 3HY2A 5D93A 5CNWA 3DXBA 2PERA 1SK0A 1H75A 3H4KA 2FHEA 1YF0A 3IOSA 1OAZA 1BJXA 1MTCA 1AQXA 5CYYA 4PTSA 1Y25A 4XS4A 5ID2B 3WGDA 4KDUA 1VF4A 4WBRD 5IMCA 1K0DA 3IRAA 2Z9SA 1EEJA 2NDOA 3ZREA 3RBTA 1JFUA 1OC3A 1O85A 4JE1A 3ZMLA 1F3BA 4IELA 1U88A 1GNWA 2YJ7A 2NTOA 3M1GA 4L8EA 3CMIA 3DMLA 2J23A 2PGTA 1XWBA 6GSYA 1M2DA 1LU4A 3VFIA 2CX3A 3Q19A 2VLUA 4DSRA 3GRXA 2OACA 3RAZA 1GTIA 1H4OA 4CW9A 4EUYA 1GTAA 1WPIA 3DIEA 4WETA 3TKSC 5GZZB 1K0NA 2B5YA 2H8LA 2X8HA 1GL8A 2HRNA 2H1GA 1TW9A 4JRRA 1F3AA 3BJ5A 1ML6A 3TKSE 1URMA 3F4TA 2A4VA 5J4UA 1HYUA 3UARA 4EF0A 4FYBA 1YEXA 3WGXA 3OR5A 1F9MA 2PN8A 2WZ9A 3BOAA 2H73A 4TR1B 4IGJA 4MDCA 2LNTA 2HE3A 4ECIA 4KSOA 1USBA 4MF6A 4XTSA 4PUFC 3IDVA 3LFLA 1O8XA 3IC8A 4V1Ag 3KIJA 2HSMA 2RUFA 4Q5NA 2XPDA 5IO2A 4GWRA 3DRNA 5H5QA 4OO4A 1M9BA 4AF2A 2H1AA 4HUAA 5KN1A 1M99A 1GLQA 1JZDA 3DVXA 1PSQA 3APSA 2VUPA 2KUCA 3ZLPA 1A24A 4XCSA 2OE3A 1JZRA 1AQWA 2RIIA 1TDIA 4AJ7A 3HA9A 5L71A 17GSA 1B9YC 4MCUA 4KDYA 2HZEA 3TRQA 4TKYA 4ZL8A 2LEGA 3IAM2 5B6NA 5AGYA 3QAWA 5G30A 2GZZA 2IL3A 4J2FA 4MPGA 2HSNB 4BVYA 3EURA 1A23A 3I6AA 2H6XA 2DJ1A 3RHCA 1ZL9A 5DJMA 4MF7A 3FZ5A 4NXIA 1YY7A 1EP7A 5HFGA 4MABA 2H1DA 2OKAA 1BG5A 2RM5A 2I1UA 1YQ1A 5CO3A 3EMXA 1JHBA 4YAPA 5ECNB 3Q74A 3HJPA 3APOA 4BPYA 2JL4A 2DC5A 3P90A 4E8EA 3IE3A 2H70A 1ILOA
chains in the Genus database with same CATH superfamily
5ECIB 4MMMA 4ZB6A 1PFOA 1DSBA 4I6XA 2DKIA 3C7MA 3G7YA 4ID0A 4NV2A 4E8HA 1EOGA 2C0GA 3LQ7A 2DJ0A 1FOVA 4Z2UA 2I81A 4XRDA 2C0FA 3N9JA 1AC1A 5DDLA 1S3DA 3G7JA 2C3QA 3GKMA 2LQQA 2L6DA 4QL7A 3K8NA 4PQIA 2GQKA 2AJQB 4POBA 3ZITA 1OC8A 3TU3B 4HSCX 2AB6A 4HJMA 1YEPA 2GQMA 4WEYA 4MZWA 3VURA 4G0KA 2A4HA 2PPTA 4WR5A 5ECOB 4NHWA 4J56E 3QPMA 4J57E 2HRAA 2GT6A 1V40A 2IIYA 1RW1A 2DLXA 2D2ZA 1GSFA 2PVOC 2OBIA 3ZYWA 2TIRA 2E7PA 1XFLA 5G31A 5GSTA 1IYIA 12GSA 22GSA 5DAKA 3FRCA 2XBQA 3C8EA 5CRGA 2N5FA 2GSTA 5B7CA 1J08A 4OO5A 1X5DA 1F37A 1AW9A 2K18A 1R5PA 1N25A 5A1NA 3TB2A 2YPMA 4Z7XA 5FHIA 1SK1A 5CP1A 4ZB9A 4G10A 4YH2A 3EU3A 5J41A 4K7NA 3MSZA 4TRXA 3N5OA 1GH2A 1W89A 1MDIA 2R3XA 2X99A 2JADA 3VWVA 1R4WA 4FO5A 1GUMA 2GQLA 3HXSA 4PURA 4JR4A 5ECMB 5BMUB 1XCCA 4IBPA 2IFQB 4EDYA 4MJCA 3LEFA 4ZB7A 5KEJA 4AGSA 3ME7A 3FW2A 2IMDA 3ERWA 3TKPA 2B7JA 2WGRA 3LWAA 1M2AA 3TJGA 4D73B 1FB6A 5J40A 1S3CA 3CQFA 3IV4A 2ZCTA 3UOMA 5D9TA 2GGTA 4X4JA 5JWQB 2VCVA 1GUKA 1WIKA 4YQMA 1ZYQB 1B9XC 4I5QA 2JACA 2EC4A 1VF2A 3D6IA 1PGTA 2VOCA 4EIQA 1G6YA 1Q98A 4G9HA 3HCZA 2UV8G 1B48A 4LA1A 2PBJA 1B4QA 2B1LA 3ME8A 1SL1B 2CAQA 3UVTA 1MD4A 3QFBC 1ABAA 2HSNA 1ST9A 2KOKA 4KX4A 3GNJA 3GN3A 2RM6A 4GCIA 2H76A 2XPEA 3FZ4A 4GXZA 1UVZA 3ERGA 3DYRA 1M2BA 4GSSA 1TK5B 1ACVA 2IN3A 4PI2C 4EXJA 1GNEA 2VCZA 2VD0A 4MZCA 2WS2A 5J4YA 4K7OA 1FAAA 5ECSA 2JZTA 3BCIA 4FXYP 4N0VA 4OFMA 3GKXA 2M72A 1T7PB 1NHOA 3D5JA 2AAWA 1G7EA 1PL1A 2H72A 1A2JA 2VL3A 5D96A 1XVQA 4KB3A 3UJ1A 2K8VA 2R6KA 4XS6A 5IQYA 2CQ9A 2A2PA 4F03A 2FA4A 2UZ8A 4DSSB 5DQSA 3F3QA 1WRYA 6GSXA 4AJ6A 1SD9A 6GSWA 3BCKA 4KDXA 1SKSB 5G1LA 1T3BA 2FD3A 4O5UA 4L5OA 4PX1A 4MH3A 2LJRA 3KD0A 4F2IA 4HQZA 2FA8A 1U87A 4EIPA 1G6WA 2WDUA 5CRHA 3CWGA 1G0TA 4NMUA 4EKZA 3DVWA 3RFRC 4BIKA 3BD2A 4KGIA 4BWSA 3A5WA 4Z2TA 3PGTA 4ILFA 4MJEA 2R5GA 4OFNA 1BEDA 3KEBA 1E2YA 1ZYEA 2GVPA 4YQVA 3EMPA 3EE2A 4GSNA 3ZMKA 4N3ZA 1O8WA 1BAYA 2FWEA 1WWJA 2PU9C 1Q4JA 3A3TA 1V57A 1X0RA 4LMWA 2LRNA 2VKZG 3TJKA 2FY6A 4KCAA 3UBLA 3TJBA 5B8BA 5A34B 4K8MA 4BVXB 5BMUA 2F51A 4I2UA 2WW0A 3A2XA 2HNLA 1YJ6A 4PNGA 2FWFA 3UMAA 2LUSA 1PX7A 4JZQA 3D21A 2C4JA 2YWOA 5HR3A 1EGOA 3QDNA 3WT1A 1CQGA 1GSEA 3FHKA 1PRXA 3IK7A 2OADA 5IMFA 1PKWA 2ON7A 2YJHA 3Q6OA 1V9WA 4N10A 4AKHA 2WW3A 3O6TA 5A5KA 2WB9A 1VF3A 1K0AA 4F82A 4V2LA 5C04A 5ECHB 5J3RA 3UL3A 13GSA 3WYWA 2HSHA 3J7Yk 4AJ8A 3LXTA 1SKRB 2MBSA 2WVXB 3ZRDA 5JCGA 4YAVA 1XZOA 3GFKA 3L9VA 2YNXA 3CHXC 3KH7A 4IS0A 3APQA 3GIXA 1XWGA 5DQYA 2P5QA 4G2EA 16GSA 4MK3A 5ECKB 2E0QA 3ZVJA 2CA8A 3GYKA 1Y1UA 1WP0A 3MNGA 2CVBA 4MNNA 1BQ7A 1ZYNA 3ISOA 1BG1A 5EL8A 3EVIA 1NSWA 2WVYA 5G1KA 1THXA 4WR4A 2QGVA 3ZIVA 1N8JA 1CQHA 3WT2A 2VCXA 2HT9A 3PINA 5CRDA 1SL2B 3CTGA 1PQNA 3P7XA 3HVXA 3IA1A 5H5SA 5KN0A 2MBTA 3E9JB 4ZIJA 2H1LA 3CBUA 5IO0A 1SVMA 1Z6NA 4KA0A 1X9MB 1Z3EA 4KUNA 1FHEA 1T1VA 1THOA 3LORA 5H5RA 3FZAA 1EV4A 1TI3A 5DALA 4K0NA 1BYEA 5AN1A 4HU9A 2OBKA 1Z6MA 2NPBA 4F0BA 2BMXA 3QOUA 1FVJA 2YZHA 1TOFA 2GZYA 2FCHA 3D22A 2VCQA 1XBSA 1Z7RA 5ENUA 2YWIA 3HJOA 2RLIA 2WVZA 1X5EA 5IMZA 5FWGA 3V1WA 5IIZA 5J9CA 4O7HA 1GRXA 2IWTA 2K9FA 1FW1A 3ZFLA 1YKAA 3F6DA 3VI5A 2R4VA 2LRTA 4PUAA 4IW9A 5DJLA 3RPNA 2WCIA 4EL1A 3LW9A 2B6MA 4HU7A 3LSZA 4ZBDA 1ZYPA 3W8SA 3NZNA 3HDCA 1YF1A 4BA7A 5J47A 3M3MA 3C1RA 2CZ3A 1XW6A 2L57A 2REMA 1R26A 3FKFA 4RI6A 1SYRA 4EVMA 2GS3A 3IC4A 3GH9A 2XC2A 4MF5A 5E59A 1EGRA 1RK4A 5IOWA 3WD6A 1EWXA 4CY6A 2HRKB 3U5RE 3DEXA 2YP6A 1T4YA 2H0IA 4OMVA 2DJ2A 5IOXA 4HZ4A 1TTZA 3U6VA 5ELAA 2FLSA 1GSYA 4RI7A 2KLXA 1PN9A 4X0XA 3EINA 3RDWA 2MMAA 4EE0A 2HQTA 4GQFA 2MMNA 4NPBA 5B8AA 5F0GA 2DIZA 2DMLA 3CTFA 5DCHA 1XWCA 1A0RP 3L4NA 5F07A 2QC7A 5COHA 4ZBAA 4NAXA 5ID2A 5IM9A 2O5VA 2CAIA 2O36A 1Z5YE 3I9V2 3KTBA 4KCEA 1ZOFA 5AISA 1ON4A 1ZCPA 1XPVA 1GULA 3GSTA 2HRFA 3GKKA 3KP9A 9GSSA 4MH2A 5D9WA 4JR6A 4HEA2 4TVEA 2WVXA 4HDEA 1O81A 1BX9A 1T4ZA 3W8JA 1GWCA 2A2RA 4N0ZA 1G7OA 1KTEA 1A2MA 4TR3A 3M0FA 1ERVA 1AUCA 3J7Yb 4BL7B 1E6BA 1GSDA 2L5LA 3LXZA 1OC9B 1Z9HA 2DBCA 4ZB8A 2MMZA 5G2ZA 4JU5A 4GLTA 5ECLB 1TRWA 1TU8A 4X43A 5IMVA 2YOIA 1YVLA 2LV3A 4H86A 4YQUA 4ML1A 4GRFA 2R0CA 1LBKA 1EEMA 2M80A 4TR1A 1TRUA 2LKUA 5IMDA 4ECBA 1KBNA 2ALBA 1SJZA 4FYUA 3ZFBA 1K0CA 2BJXA 3F4SA 2OJLA 4E68A 5DVBA 5ECPB 4GF0A 4BWQA 1XVWA 2V6OA 3TUEA 3CSJA 2WRTA 4QQ7A 2O89A 4PXOA 4YKGA 1S3AA 1XOAA 1YZXA 1ZGNA 3M9KA 3QMXA 3H1NA 2VCTA 2C0DA 3VPQA 1DBYA 1S3RA 2HFDA 2A2SA 4AI6A 2LTKA 5EY6A 1V2AA 4L0WA 3RPPA 1XW5A 3D4MA 4K1FA 5GSSA 5KOWA 4POMA 1J9BA 2AUVA 1JLWA 1QFNA 4TOPA 3ERFA 3TOTA 4DEJA 3F9UA 4ZXGA 5D73A 4PGTA 2EFCA 3MWHA 1GUHA 2JZSA 1WJKA 1FOHA 4LLRA 1K0OA 2I9HA 2OE0A 3I69A 3L9UA 2MYGA 4L0UA 1U6TA 2HRKA 4TXOB 5HR1A 1NHYA 2FGXA 19GSA 4K5RA 2QA2A 2K6VA 4K5SA 1K3YA 2HXKA 1OYJA 3KXOA 3ED3A 3LYPA 2FNOA 3FR6A 4IQ1A 1T00A 1GSQA 2CV4A 4ICYA 1SENA 4K2XA 1JLVA 2LS5A 4NHZA 3C1SA 1PL2A 3IHQA 3CRUA 2C3TA 2WJUA 3NIVA 4ZBBA 10GSA 4TW5A 3FMWA 2H74A 4OWYA 1M3JA 3ZIJA 4ISDA 1O6JA 1VRSD 2L6CA 2HYXA 1EOHA 1J0FA 3TGZA 1ZMAA 4ACSA 5GAND 3GUSA 2N5AA 4GDFA 1S4BP 5HFIA 4TN8A 4O5RA 2ON5A 4MZBA 5JWRB 2HSMB 1BF5A 1VGLA 4XIHA 4USSA 4IP6A 4PI0C 1F2EA 2PVQA 4TR4A 3GMFA 4OD7A 1UA5A 1V98A 2I3YA 3TJFA 5J5NA 5F8BA 3DD3A 2VL2A 3GKNA 4K7IA 4FIWA 2G2QA 4IHUA 2C1YA 4IVFA 1LJRA 1FG4A 4GQCA 4FH8A 4IJ3A 1M0UA 2I4AA 3VPTA 1SJ6A 4K6XA 2VO4A 2V2GA 2B7KA 1JZWA 5HFKA 4ECJA 2E2GA 3CRTA 4POKA 4EDZA 4F9ZA 1DE1A 5A4UA 1K3OA 2LJKA 1TU7A 1X9WB 4MPFA 4KE3A 3GL5A 3UVHA 1XW9A 3MIXA 4BVYB 2VIMA 3LJRA 2VD1A 5D8IA 2YWNA 3DGQA 4KAEA 3KH9A 5ECQB 2AHEA 2IFQA 4HI7A 2C3NA 5D9XA 1XWKA 3LGCA 1XXUA 5CREA 3EYTA 3CYNA 4G19A 1EV9A 4HS1A 4FYCA 1DUGA 4D73A 5HR0A 2HZFA 3QD9A 4MP4A 4I8BA 2GTUA 2F9SA 4WF4A 1XG8A 3H8QA 2L59A 1N2AA 4CHSA 4V2NA 3GX0A 1O7UA 3UBKA 4WKWA 4IN0A 3F3RA 1AQVA 3QR6A 5DCGA 3F6FA 11GSA 2JZRA 2P31A 3PH9A 4ECCA 1FVKA 3IPZA 3KGKA 1NM3A 1A8LA 2CX4A 1QQ2A 1HNBA 2NVLA 2IPAA 4XHMA 3HHVA 3I43A 5J4VA 1TK8B 1WOUA 3EC3A 1GTBA 1GSUA 2CZ2A 3HKRA 3KM6A 4MJAA 5LCZA 2NBSA 4CDOA 4PQ1A 5A5HB 3D0ZA 3A2VA 1AIUA 2OE1A 2GDRA 2H6YA 3IXRA 4LL1B 2F3MA 4YKFA 1FO5A 2PUKC 4K2DA 1SJIA 1ERWA 4TXOA 3EU4A 2F8AA 3F0IA 3DWVA 5GAPD 4G0IA 1PD21 5DAKB 4DSQA 4WF5A 3UAPA 3O3TA 2CT6A 2XHFA 4F0CA 1U3AA 3TKRA 2V32A 4PNFA 1DE2A 3HD5A 2R0GA 5A1NB 3FYGA 2DSAA 1HNAA 1A8YA 4X1UA 2KHPA 3R2QA 2P0GA 5G5EA 2B5XA 1PX6A 4V1Ap 2KP1A 3IAS2 1HD2A 4K9ZA 1QMVA 2YN1A 2WFCA 3HZ4A 1TJDA 1GP1A 3ZTLA 4WXTA 4QMKA 3E3EA 1XWAA 3KP8A 2LRCA 1I5GA 4DSSA 1OVNA 4ULXA 2H19A 1M7TA 3P2AA 2LNSA 2GLRA 4JEDA 5B6MA 5AIVA 2C8UA 4ZL9A 3R3EA 2P5RA 3FY7A 1PMTA 4POLA 2H0GA 3Q18A 1X9SB 1TRVA 4N11A 3CSIA 2VL9A 2YV7A 2EIRA 2GZPA 3VWXA 4MJBA 3HYPA 5ABRA 3JCML 3CXGA 1OKTA 4O92A 2N5BA 1SL0B 1Z7PA 3FR9A 4O5QA 1UN2A 5KN2A 3QAVA 3GTUB 4K0GA 4Q5RA 1MEKA 4OFTA 3CSHA 3KMNA 3ZZXA 4EO3A 2CVKA 5HR2A 1SK2A 3VWUA 3P8WA 3TCOA 2O7KA 3RGBC 2ZUPA 3GHAA 2H66A 2PWJA 2VLTA 3HZ8A 3MDKA 4O32A 4KNDA 2O87A 2GSRA 5EPFA 4I2TA 3PPUA 4IQAA 5A34A 4BVXA 3LG6A 1W4VA 5HQPA 2B3SA 2H71A 3EWLA 3WGEA 3VK9A 2H6ZA 1QXHA 1SU9A 3SWLA 1OE7A 1TK0B 3H79A 4L5LA 4QL9A 1VF1A 2H75A 18GSA 2C0EA 3F8UA 4LMVA 1PA3A 4P3YB 3KZQA 1AAZA 4Z2RA 3QFAC 5D9VA 1UC7A 3VWWA 4ZL7A 2MZCA 2IJYA 2VLVA 3TRXA 1TKDB 4NV5A 3UIWA 3IR4A 3TKSA 2R2JA 2B1KA 1XOBA 2JSZA 1TRSA 2K8SA 5A5HA 4ML6A 3HMJG 5JCWA 1GSSA 1A0FA 3FK8A 7GSSA 2GT5A 2M46A 3TRPA 2WZSA 2VCWA 3HJMA 4TXVA 3D4TA 5BRTA 20GSA 2HSYA 1OKDA 2PMTA 5CRWA 4RQRA 4GSTA 1RQMA 3A2WA 1HQOA 6GSUA 3FEUA 1SD8A 2V41A 1B8XA 3W6GA 5CAXA 1QUWA 4CY8A 2VAFA 3A5IA 2EFEA 1TXXA 2O85A 4MLYA 5C00A 4KH7A 4TR0A 4IJIA 2VL2C 5JWOB 4WBJA 3NOFA 1EP8A 3FR3A 3MYDA 6GSTA 1JZOA 3L0HA 4NWYA 5A4VA 4KSMA 2X64A 4AKXB 3S9FA 3DKSA 3HVVA 3GURA 1I9DA 6GSSA 2TRCP 4RUVA 2DJKA 1B4PA 5LNKe 4PQHA 5J9BA 2OA7A 3H93A 1ZZYA 1OE8A 2H30A 1IYHA 4GTUA 3C71A 3GA4A 2WULA 4HZ2A 3G7IA 3M8NA 3F4RA 2X8CA 2V1MA 3KTLA 1M9AA 2JU5A 2BTOT 4XS4B 3RHBA 2ES7A 1MDJA 3IBHA 1K0BA 6GSVA 4HOJA 5IMAA 1R7HA 4JBBA 3KCMA 3GH6A 2IMKA 3GTUA 3IK9A 2EFHA 2VM2A 2QSIA 5LD0A 5A4WA 3LYKA 2X8GA 4LL4B 2FWHA 2YWMA 2C80A 5ECRB 2LJAA 4DVCA 4KW6A 1WMJA 1F6MC 2YANA 2GSQA 3ZL5A 3L9SA 3KJYA 5AIXA 2DJJA 4XS1A 2FWGA 1C72A 1HNCA 2H01A 2XBIA 5IPGA 3US3A 2H1BA 3VLNA 1SKWB 1SVOA 1MD3A 5JCUA 3KMOA 2YCDA 3C73A 2L4QA 4G0LA 1M3IA 1K0MA 2TRXA 1NW2A 1QK8A 4ZILA 5EVOA 3TDGA 2AV4A 1YKCA 2DMMA 1O73A 4IP1A 4N30A 3UEMA 2FUG2 2DKHA 1KNGA 1QGVA 4MA9A 4HQSA 8GSSA 2EIQA 2JSYA 2O8VB 1TI1A 3F63A 2E2MA 2WW1A 1MDKA 3HVSA 1EZKA 3GX8A 4Q5QA 3G9BA 1TP9A 3O76A 2HLSA 4XRAA 1Y6EA 2YV9A 3MAKA 1A2LA 5F06A 1ERUA 1V58A 3GV1A 5DALB 5KN3A 1T8EB 3GL3A 5F05A 4HJ2A 3E0UA 1PKZA 3ZVJD 4AKGA 4V2MA 1GLPA 4RQXA 4FQUA 5FT3A 5G5FA 1R5AA 14GSA 2EIOA 1ERTA 2AYTA 2CVDA 2R37A 3TJJA 2YZUA 2X49A 3GSSA 2F8FA 2VM1A 3FZ9A 2B5EA 3VI7A 1XIYA 4OCFA 2IMIA 3BBYA 4KF9A 4BL7A 1WE0A 3IHGA 2L5OA 1OC9A 4OCEA 4Q5FA 2GSSA 2HZEB 2H0HA 1KEBA 5INYA 4I97A 2LSTA 3PR8A 1YDKA 4A5PA 3L78A 3TOUA 2ZNMA 2IMFA 2J9HA 2KP2A 1SVLA 2DIYA 2MMOA 1X5CA 2V6KA 1GTUA 4PHZC 3SBCA 3QCPA 4EC0A 5E4WA 2G0FA 1TXUA 2RUEA 2L4CA 2OT3A 5ELGA 2QKEA 3AY8A 2HI7A 2IMEA 1K3LA 1U3IA 2LQOA 4IKHA 2DJ3A 5DBQA 3QAGA 3M9JA 1FB0A 1AXDA 5IPHA 1SYXA 3TKQA 3HY2A 5D93A 5CNWA 3DXBA 2PERA 1SK0A 1H75A 3H4KA 2FHEA 1YF0A 3IOSA 1OAZA 1I1IP 1YEWC 1BJXA 1MTCA 1AQXA 5CYYA 4PTSA 1Y25A 4XS4A 5ID2B 3WGDA 4KDUA 2O3EA 2X4AA 1VF4A 4WBRD 2EFDA 5IMCA 1K0DA 3IRAA 2Z9SA 1EEJA 2NDOA 3ZREA 3RBTA 1JFUA 1OC3A 1O85A 4JE1A 3ZMLA 1F3BA 4IELA 1U88A 1GNWA 2YJ7A 2NTOA 3M1GA 4L8EA 3CMIA 3DMLA 2J23A 2PGTA 1XWBA 6GSYA 1M2DA 1LU4A 3VFIA 2CX3A 3Q19A 2VLUA 4DSRA 3GRXA 2OACA 3RAZA 1GTIA 1H4OA 4CW9A 4EUYA 1GTAA 1WPIA 3DIEA 4WETA 3TKSC 5GZZB 1K0NA 2B5YA 2H8LA 2X8HA 1GL8A 2HRNA 2H1GA 4AKIA 1TW9A 4JRRA 1F3AA 3BJ5A 4G01A 1ML6A 3TKSE 1URMA 3F4TA 2A4VA 2R0PA 5J4UA 1HYUA 3UARA 4EF0A 4FYBA 1YEXA 3WGXA 3OR5A 5KOXA 1F9MA 2PN8A 2WZ9A 3BOAA 2H73A 4TR1B 4IGJA 1PN0A 4MDCA 2LNTA 2HE3A 4ECIA 4KSOA 1USBA 4MF6A 4XTSA 4PUFC 3IDVA 2WW2A 3LFLA 1O8XA 3IC8A 4V1Ag 3KIJA 2HSMA 2RUFA 4Q5NA 2XPDA 5IO2A 4GWRA 3DRNA 5H5QA 2QA1A 4OO4A 1M9BA 4AF2A 2H1AA 3EPTA 4HUAA 5KN1A 1M99A 1GLQA 1JZDA 3DVXA 1PSQA 3APSA 2VUPA 2KUCA 3ZLPA 1A24A 4XCSA 2OE3A 1JZRA 1AQWA 2RIIA 1TDIA 4AJ7A 3HA9A 5L71A 17GSA 1B9YC 4MCUA 4KDYA 2HZEA 3TRQA 4TKYA 4ZL8A 2LEGA 3IAM2 5B6NA 5AGYA 3QAWA 5G30A 2GZZA 2IL3A 4J2FA 4MPGA 2HSNB 4BVYA 3EURA 1A23A 3I6AA 2H6XA 2DJ1A 3RHCA 1ZL9A 5DJMA 4MF7A 3FZ5A 4NXIA 1YY7A 1EP7A 3HVNA 5HFGA 4MABA 2H1DA 2OKAA 1BG5A 2RM5A 2I1UA 1YQ1A 5CO3A 3EMXA 1JHBA 4YAPA 5ECNB 3Q74A 4W66A 3HJPA 3APOA 4BPYA 2JL4A 2DC5A 3P90A 4E8EA 3IE3A 2H70A 1ILOA
chains in the Genus database with same CATH topology
5ECIB 4MMMA 4ZB6A 1DSBA 4I6XA 2DKIA 3C7MA 3G7YA 4ID0A 4NV2A 4E8HA 1EOGA 2C0GA 3LQ7A 2DJ0A 1FOVA 4Z2UA 2I81A 4XRDA 2C0FA 3N9JA 1AC1A 5DDLA 1S3DA 3G7JA 2C3QA 3GKMA 2LQQA 2L6DA 4QL7A 3K8NA 4PQIA 2GQKA 2AJQB 4POBA 3ZITA 1OC8A 3TU3B 2AB6A 4HJMA 1YEPA 2GQMA 4WEYA 4MZWA 3VURA 4G0KA 2A4HA 2PPTA 4WR5A 5ECOB 4NHWA 4J56E 3QPMA 4J57E 2HRAA 2GT6A 1V40A 2IIYA 1RW1A 2DLXA 2D2ZA 1GSFA 2PVOC 2OBIA 3ZYWA 2TIRA 2E7PA 1XFLA 5G31A 5GSTA 1IYIA 12GSA 22GSA 5DAKA 3FRCA 2XBQA 3C8EA 5CRGA 2N5FA 2GSTA 5B7CA 1J08A 4OO5A 1X5DA 1F37A 1AW9A 2K18A 1R5PA 1N25A 5A1NA 3TB2A 2YPMA 4Z7XA 5FHIA 1SK1A 5CP1A 4ZB9A 4G10A 4YH2A 3EU3A 5J41A 4K7NA 3MSZA 4TRXA 3N5OA 1GH2A 1W89A 1MDIA 2R3XA 2X99A 2JADA 3VWVA 1R4WA 4FO5A 1GUMA 2GQLA 3HXSA 4PURA 4JR4A 5ECMB 5BMUB 1XCCA 4IBPA 2IFQB 4EDYA 4MJCA 3LEFA 4ZB7A 5KEJA 4AGSA 3ME7A 3FW2A 2IMDA 3ERWA 3TKPA 2B7JA 2WGRA 3LWAA 1M2AA 3TJGA 4D73B 1FB6A 5J40A 1S3CA 3IV4A 2ZCTA 3UOMA 5D9TA 2GGTA 4X4JA 5JWQB 2VCVA 1GUKA 1WIKA 4YQMA 1ZYQB 1B9XC 4I5QA 2JACA 2EC4A 1VF2A 3D6IA 1PGTA 2VOCA 4EIQA 1G6YA 1Q98A 4G9HA 3HCZA 2UV8G 1B48A 4LA1A 2PBJA 1B4QA 2B1LA 3ME8A 1SL1B 2CAQA 3UVTA 1MD4A 3QFBC 1ABAA 2HSNA 1ST9A 2KOKA 4KX4A 3GNJA 3GN3A 2RM6A 4GCIA 2H76A 2XPEA 3FZ4A 4GXZA 1UVZA 3ERGA 3DYRA 1M2BA 4GSSA 1TK5B 1ACVA 2IN3A 4EXJA 1GNEA 2VCZA 2VD0A 4MZCA 2WS2A 5J4YA 4K7OA 1FAAA 5ECSA 2JZTA 3BCIA 4N0VA 4OFMA 3GKXA 2M72A 1T7PB 1NHOA 3D5JA 2AAWA 1G7EA 1PL1A 2H72A 1A2JA 2VL3A 5D96A 1XVQA 4KB3A 3UJ1A 2K8VA 2R6KA 4XS6A 5IQYA 2CQ9A 2A2PA 4F03A 2FA4A 2UZ8A 4DSSB 5DQSA 3F3QA 1WRYA 6GSXA 4AJ6A 1SD9A 6GSWA 3BCKA 4KDXA 1SKSB 5G1LA 1T3BA 2FD3A 4O5UA 4L5OA 4PX1A 4MH3A 2LJRA 3KD0A 4F2IA 4HQZA 2FA8A 1U87A 4EIPA 1G6WA 2WDUA 5CRHA 3CWGA 1G0TA 4NMUA 4EKZA 3DVWA 3BD2A 4KGIA 4BWSA 3A5WA 4Z2TA 3PGTA 4ILFA 4MJEA 2R5GA 4OFNA 1BEDA 3KEBA 1E2YA 1ZYEA 2GVPA 4YQVA 3EMPA 3EE2A 4GSNA 3ZMKA 4N3ZA 1O8WA 1BAYA 2FWEA 1WWJA 2PU9C 1Q4JA 3A3TA 1V57A 1X0RA 4LMWA 2LRNA 2VKZG 3TJKA 2FY6A 4KCAA 3UBLA 3TJBA 5B8BA 5A34B 4K8MA 4BVXB 5BMUA 2F51A 4I2UA 3A2XA 2HNLA 1YJ6A 4PNGA 2FWFA 3UMAA 2LUSA 1PX7A 4JZQA 3D21A 2C4JA 2YWOA 5HR3A 1EGOA 3QDNA 3WT1A 1CQGA 1GSEA 3FHKA 1PRXA 3IK7A 2OADA 5IMFA 1PKWA 2ON7A 2YJHA 3Q6OA 1V9WA 4N10A 4AKHA 3O6TA 5A5KA 2WB9A 1VF3A 1K0AA 4F82A 4V2LA 5C04A 5ECHB 5J3RA 3UL3A 13GSA 3WYWA 2HSHA 3J7Yk 4AJ8A 3LXTA 1SKRB 2MBSA 3ZRDA 5JCGA 4YAVA 1XZOA 3GFKA 3L9VA 2YNXA 3KH7A 4IS0A 3APQA 3GIXA 1XWGA 5DQYA 2P5QA 4G2EA 16GSA 4MK3A 5ECKB 2E0QA 3ZVJA 2CA8A 3GYKA 1Y1UA 1WP0A 3MNGA 2CVBA 4MNNA 1BQ7A 1ZYNA 3ISOA 1BG1A 5EL8A 3EVIA 1NSWA 5G1KA 1THXA 4WR4A 2QGVA 3ZIVA 1N8JA 1CQHA 3WT2A 2VCXA 2HT9A 3PINA 5CRDA 1SL2B 3CTGA 1PQNA 3P7XA 3HVXA 3IA1A 5H5SA 5KN0A 2MBTA 3E9JB 4ZIJA 2H1LA 3CBUA 5IO0A 1SVMA 1Z6NA 4KA0A 1X9MB 1Z3EA 4KUNA 1FHEA 1T1VA 1THOA 3LORA 5H5RA 3FZAA 1EV4A 1TI3A 5DALA 4K0NA 1BYEA 5AN1A 4HU9A 2OBKA 1Z6MA 2NPBA 4F0BA 2BMXA 3QOUA 1FVJA 2YZHA 1TOFA 2GZYA 2FCHA 3D22A 2VCQA 1XBSA 1Z7RA 5ENUA 2YWIA 3HJOA 2RLIA 5IMZA 1X5EA 5FWGA 3V1WA 5IIZA 5J9CA 4O7HA 1GRXA 2IWTA 2K9FA 1FW1A 3ZFLA 1YKAA 3F6DA 3VI5A 2R4VA 2LRTA 4PUAA 4IW9A 5DJLA 3RPNA 2WCIA 4EL1A 3LW9A 2B6MA 4HU7A 3LSZA 4ZBDA 1ZYPA 3W8SA 3NZNA 3HDCA 1YF1A 4BA7A 5J47A 3M3MA 3C1RA 2CZ3A 1XW6A 2L57A 2REMA 1R26A 3FKFA 4RI6A 1SYRA 4EVMA 2GS3A 3IC4A 3GH9A 2XC2A 4MF5A 5E59A 1EGRA 1RK4A 5IOWA 3WD6A 1EWXA 4CY6A 2HRKB 3U5RE 3DEXA 2YP6A 1T4YA 2H0IA 4OMVA 2DJ2A 5IOXA 4HZ4A 1TTZA 3U6VA 5ELAA 2FLSA 1GSYA 4RI7A 2KLXA 1PN9A 4X0XA 3EINA 3RDWA 2MMAA 4EE0A 2HQTA 4GQFA 2MMNA 4NPBA 5B8AA 5F0GA 2DIZA 2DMLA 3CTFA 5DCHA 1XWCA 1A0RP 3L4NA 5F07A 2QC7A 5COHA 4ZBAA 4NAXA 5ID2A 5IM9A 2O5VA 2CAIA 1Z5YE 3I9V2 3KTBA 4KCEA 1ZOFA 5AISA 1ON4A 1ZCPA 1XPVA 1GULA 3GSTA 2HRFA 3GKKA 3KP9A 9GSSA 4MH2A 5D9WA 4JR6A 4HEA2 4TVEA 4HDEA 1O81A 1BX9A 1T4ZA 3W8JA 1GWCA 2A2RA 4N0ZA 1G7OA 1KTEA 1A2MA 4TR3A 3M0FA 1ERVA 1AUCA 3J7Yb 4BL7B 1E6BA 1GSDA 2L5LA 3LXZA 1OC9B 1Z9HA 2DBCA 4ZB8A 2MMZA 5G2ZA 4JU5A 4GLTA 5ECLB 1TRWA 1TU8A 4X43A 5IMVA 2YOIA 1YVLA 2LV3A 4H86A 4YQUA 4ML1A 4GRFA 2R0CA 1LBKA 1EEMA 2M80A 4TR1A 1TRUA 2LKUA 5IMDA 4ECBA 1KBNA 2ALBA 1SJZA 4FYUA 3ZFBA 1K0CA 2BJXA 3F4SA 2OJLA 4E68A 5DVBA 5ECPB 4GF0A 4BWQA 1XVWA 2V6OA 3TUEA 3CSJA 2WRTA 4QQ7A 2O89A 4PXOA 4YKGA 1S3AA 1XOAA 1YZXA 1ZGNA 3M9KA 3QMXA 3H1NA 2VCTA 2C0DA 3VPQA 1DBYA 2HFDA 2A2SA 4AI6A 2LTKA 5EY6A 1V2AA 4L0WA 3RPPA 1XW5A 3D4MA 4K1FA 5GSSA 5KOWA 4POMA 1J9BA 2AUVA 1JLWA 1QFNA 4TOPA 3ERFA 3TOTA 4DEJA 3F9UA 4ZXGA 5D73A 4PGTA 2EFCA 3MWHA 1GUHA 2JZSA 1WJKA 1FOHA 4LLRA 1K0OA 2I9HA 2OE0A 3I69A 3L9UA 2MYGA 4L0UA 1U6TA 2HRKA 4TXOB 5HR1A 1NHYA 2FGXA 19GSA 4K5RA 2QA2A 2K6VA 4K5SA 1K3YA 2HXKA 1OYJA 3KXOA 3ED3A 3LYPA 2FNOA 3FR6A 4IQ1A 1T00A 1GSQA 2CV4A 4ICYA 1SENA 4K2XA 1JLVA 2LS5A 4NHZA 3C1SA 1PL2A 3IHQA 3CRUA 2C3TA 2WJUA 3NIVA 4ZBBA 10GSA 4TW5A 3FMWA 2H74A 4OWYA 3ZIJA 4ISDA 1O6JA 1VRSD 2L6CA 2HYXA 1EOHA 1J0FA 3TGZA 1ZMAA 4ACSA 5GAND 3GUSA 2N5AA 4GDFA 5HFIA 4TN8A 4O5RA 2ON5A 4MZBA 5JWRB 2HSMB 1BF5A 1VGLA 4XIHA 4USSA 4IP6A 1F2EA 2PVQA 4TR4A 3GMFA 4OD7A 1UA5A 1V98A 2I3YA 3TJFA 5J5NA 5F8BA 3DD3A 2VL2A 3GKNA 4K7IA 4FIWA 2G2QA 4IHUA 2C1YA 4IVFA 1LJRA 1FG4A 4GQCA 4FH8A 4IJ3A 1M0UA 2I4AA 3VPTA 1SJ6A 4K6XA 2VO4A 2V2GA 2B7KA 1JZWA 5HFKA 4ECJA 2E2GA 3CRTA 4POKA 4EDZA 4F9ZA 1DE1A 5A4UA 1K3OA 2LJKA 1TU7A 1X9WB 4MPFA 4KE3A 3GL5A 3UVHA 1XW9A 3MIXA 4BVYB 2VIMA 3LJRA 2VD1A 5D8IA 2YWNA 3DGQA 4KAEA 3KH9A 5ECQB 2AHEA 2IFQA 4HI7A 2C3NA 5D9XA 1XWKA 3LGCA 1XXUA 5CREA 3EYTA 3CYNA 4G19A 1EV9A 4HS1A 4FYCA 1DUGA 4D73A 5HR0A 2HZFA 3QD9A 4MP4A 4I8BA 2GTUA 2F9SA 4WF4A 3H8QA 2L59A 1N2AA 4CHSA 4V2NA 3GX0A 1O7UA 3UBKA 4WKWA 4IN0A 3F3RA 1AQVA 3QR6A 5DCGA 3F6FA 11GSA 2JZRA 2P31A 3PH9A 4ECCA 1FVKA 3IPZA 3KGKA 1NM3A 1A8LA 2CX4A 1QQ2A 1HNBA 2NVLA 2IPAA 4XHMA 3HHVA 3I43A 5J4VA 1TK8B 1WOUA 3EC3A 1GTBA 1GSUA 2CZ2A 3HKRA 3KM6A 4MJAA 5LCZA 2NBSA 4CDOA 4PQ1A 5A5HB 3D0ZA 3A2VA 1AIUA 2OE1A 2GDRA 2H6YA 3IXRA 4LL1B 2F3MA 4YKFA 1FO5A 2PUKC 4K2DA 1SJIA 1ERWA 4TXOA 3EU4A 2F8AA 3F0IA 3DWVA 5GAPD 4G0IA 1PD21 5DAKB 4DSQA 4WF5A 3UAPA 3O3TA 2CT6A 2XHFA 4F0CA 1U3AA 3TKRA 2V32A 4PNFA 1DE2A 3HD5A 2R0GA 5A1NB 3FYGA 2DSAA 1HNAA 1A8YA 4X1UA 2KHPA 3R2QA 2P0GA 5G5EA 2B5XA 1PX6A 4V1Ap 2KP1A 3IAS2 1HD2A 4K9ZA 1QMVA 2YN1A 2WFCA 3HZ4A 1TJDA 1GP1A 3ZTLA 4WXTA 4QMKA 3E3EA 1XWAA 3KP8A 2LRCA 1I5GA 4DSSA 1OVNA 4ULXA 2H19A 1M7TA 3P2AA 2LNSA 2GLRA 4JEDA 5B6MA 5AIVA 2C8UA 4ZL9A 3R3EA 2P5RA 3FY7A 1PMTA 4POLA 2H0GA 3Q18A 1X9SB 1TRVA 4N11A 3CSIA 2VL9A 2YV7A 2EIRA 2GZPA 3VWXA 4MJBA 3HYPA 5ABRA 3JCML 3CXGA 1OKTA 4O92A 2N5BA 1SL0B 1Z7PA 3FR9A 4O5QA 1UN2A 5KN2A 3QAVA 3GTUB 4K0GA 4Q5RA 1MEKA 4OFTA 3CSHA 3KMNA 3ZZXA 4EO3A 2CVKA 5HR2A 1SK2A 3VWUA 3P8WA 3TCOA 2O7KA 2ZUPA 3GHAA 2H66A 2PWJA 2VLTA 3HZ8A 3MDKA 4O32A 4KNDA 2O87A 2GSRA 5EPFA 4I2TA 3PPUA 4IQAA 5A34A 4BVXA 3LG6A 1W4VA 5HQPA 2B3SA 2H71A 3EWLA 3WGEA 3VK9A 2H6ZA 1QXHA 1SU9A 3SWLA 1OE7A 1TK0B 3H79A 4L5LA 4QL9A 1VF1A 2H75A 18GSA 2C0EA 3F8UA 4LMVA 1PA3A 4P3YB 3KZQA 1AAZA 4Z2RA 3QFAC 5D9VA 1UC7A 3VWWA 4ZL7A 2MZCA 2IJYA 2VLVA 3TRXA 1TKDB 4NV5A 3UIWA 3IR4A 3TKSA 2R2JA 2B1KA 1XOBA 2JSZA 1TRSA 2K8SA 5A5HA 4ML6A 3HMJG 5JCWA 1GSSA 1A0FA 3FK8A 7GSSA 2GT5A 2M46A 3TRPA 2VCWA 3HJMA 4TXVA 3D4TA 5BRTA 20GSA 2HSYA 1OKDA 2PMTA 5CRWA 4RQRA 4GSTA 1RQMA 3A2WA 1HQOA 6GSUA 3FEUA 1SD8A 2V41A 1B8XA 3W6GA 5CAXA 1QUWA 4CY8A 2VAFA 3A5IA 2EFEA 1TXXA 2O85A 4MLYA 5C00A 4KH7A 4TR0A 4IJIA 2VL2C 5JWOB 4WBJA 3NOFA 1EP8A 3FR3A 3MYDA 6GSTA 1JZOA 3L0HA 4NWYA 5A4VA 4KSMA 2X64A 4AKXB 3S9FA 3DKSA 3HVVA 3GURA 1I9DA 6GSSA 2TRCP 4RUVA 2DJKA 1B4PA 5LNKe 4PQHA 5J9BA 2OA7A 3H93A 1ZZYA 1OE8A 2H30A 1IYHA 4GTUA 3C71A 3GA4A 2WULA 4HZ2A 3G7IA 3M8NA 3F4RA 2X8CA 2V1MA 3KTLA 1M9AA 2JU5A 2BTOT 4XS4B 3RHBA 2ES7A 1MDJA 3IBHA 1K0BA 6GSVA 4HOJA 5IMAA 1R7HA 4JBBA 3KCMA 3GH6A 2IMKA 3GTUA 3IK9A 2EFHA 2VM2A 2QSIA 5LD0A 5A4WA 3LYKA 2X8GA 4LL4B 2FWHA 2YWMA 2C80A 5ECRB 2LJAA 4DVCA 4KW6A 1WMJA 1F6MC 2YANA 2GSQA 3ZL5A 3L9SA 3KJYA 5AIXA 2DJJA 4XS1A 2FWGA 1C72A 1HNCA 2H01A 2XBIA 5IPGA 3US3A 2H1BA 3VLNA 1SKWB 1SVOA 1MD3A 5JCUA 3KMOA 2YCDA 3C73A 2L4QA 4G0LA 1K0MA 2TRXA 1NW2A 1QK8A 4ZILA 5EVOA 3TDGA 2AV4A 1YKCA 2DMMA 1O73A 4IP1A 4N30A 3UEMA 2FUG2 2DKHA 1KNGA 1QGVA 4MA9A 4HQSA 8GSSA 2EIQA 2JSYA 2O8VB 1TI1A 3F63A 2E2MA 1MDKA 3HVSA 1EZKA 3GX8A 4Q5QA 3G9BA 1TP9A 3O76A 2HLSA 4XRAA 1Y6EA 2YV9A 3MAKA 1A2LA 5F06A 1ERUA 1V58A 3GV1A 5DALB 5KN3A 1T8EB 3GL3A 5F05A 4HJ2A 3E0UA 1PKZA 3ZVJD 4AKGA 4V2MA 1GLPA 4RQXA 4FQUA 5FT3A 5G5FA 1R5AA 14GSA 2EIOA 1ERTA 2AYTA 2CVDA 2R37A 3TJJA 2YZUA 2X49A 3GSSA 2F8FA 2VM1A 3FZ9A 2B5EA 3VI7A 1XIYA 4OCFA 2IMIA 3BBYA 4KF9A 4BL7A 1WE0A 3IHGA 2L5OA 1OC9A 4OCEA 4Q5FA 2GSSA 2HZEB 2H0HA 1KEBA 5INYA 4I97A 2LSTA 3PR8A 1YDKA 4A5PA 3L78A 3TOUA 2ZNMA 2IMFA 2J9HA 2KP2A 1SVLA 2DIYA 2MMOA 1X5CA 2V6KA 1GTUA 3SBCA 3QCPA 4EC0A 5E4WA 2G0FA 1TXUA 2RUEA 2L4CA 2OT3A 5ELGA 2QKEA 3AY8A 2HI7A 2IMEA 1K3LA 1U3IA 2LQOA 4IKHA 2DJ3A 5DBQA 3QAGA 3M9JA 1FB0A 1AXDA 5IPHA 1SYXA 3TKQA 3HY2A 5D93A 5CNWA 3DXBA 2PERA 1SK0A 1H75A 3H4KA 2FHEA 1YF0A 3IOSA 1OAZA 1BJXA 1MTCA 1AQXA 5CYYA 4PTSA 1Y25A 4XS4A 5ID2B 3WGDA 4KDUA 2X4AA 1VF4A 4WBRD 2EFDA 5IMCA 1K0DA 3IRAA 2Z9SA 1EEJA 2NDOA 3ZREA 3RBTA 1JFUA 1OC3A 1O85A 4JE1A 3ZMLA 1F3BA 4IELA 1U88A 1GNWA 2YJ7A 2NTOA 3M1GA 4L8EA 3CMIA 3DMLA 2J23A 2PGTA 1XWBA 6GSYA 1M2DA 1LU4A 3VFIA 2CX3A 3Q19A 2VLUA 4DSRA 3GRXA 2OACA 3RAZA 1GTIA 1H4OA 4CW9A 4EUYA 1GTAA 1WPIA 3DIEA 4WETA 3TKSC 5GZZB 1K0NA 2B5YA 2H8LA 2X8HA 1GL8A 2HRNA 2H1GA 4AKIA 1TW9A 4JRRA 1F3AA 3BJ5A 4G01A 1ML6A 3TKSE 1URMA 3F4TA 2A4VA 2R0PA 5J4UA 1HYUA 3UARA 4EF0A 4FYBA 1YEXA 3WGXA 3OR5A 5KOXA 1F9MA 2PN8A 2WZ9A 3BOAA 2H73A 4TR1B 4IGJA 1PN0A 4MDCA 2LNTA 2HE3A 4ECIA 4KSOA 1USBA 4MF6A 4XTSA 4PUFC 3IDVA 3LFLA 1O8XA 3IC8A 4V1Ag 3KIJA 2HSMA 2RUFA 4Q5NA 2XPDA 5IO2A 4GWRA 3DRNA 5H5QA 2QA1A 4OO4A 1M9BA 4AF2A 2H1AA 3EPTA 4HUAA 5KN1A 1M99A 1GLQA 1JZDA 3DVXA 1PSQA 3APSA 2VUPA 2KUCA 3ZLPA 1A24A 4XCSA 2OE3A 1JZRA 1AQWA 2RIIA 1TDIA 4AJ7A 3HA9A 5L71A 17GSA 1B9YC 4MCUA 4KDYA 2HZEA 3TRQA 4TKYA 4ZL8A 2LEGA 3IAM2 5B6NA 5AGYA 3QAWA 5G30A 2GZZA 2IL3A 4J2FA 4MPGA 2HSNB 4BVYA 3EURA 1A23A 3I6AA 2H6XA 2DJ1A 3RHCA 1ZL9A 5DJMA 4MF7A 3FZ5A 4NXIA 1YY7A 1EP7A 5HFGA 4MABA 2H1DA 2OKAA 1BG5A 2RM5A 2I1UA 1YQ1A 5CO3A 3EMXA 1JHBA 4YAPA 5ECNB 3Q74A 4W66A 3HJPA 3APOA 4BPYA 2JL4A 2DC5A 3P90A 4E8EA 3IE3A 2H70A 1ILOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECI B;  4MMM A;  4ZB6 A;  1DSB A;  4I6X A;  3C7M A;  3G7Y A;  4ID0 A;  4NV2 A;  4E8H A;  1EOG A;  2C0G A;  3LQ7 A;  2DJ0 A;  1FOV A;  2I81 A;  4XRD A;  2C0F A;  3N9J A;  1AC1 A;  5DDL A;  1S3D A;  3G7J A;  2C3Q A;  3GKM A;  2LQQ A;  2L6D A;  4QL7 A;  3K8N A;  4PQI A;  2GQK A;  2AJQ B;  4POB A;  3ZIT A;  1OC8 A;  2AB6 A;  4HJM A;  1YEP A;  2GQM A;  4WEY A;  4MZW A;  3VUR A;  4G0K A;  2PPT A;  4WR5 A;  5ECO B;  4NHW A;  4J56 E;  3QPM A;  4J57 E;  2HRA A;  2GT6 A;  1V40 A;  2IIY A;  1RW1 A;  2DLX A;  2D2Z A;  1GSF A;  2PVO C;  2OBI A;  3ZYW A;  2TIR A;  2E7P A;  1XFL A;  5G31 A;  5GST A;  1IYI A;  12GS A;  22GS A;  5DAK A;  3FRC A;  2XBQ A;  3C8E A;  5CRG A;  2N5F A;  2GST A;  5B7C A;  1J08 A;  4OO5 A;  1X5D A;  1F37 A;  1AW9 A;  2K18 A;  1R5P A;  3TB2 A;  2YPM A;  4Z7X A;  5FHI A;  1SK1 A;  5CP1 A;  4ZB9 A;  4G10 A;  4YH2 A;  3EU3 A;  5J41 A;  4K7N A;  3MSZ A;  4TRX A;  3N5O A;  1GH2 A;  1W89 A;  1MDI A;  2R3X A;  2X99 A;  2JAD A;  3VWV A;  1R4W A;  4FO5 A;  1GUM A;  2GQL A;  3HXS A;  4PUR A;  4JR4 A;  5ECM B;  1XCC A;  4IBP A;  2IFQ B;  4EDY A;  4MJC A;  3LEF A;  5KEJ A;  4AGS A;  3ME7 A;  3FW2 A;  2IMD A;  3ERW A;  3TKP A;  2B7J A;  2WGR A;  3LWA A;  1M2A A;  3TJG A;  4D73 B;  1FB6 A;  1S3C A;  3IV4 A;  2ZCT A;  3UOM A;  5D9T A;  2GGT A;  5JWQ B;  2VCV A;  1GUK A;  1WIK A;  4YQM A;  1ZYQ B;  1B9X C;  4I5Q A;  2JAC A;  2EC4 A;  1VF2 A;  3D6I A;  1PGT A;  2VOC A;  1G6Y A;  1Q98 A;  4G9H A;  3HCZ A;  1B48 A;  4LA1 A;  2PBJ A;  1B4Q A;  2B1L A;  3ME8 A;  1SL1 B;  2CAQ A;  3UVT A;  1MD4 A;  3QFB C;  1ABA A;  1ST9 A;  2KOK A;  4KX4 A;  3GNJ A;  3GN3 A;  2RM6 A;  4GCI A;  2H76 A;  2XPE A;  3FZ4 A;  4GXZ A;  1UVZ A;  3ERG A;  3DYR A;  1M2B A;  4GSS A;  1TK5 B;  1ACV A;  2IN3 A;  4EXJ A;  1GNE A;  2VCZ A;  2VD0 A;  4MZC A;  2WS2 A;  4K7O A;  1FAA A;  5ECS A;  2JZT A;  3BCI A;  4N0V A;  4OFM A;  3GKX A;  2M72 A;  1T7P B;  1NHO A;  3D5J A;  2AAW A;  1G7E A;  1PL1 A;  2H72 A;  1A2J A;  2VL3 A;  5D96 A;  1XVQ A;  4KB3 A;  3UJ1 A;  2K8V A;  2R6K A;  4XS6 A;  5IQY A;  2CQ9 A;  4F03 A;  2FA4 A;  2UZ8 A;  4DSS B;  5DQS A;  3F3Q A;  1WRY A;  6GSX A;  4AJ6 A;  1SD9 A;  6GSW A;  3BCK A;  4KDX A;  1SKS B;  5G1L A;  1T3B A;  2FD3 A;  4L5O A;  4PX1 A;  4MH3 A;  2LJR A;  3KD0 A;  4F2I A;  4HQZ A;  2FA8 A;  1U87 A;  1G6W A;  2WDU A;  5CRH A;  1G0T A;  4NMU A;  4EKZ A;  3DVW A;  3BD2 A;  4KGI A;  4BWS A;  3A5W A;  3PGT A;  4ILF A;  4MJE A;  2R5G A;  4OFN A;  1BED A;  3KEB A;  1E2Y A;  1ZYE A;  2GVP A;  4YQV A;  3EMP A;  3EE2 A;  4GSN A;  3ZMK A;  1O8W A;  1BAY A;  2FWE A;  1WWJ A;  2PU9 C;  1Q4J A;  3A3T A;  1V57 A;  1X0R A;  4LMW A;  2LRN A;  3TJK A;  2FY6 A;  4KCA A;  3UBL A;  3TJB A;  5B8B A;  4K8M A;  4BVX B;  5BMU A;  4I2U A;  2F51 A;  3A2X A;  2HNL A;  1YJ6 A;  4PNG A;  2FWF A;  3UMA A;  2LUS A;  1PX7 A;  4JZQ A;  3D21 A;  2C4J A;  2YWO A;  5HR3 A;  1EGO A;  3QDN A;  3WT1 A;  1CQG A;  1GSE A;  3FHK A;  1PRX A;  3IK7 A;  2OAD A;  5IMF A;  1PKW A;  2ON7 A;  2YJH A;  3Q6O A;  1V9W A;  4N10 A;  3O6T A;  5A5K A;  2WB9 A;  1VF3 A;  1K0A A;  4F82 A;  4V2L A;  5C04 A;  5ECH B;  5J3R A;  3UL3 A;  13GS A;  3WYW A;  2HSH A;  3J7Y k;  4AJ8 A;  3LXT A;  1SKR B;  2MBS A;  3ZRD A;  5JCG A;  4YAV A;  1XZO A;  3GFK A;  3L9V A;  2YNX A;  3KH7 A;  4IS0 A;  3APQ A;  3GIX A;  1XWG A;  5DQY A;  2P5Q A;  4G2E A;  16GS A;  4MK3 A;  5ECK B;  2E0Q A;  3ZVJ A;  2CA8 A;  3GYK A;  1WP0 A;  3MNG A;  2CVB A;  1BQ7 A;  3ISO A;  5EL8 A;  3EVI A;  1NSW A;  5G1K A;  1THX A;  4WR4 A;  2QGV A;  3ZIV A;  1N8J A;  1CQH A;  3WT2 A;  2VCX A;  2HT9 A;  3PIN A;  5CRD A;  1SL2 B;  3CTG A;  1PQN A;  3P7X A;  3HVX A;  3IA1 A;  5H5S A;  5KN0 A;  2MBT A;  3E9J B;  4ZIJ A;  3CBU A;  5IO0 A;  1Z6N A;  4KA0 A;  1X9M B;  1Z3E A;  4KUN A;  1FHE A;  1T1V A;  1THO A;  3LOR A;  5H5R A;  3FZA A;  1EV4 A;  1TI3 A;  5DAL A;  4K0N A;  1BYE A;  5AN1 A;  4HU9 A;  2OBK A;  1Z6M A;  2NPB A;  4F0B A;  2BMX A;  3QOU A;  1FVJ A;  2YZH A;  1TOF A;  2GZY A;  2FCH A;  3D22 A;  2VCQ A;  1XBS A;  1Z7R A;  5ENU A;  2YWI A;  3HJO A;  2RLI A;  5IMZ A;  1X5E A;  5FWG A;  3V1W A;  5IIZ A;  5J9C A;  4O7H A;  1GRX A;  2IWT A;  2K9F A;  1FW1 A;  3ZFL A;  1YKA A;  3F6D A;  3VI5 A;  2R4V A;  2LRT A;  4PUA A;  4IW9 A;  5DJL A;  3RPN A;  2WCI A;  4EL1 A;  4HU7 A;  2B6M A;  3LSZ A;  4ZBD A;  3W8S A;  3NZN A;  3HDC A;  1YF1 A;  4BA7 A;  3M3M A;  3C1R A;  2CZ3 A;  1XW6 A;  2L57 A;  2REM A;  1R26 A;  3FKF A;  4RI6 A;  1SYR A;  4EVM A;  2GS3 A;  3IC4 A;  3GH9 A;  2XC2 A;  4MF5 A;  5E59 A;  1EGR A;  1RK4 A;  5IOW A;  3WD6 A;  1EWX A;  2HRK B;  3U5R E;  3DEX A;  2YP6 A;  1T4Y A;  2H0I A;  4OMV A;  2DJ2 A;  5IOX A;  4HZ4 A;  1TTZ A;  3U6V A;  5ELA A;  2FLS A;  1GSY A;  4RI7 A;  2KLX A;  1PN9 A;  4X0X A;  3EIN A;  3RDW A;  2MMA A;  4EE0 A;  2HQT A;  4GQF A;  2MMN A;  4NPB A;  5B8A A;  5F0G A;  2DIZ A;  2DML A;  3CTF A;  5DCH A;  1XWC A;  1A0R P;  3L4N A;  5F07 A;  2QC7 A;  5COH A;  4ZBA A;  4NAX A;  5ID2 A;  5IM9 A;  2CAI A;  1Z5Y E;  3I9V 2;  3KTB A;  4KCE A;  1ZOF A;  5AIS A;  1ON4 A;  1ZCP A;  1XPV A;  1GUL A;  3GST A;  2HRF A;  3GKK A;  3KP9 A;  9GSS A;  4MH2 A;  5D9W A;  4JR6 A;  4HEA 2;  4TVE A;  4HDE A;  1O81 A;  1BX9 A;  1T4Z A;  3W8J A;  1GWC A;  2A2R A;  4N0Z A;  1G7O A;  1KTE A;  1A2M A;  4TR3 A;  3M0F A;  1ERV A;  1AUC A;  3J7Y b;  4BL7 B;  1E6B A;  1GSD A;  2L5L A;  3LXZ A;  1OC9 B;  1Z9H A;  2DBC A;  4ZB8 A;  2MMZ A;  5G2Z A;  4JU5 A;  4GLT A;  5ECL B;  1TRW A;  1TU8 A;  4X43 A;  5IMV A;  2YOI A;  2LV3 A;  4H86 A;  4YQU A;  4ML1 A;  4GRF A;  1LBK A;  1EEM A;  2M80 A;  4TR1 A;  1TRU A;  2LKU A;  5IMD A;  4ECB A;  1KBN A;  2ALB A;  1SJZ A;  4FYU A;  3ZFB A;  1K0C A;  2BJX A;  3F4S A;  2OJL A;  5DVB A;  5ECP B;  4GF0 A;  4BWQ A;  1XVW A;  2V6O A;  3TUE A;  3CSJ A;  2WRT A;  4QQ7 A;  2O89 A;  4PXO A;  1S3A A;  1XOA A;  1YZX A;  1ZGN A;  3M9K A;  3QMX A;  3H1N A;  2VCT A;  2C0D A;  3VPQ A;  1DBY A;  2HFD A;  2A2S A;  2LTK A;  5EY6 A;  1V2A A;  4L0W A;  3RPP A;  1XW5 A;  3D4M A;  4K1F A;  5GSS A;  4POM A;  1J9B A;  2AUV A;  1JLW A;  1QFN A;  4TOP A;  3ERF A;  3TOT A;  4DEJ A;  3F9U A;  4ZXG A;  5D73 A;  4PGT A;  3MWH A;  1GUH A;  2JZS A;  1WJK A;  4LLR A;  1K0O A;  2I9H A;  2OE0 A;  3I69 A;  3L9U A;  2MYG A;  4L0U A;  1U6T A;  2HRK A;  4TXO B;  5HR1 A;  1NHY A;  2FGX A;  19GS A;  2K6V A;  1K3Y A;  2HXK A;  1OYJ A;  3KXO A;  3ED3 A;  3LYP A;  2FNO A;  3FR6 A;  4IQ1 A;  1T00 A;  1GSQ A;  2CV4 A;  1SEN A;  1JLV A;  2LS5 A;  4NHZ A;  3C1S A;  1PL2 A;  3IHQ A;  3CRU A;  2C3T A;  2WJU A;  3NIV A;  4ZBB A;  10GS A;  4TW5 A;  2H74 A;  4OWY A;  3ZIJ A;  4ISD A;  1O6J A;  1VRS D;  2L6C A;  2HYX A;  1EOH A;  1J0F A;  3TGZ A;  1ZMA A;  4ACS A;  5GAN D;  3GUS A;  2N5A A;  5HFI A;  4TN8 A;  4O5R A;  2ON5 A;  4MZB A;  5JWR B;  2HSM B;  1VGL A;  4XIH A;  4USS A;  4IP6 A;  1F2E A;  2PVQ A;  4TR4 A;  3GMF A;  4OD7 A;  1UA5 A;  1V98 A;  2I3Y A;  3TJF A;  5J5N A;  5F8B A;  3DD3 A;  2VL2 A;  3GKN A;  4K7I A;  4FIW A;  2G2Q A;  4IHU A;  2C1Y A;  4IVF A;  1LJR A;  1FG4 A;  4GQC A;  4FH8 A;  4IJ3 A;  1M0U A;  2I4A A;  3VPT A;  1SJ6 A;  4K6X A;  2VO4 A;  2V2G A;  2B7K A;  1JZW A;  5HFK A;  4ECJ A;  2E2G A;  3CRT A;  4POK A;  4EDZ A;  4F9Z A;  1DE1 A;  5A4U A;  1K3O A;  2LJK A;  1TU7 A;  1X9W B;  4MPF A;  4KE3 A;  3GL5 A;  3UVH A;  1XW9 A;  4BVY B;  2VIM A;  3LJR A;  2VD1 A;  5D8I A;  2YWN A;  3DGQ A;  4KAE A;  3KH9 A;  5ECQ B;  2AHE A;  2IFQ A;  4HI7 A;  2C3N A;  5D9X A;  1XWK A;  3LGC A;  1XXU A;  5CRE A;  3EYT A;  3CYN A;  4G19 A;  1EV9 A;  4HS1 A;  4FYC A;  1DUG A;  4D73 A;  5HR0 A;  2HZF A;  3QD9 A;  4MP4 A;  4I8B A;  2GTU A;  2F9S A;  4WF4 A;  3H8Q A;  2L59 A;  1N2A A;  4CHS A;  4V2N A;  3GX0 A;  1O7U A;  3UBK A;  4WKW A;  4IN0 A;  3F3R A;  1AQV A;  3QR6 A;  5DCG A;  3F6F A;  11GS A;  2JZR A;  2P31 A;  3PH9 A;  4ECC A;  1FVK A;  3IPZ A;  3KGK A;  1NM3 A;  1A8L A;  2CX4 A;  1QQ2 A;  1HNB A;  2NVL A;  2IPA A;  4XHM A;  3HHV A;  3I43 A;  1TK8 B;  1WOU A;  3EC3 A;  1GTB A;  1GSU A;  2CZ2 A;  3HKR A;  3KM6 A;  4MJA A;  5LCZ A;  2NBS A;  4CDO A;  4PQ1 A;  3D0Z A;  3A2V A;  1AIU A;  2OE1 A;  2GDR A;  2H6Y A;  3IXR A;  4LL1 B;  2F3M A;  1FO5 A;  2PUK C;  4K2D A;  1SJI A;  1ERW A;  4TXO A;  3EU4 A;  2F8A A;  3F0I A;  3DWV A;  5GAP D;  4G0I A;  1PD2 1;  5DAK B;  4DSQ A;  4WF5 A;  3UAP A;  3O3T A;  2CT6 A;  2XHF A;  4F0C A;  1U3A A;  3TKR A;  2V32 A;  4PNF A;  1DE2 A;  3HD5 A;  3FYG A;  2DSA A;  1HNA A;  1A8Y A;  4X1U A;  2KHP A;  3R2Q A;  2P0G A;  5G5E A;  2B5X A;  1PX6 A;  4V1A p;  2KP1 A;  3IAS 2;  1HD2 A;  4K9Z A;  1QMV A;  2YN1 A;  2WFC A;  3HZ4 A;  1TJD A;  1GP1 A;  3ZTL A;  4WXT A;  3E3E A;  1XWA A;  3KP8 A;  2LRC A;  1I5G A;  4DSS A;  1OVN A;  4ULX A;  2H19 A;  1M7T A;  3P2A A;  2LNS A;  2GLR A;  4JED A;  5B6M A;  5AIV A;  2C8U A;  4ZL9 A;  3R3E A;  2P5R A;  3FY7 A;  1PMT A;  4POL A;  2H0G A;  3Q18 A;  1X9S B;  1TRV A;  4N11 A;  3CSI A;  2VL9 A;  2YV7 A;  2EIR A;  2GZP A;  3VWX A;  4MJB A;  3HYP A;  5ABR A;  3JCM L;  3CXG A;  1OKT A;  4O92 A;  2N5B A;  1SL0 B;  1Z7P A;  3FR9 A;  1UN2 A;  5KN2 A;  3QAV A;  3GTU B;  4K0G A;  4Q5R A;  1MEK A;  4OFT A;  3CSH A;  3KMN A;  3ZZX A;  4EO3 A;  2CVK A;  5HR2 A;  1SK2 A;  3VWU A;  3P8W A;  3TCO A;  2O7K A;  2ZUP A;  3GHA A;  2H66 A;  2PWJ A;  2VLT A;  3HZ8 A;  3MDK A;  4O32 A;  4KND A;  2O87 A;  2GSR A;  5EPF A;  4I2T A;  3PPU A;  4IQA A;  4BVX A;  3LG6 A;  1W4V A;  5HQP A;  2B3S A;  2H71 A;  3EWL A;  3WGE A;  3VK9 A;  2H6Z A;  1QXH A;  1SU9 A;  3SWL A;  1OE7 A;  1TK0 B;  3H79 A;  4L5L A;  4QL9 A;  1VF1 A;  2H75 A;  18GS A;  2C0E A;  3F8U A;  4LMV A;  1PA3 A;  4P3Y B;  3KZQ A;  1AAZ A;  3QFA C;  5D9V A;  1UC7 A;  3VWW A;  4ZL7 A;  2MZC A;  2IJY A;  2VLV A;  3TRX A;  1TKD B;  4NV5 A;  3UIW A;  3IR4 A;  3TKS A;  2R2J A;  2B1K A;  1XOB A;  2JSZ A;  1TRS A;  2K8S A;  4ML6 A;  5JCW A;  1GSS A;  1A0F A;  3FK8 A;  7GSS A;  2GT5 A;  2M46 A;  3TRP A;  2VCW A;  3HJM A;  4TXV A;  3D4T A;  20GS A;  2HSY A;  1OKD A;  2PMT A;  5CRW A;  4RQR A;  4GST A;  1RQM A;  3A2W A;  1HQO A;  6GSU A;  3FEU A;  1SD8 A;  2V41 A;  1B8X A;  3W6G A;  5CAX A;  1QUW A;  2VAF A;  1TXX A;  2O85 A;  4MLY A;  5C00 A;  4KH7 A;  4TR0 A;  4IJI A;  2VL2 C;  5JWO B;  4WBJ A;  3NOF A;  1EP8 A;  3FR3 A;  6GST A;  1JZO A;  3L0H A;  4NWY A;  5A4V A;  4KSM A;  2X64 A;  3S9F A;  3DKS A;  3HVV A;  3GUR A;  1I9D A;  6GSS A;  2TRC P;  4RUV A;  2DJK A;  1B4P A;  5LNK e;  4PQH A;  5J9B A;  2OA7 A;  3H93 A;  1ZZY A;  1OE8 A;  2H30 A;  1IYH A;  4GTU A;  3C71 A;  3GA4 A;  2WUL A;  4HZ2 A;  3G7I A;  3M8N A;  3F4R A;  2X8C A;  2V1M A;  3KTL A;  1M9A A;  2JU5 A;  2BTO T;  4XS4 B;  3RHB A;  2ES7 A;  1MDJ A;  3IBH A;  1K0B A;  6GSV A;  4HOJ A;  5IMA A;  1R7H A;  4JBB A;  3KCM A;  3GH6 A;  2IMK A;  3GTU A;  3IK9 A;  2VM2 A;  2QSI A;  5LD0 A;  5A4W A;  3LYK A;  2X8G A;  4LL4 B;  2FWH A;  2YWM A;  2C80 A;  5ECR B;  2LJA A;  4DVC A;  4KW6 A;  1WMJ A;  1F6M C;  2YAN A;  2GSQ A;  3ZL5 A;  3L9S A;  3KJY A;  5AIX A;  2DJJ A;  4XS1 A;  2FWG A;  1C72 A;  1HNC A;  2H01 A;  2XBI A;  5IPG A;  3US3 A;  2H1B A;  3VLN A;  1SKW B;  1MD3 A;  5JCU A;  3KMO A;  2YCD A;  3C73 A;  2L4Q A;  4G0L A;  1K0M A;  2TRX A;  1NW2 A;  1QK8 A;  4ZIL A;  5EVO A;  3TDG A;  2AV4 A;  1YKC A;  2DMM A;  1O73 A;  4IP1 A;  4N30 A;  3UEM A;  2FUG 2;  1KNG A;  1QGV A;  4MA9 A;  4HQS A;  8GSS A;  2EIQ A;  2JSY A;  2O8V B;  1TI1 A;  3F63 A;  2E2M A;  1MDK A;  3HVS A;  1EZK A;  3GX8 A;  4Q5Q A;  3G9B A;  1TP9 A;  3O76 A;  2HLS A;  4XRA A;  1Y6E A;  2YV9 A;  3MAK A;  1A2L A;  5F06 A;  1ERU A;  1V58 A;  3GV1 A;  5DAL B;  5KN3 A;  1T8E B;  3GL3 A;  5F05 A;  4HJ2 A;  3E0U A;  1PKZ A;  3ZVJ D;  4V2M A;  1GLP A;  4RQX A;  4FQU A;  5FT3 A;  5G5F A;  1R5A A;  14GS A;  2EIO A;  1ERT A;  2AYT A;  2CVD A;  2R37 A;  3TJJ A;  2YZU A;  3GSS A;  2F8F A;  2VM1 A;  3FZ9 A;  2B5E A;  3VI7 A;  1XIY A;  4OCF A;  2IMI A;  3BBY A;  4KF9 A;  4BL7 A;  1WE0 A;  2L5O A;  1OC9 A;  4OCE A;  4Q5F A;  2GSS A;  2HZE B;  2H0H A;  1KEB A;  5INY A;  4I97 A;  2LST A;  3PR8 A;  1YDK A;  3L78 A;  3TOU A;  2ZNM A;  2IMF A;  2J9H A;  2KP2 A;  2DIY A;  2MMO A;  1X5C A;  2V6K A;  1GTU A;  3SBC A;  3QCP A;  4EC0 A;  5E4W A;  2G0F A;  2RUE A;  2L4C A;  5ELG A;  2QKE A;  3AY8 A;  2HI7 A;  2IME A;  1K3L A;  1U3I A;  2LQO A;  4IKH A;  2DJ3 A;  5DBQ A;  3QAG A;  3M9J A;  1FB0 A;  1AXD A;  5IPH A;  1SYX A;  3TKQ A;  3HY2 A;  5D93 A;  5CNW A;  3DXB A;  2PER A;  1SK0 A;  1H75 A;  3H4K A;  2FHE A;  1YF0 A;  3IOS A;  1OAZ A;  1BJX A;  1MTC A;  1AQX A;  5CYY A;  4PTS A;  1Y25 A;  4XS4 A;  5ID2 B;  3WGD A;  4KDU A;  1VF4 A;  4WBR D;  5IMC A;  1K0D A;  3IRA A;  2Z9S A;  1EEJ A;  2NDO A;  3ZRE A;  3RBT A;  1JFU A;  1OC3 A;  1O85 A;  4JE1 A;  3ZML A;  1F3B A;  4IEL A;  1U88 A;  1GNW A;  2YJ7 A;  2NTO A;  3M1G A;  4L8E A;  3CMI A;  3DML A;  2J23 A;  2PGT A;  1XWB A;  6GSY A;  1M2D A;  1LU4 A;  3VFI A;  2CX3 A;  3Q19 A;  2VLU A;  4DSR A;  3GRX A;  2OAC A;  3RAZ A;  1GTI A;  1H4O A;  4CW9 A;  4EUY A;  1GTA A;  1WPI A;  3DIE A;  4WET A;  3TKS C;  5GZZ B;  1K0N A;  2B5Y A;  2H8L A;  2X8H A;  1GL8 A;  2HRN A;  2H1G A;  1TW9 A;  4JRR A;  1F3A A;  3BJ5 A;  1ML6 A;  3TKS E;  1URM A;  3F4T A;  2A4V A;  5J4U A;  1HYU A;  3UAR A;  4EF0 A;  4FYB A;  1YEX A;  3WGX A;  3OR5 A;  1F9M A;  2PN8 A;  2WZ9 A;  3BOA A;  2H73 A;  4TR1 B;  4IGJ A;  4MDC A;  2LNT A;  2HE3 A;  4ECI A;  4KSO A;  1USB A;  4MF6 A;  4XTS A;  4PUF C;  3IDV A;  3LFL A;  1O8X A;  3IC8 A;  4V1A g;  3KIJ A;  2HSM A;  2RUF A;  4Q5N A;  2XPD A;  5IO2 A;  4GWR A;  3DRN A;  5H5Q A;  4OO4 A;  1M9B A;  4AF2 A;  2H1A A;  4HUA A;  5KN1 A;  1M99 A;  1GLQ A;  1JZD A;  3DVX A;  1PSQ A;  3APS A;  2VUP A;  2KUC A;  3ZLP A;  1A24 A;  4XCS A;  2OE3 A;  1JZR A;  1AQW A;  2RII A;  1TDI A;  4AJ7 A;  3HA9 A;  5L71 A;  17GS A;  1B9Y C;  4MCU A;  4KDY A;  2HZE A;  3TRQ A;  4TKY A;  4ZL8 A;  2LEG A;  3IAM 2;  5B6N A;  5AGY A;  3QAW A;  5G30 A;  2GZZ A;  2IL3 A;  4J2F A;  4MPG A;  2HSN B;  4BVY A;  3EUR A;  1A23 A;  3I6A A;  2H6X A;  2DJ1 A;  3RHC A;  1ZL9 A;  5DJM A;  4MF7 A;  3FZ5 A;  4NXI A;  1YY7 A;  1EP7 A;  5HFG A;  4MAB A;  2H1D A;  2OKA A;  1BG5 A;  2RM5 A;  2I1U A;  1YQ1 A;  5CO3 A;  3EMX A;  1JHB A;  4YAP A;  5ECN B;  3Q74 A;  3HJP A;  3APO A;  4BPY A;  2JL4 A;  2DC5 A;  3P90 A;  4E8E A;  3IE3 A;  2H70 A;  1ILO A; 
#chains in the Genus database with same CATH topology
 5ECI B;  4MMM A;  4ZB6 A;  1PFO A;  1DSB A;  4I6X A;  2DKI A;  3C7M A;  3G7Y A;  4ID0 A;  4NV2 A;  4E8H A;  1EOG A;  2C0G A;  3LQ7 A;  2DJ0 A;  1FOV A;  4Z2U A;  2I81 A;  4XRD A;  2C0F A;  3N9J A;  1AC1 A;  5DDL A;  1S3D A;  3G7J A;  2C3Q A;  3GKM A;  2LQQ A;  2L6D A;  4QL7 A;  3K8N A;  4PQI A;  2GQK A;  2AJQ B;  4POB A;  3ZIT A;  1OC8 A;  3TU3 B;  4HSC X;  2AB6 A;  4HJM A;  1YEP A;  2GQM A;  4WEY A;  4MZW A;  3VUR A;  4G0K A;  2A4H A;  2PPT A;  4WR5 A;  5ECO B;  4NHW A;  4J56 E;  3QPM A;  4J57 E;  2HRA A;  2GT6 A;  1V40 A;  2IIY A;  1RW1 A;  2DLX A;  2D2Z A;  1GSF A;  2PVO C;  2OBI A;  3ZYW A;  2TIR A;  2E7P A;  1XFL A;  5G31 A;  5GST A;  1IYI A;  12GS A;  22GS A;  5DAK A;  3FRC A;  2XBQ A;  3C8E A;  5CRG A;  2N5F A;  2GST A;  5B7C A;  1J08 A;  4OO5 A;  1X5D A;  1F37 A;  1AW9 A;  2K18 A;  1R5P A;  1N25 A;  5A1N A;  3TB2 A;  2YPM A;  4Z7X A;  5FHI A;  1SK1 A;  5CP1 A;  4ZB9 A;  4G10 A;  4YH2 A;  3EU3 A;  5J41 A;  4K7N A;  3MSZ A;  4TRX A;  3N5O A;  1GH2 A;  1W89 A;  1MDI A;  2R3X A;  2X99 A;  2JAD A;  3VWV A;  1R4W A;  4FO5 A;  1GUM A;  2GQL A;  3HXS A;  4PUR A;  4JR4 A;  5ECM B;  5BMU B;  1XCC A;  4IBP A;  2IFQ B;  4EDY A;  4MJC A;  3LEF A;  4ZB7 A;  5KEJ A;  4AGS A;  3ME7 A;  3FW2 A;  2IMD A;  3ERW A;  3TKP A;  2B7J A;  2WGR A;  3LWA A;  1M2A A;  3TJG A;  4D73 B;  1FB6 A;  5J40 A;  1S3C A;  3CQF A;  3IV4 A;  2ZCT A;  3UOM A;  5D9T A;  2GGT A;  4X4J A;  5JWQ B;  2VCV A;  1GUK A;  1WIK A;  4YQM A;  1ZYQ B;  1B9X C;  4I5Q A;  2JAC A;  2EC4 A;  1VF2 A;  3D6I A;  1PGT A;  2VOC A;  4EIQ A;  1G6Y A;  1Q98 A;  4G9H A;  3HCZ A;  2UV8 G;  1B48 A;  4LA1 A;  2PBJ A;  1B4Q A;  2B1L A;  3ME8 A;  1SL1 B;  2CAQ A;  3UVT A;  1MD4 A;  3QFB C;  1ABA A;  2HSN A;  1ST9 A;  2KOK A;  4KX4 A;  3GNJ A;  3GN3 A;  2RM6 A;  4GCI A;  2H76 A;  2XPE A;  3FZ4 A;  4GXZ A;  1UVZ A;  3ERG A;  3DYR A;  1M2B A;  4GSS A;  1TK5 B;  1ACV A;  2IN3 A;  4PI2 C;  4EXJ A;  1GNE A;  2VCZ A;  2VD0 A;  4MZC A;  2WS2 A;  5J4Y A;  4K7O A;  1FAA A;  5ECS A;  2JZT A;  3BCI A;  4FXY P;  4N0V A;  4OFM A;  3GKX A;  2M72 A;  1T7P B;  1NHO A;  3D5J A;  2AAW A;  1G7E A;  1PL1 A;  2H72 A;  1A2J A;  2VL3 A;  5D96 A;  1XVQ A;  4KB3 A;  3UJ1 A;  2K8V A;  2R6K A;  4XS6 A;  5IQY A;  2CQ9 A;  2A2P A;  4F03 A;  2FA4 A;  2UZ8 A;  4DSS B;  5DQS A;  3F3Q A;  1WRY A;  6GSX A;  4AJ6 A;  1SD9 A;  6GSW A;  3BCK A;  4KDX A;  1SKS B;  5G1L A;  1T3B A;  2FD3 A;  4O5U A;  4L5O A;  4PX1 A;  4MH3 A;  2LJR A;  3KD0 A;  4F2I A;  4HQZ A;  2FA8 A;  1U87 A;  4EIP A;  1G6W A;  2WDU A;  5CRH A;  3CWG A;  1G0T A;  4NMU A;  4EKZ A;  3DVW A;  3RFR C;  4BIK A;  3BD2 A;  4KGI A;  4BWS A;  3A5W A;  4Z2T A;  3PGT A;  4ILF A;  4MJE A;  2R5G A;  4OFN A;  1BED A;  3KEB A;  1E2Y A;  1ZYE A;  2GVP A;  4YQV A;  3EMP A;  3EE2 A;  4GSN A;  3ZMK A;  4N3Z A;  1O8W A;  1BAY A;  2FWE A;  1WWJ A;  2PU9 C;  1Q4J A;  3A3T A;  1V57 A;  1X0R A;  4LMW A;  2LRN A;  2VKZ G;  3TJK A;  2FY6 A;  4KCA A;  3UBL A;  3TJB A;  5B8B A;  5A34 B;  4K8M A;  4BVX B;  5BMU A;  2F51 A;  4I2U A;  2WW0 A;  3A2X A;  2HNL A;  1YJ6 A;  4PNG A;  2FWF A;  3UMA A;  2LUS A;  1PX7 A;  4JZQ A;  3D21 A;  2C4J A;  2YWO A;  5HR3 A;  1EGO A;  3QDN A;  3WT1 A;  1CQG A;  1GSE A;  3FHK A;  1PRX A;  3IK7 A;  2OAD A;  5IMF A;  1PKW A;  2ON7 A;  2YJH A;  3Q6O A;  1V9W A;  4N10 A;  4AKH A;  2WW3 A;  3O6T A;  5A5K A;  2WB9 A;  1VF3 A;  1K0A A;  4F82 A;  4V2L A;  5C04 A;  5ECH B;  5J3R A;  3UL3 A;  13GS A;  3WYW A;  2HSH A;  3J7Y k;  4AJ8 A;  3LXT A;  1SKR B;  2MBS A;  2WVX B;  3ZRD A;  5JCG A;  4YAV A;  1XZO A;  3GFK A;  3L9V A;  2YNX A;  3CHX C;  3KH7 A;  4IS0 A;  3APQ A;  3GIX A;  1XWG A;  5DQY A;  2P5Q A;  4G2E A;  16GS A;  4MK3 A;  5ECK B;  2E0Q A;  3ZVJ A;  2CA8 A;  3GYK A;  1Y1U A;  1WP0 A;  3MNG A;  2CVB A;  4MNN A;  1BQ7 A;  1ZYN A;  3ISO A;  1BG1 A;  5EL8 A;  3EVI A;  1NSW A;  2WVY A;  5G1K A;  1THX A;  4WR4 A;  2QGV A;  3ZIV A;  1N8J A;  1CQH A;  3WT2 A;  2VCX A;  2HT9 A;  3PIN A;  5CRD A;  1SL2 B;  3CTG A;  1PQN A;  3P7X A;  3HVX A;  3IA1 A;  5H5S A;  5KN0 A;  2MBT A;  3E9J B;  4ZIJ A;  2H1L A;  3CBU A;  5IO0 A;  1SVM A;  1Z6N A;  4KA0 A;  1X9M B;  1Z3E A;  4KUN A;  1FHE A;  1T1V A;  1THO A;  3LOR A;  5H5R A;  3FZA A;  1EV4 A;  1TI3 A;  5DAL A;  4K0N A;  1BYE A;  5AN1 A;  4HU9 A;  2OBK A;  1Z6M A;  2NPB A;  4F0B A;  2BMX A;  3QOU A;  1FVJ A;  2YZH A;  1TOF A;  2GZY A;  2FCH A;  3D22 A;  2VCQ A;  1XBS A;  1Z7R A;  5ENU A;  2YWI A;  3HJO A;  2RLI A;  2WVZ A;  1X5E A;  5IMZ A;  5FWG A;  3V1W A;  5IIZ A;  5J9C A;  4O7H A;  1GRX A;  2IWT A;  2K9F A;  1FW1 A;  3ZFL A;  1YKA A;  3F6D A;  3VI5 A;  2R4V A;  2LRT A;  4PUA A;  4IW9 A;  5DJL A;  3RPN A;  2WCI A;  4EL1 A;  3LW9 A;  2B6M A;  4HU7 A;  3LSZ A;  4ZBD A;  1ZYP A;  3W8S A;  3NZN A;  3HDC A;  1YF1 A;  4BA7 A;  5J47 A;  3M3M A;  3C1R A;  2CZ3 A;  1XW6 A;  2L57 A;  2REM A;  1R26 A;  3FKF A;  4RI6 A;  1SYR A;  4EVM A;  2GS3 A;  3IC4 A;  3GH9 A;  2XC2 A;  4MF5 A;  5E59 A;  1EGR A;  1RK4 A;  5IOW A;  3WD6 A;  1EWX A;  4CY6 A;  2HRK B;  3U5R E;  3DEX A;  2YP6 A;  1T4Y A;  2H0I A;  4OMV A;  2DJ2 A;  5IOX A;  4HZ4 A;  1TTZ A;  3U6V A;  5ELA A;  2FLS A;  1GSY A;  4RI7 A;  2KLX A;  1PN9 A;  4X0X A;  3EIN A;  3RDW A;  2MMA A;  4EE0 A;  2HQT A;  4GQF A;  2MMN A;  4NPB A;  5B8A A;  5F0G A;  2DIZ A;  2DML A;  3CTF A;  5DCH A;  1XWC A;  1A0R P;  3L4N A;  5F07 A;  2QC7 A;  5COH A;  4ZBA A;  4NAX A;  5ID2 A;  5IM9 A;  2O5V A;  2CAI A;  2O36 A;  1Z5Y E;  3I9V 2;  3KTB A;  4KCE A;  1ZOF A;  5AIS A;  1ON4 A;  1ZCP A;  1XPV A;  1GUL A;  3GST A;  2HRF A;  3GKK A;  3KP9 A;  9GSS A;  4MH2 A;  5D9W A;  4JR6 A;  4HEA 2;  4TVE A;  2WVX A;  4HDE A;  1O81 A;  1BX9 A;  1T4Z A;  3W8J A;  1GWC A;  2A2R A;  4N0Z A;  1G7O A;  1KTE A;  1A2M A;  4TR3 A;  3M0F A;  1ERV A;  1AUC A;  3J7Y b;  4BL7 B;  1E6B A;  1GSD A;  2L5L A;  3LXZ A;  1OC9 B;  1Z9H A;  2DBC A;  4ZB8 A;  2MMZ A;  5G2Z A;  4JU5 A;  4GLT A;  5ECL B;  1TRW A;  1TU8 A;  4X43 A;  5IMV A;  2YOI A;  1YVL A;  2LV3 A;  4H86 A;  4YQU A;  4ML1 A;  4GRF A;  2R0C A;  1LBK A;  1EEM A;  2M80 A;  4TR1 A;  1TRU A;  2LKU A;  5IMD A;  4ECB A;  1KBN A;  2ALB A;  1SJZ A;  4FYU A;  3ZFB A;  1K0C A;  2BJX A;  3F4S A;  2OJL A;  4E68 A;  5DVB A;  5ECP B;  4GF0 A;  4BWQ A;  1XVW A;  2V6O A;  3TUE A;  3CSJ A;  2WRT A;  4QQ7 A;  2O89 A;  4PXO A;  4YKG A;  1S3A A;  1XOA A;  1YZX A;  1ZGN A;  3M9K A;  3QMX A;  3H1N A;  2VCT A;  2C0D A;  3VPQ A;  1DBY A;  1S3R A;  2HFD A;  2A2S A;  4AI6 A;  2LTK A;  5EY6 A;  1V2A A;  4L0W A;  3RPP A;  1XW5 A;  3D4M A;  4K1F A;  5GSS A;  5KOW A;  4POM A;  1J9B A;  2AUV A;  1JLW A;  1QFN A;  4TOP A;  3ERF A;  3TOT A;  4DEJ A;  3F9U A;  4ZXG A;  5D73 A;  4PGT A;  2EFC A;  3MWH A;  1GUH A;  2JZS A;  1WJK A;  1FOH A;  4LLR A;  1K0O A;  2I9H A;  2OE0 A;  3I69 A;  3L9U A;  2MYG A;  4L0U A;  1U6T A;  2HRK A;  4TXO B;  5HR1 A;  1NHY A;  2FGX A;  19GS A;  4K5R A;  2QA2 A;  2K6V A;  4K5S A;  1K3Y A;  2HXK A;  1OYJ A;  3KXO A;  3ED3 A;  3LYP A;  2FNO A;  3FR6 A;  4IQ1 A;  1T00 A;  1GSQ A;  2CV4 A;  4ICY A;  1SEN A;  4K2X A;  1JLV A;  2LS5 A;  4NHZ A;  3C1S A;  1PL2 A;  3IHQ A;  3CRU A;  2C3T A;  2WJU A;  3NIV A;  4ZBB A;  10GS A;  4TW5 A;  3FMW A;  2H74 A;  4OWY A;  1M3J A;  3ZIJ A;  4ISD A;  1O6J A;  1VRS D;  2L6C A;  2HYX A;  1EOH A;  1J0F A;  3TGZ A;  1ZMA A;  4ACS A;  5GAN D;  3GUS A;  2N5A A;  4GDF A;  1S4B P;  5HFI A;  4TN8 A;  4O5R A;  2ON5 A;  4MZB A;  5JWR B;  2HSM B;  1BF5 A;  1VGL A;  4XIH A;  4USS A;  4IP6 A;  4PI0 C;  1F2E A;  2PVQ A;  4TR4 A;  3GMF A;  4OD7 A;  1UA5 A;  1V98 A;  2I3Y A;  3TJF A;  5J5N A;  5F8B A;  3DD3 A;  2VL2 A;  3GKN A;  4K7I A;  4FIW A;  2G2Q A;  4IHU A;  2C1Y A;  4IVF A;  1LJR A;  1FG4 A;  4GQC A;  4FH8 A;  4IJ3 A;  1M0U A;  2I4A A;  3VPT A;  1SJ6 A;  4K6X A;  2VO4 A;  2V2G A;  2B7K A;  1JZW A;  5HFK A;  4ECJ A;  2E2G A;  3CRT A;  4POK A;  4EDZ A;  4F9Z A;  1DE1 A;  5A4U A;  1K3O A;  2LJK A;  1TU7 A;  1X9W B;  4MPF A;  4KE3 A;  3GL5 A;  3UVH A;  1XW9 A;  3MIX A;  4BVY B;  2VIM A;  3LJR A;  2VD1 A;  5D8I A;  2YWN A;  3DGQ A;  4KAE A;  3KH9 A;  5ECQ B;  2AHE A;  2IFQ A;  4HI7 A;  2C3N A;  5D9X A;  1XWK A;  3LGC A;  1XXU A;  5CRE A;  3EYT A;  3CYN A;  4G19 A;  1EV9 A;  4HS1 A;  4FYC A;  1DUG A;  4D73 A;  5HR0 A;  2HZF A;  3QD9 A;  4MP4 A;  4I8B A;  2GTU A;  2F9S A;  4WF4 A;  1XG8 A;  3H8Q A;  2L59 A;  1N2A A;  4CHS A;  4V2N A;  3GX0 A;  1O7U A;  3UBK A;  4WKW A;  4IN0 A;  3F3R A;  1AQV A;  3QR6 A;  5DCG A;  3F6F A;  11GS A;  2JZR A;  2P31 A;  3PH9 A;  4ECC A;  1FVK A;  3IPZ A;  3KGK A;  1NM3 A;  1A8L A;  2CX4 A;  1QQ2 A;  1HNB A;  2NVL A;  2IPA A;  4XHM A;  3HHV A;  3I43 A;  5J4V A;  1TK8 B;  1WOU A;  3EC3 A;  1GTB A;  1GSU A;  2CZ2 A;  3HKR A;  3KM6 A;  4MJA A;  5LCZ A;  2NBS A;  4CDO A;  4PQ1 A;  5A5H B;  3D0Z A;  3A2V A;  1AIU A;  2OE1 A;  2GDR A;  2H6Y A;  3IXR A;  4LL1 B;  2F3M A;  4YKF A;  1FO5 A;  2PUK C;  4K2D A;  1SJI A;  1ERW A;  4TXO A;  3EU4 A;  2F8A A;  3F0I A;  3DWV A;  5GAP D;  4G0I A;  1PD2 1;  5DAK B;  4DSQ A;  4WF5 A;  3UAP A;  3O3T A;  2CT6 A;  2XHF A;  4F0C A;  1U3A A;  3TKR A;  2V32 A;  4PNF A;  1DE2 A;  3HD5 A;  2R0G A;  5A1N B;  3FYG A;  2DSA A;  1HNA A;  1A8Y A;  4X1U A;  2KHP A;  3R2Q A;  2P0G A;  5G5E A;  2B5X A;  1PX6 A;  4V1A p;  2KP1 A;  3IAS 2;  1HD2 A;  4K9Z A;  1QMV A;  2YN1 A;  2WFC A;  3HZ4 A;  1TJD A;  1GP1 A;  3ZTL A;  4WXT A;  4QMK A;  3E3E A;  1XWA A;  3KP8 A;  2LRC A;  1I5G A;  4DSS A;  1OVN A;  4ULX A;  2H19 A;  1M7T A;  3P2A A;  2LNS A;  2GLR A;  4JED A;  5B6M A;  5AIV A;  2C8U A;  4ZL9 A;  3R3E A;  2P5R A;  3FY7 A;  1PMT A;  4POL A;  2H0G A;  3Q18 A;  1X9S B;  1TRV A;  4N11 A;  3CSI A;  2VL9 A;  2YV7 A;  2EIR A;  2GZP A;  3VWX A;  4MJB A;  3HYP A;  5ABR A;  3JCM L;  3CXG A;  1OKT A;  4O92 A;  2N5B A;  1SL0 B;  1Z7P A;  3FR9 A;  4O5Q A;  1UN2 A;  5KN2 A;  3QAV A;  3GTU B;  4K0G A;  4Q5R A;  1MEK A;  4OFT A;  3CSH A;  3KMN A;  3ZZX A;  4EO3 A;  2CVK A;  5HR2 A;  1SK2 A;  3VWU A;  3P8W A;  3TCO A;  2O7K A;  3RGB C;  2ZUP A;  3GHA A;  2H66 A;  2PWJ A;  2VLT A;  3HZ8 A;  3MDK A;  4O32 A;  4KND A;  2O87 A;  2GSR A;  5EPF A;  4I2T A;  3PPU A;  4IQA A;  5A34 A;  4BVX A;  3LG6 A;  1W4V A;  5HQP A;  2B3S A;  2H71 A;  3EWL A;  3WGE A;  3VK9 A;  2H6Z A;  1QXH A;  1SU9 A;  3SWL A;  1OE7 A;  1TK0 B;  3H79 A;  4L5L A;  4QL9 A;  1VF1 A;  2H75 A;  18GS A;  2C0E A;  3F8U A;  4LMV A;  1PA3 A;  4P3Y B;  3KZQ A;  1AAZ A;  4Z2R A;  3QFA C;  5D9V A;  1UC7 A;  3VWW A;  4ZL7 A;  2MZC A;  2IJY A;  2VLV A;  3TRX A;  1TKD B;  4NV5 A;  3UIW A;  3IR4 A;  3TKS A;  2R2J A;  2B1K A;  1XOB A;  2JSZ A;  1TRS A;  2K8S A;  5A5H A;  4ML6 A;  3HMJ G;  5JCW A;  1GSS A;  1A0F A;  3FK8 A;  7GSS A;  2GT5 A;  2M46 A;  3TRP A;  2WZS A;  2VCW A;  3HJM A;  4TXV A;  3D4T A;  5BRT A;  20GS A;  2HSY A;  1OKD A;  2PMT A;  5CRW A;  4RQR A;  4GST A;  1RQM A;  3A2W A;  1HQO A;  6GSU A;  3FEU A;  1SD8 A;  2V41 A;  1B8X A;  3W6G A;  5CAX A;  1QUW A;  4CY8 A;  2VAF A;  3A5I A;  2EFE A;  1TXX A;  2O85 A;  4MLY A;  5C00 A;  4KH7 A;  4TR0 A;  4IJI A;  2VL2 C;  5JWO B;  4WBJ A;  3NOF A;  1EP8 A;  3FR3 A;  3MYD A;  6GST A;  1JZO A;  3L0H A;  4NWY A;  5A4V A;  4KSM A;  2X64 A;  4AKX B;  3S9F A;  3DKS A;  3HVV A;  3GUR A;  1I9D A;  6GSS A;  2TRC P;  4RUV A;  2DJK A;  1B4P A;  5LNK e;  4PQH A;  5J9B A;  2OA7 A;  3H93 A;  1ZZY A;  1OE8 A;  2H30 A;  1IYH A;  4GTU A;  3C71 A;  3GA4 A;  2WUL A;  4HZ2 A;  3G7I A;  3M8N A;  3F4R A;  2X8C A;  2V1M A;  3KTL A;  1M9A A;  2JU5 A;  2BTO T;  4XS4 B;  3RHB A;  2ES7 A;  1MDJ A;  3IBH A;  1K0B A;  6GSV A;  4HOJ A;  5IMA A;  1R7H A;  4JBB A;  3KCM A;  3GH6 A;  2IMK A;  3GTU A;  3IK9 A;  2EFH A;  2VM2 A;  2QSI A;  5LD0 A;  5A4W A;  3LYK A;  2X8G A;  4LL4 B;  2FWH A;  2YWM A;  2C80 A;  5ECR B;  2LJA A;  4DVC A;  4KW6 A;  1WMJ A;  1F6M C;  2YAN A;  2GSQ A;  3ZL5 A;  3L9S A;  3KJY A;  5AIX A;  2DJJ A;  4XS1 A;  2FWG A;  1C72 A;  1HNC A;  2H01 A;  2XBI A;  5IPG A;  3US3 A;  2H1B A;  3VLN A;  1SKW B;  1SVO A;  1MD3 A;  5JCU A;  3KMO A;  2YCD A;  3C73 A;  2L4Q A;  4G0L A;  1M3I A;  1K0M A;  2TRX A;  1NW2 A;  1QK8 A;  4ZIL A;  5EVO A;  3TDG A;  2AV4 A;  1YKC A;  2DMM A;  1O73 A;  4IP1 A;  4N30 A;  3UEM A;  2FUG 2;  2DKH A;  1KNG A;  1QGV A;  4MA9 A;  4HQS A;  8GSS A;  2EIQ A;  2JSY A;  2O8V B;  1TI1 A;  3F63 A;  2E2M A;  2WW1 A;  1MDK A;  3HVS A;  1EZK A;  3GX8 A;  4Q5Q A;  3G9B A;  1TP9 A;  3O76 A;  2HLS A;  4XRA A;  1Y6E A;  2YV9 A;  3MAK A;  1A2L A;  5F06 A;  1ERU A;  1V58 A;  3GV1 A;  5DAL B;  5KN3 A;  1T8E B;  3GL3 A;  5F05 A;  4HJ2 A;  3E0U A;  1PKZ A;  3ZVJ D;  4AKG A;  4V2M A;  1GLP A;  4RQX A;  4FQU A;  5FT3 A;  5G5F A;  1R5A A;  14GS A;  2EIO A;  1ERT A;  2AYT A;  2CVD A;  2R37 A;  3TJJ A;  2YZU A;  2X49 A;  3GSS A;  2F8F A;  2VM1 A;  3FZ9 A;  2B5E A;  3VI7 A;  1XIY A;  4OCF A;  2IMI A;  3BBY A;  4KF9 A;  4BL7 A;  1WE0 A;  3IHG A;  2L5O A;  1OC9 A;  4OCE A;  4Q5F A;  2GSS A;  2HZE B;  2H0H A;  1KEB A;  5INY A;  4I97 A;  2LST A;  3PR8 A;  1YDK A;  4A5P A;  3L78 A;  3TOU A;  2ZNM A;  2IMF A;  2J9H A;  2KP2 A;  1SVL A;  2DIY A;  2MMO A;  1X5C A;  2V6K A;  1GTU A;  4PHZ C;  3SBC A;  3QCP A;  4EC0 A;  5E4W A;  2G0F A;  1TXU A;  2RUE A;  2L4C A;  2OT3 A;  5ELG A;  2QKE A;  3AY8 A;  2HI7 A;  2IME A;  1K3L A;  1U3I A;  2LQO A;  4IKH A;  2DJ3 A;  5DBQ A;  3QAG A;  3M9J A;  1FB0 A;  1AXD A;  5IPH A;  1SYX A;  3TKQ A;  3HY2 A;  5D93 A;  5CNW A;  3DXB A;  2PER A;  1SK0 A;  1H75 A;  3H4K A;  2FHE A;  1YF0 A;  3IOS A;  1OAZ A;  1I1I P;  1YEW C;  1BJX A;  1MTC A;  1AQX A;  5CYY A;  4PTS A;  1Y25 A;  4XS4 A;  5ID2 B;  3WGD A;  4KDU A;  2O3E A;  2X4A A;  1VF4 A;  4WBR D;  2EFD A;  5IMC A;  1K0D A;  3IRA A;  2Z9S A;  1EEJ A;  2NDO A;  3ZRE A;  3RBT A;  1JFU A;  1OC3 A;  1O85 A;  4JE1 A;  3ZML A;  1F3B A;  4IEL A;  1U88 A;  1GNW A;  2YJ7 A;  2NTO A;  3M1G A;  4L8E A;  3CMI A;  3DML A;  2J23 A;  2PGT A;  1XWB A;  6GSY A;  1M2D A;  1LU4 A;  3VFI A;  2CX3 A;  3Q19 A;  2VLU A;  4DSR A;  3GRX A;  2OAC A;  3RAZ A;  1GTI A;  1H4O A;  4CW9 A;  4EUY A;  1GTA A;  1WPI A;  3DIE A;  4WET A;  3TKS C;  5GZZ B;  1K0N A;  2B5Y A;  2H8L A;  2X8H A;  1GL8 A;  2HRN A;  2H1G A;  4AKI A;  1TW9 A;  4JRR A;  1F3A A;  3BJ5 A;  4G01 A;  1ML6 A;  3TKS E;  1URM A;  3F4T A;  2A4V A;  2R0P A;  5J4U A;  1HYU A;  3UAR A;  4EF0 A;  4FYB A;  1YEX A;  3WGX A;  3OR5 A;  5KOX A;  1F9M A;  2PN8 A;  2WZ9 A;  3BOA A;  2H73 A;  4TR1 B;  4IGJ A;  1PN0 A;  4MDC A;  2LNT A;  2HE3 A;  4ECI A;  4KSO A;  1USB A;  4MF6 A;  4XTS A;  4PUF C;  3IDV A;  2WW2 A;  3LFL A;  1O8X A;  3IC8 A;  4V1A g;  3KIJ A;  2HSM A;  2RUF A;  4Q5N A;  2XPD A;  5IO2 A;  4GWR A;  3DRN A;  5H5Q A;  2QA1 A;  4OO4 A;  1M9B A;  4AF2 A;  2H1A A;  3EPT A;  4HUA A;  5KN1 A;  1M99 A;  1GLQ A;  1JZD A;  3DVX A;  1PSQ A;  3APS A;  2VUP A;  2KUC A;  3ZLP A;  1A24 A;  4XCS A;  2OE3 A;  1JZR A;  1AQW A;  2RII A;  1TDI A;  4AJ7 A;  3HA9 A;  5L71 A;  17GS A;  1B9Y C;  4MCU A;  4KDY A;  2HZE A;  3TRQ A;  4TKY A;  4ZL8 A;  2LEG A;  3IAM 2;  5B6N A;  5AGY A;  3QAW A;  5G30 A;  2GZZ A;  2IL3 A;  4J2F A;  4MPG A;  2HSN B;  4BVY A;  3EUR A;  1A23 A;  3I6A A;  2H6X A;  2DJ1 A;  3RHC A;  1ZL9 A;  5DJM A;  4MF7 A;  3FZ5 A;  4NXI A;  1YY7 A;  1EP7 A;  3HVN A;  5HFG A;  4MAB A;  2H1D A;  2OKA A;  1BG5 A;  2RM5 A;  2I1U A;  1YQ1 A;  5CO3 A;  3EMX A;  1JHB A;  4YAP A;  5ECN B;  3Q74 A;  4W66 A;  3HJP A;  3APO A;  4BPY A;  2JL4 A;  2DC5 A;  3P90 A;  4E8E A;  3IE3 A;  2H70 A;  1ILO A; 
#chains in the Genus database with same CATH homology
 5ECI B;  4MMM A;  4ZB6 A;  1DSB A;  4I6X A;  2DKI A;  3C7M A;  3G7Y A;  4ID0 A;  4NV2 A;  4E8H A;  1EOG A;  2C0G A;  3LQ7 A;  2DJ0 A;  1FOV A;  4Z2U A;  2I81 A;  4XRD A;  2C0F A;  3N9J A;  1AC1 A;  5DDL A;  1S3D A;  3G7J A;  2C3Q A;  3GKM A;  2LQQ A;  2L6D A;  4QL7 A;  3K8N A;  4PQI A;  2GQK A;  2AJQ B;  4POB A;  3ZIT A;  1OC8 A;  3TU3 B;  2AB6 A;  4HJM A;  1YEP A;  2GQM A;  4WEY A;  4MZW A;  3VUR A;  4G0K A;  2A4H A;  2PPT A;  4WR5 A;  5ECO B;  4NHW A;  4J56 E;  3QPM A;  4J57 E;  2HRA A;  2GT6 A;  1V40 A;  2IIY A;  1RW1 A;  2DLX A;  2D2Z A;  1GSF A;  2PVO C;  2OBI A;  3ZYW A;  2TIR A;  2E7P A;  1XFL A;  5G31 A;  5GST A;  1IYI A;  12GS A;  22GS A;  5DAK A;  3FRC A;  2XBQ A;  3C8E A;  5CRG A;  2N5F A;  2GST A;  5B7C A;  1J08 A;  4OO5 A;  1X5D A;  1F37 A;  1AW9 A;  2K18 A;  1R5P A;  1N25 A;  5A1N A;  3TB2 A;  2YPM A;  4Z7X A;  5FHI A;  1SK1 A;  5CP1 A;  4ZB9 A;  4G10 A;  4YH2 A;  3EU3 A;  5J41 A;  4K7N A;  3MSZ A;  4TRX A;  3N5O A;  1GH2 A;  1W89 A;  1MDI A;  2R3X A;  2X99 A;  2JAD A;  3VWV A;  1R4W A;  4FO5 A;  1GUM A;  2GQL A;  3HXS A;  4PUR A;  4JR4 A;  5ECM B;  5BMU B;  1XCC A;  4IBP A;  2IFQ B;  4EDY A;  4MJC A;  3LEF A;  4ZB7 A;  5KEJ A;  4AGS A;  3ME7 A;  3FW2 A;  2IMD A;  3ERW A;  3TKP A;  2B7J A;  2WGR A;  3LWA A;  1M2A A;  3TJG A;  4D73 B;  1FB6 A;  5J40 A;  1S3C A;  3IV4 A;  2ZCT A;  3UOM A;  5D9T A;  2GGT A;  4X4J A;  5JWQ B;  2VCV A;  1GUK A;  1WIK A;  4YQM A;  1ZYQ B;  1B9X C;  4I5Q A;  2JAC A;  2EC4 A;  1VF2 A;  3D6I A;  1PGT A;  2VOC A;  4EIQ A;  1G6Y A;  1Q98 A;  4G9H A;  3HCZ A;  2UV8 G;  1B48 A;  4LA1 A;  2PBJ A;  1B4Q A;  2B1L A;  3ME8 A;  1SL1 B;  2CAQ A;  3UVT A;  1MD4 A;  3QFB C;  1ABA A;  2HSN A;  1ST9 A;  2KOK A;  4KX4 A;  3GNJ A;  3GN3 A;  2RM6 A;  4GCI A;  2H76 A;  2XPE A;  3FZ4 A;  4GXZ A;  1UVZ A;  3ERG A;  3DYR A;  1M2B A;  4GSS A;  1TK5 B;  1ACV A;  2IN3 A;  4EXJ A;  1GNE A;  2VCZ A;  2VD0 A;  4MZC A;  2WS2 A;  5J4Y A;  4K7O A;  1FAA A;  5ECS A;  2JZT A;  3BCI A;  4N0V A;  4OFM A;  3GKX A;  2M72 A;  1T7P B;  1NHO A;  3D5J A;  2AAW A;  1G7E A;  1PL1 A;  2H72 A;  1A2J A;  2VL3 A;  5D96 A;  1XVQ A;  4KB3 A;  3UJ1 A;  2K8V A;  2R6K A;  4XS6 A;  5IQY A;  2CQ9 A;  2A2P A;  4F03 A;  2FA4 A;  2UZ8 A;  4DSS B;  5DQS A;  3F3Q A;  1WRY A;  6GSX A;  4AJ6 A;  1SD9 A;  6GSW A;  3BCK A;  4KDX A;  1SKS B;  5G1L A;  1T3B A;  2FD3 A;  4O5U A;  4L5O A;  4PX1 A;  4MH3 A;  2LJR A;  3KD0 A;  4F2I A;  4HQZ A;  2FA8 A;  1U87 A;  4EIP A;  1G6W A;  2WDU A;  5CRH A;  3CWG A;  1G0T A;  4NMU A;  4EKZ A;  3DVW A;  3BD2 A;  4KGI A;  4BWS A;  3A5W A;  4Z2T A;  3PGT A;  4ILF A;  4MJE A;  2R5G A;  4OFN A;  1BED A;  3KEB A;  1E2Y A;  1ZYE A;  2GVP A;  4YQV A;  3EMP A;  3EE2 A;  4GSN A;  3ZMK A;  4N3Z A;  1O8W A;  1BAY A;  2FWE A;  1WWJ A;  2PU9 C;  1Q4J A;  3A3T A;  1V57 A;  1X0R A;  4LMW A;  2LRN A;  2VKZ G;  3TJK A;  2FY6 A;  4KCA A;  3UBL A;  3TJB A;  5B8B A;  5A34 B;  4K8M A;  4BVX B;  5BMU A;  2F51 A;  4I2U A;  3A2X A;  2HNL A;  1YJ6 A;  4PNG A;  2FWF A;  3UMA A;  2LUS A;  1PX7 A;  4JZQ A;  3D21 A;  2C4J A;  2YWO A;  5HR3 A;  1EGO A;  3QDN A;  3WT1 A;  1CQG A;  1GSE A;  3FHK A;  1PRX A;  3IK7 A;  2OAD A;  5IMF A;  1PKW A;  2ON7 A;  2YJH A;  3Q6O A;  1V9W A;  4N10 A;  4AKH A;  3O6T A;  5A5K A;  2WB9 A;  1VF3 A;  1K0A A;  4F82 A;  4V2L A;  5C04 A;  5ECH B;  5J3R A;  3UL3 A;  13GS A;  3WYW A;  2HSH A;  3J7Y k;  4AJ8 A;  3LXT A;  1SKR B;  2MBS A;  3ZRD A;  5JCG A;  4YAV A;  1XZO A;  3GFK A;  3L9V A;  2YNX A;  3KH7 A;  4IS0 A;  3APQ A;  3GIX A;  1XWG A;  5DQY A;  2P5Q A;  4G2E A;  16GS A;  4MK3 A;  5ECK B;  2E0Q A;  3ZVJ A;  2CA8 A;  3GYK A;  1Y1U A;  1WP0 A;  3MNG A;  2CVB A;  4MNN A;  1BQ7 A;  1ZYN A;  3ISO A;  1BG1 A;  5EL8 A;  3EVI A;  1NSW A;  5G1K A;  1THX A;  4WR4 A;  2QGV A;  3ZIV A;  1N8J A;  1CQH A;  3WT2 A;  2VCX A;  2HT9 A;  3PIN A;  5CRD A;  1SL2 B;  3CTG A;  1PQN A;  3P7X A;  3HVX A;  3IA1 A;  5H5S A;  5KN0 A;  2MBT A;  3E9J B;  4ZIJ A;  2H1L A;  3CBU A;  5IO0 A;  1SVM A;  1Z6N A;  4KA0 A;  1X9M B;  1Z3E A;  4KUN A;  1FHE A;  1T1V A;  1THO A;  3LOR A;  5H5R A;  3FZA A;  1EV4 A;  1TI3 A;  5DAL A;  4K0N A;  1BYE A;  5AN1 A;  4HU9 A;  2OBK A;  1Z6M A;  2NPB A;  4F0B A;  2BMX A;  3QOU A;  1FVJ A;  2YZH A;  1TOF A;  2GZY A;  2FCH A;  3D22 A;  2VCQ A;  1XBS A;  1Z7R A;  5ENU A;  2YWI A;  3HJO A;  2RLI A;  5IMZ A;  1X5E A;  5FWG A;  3V1W A;  5IIZ A;  5J9C A;  4O7H A;  1GRX A;  2IWT A;  2K9F A;  1FW1 A;  3ZFL A;  1YKA A;  3F6D A;  3VI5 A;  2R4V A;  2LRT A;  4PUA A;  4IW9 A;  5DJL A;  3RPN A;  2WCI A;  4EL1 A;  3LW9 A;  2B6M A;  4HU7 A;  3LSZ A;  4ZBD A;  1ZYP A;  3W8S A;  3NZN A;  3HDC A;  1YF1 A;  4BA7 A;  5J47 A;  3M3M A;  3C1R A;  2CZ3 A;  1XW6 A;  2L57 A;  2REM A;  1R26 A;  3FKF A;  4RI6 A;  1SYR A;  4EVM A;  2GS3 A;  3IC4 A;  3GH9 A;  2XC2 A;  4MF5 A;  5E59 A;  1EGR A;  1RK4 A;  5IOW A;  3WD6 A;  1EWX A;  4CY6 A;  2HRK B;  3U5R E;  3DEX A;  2YP6 A;  1T4Y A;  2H0I A;  4OMV A;  2DJ2 A;  5IOX A;  4HZ4 A;  1TTZ A;  3U6V A;  5ELA A;  2FLS A;  1GSY A;  4RI7 A;  2KLX A;  1PN9 A;  4X0X A;  3EIN A;  3RDW A;  2MMA A;  4EE0 A;  2HQT A;  4GQF A;  2MMN A;  4NPB A;  5B8A A;  5F0G A;  2DIZ A;  2DML A;  3CTF A;  5DCH A;  1XWC A;  1A0R P;  3L4N A;  5F07 A;  2QC7 A;  5COH A;  4ZBA A;  4NAX A;  5ID2 A;  5IM9 A;  2O5V A;  2CAI A;  1Z5Y E;  3I9V 2;  3KTB A;  4KCE A;  1ZOF A;  5AIS A;  1ON4 A;  1ZCP A;  1XPV A;  1GUL A;  3GST A;  2HRF A;  3GKK A;  3KP9 A;  9GSS A;  4MH2 A;  5D9W A;  4JR6 A;  4HEA 2;  4TVE A;  4HDE A;  1O81 A;  1BX9 A;  1T4Z A;  3W8J A;  1GWC A;  2A2R A;  4N0Z A;  1G7O A;  1KTE A;  1A2M A;  4TR3 A;  3M0F A;  1ERV A;  1AUC A;  3J7Y b;  4BL7 B;  1E6B A;  1GSD A;  2L5L A;  3LXZ A;  1OC9 B;  1Z9H A;  2DBC A;  4ZB8 A;  2MMZ A;  5G2Z A;  4JU5 A;  4GLT A;  5ECL B;  1TRW A;  1TU8 A;  4X43 A;  5IMV A;  2YOI A;  1YVL A;  2LV3 A;  4H86 A;  4YQU A;  4ML1 A;  4GRF A;  2R0C A;  1LBK A;  1EEM A;  2M80 A;  4TR1 A;  1TRU A;  2LKU A;  5IMD A;  4ECB A;  1KBN A;  2ALB A;  1SJZ A;  4FYU A;  3ZFB A;  1K0C A;  2BJX A;  3F4S A;  2OJL A;  4E68 A;  5DVB A;  5ECP B;  4GF0 A;  4BWQ A;  1XVW A;  2V6O A;  3TUE A;  3CSJ A;  2WRT A;  4QQ7 A;  2O89 A;  4PXO A;  4YKG A;  1S3A A;  1XOA A;  1YZX A;  1ZGN A;  3M9K A;  3QMX A;  3H1N A;  2VCT A;  2C0D A;  3VPQ A;  1DBY A;  2HFD A;  2A2S A;  4AI6 A;  2LTK A;  5EY6 A;  1V2A A;  4L0W A;  3RPP A;  1XW5 A;  3D4M A;  4K1F A;  5GSS A;  5KOW A;  4POM A;  1J9B A;  2AUV A;  1JLW A;  1QFN A;  4TOP A;  3ERF A;  3TOT A;  4DEJ A;  3F9U A;  4ZXG A;  5D73 A;  4PGT A;  2EFC A;  3MWH A;  1GUH A;  2JZS A;  1WJK A;  1FOH A;  4LLR A;  1K0O A;  2I9H A;  2OE0 A;  3I69 A;  3L9U A;  2MYG A;  4L0U A;  1U6T A;  2HRK A;  4TXO B;  5HR1 A;  1NHY A;  2FGX A;  19GS A;  4K5R A;  2QA2 A;  2K6V A;  4K5S A;  1K3Y A;  2HXK A;  1OYJ A;  3KXO A;  3ED3 A;  3LYP A;  2FNO A;  3FR6 A;  4IQ1 A;  1T00 A;  1GSQ A;  2CV4 A;  4ICY A;  1SEN A;  4K2X A;  1JLV A;  2LS5 A;  4NHZ A;  3C1S A;  1PL2 A;  3IHQ A;  3CRU A;  2C3T A;  2WJU A;  3NIV A;  4ZBB A;  10GS A;  4TW5 A;  3FMW A;  2H74 A;  4OWY A;  3ZIJ A;  4ISD A;  1O6J A;  1VRS D;  2L6C A;  2HYX A;  1EOH A;  1J0F A;  3TGZ A;  1ZMA A;  4ACS A;  5GAN D;  3GUS A;  2N5A A;  4GDF A;  5HFI A;  4TN8 A;  4O5R A;  2ON5 A;  4MZB A;  5JWR B;  2HSM B;  1BF5 A;  1VGL A;  4XIH A;  4USS A;  4IP6 A;  1F2E A;  2PVQ A;  4TR4 A;  3GMF A;  4OD7 A;  1UA5 A;  1V98 A;  2I3Y A;  3TJF A;  5J5N A;  5F8B A;  3DD3 A;  2VL2 A;  3GKN A;  4K7I A;  4FIW A;  2G2Q A;  4IHU A;  2C1Y A;  4IVF A;  1LJR A;  1FG4 A;  4GQC A;  4FH8 A;  4IJ3 A;  1M0U A;  2I4A A;  3VPT A;  1SJ6 A;  4K6X A;  2VO4 A;  2V2G A;  2B7K A;  1JZW A;  5HFK A;  4ECJ A;  2E2G A;  3CRT A;  4POK A;  4EDZ A;  4F9Z A;  1DE1 A;  5A4U A;  1K3O A;  2LJK A;  1TU7 A;  1X9W B;  4MPF A;  4KE3 A;  3GL5 A;  3UVH A;  1XW9 A;  3MIX A;  4BVY B;  2VIM A;  3LJR A;  2VD1 A;  5D8I A;  2YWN A;  3DGQ A;  4KAE A;  3KH9 A;  5ECQ B;  2AHE A;  2IFQ A;  4HI7 A;  2C3N A;  5D9X A;  1XWK A;  3LGC A;  1XXU A;  5CRE A;  3EYT A;  3CYN A;  4G19 A;  1EV9 A;  4HS1 A;  4FYC A;  1DUG A;  4D73 A;  5HR0 A;  2HZF A;  3QD9 A;  4MP4 A;  4I8B A;  2GTU A;  2F9S A;  4WF4 A;  3H8Q A;  2L59 A;  1N2A A;  4CHS A;  4V2N A;  3GX0 A;  1O7U A;  3UBK A;  4WKW A;  4IN0 A;  3F3R A;  1AQV A;  3QR6 A;  5DCG A;  3F6F A;  11GS A;  2JZR A;  2P31 A;  3PH9 A;  4ECC A;  1FVK A;  3IPZ A;  3KGK A;  1NM3 A;  1A8L A;  2CX4 A;  1QQ2 A;  1HNB A;  2NVL A;  2IPA A;  4XHM A;  3HHV A;  3I43 A;  5J4V A;  1TK8 B;  1WOU A;  3EC3 A;  1GTB A;  1GSU A;  2CZ2 A;  3HKR A;  3KM6 A;  4MJA A;  5LCZ A;  2NBS A;  4CDO A;  4PQ1 A;  5A5H B;  3D0Z A;  3A2V A;  1AIU A;  2OE1 A;  2GDR A;  2H6Y A;  3IXR A;  4LL1 B;  2F3M A;  4YKF A;  1FO5 A;  2PUK C;  4K2D A;  1SJI A;  1ERW A;  4TXO A;  3EU4 A;  2F8A A;  3F0I A;  3DWV A;  5GAP D;  4G0I A;  1PD2 1;  5DAK B;  4DSQ A;  4WF5 A;  3UAP A;  3O3T A;  2CT6 A;  2XHF A;  4F0C A;  1U3A A;  3TKR A;  2V32 A;  4PNF A;  1DE2 A;  3HD5 A;  2R0G A;  5A1N B;  3FYG A;  2DSA A;  1HNA A;  1A8Y A;  4X1U A;  2KHP A;  3R2Q A;  2P0G A;  5G5E A;  2B5X A;  1PX6 A;  4V1A p;  2KP1 A;  3IAS 2;  1HD2 A;  4K9Z A;  1QMV A;  2YN1 A;  2WFC A;  3HZ4 A;  1TJD A;  1GP1 A;  3ZTL A;  4WXT A;  4QMK A;  3E3E A;  1XWA A;  3KP8 A;  2LRC A;  1I5G A;  4DSS A;  1OVN A;  4ULX A;  2H19 A;  1M7T A;  3P2A A;  2LNS A;  2GLR A;  4JED A;  5B6M A;  5AIV A;  2C8U A;  4ZL9 A;  3R3E A;  2P5R A;  3FY7 A;  1PMT A;  4POL A;  2H0G A;  3Q18 A;  1X9S B;  1TRV A;  4N11 A;  3CSI A;  2VL9 A;  2YV7 A;  2EIR A;  2GZP A;  3VWX A;  4MJB A;  3HYP A;  5ABR A;  3JCM L;  3CXG A;  1OKT A;  4O92 A;  2N5B A;  1SL0 B;  1Z7P A;  3FR9 A;  4O5Q A;  1UN2 A;  5KN2 A;  3QAV A;  3GTU B;  4K0G A;  4Q5R A;  1MEK A;  4OFT A;  3CSH A;  3KMN A;  3ZZX A;  4EO3 A;  2CVK A;  5HR2 A;  1SK2 A;  3VWU A;  3P8W A;  3TCO A;  2O7K A;  2ZUP A;  3GHA A;  2H66 A;  2PWJ A;  2VLT A;  3HZ8 A;  3MDK A;  4O32 A;  4KND A;  2O87 A;  2GSR A;  5EPF A;  4I2T A;  3PPU A;  4IQA A;  5A34 A;  4BVX A;  3LG6 A;  1W4V A;  5HQP A;  2B3S A;  2H71 A;  3EWL A;  3WGE A;  3VK9 A;  2H6Z A;  1QXH A;  1SU9 A;  3SWL A;  1OE7 A;  1TK0 B;  3H79 A;  4L5L A;  4QL9 A;  1VF1 A;  2H75 A;  18GS A;  2C0E A;  3F8U A;  4LMV A;  1PA3 A;  4P3Y B;  3KZQ A;  1AAZ A;  4Z2R A;  3QFA C;  5D9V A;  1UC7 A;  3VWW A;  4ZL7 A;  2MZC A;  2IJY A;  2VLV A;  3TRX A;  1TKD B;  4NV5 A;  3UIW A;  3IR4 A;  3TKS A;  2R2J A;  2B1K A;  1XOB A;  2JSZ A;  1TRS A;  2K8S A;  5A5H A;  4ML6 A;  3HMJ G;  5JCW A;  1GSS A;  1A0F A;  3FK8 A;  7GSS A;  2GT5 A;  2M46 A;  3TRP A;  2VCW A;  3HJM A;  4TXV A;  3D4T A;  5BRT A;  20GS A;  2HSY A;  1OKD A;  2PMT A;  5CRW A;  4RQR A;  4GST A;  1RQM A;  3A2W A;  1HQO A;  6GSU A;  3FEU A;  1SD8 A;  2V41 A;  1B8X A;  3W6G A;  5CAX A;  1QUW A;  4CY8 A;  2VAF A;  3A5I A;  2EFE A;  1TXX A;  2O85 A;  4MLY A;  5C00 A;  4KH7 A;  4TR0 A;  4IJI A;  2VL2 C;  5JWO B;  4WBJ A;  3NOF A;  1EP8 A;  3FR3 A;  3MYD A;  6GST A;  1JZO A;  3L0H A;  4NWY A;  5A4V A;  4KSM A;  2X64 A;  4AKX B;  3S9F A;  3DKS A;  3HVV A;  3GUR A;  1I9D A;  6GSS A;  2TRC P;  4RUV A;  2DJK A;  1B4P A;  5LNK e;  4PQH A;  5J9B A;  2OA7 A;  3H93 A;  1ZZY A;  1OE8 A;  2H30 A;  1IYH A;  4GTU A;  3C71 A;  3GA4 A;  2WUL A;  4HZ2 A;  3G7I A;  3M8N A;  3F4R A;  2X8C A;  2V1M A;  3KTL A;  1M9A A;  2JU5 A;  2BTO T;  4XS4 B;  3RHB A;  2ES7 A;  1MDJ A;  3IBH A;  1K0B A;  6GSV A;  4HOJ A;  5IMA A;  1R7H A;  4JBB A;  3KCM A;  3GH6 A;  2IMK A;  3GTU A;  3IK9 A;  2EFH A;  2VM2 A;  2QSI A;  5LD0 A;  5A4W A;  3LYK A;  2X8G A;  4LL4 B;  2FWH A;  2YWM A;  2C80 A;  5ECR B;  2LJA A;  4DVC A;  4KW6 A;  1WMJ A;  1F6M C;  2YAN A;  2GSQ A;  3ZL5 A;  3L9S A;  3KJY A;  5AIX A;  2DJJ A;  4XS1 A;  2FWG A;  1C72 A;  1HNC A;  2H01 A;  2XBI A;  5IPG A;  3US3 A;  2H1B A;  3VLN A;  1SKW B;  1SVO A;  1MD3 A;  5JCU A;  3KMO A;  2YCD A;  3C73 A;  2L4Q A;  4G0L A;  1K0M A;  2TRX A;  1NW2 A;  1QK8 A;  4ZIL A;  5EVO A;  3TDG A;  2AV4 A;  1YKC A;  2DMM A;  1O73 A;  4IP1 A;  4N30 A;  3UEM A;  2FUG 2;  2DKH A;  1KNG A;  1QGV A;  4MA9 A;  4HQS A;  8GSS A;  2EIQ A;  2JSY A;  2O8V B;  1TI1 A;  3F63 A;  2E2M A;  1MDK A;  3HVS A;  1EZK A;  3GX8 A;  4Q5Q A;  3G9B A;  1TP9 A;  3O76 A;  2HLS A;  4XRA A;  1Y6E A;  2YV9 A;  3MAK A;  1A2L A;  5F06 A;  1ERU A;  1V58 A;  3GV1 A;  5DAL B;  5KN3 A;  1T8E B;  3GL3 A;  5F05 A;  4HJ2 A;  3E0U A;  1PKZ A;  3ZVJ D;  4AKG A;  4V2M A;  1GLP A;  4RQX A;  4FQU A;  5FT3 A;  5G5F A;  1R5A A;  14GS A;  2EIO A;  1ERT A;  2AYT A;  2CVD A;  2R37 A;  3TJJ A;  2YZU A;  2X49 A;  3GSS A;  2F8F A;  2VM1 A;  3FZ9 A;  2B5E A;  3VI7 A;  1XIY A;  4OCF A;  2IMI A;  3BBY A;  4KF9 A;  4BL7 A;  1WE0 A;  3IHG A;  2L5O A;  1OC9 A;  4OCE A;  4Q5F A;  2GSS A;  2HZE B;  2H0H A;  1KEB A;  5INY A;  4I97 A;  2LST A;  3PR8 A;  1YDK A;  4A5P A;  3L78 A;  3TOU A;  2ZNM A;  2IMF A;  2J9H A;  2KP2 A;  1SVL A;  2DIY A;  2MMO A;  1X5C A;  2V6K A;  1GTU A;  3SBC A;  3QCP A;  4EC0 A;  5E4W A;  2G0F A;  1TXU A;  2RUE A;  2L4C A;  2OT3 A;  5ELG A;  2QKE A;  3AY8 A;  2HI7 A;  2IME A;  1K3L A;  1U3I A;  2LQO A;  4IKH A;  2DJ3 A;  5DBQ A;  3QAG A;  3M9J A;  1FB0 A;  1AXD A;  5IPH A;  1SYX A;  3TKQ A;  3HY2 A;  5D93 A;  5CNW A;  3DXB A;  2PER A;  1SK0 A;  1H75 A;  3H4K A;  2FHE A;  1YF0 A;  3IOS A;  1OAZ A;  1BJX A;  1MTC A;  1AQX A;  5CYY A;  4PTS A;  1Y25 A;  4XS4 A;  5ID2 B;  3WGD A;  4KDU A;  2X4A A;  1VF4 A;  4WBR D;  2EFD A;  5IMC A;  1K0D A;  3IRA A;  2Z9S A;  1EEJ A;  2NDO A;  3ZRE A;  3RBT A;  1JFU A;  1OC3 A;  1O85 A;  4JE1 A;  3ZML A;  1F3B A;  4IEL A;  1U88 A;  1GNW A;  2YJ7 A;  2NTO A;  3M1G A;  4L8E A;  3CMI A;  3DML A;  2J23 A;  2PGT A;  1XWB A;  6GSY A;  1M2D A;  1LU4 A;  3VFI A;  2CX3 A;  3Q19 A;  2VLU A;  4DSR A;  3GRX A;  2OAC A;  3RAZ A;  1GTI A;  1H4O A;  4CW9 A;  4EUY A;  1GTA A;  1WPI A;  3DIE A;  4WET A;  3TKS C;  5GZZ B;  1K0N A;  2B5Y A;  2H8L A;  2X8H A;  1GL8 A;  2HRN A;  2H1G A;  4AKI A;  1TW9 A;  4JRR A;  1F3A A;  3BJ5 A;  4G01 A;  1ML6 A;  3TKS E;  1URM A;  3F4T A;  2A4V A;  2R0P A;  5J4U A;  1HYU A;  3UAR A;  4EF0 A;  4FYB A;  1YEX A;  3WGX A;  3OR5 A;  5KOX A;  1F9M A;  2PN8 A;  2WZ9 A;  3BOA A;  2H73 A;  4TR1 B;  4IGJ A;  1PN0 A;  4MDC A;  2LNT A;  2HE3 A;  4ECI A;  4KSO A;  1USB A;  4MF6 A;  4XTS A;  4PUF C;  3IDV A;  3LFL A;  1O8X A;  3IC8 A;  4V1A g;  3KIJ A;  2HSM A;  2RUF A;  4Q5N A;  2XPD A;  5IO2 A;  4GWR A;  3DRN A;  5H5Q A;  2QA1 A;  4OO4 A;  1M9B A;  4AF2 A;  2H1A A;  3EPT A;  4HUA A;  5KN1 A;  1M99 A;  1GLQ A;  1JZD A;  3DVX A;  1PSQ A;  3APS A;  2VUP A;  2KUC A;  3ZLP A;  1A24 A;  4XCS A;  2OE3 A;  1JZR A;  1AQW A;  2RII A;  1TDI A;  4AJ7 A;  3HA9 A;  5L71 A;  17GS A;  1B9Y C;  4MCU A;  4KDY A;  2HZE A;  3TRQ A;  4TKY A;  4ZL8 A;  2LEG A;  3IAM 2;  5B6N A;  5AGY A;  3QAW A;  5G30 A;  2GZZ A;  2IL3 A;  4J2F A;  4MPG A;  2HSN B;  4BVY A;  3EUR A;  1A23 A;  3I6A A;  2H6X A;  2DJ1 A;  3RHC A;  1ZL9 A;  5DJM A;  4MF7 A;  3FZ5 A;  4NXI A;  1YY7 A;  1EP7 A;  5HFG A;  4MAB A;  2H1D A;  2OKA A;  1BG5 A;  2RM5 A;  2I1U A;  1YQ1 A;  5CO3 A;  3EMX A;  1JHB A;  4YAP A;  5ECN B;  3Q74 A;  4W66 A;  3HJP A;  3APO A;  4BPY A;  2JL4 A;  2DC5 A;  3P90 A;  4E8E A;  3IE3 A;  2H70 A;  1ILO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...