1PMYA

Refined crystal structure of pseudoazurin from methylobacterium extorquens am1 at 1.5 angstroms resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
123
structure length
123
Chain Sequence
DEVAVKMLNSGPGGMMVFDPALVRLKPGDSIKFLPTDKGHNVETIKGMAPDGADYVKTTVGQEAVVKFDKEGVYGFKCAPHYMMGMVALVVVGDKRDNLEAAKSVQHNKLTQKRLDPLFAQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Refined crystal structure of pseudoazurin from Methylobacterium extorquens AM1 at 1.5 A resolution.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Electron transfer(cuproprotein)
total genus 35
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1994-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1pmyA00
1WA0X 2UXGA 2IDFA 1KV7A 1JZHA 1NDTA 1AS8A 2YAMA 3N2JA 2BO0A 4P5SA 1ADWA 4E9QA 1SDDB 3NJGA 5PAZA 2I7OA 5AKRA 4YSUA 4G71B 3RYMA 3UADA 5D4HA 2FNWA 5F7BA 1PAZA 2VSMB 3ASNB 1W6WA 2HRHA 2IDSA 4DP1X 3PLYA 1IBYA 2BP0B 2BP8A 1OCCB 1IKOP 2VMJA 3QJUB 1PCSA 4K9JA 4A68A 5PCYA 1AZRA 3FQ2A 3FU7A 2GHZA 3IE9A 1OF0A 1A4CA 2PPDA 1PNCA 2HX8A 2FQDA 4ENZA 1A8ZA 2QPEB 3CDZA 2BZCA 2PLTA 3T6WA 2FT7A 3HB3B 2R7EB 2WO2B 3FSAA 4WKXA 4DP5X 5B3SB 3PXLA 4YSSA 3OMIB 3SBQA 4HCGA 4YSEA 2XLLA 5E9NA 3NJNA 4E9SA 8PAZA 1KCBA 3UGEA 1NICA 4DPBX 3H4HA 2QT6A 3AZUA 5I6PA 3X2QB 4HALA 3FSWA 4YVNA 3QJSB 3TU6A 1I53A 1E30A 6PAZA 4W1TA 4BXVA 4DP4X 3FU9A 3QQXA 1JZJA 2P80D 3WI9A 4DP6X 1GSKA 4HIPA 3WNJA 1CYXA 3JTBA 2XX1A 1L9QA 3NJLA 3NJHA 3X1EA 2EIJB 3JT2A 3NP3A 3FQ1A 4AKPA 5I6MA 2AZUA 2OCCB 3EH4B 2XV3A 4N8UA 1N70A 2CAKA 1AZUA 3OM3B 1IUZA 2GIMA 4N4YB 2YXWA 1NINA 2IH9A 4QKTA 1ET8A 2HZHA 3NJFA 1TEFA 1M56B 1PZBA 2DYRB 4GXFA 3EH3B 4DP0X 2I85A 4KNTA 4A67A 1BYPA 2UXTA 1AOZA 1GY1A 1NIBA 1CUOA 1OE2A 2XV0A 2YAQA 2HX7A 5I5MA 4YVUA 1HFUA 2XVBA 3T6ZA 3EHBB 1E65A 3QJTB 3CZUB 1L9TA 4JHUA 1YLBB 3WNIA 3AG1B 2DY2A 3TBCA 1RKRA 3U25A 2X88A 1OE3A 4UAHA 1XB8A 4CSPA 3DIVA 2PCFA 5I28A 2CUAA 1E67A 2FT6A 1TKWA 4BDVA 4KOBA 4F2FA 3S8GB 1ILUA 1AZCA 2W88A 1MZYA 4YSCA 4HAKA 2PP9A 3X1BA 3IN0A 4NERA 2HXAA 1JOIA 4ZK8A 4YSTA 3SBPA 3T6VA 2XXGA 2PPEA 3C75A 1M57B 3FQYA 4G7RB 3GDCA 4DPCX 1A65A 1OV8A 2VW6A 4E9VA 2J5WA 2PP7A 2UX7A 1OCZB 2XXFA 1ASPA 4NB7A 3WG7B 3WKQA 2RACA 5I5IA 2EINB 6PCYA 1SDDA 3PAUA 1AS7A 3QJVB 1BQRA 1W8EA 4A2EA 4AKOA 5D4IA 2E86A 4E9XA 5TK4A 2VN3A 5EHFA 1BXVA 2JKWA 4BK5C 2ZXWB 4JHVA 3NSDA 4EF3A 3PAZA 4DPAX 2B08A 4E9WA 1AACA 4GYBA 2MTAA 1IC0A 4G7SB 5FC9A 1J9RA 3V9CA 2IWEA 1JXFA 7PCYA 1TU2A 3S3BB 4CSZA 1EHKB 4G70B 4A2HA 2Y69B 4AZUA 3S3CB 2YAFA 2AZAA 2QDWA 1PZCA 1ZV2A 4KO7A 1PY0A 2CALA 1JZIA 2YXVA 2WO3B 3CG8A 1KGYE 1SFHA 2TSBA 1JVLA 1JZGA 5B1JA 1J5CA 2BP8B 1MG2C 1V10A 1ET5A 2J57A 1A3ZA 2AFNA 2FTAA 3FU8A 1ILSA 4MFHA 2FWLB 3S8FB 3EF4A 2A3TA 1PLAA 5ANHA 1NPJA 2B3IA 3X1FA 2IAAC 1OCOB 3ERXA 3KW8A 4A2GA 5I6KA 3T71A 3CVBA 4HHGA 3FT0A 1ASQA 3CDZB 3BVDB 1NWOA 4A66A 5AFAA 3SQRA 1GYCA 1TEGA 1R1CA 2TSAA 1SHXA 4HCFA 3TBBA 1SF5A 4YSRA 4KNUA 4GP4B 1WS7A 5A7EA 2IWFA 1BEXA 1ID2A 1SHWA 2GBAA 4G72B 1VLXA 2PPFA 3N55A 1FWXA 1WS8A 1F56A 2AANA 2OV0A 5TK2A 2BZ7A 2H5UA 3NP4A 2YAPA 3AW5A 1NTDA 1URIA 4RH4A 1GS8A 1X9RA 1JXGA 1AAJA 5B1JC 3S3DB 1J9TA 2DYSB 2I7SA 1A4AA 4DP8X 4KO5A 1AZBA 4HZ1A 2OJ1A 2VM3A 3G5WA 3PAVA 2J55A 4FA7B 4W9ZA 2FQEA 1OCRB 4HCIA 4BWWA 1WA1X 3T6XA 5B1KA 1NPNA 2HLEB 3UACA 4E9RA 2GC7C 3GXUB 1NIEA 3ABMB 1B3IA 1SJMA 2CJ3A 5B7FA 5LDUA 2XU9A 2YQBA 2FT8A 4YSOA 2P80A 3QJRB 1ZDQA 4UANA 4X4KA 3X1NA 3IN2A 1PLCA 2Q5BA 2BWDA 3H4FA 4FAAB 3TA4D 1CC3A 1PF3A 5IY5B 2EILB 3GYRA 3NSYA 2IH8A 1AS6A 3FYIB 1AR1B 3DKHA 1ZIBA 5I26A 1AZNA 1MZZA 2GI0A 1GY2A 2XUWA 7PAZA 1RCYA 1SFDA 2XV2A 3BQVA 4L0PB 1JXDA 4BWTA 4AKQA 4UF7C 1WA2X 3FS9A 1GR7A 4F7KA 5B7EA 2XX0A 1NIFA 1QLEB 1KDIA 2ZONA 2FQGA 4M4RB 1J9QA 1HAWA 3NJIA 9PCYA 4AX3A 1ZPUA 3PCYA 2IDQA 3NSFA 1BXAA 1QNIA 3ZX1A 2BP0A 5I6OA 1AG0A 1BAWA 1L9PA 1PLBA 2HRGA 4A2FA 1OOWA 3IEAA 3L45A 2N0MA 4KNSA 2YARA 3NJJA 1GS6X 2GB2A 3AG2B 2GSMB 3FSZA 1L9SA 4AI7A 2UXFA 1JZEA 3OD3A 3NSCA 3ZDWA 2R7EA 1BYOA 1E5ZA 2JXMA 1KCWA 1BQ5A 1ZIAA 1KBVA 1WAEA 4PAZA 1HAUA 1ETJA 2W8CA 4Q89A 2ZWNA 4YSDA 5B7MA 5F7AA 3MX0B 4BWUA 1PZAA 3PPSA 1EZLA 1A4BA 2VW7A 1J5DA 1IBZA 5AZUA 3D12B 4KO6A 1OE1A 2QDVA 1PMYA 5D4JA 4DP2X 2PP8A 4G7QB 2IWKA 2VM4A 3OQRA 3NT0A 2AVFA 1XMEB 3AG3B 3FU7B 1AG6A 3QJQB 3CVCA 3FPXA 5B1AB 4YSQA 2WSDA 3AG4B 1AQ8A 3UAEA 2VSKB 2QPDB 4PCYA 2DWTA 1ET7A 1NIDA 4JKNA 1J9SA 1GS7A 5I6LA 4Q8BA 1V55B 4KOCA 1NZRA 1QHQA 2YAEA 4GP5B 3QPKA 4A2DA 1SF3A 1M9WA 4E9TA 1DZ0A 5I6NA 3KW7A 1RZQA 1RZPA 3WIAA 1KYAA 2YAOA 4M3HA 4GY4A 1FA4A 1KBWA 2IDTA 2DV6A 4E9YA 2XWZA 2MRYA 3TASA 1JERA 2IDUA 2Q9OA 3FSVA 4YL4A 3ZIYA 2DWSA 1BXUA 1UATA 2ZOOA 1X9UA 2XYBA 4WTQA 3ZBMA 3NJMA 2Y1AA 3X1GA 1KDJA 2JFCA 5B1BB 1AIZA 2FJSA 2VW4A 3HEIB 2FQFA 3SBRA 3FPYA 4TXVB 2PPCA 1ASOA 2LLNA 4HHWA 1CYWA 1L9RA 3ASOB 4NAJA 2J56A 1GW0A 4DP7X 2PCYA 1XB6A 1JVOA 1V54B 2YAHA 3AY2A 2GC4C 3NYKA 3CVDA 3OMAB 4P5RA 5I5JA 3DTUB 4DP9X 1MG3C 3ABGA 3UAAA 2X87A 3H56A 2NRDA 2EIKB 4GP8B 2CBPA 1FFTB 1NWPA 3V9EA 1DYZA 1SNRA 1BQKA 2BW4A 1E5YA 3T9WA 3FYEB 4BXSV 3ABLB 2EIMB 1ZDSA 1NIAA 2UXVA 4KO9A 2UX6A 3MBWB 1CURA 1XB3A 3ABKB 4QLWA 1JZFA 2PPAA 1AANA 2BW5A 1PNDA 3OMNB 3WKPA 4BDVB 4YSAA 2BHFA 3EH5B 1L9OA 3IBOA 3NJKA 2H3XC 2HX9A 1MDAA 2H47C 4F2EA 1N68A 4YSPA 2BWIA 1T5KA 1W6LA 2CCWA 3UABA
chains in the Genus database with same CATH superfamily
1IBGH 2ADGB 3PWNA 2W94A 3FQUA 1WGVA 1MPAL 3PP3K 4K7FA 2Y1ZA 1M05A 1QQDB 4DF9A 4AW7A 2YAMA 2IQ9H 3N2JA 2FHCA 1F1AA 3A67H 2D8KA 5D70L 2PYFB 3C5ZC 3NJGA 4Y5XC 4WI0B 2O6EA 1G6RH 4HT1L 2I24N 1CN4A 3BEWA 3GNML 2D2CC 5ID0A 1XSOA 4BCZA 3MLYH 3OLGA 1VAHA 2AEPL 3LN5B 4OZIB 4TM9A 1UEMA 1DBKH 2NTFB 1RZGB 2NDGA 4UILH 1CZ8H 2TRYA 3MV8E 4HIQA 4IOSA 3SQBB 4PJ7F 1GGCH 2OYKA 2CMRL 1UWEL 3ROOB 2JIXD 1E7VA 2NNAB 5D2LE 3SE8L 5I1AA 4M4PA 2Y25A 5BUGA 2P5WB 1EFQA 2NZ9D 1DQTA 3O3EA 4HJGB 5ENWA 1ZWIB 3DPBB 3HB3B 4ABVA 4IKLA 4NRZB 3L3JB 3EBAA 1OAYH 3COOA 4N28A 5AW4B 4HOWA 2BCMA 4AEIL 3SZKC 1D5IL 4X5XA 1OW0A 4ZPVA 1SOKA 3U1QA 2XIDA 2WLLB 3ME0A 4PJDF 2ZSWB 5KSAA 1JZ6A 1XH1A 5FO8A 4YC2C 5D8JH 1X7QB 2UUDH 3AZUA 1KLFA 2ZCLH 4Y5YB 1MFEL 3TU6A 3FOMA 3BPNC 3VFTB 5BW7A 3DI2B 4JY4B 5AUMB 1XT5A 3FTUA 3LY6A 3I3BA 1DBJL 5I1LB 3ZIMA 2ODHA 1BLNB 4ONGL 3UCRA 3RHWK 1K8DA 1YNTF 2F54E 2XX1A 1EERB 3SGDI 2P8PB 4I0PC 3IJHA 4AH2B 4YR6A 5IMLA 3A4EA 2MCPH 1D5RA 3FQNA 1SJHA 4ZTPH 2OM5A 3AUWB 4C47A 3OZ9L 5DK0A 4OIIH 2WOYA 4UNTA 1W72A 2FWOA 5CEZL 2E9IA 3JWOL 5JPNA 1M56B 2YFOA 4MA3A 1WHOA 3RWJB 4LNVA 5E6RB 2E8YA 4AV5A 1BOGA 4Y9GA 1XWVA 4XCYA 3SE3C 1FAIL 1NIBA 2O1AA 5FCUH 2KQMA 5C0AB 1VB9A 2H8PB 2HX7A 3DXAB 3HS0B 3ZK0A 1EEZB 2HUHA 3STZB 5FYLE 3G5ZA 1N64H 3U46B 1O6TA 1IBHA 1KN4L 2FIRT 1VPOL 4BSWB 5KANI 1YYMH 3CE1A 3N42F 3K4DA 3S5ZA 5D7JD 1YEGH 4HJ0C 2XICA 4L1HA 3BUYA 5E6ZA 2XRAL 4N87A 3VFMA 4H0HB 4UQ9A 4YAQB 5C9JA 1NKOA 1JG9A 2I9TA 3FAWA 1YMHB 4JFPA 2ZWYA 5DJ6A 3AGWA 4P9HC 2D3NA 2B1HL 5FW6A 2JQZA 3VTMA 2J3SA 1BXXA 1OF2A 4FABL 4X99B 2DQHL 2CLVA 3GSWB 2VIRA 4KDWA 1QW8A 1YJDL 1PZ5B 4L8CA 1IAKB 3DX0A 3D3VA 3TV8A 1P5VA 2J5LC 1WHPA 3A6OA 2X9XA 2L7UA 1E8WA 2PPEA 3FQYA 4M6NH 4X80L 4IGBC 5L8JB 1DJYA 1GZPB 4LASH 3FTZA 4F7MA 3WSQH 1OCZB 2XHNA 1DVSA 1JNNL 1S3KL 4R7VA 4AMXA 1BX2A 4HU8A 5I1DB 3CZLA 3MRHA 3QS2A 4XCEB 4XHJD 2VE6B 2VSDA 3RRQA 3RWDA 4YHKL 2NT1A 3TBWA 4PJ8D 5ERWA 1HI6A 1NEPA 4PRBB 3CQPA 1RPQA 5C0IB 3BFOA 1A7PL 4PR5A 5HDOA 4JK0D 1RD6A 4O9HH 4NWUL 4JHVA 1MH5A 4KK6C 5A2BA 4R5VA 5DC9B 1AD0B 3OSVA 4C55A 3HBQA 4BKLB 1LWJA 2VITB 5HGAB 3A3YB 2BSTA 4AL8L 3V9CA 1UB6B 2TAAA 3ULAB 1G0XA 1HNFA 1OPGL 1VFAB 3S3BB 4XPHL 3VGGA 1YVLA 1I1AB 1TITA 5B8CA 3BVTA 1JZ4A 2AMGA 4PQXA 3UTTE 4AUJA 2YD2A 4IK6A 3V2AR 1MCHA 3Q2VA 5HDBE 4ENED 4FQJL 4NHCL 3U7WH 3GLDA 2LR4A 1BG9A 3EFOB 4XXDB 2VXQH 5FAAA 3CD4A 1S7RB 4D7BA 5KSBB 1YN7A 2ROXA 4XO8A 4N2MA 4DN3H 1S7XA 3GLAA 2HFFB 3TBVA 3BLBA 3FU8A 1JNLL 2OW7A 4OR1A 3MNWA 1QABA 3BUQA 2HA1A 3K6NA 5EUKB 4YPGA 5KSVB 3GMMA 1VRSA 3QUKB 3BVXA 4P9HL 3MNDA 4X7EC 4Z18A 2BLFA 3K81A 3OGOE 3NIFF 5I15H 4WWKD 3TLRA 1T1XB 1CLCA 3UOAB 1UACH 1SF5A 2APBA 4ELME 1YC8A 4N85A 4RFOL 4ZMLA 4DVBB 1JMZA 5HYSG 2IWFA 1ZLSL 1HZKA 2JIXA 3DUHA 1X7TA 4OCYL 5GRWA 3U2JA 3U48A 2JKLA 2ZXGA 4JRXE 3LOWA 4CSTA 5JQIB 1K85A 3VU1A 1NTDA 5DT1H 1PTZA 2YQ2A 1V27A 2L4OA 1RIHL 1MHCB 2F5AL 2WWNA 4PS8A 4QXGH 4X6FA 2VXTH 5DRZB 4H2CA 4OF0A 4GKOA 5DK3A 3L4UA 3ETTA 2GW5A 1Q90A 1CLZL 3D25A 2JI2A 1LVEA 1KJ2H 1ZOXA 4O58L 2F53B 3QUGA 2CDFB 1VEMA 3ZDZB 2A6KA 2FB4L 1CGTA 3VDBA 4NI6A 4OJFH 1JZ8A 4NZFA 1YSOA 2WKGA 3W1ZA 3MMEA 1BF8A 4ZZFA 2GJZA 4LLDA 1G0YR 1M7IA 3H53A 4G8GB 3O0LA 1NANH 1UJTA 5BO0D 2JJWA 3DURB 3DX6B 4FAAB 3TA4D 1XCQA 3W39A 2KDGA 4OZFA 4L4TB 4TNEA 1KPRB 1HH6A 2XI9A 3ZE1E 4F57L 3Q8FA 1T03L 3ALXA 4JFSA 4WUUD 2UWEB 5BVJB 2K7PA 4L3ED 3TTSA 1RK7A 1E2ZA 3BAKA 2GJPA 3AQYA 1RZKL 2Z4TA 4GG6F 1MCDA 2PXYD 5AVTB 1SXSA 5CZRA 1KDIA 4J6RH 3V6OA 1UWYA 1YNLH 4GQPH 4R5XA 2WQWA 1YO4A 2X1PA 3T08A 5CMAA 2JH2A 4MTMA 2C7UB 3C60B 1JBJA 3L3HB 2AXHA 3CVHL 3RDTC 1M71A 4OH2A 2ZUVA 3VG0L 1DL7H 4HC1A 5D7JA 3SPCA 4MNHB 5J9PA 4Y9EA 2I25N 4JO4H 2VL5A 2R4RL 4XVSL 1Q94A 3A6BH 3NJJA 3O3AB 1S6NA 2B8OT 1FO0L 2GB2A 5DJDA 4WUKL 2VISA 3PFUA 2X0UA 1TETH 1X5HA 4OM0H 5GS0L 3JWNC 3QIBC 1F13A 1I9JL 3ILPA 3L17A 3LH9A 3B5HA 3BLKA 3BT2H 1MPAH 2UZXA 3ES6B 3VXQA 3ZE0F 3MODH 1UFUA 2ARJQ 2UYLA 3T1FA 4D9RE 2OCFD 2W8CA 3EOAB 4XP1H 5D70H 2H41A 3ULVF 3LNEA 5C86A 4XZ4A 1A4BA 3GNMH 2L7QA 1K5WA 1LEGA 3FTSA 1F4AA 3Q5YA 4Z7OB 4NCDA 5HJGA 2AEPH 3DV4A 1XD1A 3QFJE 4L1LA 5D4JA 5DJ8B 3X12B 1A25A 2BIQA 3O41B 1YY8A 1I3VA 1TZIB 2NOYA 3LIZL 3OR6B 3H8NA 4Z5RA 1TU2B 4PJ8A 2CMRH 1UWEH 4PU2A 4GRLD 3SE8H 1OZUA 3PIQB 2VKWA 5H37G 2JB5L 5EWIL 1ZA3B 1QHQA 4MB4A 4A2DA 4L5FE 2LOEA 1VGKB 1HDMA 1FG2B 3ZTJG 1W0VB 1BCIA 2AK4E 3QHZL 12E8H 5T1JA 3VD7A 2FECL 2FEEI 2QKSA 3KBHE 3NN8B 4AEIH 4YQXL 1IB5A 5KSAB 2YAOA 4M3HA 2JNZA 2GJ6E 2VQTA 5DZ9A 3U9UA 1G7IB 5E1AA 4DK3A 5C9KA 1I3RA 3ATBA 1A9BB 1ZHKA 1FI8C 2ENJA 1MEXL 2EE0A 2OMXA 2NY7H 2D7PA 5BV7B 5DR5L 3OB0K 4L8DA 4P5KA 3ZBMA 1DBJH 5F6IC 5FYKD 4MAYC 3ULSA 2B4CC 4R97C 3VQMA 3D18B 4J3OF 5IMLB 4F33B 2FQFA 1NANI 2V4LA 3RWIA 3FQNB 1JN6A 3CVIH 2Z4QB 5DK0B 4L3AA 1TJGL 3GSUB 3OZ9H 1WCBA 1W72B 2FWOB 2EICA 3ARYA 2PCYA 1XB6A 3KBFA 4MA3B 2G5BA 2QELA 4JQVA 1BOGB 5HDRA 1NMCB 4PJ9C 1UVQA 3LDBC 4X7SH 4N8CL 1DN0A 1T3FA 2DQGH 4WW2A 4GSDL 4PJAE 4PGEA 1FAIH 3FCBA 1CFNA 5EPMA 4CNIB 2EP6A 4ADJA 3G5ZB 1CT8A 1T21B 2FUTA 5KZCD 2ZWLT 3LEXA 3OZLA 4NO3A 1KN4H 4M6ML 1VPOH 3BUBA 5DDHA 2MHAB 3O2VL 3W82A 3BUYB 4AG4L 4D8PB 2ED8A 4JJHA 3VFMB 3QEGL 1ZDSA 4YLBA 3CFIC 1N67A 2OMBA 2ICEA 1X6NA 1ZT4A 4KO9A 3ZDYE 4K5PA 4YXHH 2UX6A 1SXCA 3PHAA 3EXJA 2B1HH 1AD9B 2FL5A 2BW5A 4NKIH 1OF2B 2JK5B 1CGWA 1KYUA 1VFMA 3LNDA 4WLCA 3VXSE 2DQHH 2H3XC 1M6OA 5F7EL 1ACXA 3T2OA 4L8CB 1YJDH 3KD4A 4QRAA 1RUML 2BWIA 1P5VB 1A02N 5CIPH 5A2CA 2F8IA 3MBXL 1X4XA 2Z8RA 1OAUL 2FIKB 4X80H 5IB2A 1GGTA 3Q8BA 4JPKH 3BKYL 4MZRA 2QGEA 2N01B 4G7VH 3ABZA 1BAGA 2WWOA 1BX2B 5J06A 4MS8D 2K3TA 1NBVH 3MRHB 4P5SA 1JNNH 2NNFA 3QO1B 3OLDA 4FI6A 2F15A 4PJGE 5T3XD 4MDRA 1XV8A 5CZXC 5ERWB 4YHKH 4ZFQA 5SWZD 3UADA 3O8XD 4X8JB 2HRHA 1N18A 3IDNA 3U4KA 3WDIA 2BP0B 4UIKL 2R0WL 1A7PH 3B9KC 1UXLA 4KJQC 4L3EA 4O02A 5GRJH 1MH5B 1WAAE 3H9HA 5D1ZI 2GHZA 5CFHA 2PXYA 1A4CA 4JDVB 3BIKA 5IBLC 3LQZA 3NMEA 5F7KC 4HS6A 3HNSH 1TJHL 4AL8H 2RTTA 4AVKA 4FTVE 3O0RL 3FN0H 4MJ6A 2HB0A 5L7XH 3QQDA 4LE8A 4NQQA 1HKLL 1MQ8A 2B39A 1WQVT 3MRPA 4R9HA 4WI2A 4NUJA 5FKPA 3HLAA 4GFTB 1IGFH 1WWBX 2HJKA 3FFOA 3NIDE 4NHCH 3JTSB 5G4OA 5HBBA 1N5AB 2HT2D 1I85C 3INOA 4FXLA 3OKNB 2CE6A 4JMNA 5I1KL 4IBWA 3RVUC 2QT6A 2BSCA 2NY5C 4XZUB 4WFHE 3EJTA 5GSRB 1ZLWH 3D48R 3W57A 5AAWA 4RMUA 3VW3L 2IAMD 4Z7WB 2HLFC 4LOUD 5FM4A 4ODHL 3V6BR 1BM3L 2FEDC 3MNVB 3Q6FB 4RMWA 1GCFA 2X4SB 5BZWB 4HIPA 3FONA 3G9VA 3MRRA 4YHZH 4NS0A 4RAUA 4IBUA 4RAVA 4RCAA 4NO2A 3P4LA 1U8CA 1G7HA 2CBOA 2GIMA 1IX2A 3FULA 4RFOH 4N4YB 4ZUTA 2JIXB 3MLPA 1PLGH 2XA8L 1ZLSH 4MGXA 2GAZA 4GRLA 1N6VA 4KNTA 4NM8L 4EI6B 2NYYD 5IP4A 3HRZC 5C0RH 2FGWL 3FO9A 4KXAA 4QT5A 1GL4B 2R9HC 4YO0A 5E9DE 4PTTA 2OMTA 1RIHH 2F5AH 3ARED 4S0HA 3BN3B 5ID1A 2EVHA 4OLEA 4I1NB 1T83A 4H5SA 3BP4A 2L8AA 3VI3E 2QQLL 3FNKA 3FQXA 5IVXF 1JPSH 1JUFB 3LH2L 1K2DB 4TVPL 2DEWX 4K5LA 5FO7A 4EXPX 2FB4H 2R0ZL 4P0DA 5ITFB 3QUYC 2VQ1B 3QWOA 5AOZA 4S1DC 3MMEB 1A6UH 1LHZA 4GRWH 3GKWL 1RV6X 4QRQA 3B9VA 2R27A 1PSKL 1Q38A 1H3GA 3JV0A 4F2FA 2CUMA 1SUHA 5I73C 3F7QA 1RZ7L 3AXLA 4I87A 1MCNA 2UVFA 1SMDA 4DH2A 4ZK8A 4YGAB 4AYMC 4G7RB 3MFGB 4HUWB 5A1AA 5KN5A 3BH9B 1LD9B 5JDJA 3SDCC 2VDML 2NY5L 1E43A 2XXFA 5JW4M 1IIIA 5KSUA 4K3JL 4HD5A 1OARH 5DEJA 1U8KA 1RZKH 3VD9A 4H25B 4A7VA 3LKNA 1XMWA 2KLRA 4G6AC 4GS7C 4G9FD 1EHAA 5IQOA 2C3HA 2R29A 1TIUA 2H1XA 5FOBB 5D7JB 4KKCC 4JANA 4BK8A 2WQRA 3NCYP 2JKXA 5C0NC 2XTJC 2YPLE 4BZYA 2HKFH 4JFFD 7PCYA 2R4RH 1Q94B 4L48A 4AMKH 5HJ3A 5IROC 1KYFA 4PJHE 4ZNCD 2WXJA 1FO0H 3CUPA 5GS0H 5LGJA 5KVEH 1A1OB 3LXUX 4Y1TA 5IZ7A 4ADGA 1T04A 5FUOL 4KKQA 1IMHC 2ITEA 3VXQB 1EHXA 2ZUSA 4NQVA 4NZDA 4YZFE 3K6IA 2C9XA 1CG9B 1KGYE 3JWDL 4P3CL 3LKPA 2GITA 1KTLA 3RA7H 3DMMC 4Y7MA 5I8CA 4DW2H 1DFBH 1NBCA 4W9KC 1RUKL 4TN9A 2FWSA 3WIIL 3DETD 5ANHA 1PLAA 3C6LD 3EF7A 3HAEH 2FEJA 1INEL 1BJ1J 4PRPD 4HHGA 1HJCA 3MRDA 1IT9L 3BVDB 5DEGA 2EUWA 4NKQB 1VGEL 4DEPB 5ECGA 3O8XA 3RZCC 3VTAA 2CPUA 1SEBA 2MQ3A 3KXFB 4GH7B 4HISA 4HCFA 1A7QH 2OJEB 5EWIH 4FEMA 5F0JB 1HDMB 1A6VH 1KB5B 4MDJA 3FBQA 5DEFA 3TV3L 2P5WE 2OTUA 1P6WA 2PPFA 3TONA 4JBSA 1F56A 1ZSDB 3FQRA 2XG4A 4YQXH 5T3ZD 3DHUA 5GRUL 2MFNA 5TK2A 2H5UA 4YOKA 3PGFL 3U9UB 3GMLA 4RFNC 4X7TA 3RGVD 3RX5A 4Z3HA 4XMLH 1OP5H 3US0A 1BW8A 2V8MA 3LKQA 5E1AB 4G42A 5HVWA 4NNYA 5EDXA 5IT2H 3VXNB 3UROR 1AAJA 3DJSA 4LRIA 1ZVYA 1CICD 4JPIA 5D1ZB 3UZEA 1JAEA 2DWDA 4EUPH 1DVTA 3MVSA 1P7HL 2J55A 3MXWH 3G5XB 2ENYA 4W9ZA 5HVHC 2Q7YA 2Q3XA 3QPQD 4B6ZA 3RKPA 1HINH 4NQED 3WLWD 3MJGX 5GGSA 1DLFL 3RWIB 1N7ML 1QUPA 1ROCA 1G9NC 2OP4L 1S7VB 4HWNA 4UTCA 3D2UB 5L2KB 1FHGA 4TNWF 3WFHB 5LDUA 3TF4A 2EC9U 3OGCA 3OKLB 4G1EA 3SDXA 1R3KA 1TJGH 5DQDL 2EKJA 4RMQA 4WO4D 4O5LH 1JGEA 1CGXA 4UANA 1SLXA 1ACCA 4QHNB 1JCKA 4WWKB 1UVQB 3D4ZA 4U1JA 4WW2B 2XZQH 3GYRA 2YD3A 4HGWA 1Q9WB 2B1AL 1QO3A 4GSDH 5EPMB 3EDDA 4WTXA 1X5KA 4B9CA 4PRIB 3VQ2C 3S5LA 1VJSA 5L88H 5DDHB 1HYRC 5D7IA 4AYID 1BZ9B 3KLHC 5IWLA 4QOKD 2IIJA 3O2VH 1V05A 4AG4H 3B56A 3AREA 3QEGH 1D5MB 2ICEB 1ZT4B 1J0YA 3U0WL 3H2WA 4OCSL 5C6TH 3Q2LA 3WAKA 1MCPL 2NY6B 3QJHA 3T0DA 2XQYA 4WY7L 4LO9A 4GAJH 4TSBL 1HZLA 1BZQK 1NOFA 4AQ8C 1H6TA 3CV5A 4AE0A 5C7XL 3PDOA 3TBTB 1PFCA 3D8MA 4GXUM 3NIGF 5BQ7A 3L45A 3EG9A 5F7EH 4NKDB 3EJJX 4IRSB 2HCZX 1RUMH 3WN5B 3PGDA 2C5DC 3HE7C 2WANA 1BEYH 2VLJD 3MBXH 1HXKA 4CVXB 1OAUH 2E4TA 3V4VL 2YXFA 4LB8A 3BKYH 1PZDA 4ZXBC 3VFUB 4IKKA 5AENA 4A39A 4Q89A 1RK0A 5ESVB 3BWUC 4NQSA 1QFWM 5E8OB 2BFGA 4B50A 5IR1A 1HHGB 4BYHA 4G6JL 2D31B 4PJIB 4RETB 4WUUB 1WWCA 3P4NA 3SPGA 5K1VA 2VM4A 4UIKH 2R0WH 4DO5A 3T0WA 4QXTA 2J1WA 4KY2A 3VRIB 2WXKA 4XO4A 4HZAA 2BPBA 3CFBB 2IGTA 1G9NL 3CVCA 3CX5K 4LLWA 1FZJB 3LQZB 3NEOA 3MUY1 5F7LB 2VSKB 2FSDA 4N5EC 5C3LD 4NZRL 2Y3NA 4G9FA 1TJHH 4MJ6B 4ZMVA 3F83A 3O0RH 4ODWA 3C6EA 3MRIA 2EZ0D 2KKQA 4PJ7A 4CVUA 1T1ZB 1IIKA 3EO0B 1HKLH 4EO5A 5B4MC 2WXQA 5F44A 5C6WH 4JFFA 4L18A 1RU9L 4LLAA 2DIAA 5FV1L 5GGQH 4DHLA 4KK5D 4IKIA 1OGTA 2DV6A 1TCRA 3QG7H 4YEEA 1ADQL 2P4AB 5GQBA 5I1KH 3BHBB 2F7QA 4YL4A 2NUPA 2P24A 4L05A 2YPKB 3R06B 4NZTL 4W9JC 1QR1A 5IFJB 3CMOH 2J44A 4PVMA 4PJDA 1X9UA 4DGIL 3VFSB 3DWTA 5LKNA 2ZSVA 4YS4A 3X1GA 4IRZA 4R2GC 1CDCA 1PL3A 1ZTMA 1ZS2A 3MRRB 1YAIA 3MUGA 4U0QB 3E80A 3CH1B 3MSPA 3RAJL 2NQ3A 3K2KA 3F7KA 4NRXA 3L2MA 2K6YA 2XZAH 2OJZL 3LEVL 3MRKA 5FGBC 2C1OA 1W8NA 1YNTA 1TLKA 4NAJA 5AW6B 3AVEA 1CXFA 3BAJA 4PRPA 3K1DA 3D1MC 2AQPA 3SJVD 4Y9BA 1O9VA 3BP6A 1VFOA 3DX7A 2XA8H 1JSYA 2I07B 4FQXC 5ESAB 1FC2D 4PTTB 5ID1B 3MACL 5CSZA 4Z0BL 4H5SB 3IDYB 2OS7A 1JHLL 1F2QA 1NBQA 1HWHB 2PYEB 1D5XB 4KMLB 3IDXL 2QQLH 4XN4A 2RQEA 2ZAHA 3QDMD 3RGVA 5HJBA 5DVNA 3LH2H 1WEJL 2EO7A 3FB5B 2LHAA 4ZW6A 1I9EA 2KH2B 1QP1A 4QJ3B 2HTLD 3EO9L 3BN9D 3QWOB 4I7ZC 1CICA 4OZHE 1TJIL 3C2AL 2R0ZH 5EZJA 2F53E 3HCVB 1XB3A 3MUHL 5DFTA 5DMYA 3ZDZE 1OTSD 3FH7A 2X7LA 3GKWH 1Q0XL 2E9BA 5HD8C 1X6LA 3BH4A 3LKRA 4XH2B 4J3TA 4NQEA 4QRRE 3W0WB 2JV6A 4NI3A 2D9CA 1PEWA 2LFGA 5F2FA 1RZ7H 5GZOC 3QZWA 4WJKB 4BZ2L 1HOEA 1S9VA 1WZLA 2YKLL 1JV5A 4PRNA 3L48A 5FUCC 4M02A 4V2CB 4IHOA 5FK9B 5F9AC 2WYTA 4WO4A 5ICYA 4MSWA 3TYFA 3CC5A 1J8SA 3VD1A 4KZDL 3BISA 2VDMH 4LHUD 1F3DJ 1QOKA 1MNNA 1QW9A 3LCYA 4KXDA 1M3JA 2ZX5A 4B9GA 1U8KB 4M7KL 4LSPL 4K3JH 1N6QL 2UWEE 4YBLC 43C9A 1CYGA 4NLHA 3LKNB 1ETZA 4P5TC 5FPIA 2A74A 4HJJL 2FX9L 5LQBL 4U7SA 1HQRA 1U3YA 1C9SA 3EIFA 5BZZA 2RA1A 2Y5EA 3L4XA 2A38A 2H2SC 3I6KB 3TFKC 2VR3A 4J8RA 1NGXB 4QOKA 2HTKC 1JDAA 4H8WH 1XF3B 3HMXA 1LO4L 4NN7C 4YE4L 2FD6L 3EYFB 1ACZA 2HN7B 3KH3A 2VDLL 2BDNL 4WI6A 3OHXC 4M1CC 4FXKA 3GMOA 3L7FA 1ZT7A 3ZZSA 4ZSOA 1KNOA 5FUOH 1I8LC 1QI3A 3PL6D 2PKDA 5I0ZA 5DU7A 2MQ0A 4JCLA 3LKPB 3TWYA 2GITB 1A66A 2CO6B 5FYJE 3JWDH 1OP9A 3VFVB 5HVGB 5IJKC 1T1WB 1X5MA 5LGHH 3CSFA 2VLJA 4L9LC 4LQFL 5I2IB 5HI4C 4FOMA 2ATPA 4PLKC 4WWOA 4NM4H 2C3VB 6PAZA 1WFJA 3AGVA 5CZVL 4NP9A 4QTIL 1KGCE 2X4QB 4PLJC 3LN9A 2BSDA 3QQXA 3WI9A 4DP6X 3AFLA 4WK2B 1INEH 2EE3A 4IOIB 4J3OD 5SWZB 2XIIA 3O8XB 4P2QD 5B39G 1SEBB 3ARFA 4AKPA 1D9KB 4FNSA 3BESR 1M1XB 1OGAB 3OLIA 2RMNA 2HWZL 5IF0A 1N70A 3NJVA 4MDJB 4QTFA 5I1JL 4NPJA 4MCYB 3AQXA 4XNUL 1LO5A 4GW4B 2IOMA 2HJFA 2DYRB 3VGAC 3ARBC 2X4UA 5LHDA 4LGSB 5TD4A 4B97A 3EYVB 1Y18A 4OIAA 4OLUH 5CP7A 1JGIA 4X7TB 1KFGA 5GRUH 3ULUH 3VO0A 3PGFH 4G42B 3WEAA 4GUPB 4NNYB 2WGNB 3ZL4L 5JQHC 2GKIA 5I5MA 3M07A 2NLJA 3KPPA 3VH8A 2GIYA 2J8UF 2H6PA 4GRWF 5L6YL 5F96L 4G8FB 4Y0GA 4N0UB 4JLRA 3EJQA 3P0GB 2N7BA 2Q7YB 1H6UA 5GGTA 2YD8A 4YHOL 1VIWA 4Y1SA 4KPHL 2V0AA 4G9DB 2IAMB 1DLFH 3WV0A 2Z91A 4U3CA 2XWJA 3S4SA 3CFJA 5I28A 1UOKA 2VZOA 5MEPA 2OP4H 3GM0A 4A55A 4TMPA 1WZMA 3SDXB 3AS1A 3SE4C 1UZ8B 1RIUH 2XY1A 1A7NH 3PGCB 4RGND 5DQDH 1ILUA 1UQSA 1V5JA 4WVRA 2Q6WB 3SKJH 3C8KB 3E6FA 3KNBA 4ZUUA 1UT2A 2IVFC 4PJXF 3PWLB 4ILDA 3WLBA 3CXDL 3IVKA 3ARXA 4ZNEA 3KPSD 2VXUL 5I24A 2HVJA 1J05A 4J4PC 5BRPA 2VW6A 4OLVL 5TE7H 3SJVA 2CKBL 3MRGA 4LLYA 2PTUA 3GO1L 4RRPA 5TQ0L 1GHFL 4QY8A 4QNPF 5F9WB 2ZYHA 4POZD 2JQAA 2IBZX 4PJ5D 5KTEL 1KXTB 3F58L 1Z66A 2JI3A 3EOBB 4NDMA 5CU5A 1BQRA 3QRLA 3BDYH 4OCNC 3ZYJA 5C0EB 4I9WD 3U0WH 1J8HB 2DLFL 5EA0L 7FABH 1ES0A 1BQHB 4OCSH 5TK4A 2N4IA 2MWCA 4BK5C 5ADOL 4GG6A 4FKEA 3C5XA 1J0JA 3MV7B 3VM7A 1CFSA 3LPOA 3QDMA 4HIEB 4TSBH 4BE6A 3PWUB 1J9RA 4BK4A 3OJMB 5BQ7B 4Y2NA 3ZE2B 4NPYA 5BQDA 3WHE0 5C7XH 3FO1A 4UT9L 5JXAL 1Q0YL 4AMWA 1RZJL 4K23L 3LRSB 1U0QA 5J6HA 4QRUB 3BZ4B 1QBMH 4BRJA 3V4VH 5K9KB 1HU8A 1W0WB 3M6DA 2DI8A 3RBSA 1S9KC 4JFEB 4P46C 3QNFA 1D5BB 4PTUB 3VTTA 2KS0A 3MRFA 3ZTEA 5IR1B 5LWYL 1V10A 1V7MH 4FLOA 1BIIA 1A3ZA 1SOXA 2V37A 2VR9A 1TPXB 3HN8A 4HUUB 4HUNB 4LHUA 4ZUWB 4QXTB 2H7WA 4NKOB 2DMHA 2IAND 4FYSA 5ECJE 4CDGC 3CVBA 2WTRA 1RXLA 2X2HA 1G9NH 3S97C 1PFOA 1DVXA 1M7DB 3N91A 1U93B 4G9FB 5ABAA 3H0TB 1VA9A 3MRIB 3VWKC 3CCHA 1E5AA 2DLIA 5E2JA 5A40E 2WP3T 4PJ7B 2QVTA 2VZ3A 4UI2A 4XOAA 1YNKL 1OGPA 3X13B 2YBRA 2EEBA 3SOBL 4ZI8A 1R3JB 1RJZB 5C6PB 1UUSA 5GGRB 3HZMA 5FEBA 5JOFA 5DWUH 4JFFB 4TUJB 5LCVA 1R0AL 3HBPA 4PSRA 1BBDL 3VFWB 4HETA 1TCRB 4J3WA 3GSRB 3U36A 2DEYX 1URIA 1GS8A 3V0HA 1ADQH 3CIAA 4F8OA 3WJLA 5BXFB 2AXFA 3IMUA 1DDHA 4XMVA 2XCMC 4NZTH 4DP8X 3CZKA 3KWTA 2OJ1A 3QS3A 5E6IA 3PL6A 2ZSVB 2CRIA 7CGTA 4DGIH 4M8UA 1ZLWK 3IFOB 3FT2B 3MUGB 4OFKA 4OFIA 1FNGA 3K74B 4Z7WE 1A5FL 1AHKA 2A99A 2QSCH 4TVSa 4KUZL 1LXMA 4NRXB 4P06A 3RAJH 3LS5L 3OKOA 3BXNB 4FQCL 3C6LB 4MQ7B 4XOCA 2AAVA 2C1OB 1TQBC 4Y19B 3LEVH 2DQFA 3WMPA 2MQCA 1DVFC 3HZKA 3T2NL 3BP6B 3BLPX 3DX7B 3N40P 4P2QA 1OVZA 2CXGA 4LEOA 3V5HA 1QSFD 5D55A 1TO5A 3MBEC 3HBGA 4HWZA 1CBVH 5CSZB 3S34L 1N9PA 3MACH 4C83B 3L5IA 3WIHL 2XV2A 4CBPA 4CW1B 1DUYA 4MJID 1HVXA 4FQLH 2X12A 3G04A 2ADJA 3IDXH 3RGVB 3DTXA 3RUGF 3Q44A 4AQZA 4PVLA 4Z7IA 4O2FA 5E70A 4GBXC 2QGDA 1CXIA 3E8UL 4N2HA 2A1WL 3KL3A 1TJIH 3MFFB 1ZT1B 3C2AH 3H2PA 2OR7A 4LEXL 5F7DA 3C5SA 3QHTC 2RCSH 4JAMB 5GZNC 2WZ5A 4U6XB 3HE6D 4Y89A 1Q0XH 3BUTA 4NQEB 4M8QA 1J10A 1KPVA 4QHMA 2NR6C 2GPZA 2HRGA 3QZWB 4AVJA 5E4EC 1JV5B 1NAMA 1T2XA 3JTTA 4JO5A 5J6GA 1TDQA 1FCGA 4R90L 1AXIB 2X3AA 3FSZA 3BFWA 4IHOB 4MA1C 1C8QA 2UXFA 4JM2D 4PG9A 2JJUA 2YZ8A 2JXMA 4ES9A 4KRPC 4KZDH 3MA9L 1YYCA 1EEQA 4XXCC 3C8HA 3LQMA 1WO2A 43C9B 1P69B 3M1OA 4M7KH 4GW5B 1SHSA 4LSPH 1HEJC 2ERJB 2W07A 4OD1H 4PJFF 1J5DA 2CRZA 1HQRB 2DBJA 1MJUL 2FX9H 5LQBH 1PMYA 2XQBL 2EEXA 5CWSA 1RPKA 5MHSE 4N2DA 4WV1B 1AP2B 4F5CA 5CCGE 1OAZL 2HVBA 1FZMB 1M2VB 1QX1A 2ZICA 3SO5A 5DC2A 3FPXA 4QOKB 4PJ5A 3VB8A 1J11A 4OFDA 1CMOA 1H8LA 4P3WA 1I7TB 5I9QC 4LCVA 3O6LH 4G1MA 2K7QA 1V55B 3E8VA 4TL5A 2QLYA 4HF5L 2W9EL 4ACPA 3OAUL 2B9AA 3V95A 3M1BA 1QBLL 4KI1A 2BDNH 3DLQR 4Y16D 1FL5A 2FH6A 4HFWA 1MHHA 4HUCA 4ZSOB 2RFXA 3SYOA 1XGYL 3U7YL 1B88A 2UZYA 3ARGC 4XNAA 1U41A 2NW2B 2XWZA 2VDOL 4IDJL 2XQ0A 5CD5D 2VXSL 2DWSA 3S9DB 5CHNB 1I8MB 4LSQL 2VQ4A 3EYQD 2ZOOA 4WFFE 2DICA 4U6VH 2HFGL 4NO0D 35C8L 3NJMA 2VN4A 5E94A 5KW9H 4HUVB 5HTSA 1EUUA 2D7TL 3BZFB 3KCPA 2I27N 3DDFA 1FUNA 5E8DH 2BNQE 5AYUL 3K0YA 3WS6A 5B38G 4HKXB 2O30A 4JL1A 4XNZC 4G6KL 5D6DA 5DJAA 3TCTA 2FLBT 1O7SA 2V33A 4N6RA 2IANA 2X09A 2Z31C 4Q2ZA 4CU7A 1RZIA 5DHVB 3M8OL 1CO1A 3KXFE 5I1JH 5C08B 2VT0A 2YAHA 1G4RA 4XNUH 1QI4A 1EJ8A 1EGJA 3CVDA 1CI5A 4LLVB 3V0VA 2G3ZA 1HOCB 2LVCA 4ZO7A 4B95C 4W9IC 4J27A 2NXYC 2CD0A 2NY2D 2O6CA 3CFDB 3ZL4H 3VH8B 1ETA1 4F7PA 1OQOA 3BWAA 1SN5A 3QI9C 2H6PB 3BC9A 4H44C 2GY7B 4Y9FA 4NT6B 5F96H 3ZO9A 2VMDA 4Y5VA 4QYOB 4N22A 2BY0A 1OB1B 5A3ID 4YHOH 3EGDB 3S98A 4KK8C 3ROLA 4KPHH 2C7FA 2XWJB 4OI9A 1A21A 5F7WC 4AQ1A 3SDYH 2P28B 2FYYB 4M61B 1JZFA 3C08L 5A6IA 5F70A 1LYQA 4MNGA 5LO7A 5HHPA 5AL8A 1MCBA 1UQSB 2BHFA 2YD9A 5DYFA 1NGYB 3KNBB 5JHBA 5L2KE 3PJSA 3UAJC 1E8XA 3OBAA 1IL1B 3GRWH 3KGSA 2JJTA 1R3HA 2UV3A 4PWGA 2CDGB 3UABA 2H2PC 3WLBB 3DTDA 4U0RB 3TA3C 2Z92A 2HVJB 5EV7A 3MJ8B 1V8HA 3L9RA 2VXUH 5ANMA 1A0QL 2OSXA 3HUJF 4XCNA 5DMIH 4C56A 4WI5A 3C12A 3T4AC 3GO1H 5TQ0H 1T7YA 4PRIE 2ITDB 4JFOA 1QSFA 1NCHA 4FLRA 5KTEH 3F58H 4Y8DC 3QFDB 2LU3A 2XVGA 4ATTA 1TMCB 1ERNA 4HOZA 4QCIA 4MA8H 2JCWA 3S35L 2DLFH 1HH9A 5JUEH 2P8MB 3DIDA 4JREB 4MJIA 3TX4A 4PJEF 3VD5A 4AOFA 5DVPA 4UV7H 5HDLA 1E50A 4QIRA 3RX7A 4J28A 2W0PA 1B2YA 1AO7D 2DJUA 2H0PA 4XPAL 3VI4B 4UQAA 2F5BL 1JP5A 5JXAH 1ZXKA 4PP2B 3MCG1 4XPGH 3ARRA 1Q0YH 4U1KB 1R46A 1RZJH 2F1EA 2EIDA 3FSAA 5IEHA 1GOFA 4LCIL 5D6CB 1F4WL 2ICES 3HE6A 5CS7A 4RFEB 1DANU 3LXCA 4YSEA 5IGXL 4HIHB 2WNXA 3WU1A 3A4DA 3OVUB 3IGLA 3IJ8A 3B7TA 5A6LA 3MKGA 4JVWA 5DJZA 3E7JA 4OQ1A 1EPFA 3MRFB 4MCZA 1LEKA 2FJHB 3KZ8A 3PREA 1AZZC 5J1SC 1FFQA 4PW4A 5HI5D 4JM2A 3ZE0B 2VJ8A 3F7VA 2LW3A 3NFPB 1CF8H 4FYQA 4KKPA 4TVUA 3KGRA 4M3JA 4ABWA 1BVLA 2QHLA 3T3MB 5CEZD 2YFNA 3U0TB 2ZUYA 4PJIE 2WTRB 4WUUE 4Z78A 3ATEA 1LP9E 3T77A 4WTZA 4CRPA 4EDXA 1L9QA 4HUXB 1JTOA 5H37H 3SB3A 3WHXA 5JW5B 3UZVB 3ULUF 1CU4L 3CAFA 2FBOJ 2OLDA 2EYTB 4HWEL 4XNXL 3BAEL 5CN2A 3MOBH 2WXNA 3OM3B 3B2UC 4NGHH 5CJOH 5IEKA 3B43A 5GGVH 2ZXEB 1TEFA 5IK3B 3VGBA 1F90H 3F2LA 1P5UA 3HZMB 3OJDA 4M7ZC 5CN1A 3SOBH 4EQ3A 3CXHK 2C8NA 4N2IA 3LNGA 5HHMD 4CDHA 5GGRY 1OW0C 4UDUB 1JWSB 1AXSB 2BVQA 4G11A 4MXQC 4K7PL 2COQA 5FLVA 1HXMA 4TNGA 4C4UA 2M1KA 2VR4A 4Y16A 4AW4A 4NSKA 4PB0L 5EEUA 1RHHB 1KJ2A 1Z3GL 4HBCL 2X6VA 3DO3A 4JFZL 1OP4A 3HG3A 1BQLL 1XAUA 1YLBB 1EZSA 1WCQA 3TPUA 1XHHA 1H3UA 4D94A 4XN1A 4S1QL 1OAQL 1KC5L 3U25A 1G0DA 3OXRB 4BM7A 2NXZB 4KUZH 3V6ZA 4JE4B 3UDWA 3L3OC 3WAJA 3LS5H 2X1OA 1MFAL 2YN5A 3BE1L 4FQHA 1CVSC 4PV9B 3WL9A 4PI2A 3U4BH 4XR8C 2Y0SA 2QVIA 5DJXB 4UT6L 3T2NH 1FFPA 2JJSC 4HEMA 3AS2A 1MCRA 3M17A 3G9AB 3L3IA 3MJ9A 1OKEA 3D39D 3OKEA 4UNIA 3CBKB 1DJHA 3NA4A 4IU2A 1Y6MR 1G7MA 4ODUA 3GK8L 1J0KA 3SGJC 2BOCA 4NHUA 1U33A 1JGDA 1X5LA 3GIVA 1QSVA 3WIHH 2CXKA 1KTRL 3JYBA 1PKQB 2ENQA 5EIIB 1KLUB 4KH9A 2PYEE 4UM9B 2WSKA 1E4XI 1PYWA 5G2NA 3IJEA 3UBXA 4ZOAA 4LL9A 4WWNA 5D4IA 2E86A 3E8UH 1E5CA 3KHOA 4HDIA 4CVZA 4K8RL 3ZHKA 1BYNA 2WLIB 5D2NA 3V0DA 4AQAB 1YMMD 1U91A 2R15A 4LIQE 4EF3A 4Z7UF 3PQYD 43CAA 4M8QB 1KPVB 2XBZA 1AGEA 1NAMB 3JTTB 5MEND 1JI1A 2OX5A 4EZJA 5CCJA 3W0WE 5HHOD 4AZUA 2BY2A 1H15B 4R90H 4Y4FC 3WEXA 3NTCH 2AZAA 4S11A 3VYOA 4Q6IA 3VSUA 2PCPB 1JZIA 2XWXA 2EE6A 1XGUA 4U1GB 1JVLA 1AGCB 3LD8C 3S37H 1MG2C 3KPSB 4QRTA 4GQ9L 4MMZB 2B0SH 1U21A 5C0GA 3EZ8A 5DZNA 1MJUH 1XFPA 1J87A 5ICZB 3NFNA 3FFCE 1WYJA 3Q8AA 1OAZH 1EV2E 4I18A 4XGZB 4PJ5B 3FCTB 1I7ZB 1F8TL 4IGBD 3W3BA 3TT1H 1SBSL 1W80A 5F8RC 4G1MB 4A66A 5AW7B 5DYOB 2YC1B 1P1ZB 4X4XB 1R1CA 1OEZW 1FL6B 1FVDA 2ZUWA 1T0NA 3EYSH 4MD5A 4HF5H 2W9EH 2A73B 1KCUL 1QBLH 5DS8A 1A9VA 5B8CC 1MHHB 4WU5A 1AO7A 4OLXL 2UZYB 4FQQA 4TLUA 3PHQB 2ZG1A 1THAA 3IAPA 4KK6D 1AXTH 2VDOH 4PIBA 5IOPA 1OIOA 4GEIA 4IDJH 4OGZA 5BMFL 3GRBA 4EMZA 2DPKA 4FQ2L 4MMXC 2BIIA 5LGKA 4MJJA 4LSQH 4TLSA 5ADPL 5A6MA 2YEZB 2XG5A 1XH3B 1K4CA 5E94B 4E2OA 1X4YA 3D0LA 3ML8A 4IMKA 3MYJB 4H8PA 1CXHA 4NUPA 4N0CC 1VFBA 4PYGA 1QSZA 1NPNA 2D7TH 5KVEE 5AYUH 4PHZA 3HZYA 1SJMA 3EGSB 5SWZE 1FGVL 1ORSB 2AQNA 3P3UA 4N6RB 4G6KH 4Q2ZB 2CBTA 5DVOA 1F3JA 4HSQA 5HHNA 3QJRB 3BWUF 4OCXL 3SY6A 1OGAE 1NUFA 3HS9A 4RLDA 1HEZA 1I3GL 1H3PL 3J27A 4URKA 1CC3A 1PF3A 1PD1A 3RNQB 4UINH 2YRPA 2ENSA 2QVMA 1ZV9A 4LMQE 5LBVA 1X5AA 4L8BA 1MZZA 1A6WH 4GB9A 4F7PB 5DMKA 1WBZA 4PS3A 4IKJA 5FA3A 3WY3A 4P2RB 3TGXA 2F74A 5DRWB 4IJ3C 3Q3GB 3N50A 1K5NA 1M2OA 3FS9A 5CAYB 3WHE1 1IGCL 3U30C 1FL3A 3ECVA 1NIFA 1UEYA 1WBYB 1A22B 4N0UE 5DJCB 1E3ZA 4HD9A 1UXSB 1GIGH 2YA2A 4X0NA 3TO4B 5GS0D 5IVXB 1R0AH 4OAWA 4MHHG 1BBJA 1L5GA 1BXAA 4G8EA 3HR5A 1OXYA 3C08H 1Z3RA 5D5MF 2OTWB 3RURA 2XY2A 1FSKC 5EU4A 3C5JB 3KPRD 1BFVH 5CIPA 3SDXE 3ZDXE 5GGUA 5E8PB 4XMPL 4WFED 1WPCA 2Z92B 2Y1VA 5AW5B 4L8SB 3KWUA 2VDPB 3KWWA 1TVHA 4RQQA 5DQ9B 2R7EA 3OX8B 2YA1A 4HX1A 4XCNB 5T1MB 1NMBH 3SO3C 1ZIAA 3MRMA 4XTRC 1A0QH 3CN4A 1HAUA 1AGDB 2ZWNA 3D39A 4J23A 5D7LD 1NA8A 2PN5A 1A2YA 4BWUA 1JNHB 3R1GL 1DSFL 2K3HA 3D2TA 1L9NA 1CB4A 2PP8A 5IHWA 4HIJB 1QKZL 1NDMA 4M9OA 3S35H 2WIIA 4ZPTA 3WUZA 3DROB 4XOEA 4PY7A 3L3GA 4LKCB 5ETUB 1J8HE 5LNDA 1MCWM 4AUYA 2DQTL 3PWVA 4LOEA 1LTXA 5DD6B 2JE8A 4DKFL 2X1WL 3M7FB 2LU4A 3MV7E 1HCVA 1QG3A 2J72A 3D06A 4KOCA 3ZT5A 2VL4A 3CDCA 4XE5B 3JSSA 4E42B 5C8JA 5E7BA 5CNHA 1YMMA 2IBZY 1NUDA 3N1PC 3SE3A 3ZE2E 4ZFFB 3PQYA 3KPQB 1AKJB 3A5VA 1F4WH 4XVTL 4V1DD 4NN5C 4HKJB 5T1DL 5TFSH 3QE5A 5DUJA 4OCLC 1NAKL 2P43B 5IGXH 5IJCC 3BQUB 5C2BH 5D9SA 4WENB 3QR0A 2F1BA 5MENA 1FA4A 5HHOA 4UUJA 3BRDA 2Q9OA 1TENA 1JDDA 3F7VB 4JFEE 4AT6B 2OMZA 3PF2A 1H6EA 4H7VA 3UEQA 1MRDH 4ICXA 4U1IA 3MRBA 2WNGA 2LTQB 2KZBA 2G9KA 3HPLB 3T77B 1KDJA 3QIBD 1AIZA 4IKNA 4KKAC 4XHJC 1QRND 5FYJU 4HJUA 5IQ9B 3UAFA 4E36A 1XR8B 4FD0A 4AXWA 4NOFA 3B2VH 2ZOKB 2VSCA 4N2KA 4HWEH 1OY3B 4JPQA 3BAEH 5E2UH 3K80A 2FO4A 3RWCA 3FF8A 3T5WA 4NXSA 4IGBA 4P4RA 5JW4N 3B83A 3KPMB 1MFCL 1HHHA 4RNRA 5I5JA 4EE2A 1NC2D 2OR9H 4K7PH 1A9EA 5KG9B 3N0AA 4D0DA 3QDGD 2OQJA 4C58B 1KUMA 1NPUA 3DGGA 3FCUB 4PB0H 4RSYA 1U8MB 5GJTL 3BPOC 1BQLH 3UO8B 1NGWA 4ENEC 1QWNA 1U8PA 4NYLA 3ZKNC 3QXWA 2V9TA 3B1UA 1JNJA 2EIMB 4S1QH 2WXPA 2J8UA 1OAQH 1KC5H 1ZD6A 3V6ZB 4HLZG 3OKYA 3T04D 5EU3A 3U9PH 2NT0A 5AW9B 2W0LA 2GFBB 4C4BA 4AGOA 2YGNA 4UQBA 4NO0B 3WL9B 1OTTD 4YSAA 3ZSSA 3BE1H 4Q4EA 1T89C 3VG9B 4NBZB 3BZEA 1KT2A 1NFDE 2WJ5A 1GSMA 3DX4A 2P7TA 3NJKA 4MAUH 4Y2OB 4YUEL 2EEFA 1CD1B 3O3DB 4MAZA 2FHBA 4K94C 4XPFL 4WHTA 1NBYB 4F2EA 1IZKA 2EYRA 3M17B 4Y19E 4PWEA 4JQVC 4TUKL 4HH9A 2E75C 5A16A 4MQXC 1FH5L 2Y1YA 3GHBH 1G7MB 4CC4C 4BFGA 3MLUL 3OJ2C 3QCUL 4DJMA 2R1XA 2UXGA 4NHUB 3AS0A 3GK8H 5DA4A 4Y2DC 1RZFL 1J8RA 3HPJA 3OJVC 4U3XA 2E9GA 2MPAH 5JIDA 3CZSA 1JPGA 3CN3A 4PJXA 1XF2A 4I3SH 5IMOB 1N19A 4Z1PA 3VXUD 5T3ZE 4TTGA 1LNUB 5L4FA 1KGUA 1RLWA 4FI7A 1KJVA 5FYLL 3CVHA 2X53A 2BP8A 1OCCB 4J7RA 4PJ9D 3BH8A 4K8RH 4X50A 3WE6B 1QEWA 3FU7A 4N2OA 5EO1A 3V8CA 4HJ1A 1HNYA 2F8XC 1FO0A 2VRAA 1A8ZA 4FULA 2OX5B 3ZGIA 1J0IA 3O4OC 1VADA 4NQEE 2HT3C 3QWNA 5CN3A 2FATL 3FAXA 4FG0A 3KLAA 4DKDC 2JLPA 5CEXA 3ILDA 2APWA 2E47A 4KFZC 5AG9A 4YSSA 1NMAL 3L95B 4P5MA 1AQDA 2WHVA 2YOAA 3KPRA 4U3SA 1JHTA 3C9NA 1IQDA 3OWEA 3C09B 1DVYA 1XGUB 5DI8B 1BVNT 4GIAA 2AQRA 3AU1B 5TF0A 3PDGA 3HFML 4YHLL 5DUPL 2P42B 4BJLA 2ZX8A 4NENA 3TFBA 1DDTA 4HXAL 4QRTB 5F1IA 1P6AB 3BUDA 1M53A 3FXIC 4GQ9H 1X5XA 3NFNB 4W1TA 3LIZA 2OMWA 3N6YA 1E27A 1NFAA 3E2HC 3LKSB 3ZTDC 3FHQA 3BSHA 3TEXA 3MREA 4DQOH 4F37K 2WXMA 2OSWA 1JF6A 5D7LA 3Q2NA 1F8TH 1OD9A 2VN7A 4TNVF 2VDRL 3VXRD 5IJVA 1SBSH 2PXYC 5EOCJ 1OWRM 1GRWA 2WN3A 4NBYB 1B6DA 1MQKL 4DZ8A 2NY1D 1KCUH 3QUXB 4LCCA 1AO7B 1PZBA 2QL1A 2CA3A 3DX9A 6FABH 1CFVL 3MGAA 4OLXH 4KAQL 4TVPD 5FX3A 1C8PA 1MW1A 1QSEB 3B9KD 3KYOA 3GJEA 4ZSOE 3SBWC 1QLRA 2CO3A 3CTTA 4IIQA 1VESA 4ZMPA 4EUPA 2Z93A 3KJ4C 2WXOA 1UG9A 5BMFH 4V1DA 2Q10A 5I17B 1U8OA 1XGQB 4DTGL 4QUOA 1IGJA 4LSDA 5AAWC 3UC0H 4E41D 1U92A 1VFBB 4X6DB 1MW2A 1SXAA 4GXUN 4FQPA 3RVTD 3WKML 5KANG 2QTVA 3DIVA 5LBSL 3O6FC 1KCVL 3TURA 5CBEA 1FGVH 5HHNB 4NJ9L 1U9KA 4KQ4H 4TQIA 3QIBA 2P3YA 4E9LA 1QRNA 1BMZA 3QNZB 3DI3B 1H3PH 3F84A 2HLFD 4OVUA 5C08E 2EDYA 2FEDD 3C5ZB 4DOHB 4L8BB 4Y5XB 1WBZB 4Z0XB 3VXTB 1R9FA 4E0RB 3ZZ1A 2D3LA 4N20A 4YEFA 1XCTA 2LGNA 1T83C 3GI9H 1TLMA 3MLSH 1XEUA 4WI4A 1ODUA 3WXVH 1MCOL 1TSHA 2DS4A 2JCCA 3HHSB 4LF3A 5AB0A 5HYQA 1NC2A 1IGCH 1T2QL 4JJ5B 4XT1C 3WNNA 3AU0A 4AEEA 5DJ2A 1J5IA 3IDMB 2MQGA 3QDGA 2B14A 1A8JH 2LQRA 2DWEB 2W60A 3G7TA 5I1HH 1BXVA 1L5GB 4G8EB 2B16A 3RUGA 3HR5B 4XC3H 2PR4H 4H0GA 5C92A 4ODXB 4ZDHB 2HG0A 2R9HD 1OTUD 4JE0A 3K3QA 3IFLH 1M6UA 5FHAL 3T8MA 2OI9C 3QYNA 1IM3B 2I60H 1EDYA 2X4TB 3BSZL 1GH7A 2H9GA 1NKGA 2R2CA 3CNKA 2QADC 4DN4L 4KX7A 1MUJA 2AV7A 1C1EH 3KWWB 1TVHB 3OTTA 2YGOA 4H13C 3MROB 4M93C 3O6ML 1PZCA 2HKAA 1T2JA 2Z6FA 3BPNB 5BO1H 3CG8A 3QUYD 4A6YB 4PJ6A 3APDA 4WJ5A 5LGYA 1A2YB 4YNYA 1ACYH 5F6HI 4DK5A 2P26A 3R1GH 3HVNA 4I0PB 4TPRH 3VCLA 2CCVA 1NDMB 3PUUA 3W5MA 5DRNA 2IAAC 1K6QL 32C2A 3ZRCC 4NQUA 1RJLB 5F1SA 5IW3A 5DRXA 1JHKH 2QLVB 4HK0A 4PJFA 4HVBA 2WBJC 3VXUA 3ULUD 2JQMA 1CI3M 1KXQE 2AQ2A 3QEUA 1EFXD 3QQ9D 4OW6A 3HNTH 4PJ9A 4X5PA 2OXGB 1WS7A 5JLZA 4GQQA 3VI4E 4X4MA 3QARA 4FNLH 1TYJA 5E00B 2H1PL 3RB5A 3WIFA 2WMPA 5J1TC 4G6AD 4XVTH 2AANA 2D73A 3L08A 2X70B 4MNQD 4S2SA 5T1DH 1NAKH 1MWAL 1YPZB 4ZMQA 3RWFB 4YDKH 4JMXA 2DOCA 4UUJB 1IM9D 3ZTNL 3DOHA 1R6VA 1JXGA 2NNXA 3QYCA 2XTJD 1OPOA 4JHZA 5AKSA 1D5ZB 4KTYA 1AZBA 5F9OL 1TJXA 4HCRL 4U1IB 2X4PB 1RJCA 4FGMA 2GBVA 3IFNH 1XSKA 3L5HA 3GXDA 4JM0A 3T3ME 3ULVE 3IFPA 1B3IA 1U8JA 3MTRA 4KJPD 3MRCA 4GKZB 4WCYL 1FRGL 3HHMA 4JR9H 2FT8A 4UQEA 1FNEA 2WWKT 1OAXL 3MBWA 3DMMD 1Q9KA 4IGBB 5BOZG 4MKMA 2P8LA 2E7CA 3HW7A 4H1LA 3VXRA 5DZAA 3SEPA 3VRLF 3QXAA 4RGOL 1MFCH 3VAEA 2W59A 5I74B 4L5FL 5I0VA 2I69A 3RIFK 3IXTB 3D69B 4YHYC 3KVQA 1GZQA 1A1NB 5AOKA 3DGGB 3V52L 1E28B 4B96A 4ZW3A 3DRQA 5EEXA 3GTVA 3B9KA 3TVMB 3UZEC 4DZBA 3INUH 3V4PL 3GMRB 3T3PB 1CXEA 1K8IA 2XX0A 3CFCL 2J8UB 1XXDC 1DR9A 1FE8L 4KGJA 5K9OA 3N0PB 4QRPB 1TKWB 5D7KD 4XXWC 2RJMA 5DHXB 4E41A 1KGWA 1EXUA 4J3SA 4Q56A 2G2NA 2P7TB 4G5ZH 4M5YL 2MKLC 1T5WA 3RL2A 4WHTB 2AS5M 4JDTL 4YUEH 4DPRA 3IKCA 4XPFH 3V5DB 2OMUA 4KNSA 3L9YA 1B4TA 3AG2B 2W80C 1AHWB 3NRQA 2CQVA 2EKSA 3AQZA 4PB9L 1S9YB 4TUKH 3IXAA 3QULA 1I85A 1T80A 2KLSA 3BP5B 3BWZA 3PP4L 4U2ZA 1FH5H 3DVGB 3CLEL 2DKMA 5I8KL 3PV6A 5INCA 3D0VB 4NAQA 2Q76B 3MLUH 1YEKH 3QCUH 5C09B 4HMCA 2Z7WA 2QGBA 1JPGB 1KJ3L 4EN2A 5BS0D 2OPCA 1XF2B 1UM5L 2HRLA 2E3VA 3F6JA 5F7AA 1T6BX 2AKRA 2AXGA 3HNVH 4WO0A 4MRBA 2CO2A 3B7SA 1PKQE 2QDVA 3H7BA 3HUJA 3AREC 3BH8B 2W0KA 5K1JA 3GBEA 2FZ3A 3FU7B 1AG6A 1N0LA 3CMGA 1A6AA 2QPDB 4IYKA 1WD9A 3EBGA 3OXSA 4IRJA 4ETYA 1VADB 3L9EA 4GP5B 3TEWA 4PP1C 3HRZA 2FATH 5CEXB 3KLHD 1YN6B 4Z7QB 5J8OA 2EXWC 1RZQA 1NMAH 3H9SD 4LPUA 5I1EL 1MI5B 4HJTA 5TGBB 4FRWA 4RDQG 4U1LA 1SHMA 3HKZA 1CL7L 1WAPA 1REIA 2UY6A 4MZIA 3HFMH 1L7TL 4YHLH 5DUPH 5H4YA 5K59E 5EBMA 2V2XB 4HXAH 1MREL 2WV3A 1F4HA 3B8YA 5F71A 5GISL 2O5XL 2EDQA 2GIXA 2W92A 2VDQH 25C8L 1KN2L 3QUYA 4KTEL 4FFVC 3KPSE 5DD3H 2WIMA 2CK0L 4TULL 4LPXA 3CHPA 4LLMA 1MLBA 3GS0A 3HE7D 4F1SA 1IQWL 3KPLA 2MIZA 3QJFA 5FHBH 5LXGH 4JFYB 3WTXA 4ZFOB 3HG0A 1CLYL 3CFKB 3U4EA 2VDRH 1UGKA 3WDJA 1C5BL 2N0KA 3HG4A 3EO1B 4ZXBD 4LEBA 3TM6A 5ACZA 5DMGC 1A6ZB 4LSTL 3RL1A 4H2AA 4OV6F 1MQKH 1D7CA 3UTSE 2VR7A 4ZFGL 2IWGA 3DX9B 2HLAA 2XIBA 3UYPB 2VAAA 2VC2H 1KSRA 2BC4A 5HGDB 1CFVH 1P0SE 3MLTA 3DJZA 4AM0B 2J12B 2RBLA 3KYOB 4ZS7L 4PRAB 1EFXA 1GVIA 1KEML 2Y7MA 2X87A 1FV1B 3H56A 2F61A 1I31A 2Z93B 1YEWA 1KB9J 4P2OB 5L0QB 4R4BA 3QHFL 2QGCA 3P4OA 2CBPA 1U8OB 2HFEA 2V5SA 3NRPA 4XI5C 1FFTB 1NWPA 2FJUB 2GT9B 1MW0A 3PNWB 2CIIB 4F2MA 4DTGH 4NZUH 1Z9PA 1S8DA 4JKLA 2H1LM 5AZ2L 5HGHA 3RDTB 1FJ1A 1RAMA 3A47A 4BFBD 1IKFL 4IS6A 3WGUB 1HHIB 3ZQ9A 1FVEA 2EIEA 2EXYC 3B1TA 3CN0A 3IJSA 1GTFA 2UXVA 5E5RB 5B4MD 5LBSH 1JPTH 2DJSA 2KMWA 5J1AB 1WDAA 2ZF9A 1BVKA 3RJQB 4TSCL 1R33A 3QIBB 4NJ9H 4HKBA 4ZMTA 2FCBA 1QRNB 3TH3T 3WNPA 2Y2YA 3HG1B 5AQ0A 1ZVSB 4UYQA 1T5KA 5L2JB 1P7QB 1WA0X 2XWTA 3EYOB 2G9HB 3KPNB 5LG6A 5IREA 2VDKH 3T2PA 3DMMA 4NUQA 5JIQA 2WQVA 1JZHA 2VWEE 4I88A 3WENA 1XDTT 3RGBA 3HI5H 1PD6A 1NC2B 2YWYA 1MCOH 3RYMA 3FT4A 3SDAB 4BUGA 4IBVA 5D4HA 1S78C 4P2RE 1O6SA 4AIZA 1T2QH 1P84K 2C26A 1IBYA 3JBG7 3P9LA 1IKOP 5I8EA 1I9IL 1Q9LA 1U42A 3LB6C 4BA8A 3KLKA 3PYCA 3QDJB 1A3LH 4P57A 5FKAA 3S6CA 5FFOA 4RMVA 4KKZA 1YDPB 5IVXE 5J89A 3THMH 5FHAH 1UYWH 1L6ZA 3DJTA 3QPQC 5C0CD 2C1PB 1BD2D 2VZSA 4WDIA 3WLWC 1Z32X 4QI3A 1MUJB 3V9FA 2AV7B 4ANWA 2OZ4L 4Z7UA 4DN4H 1S5HA 3WFCH 4Z7VB 3V4VA 5KVDH 1KTJA 2NY0D 3O6MH 4HWBL 3R8BB 2IXQA 4WO4C 4KXZI 3WXWH 2G0LA 4OD3H 4OSUL 5JW3H 4O2CB 5GRXG 1BFOA 3RFZA 1FDLL 5CEYA 5HD8D 5FYKU 3RPBA 3VM5A 3HB3C 4ZO9A 3T4YB 5F6IB 4MAYB 1ZXQA 4HALA 3V7AE 2A6JA 4R97B 3VCLB 2IGLA 3LIUA 3SPVB 5GZOD 3TYGL 4ZMZA 1LO0L 3PWPD 4GAGL 5BS0A 2DTSA 4GKSA 4UB0L 4XVUC 4HK0B 1WZKA 1NGZA 1QFWL 5ALCL 4ZOEA 4M7LL 3QQ4A 4LQ1A 2ZP8A 3GMNA 1G7LA 4Y5YC 4LSSL 1INQB 3QEUB 4FP8L 4DQAA 3LDBB 3GHEL 1G7PA 1BZOA 3IJYA 5JLZB 1QLFA 5AVSB 3IRPX 4P5TD 3WIFB 5JOPE 5K93A 3F7YA 1NEZB 4BA0A 2H1PH 4GMTH 2I85A 2VZUA 3WY1A 1ADQA 3GBNL 3VJ6B 1AR2A 1Y07A 2V9QA 2EDLA 1CFTB 2H2SD 4JM4L 3TFKD 1UWXK 3AQDA 2XWCA 3BW9B 3MRJA 5HYIA 3ZTNH 5C97A 2A0LD 1WT5A 3QQNA 5C70A 2X2YA 3K6DA 1J12A 1VF5C 1KG0B 4LVOB 3H9SA 3VFRB 3VXOA 1MCWW 4I1PA 3AB0B 3V5KA 2HG5A 1WZAA 3HFFA 2AQ1A 4HCRH 4XNQA 3UTZB 2R2HA 4GPVA 4HXBL 5A2KH 1E6OL 1KBGL 4JHAL 4M1CD 5IHZA 3IU4H 1SBBA 2NCEA 2X88A 1WH0A 2A7BA 3HS0C 4MXWL 2Q8BL 1U8JB 3LAFA 4PIRF 4ZYKB 5KYYB 2PCFA 3RPIA 2ZX6A 1J1PH 3ARFC 3CWGA 1ZTXE 4M4RA 2F7IA 1DEEA 1T20A 2GJJA 4KFMA 4M7JL 1FRGH 1Z0NA 4OJEH 3BDXA 3Q43A 4YPJA 5BOPA 1Q9KB 3EH1A 4F8PA 3HE7A 3P3YA 2YEQA 3GUFA 1VEOA 1KB3A 5I18L 1P4BL 3IU3A 3LN4B 3ZR5A 1F2XK 5EORL 1H3XA 5HI4D 1DBBL 2WXGA 2PP9A 4PLKD 3IN0A 4HIXL 4PSPA 4F80A 1JOIA 4NNXB 4ZXBA 5EU5A 2XXGA 4PLJD 4JFQA 4QD2E 4CMMA 4L5FH 1UASA 4BQBA 3U2SB 3L5XL 1W91A 2IC2A 5IBTL 2EZ0C 2NX5D 3MO1B 3QCTH 1IEHA 5MERA 3V52H 2RACA 3B9KB 3N44F 3FCSA 1QFUH 4ADIA 3B8SA 1FZKA 4P4KB 3D4YA 1JTPA 1J1XL 4AQEB 4AKOA 2AMUA 3ARBD 3GMPB 3DSFL 2CKNA 5JPMC 5DO8A 5E1HB 4I89A 1G6VK 4E41B 5D1QB 5ACMA 5BRZA 4YHML 1XGPA 4MDIB 3DBXA 3UTQA 4BZ2A 4G7SB 1Q1JL 1S9WB 4CSZA 4PY8J 5TDNA 1OWWA 1Z5LA 5D5MA 1IZJA 4RMSA 3LV3A 4R84A 1CJYA 2WVVB 3CLEH 3STLA 3FN3A 4UU9B 3TC9A 5I8KH 4H26B 2Y7QA 2EH8L 2WTPA 1K72A 1JZGA 1KJ3H 4G6FD 1NDGA 3TNMA 1F11B 2AXGB 1UM5H 4M1DL 3RGHA 3MZTA 2B59B 3IYLW 5DUML 1U8QA 3HUJB 4MFHA 1QATA 4ZRGA 2CRMA 3MGTA 3EF4A 2FBJL 4RBPH 1J0ZA 2J2ZB 4AJ0A 4W81A 5MI0C 3H1ZA 5FGBA 4GINA 3IPFA 3VX0A 1ZGLA 1J9CT 1JPFB 4J4PD 3ALPA 3GB7B 1R24B 1YHPA 3ZPDA 1OHZA 1SHXA 4PJEB 1E9OA 5JDSA 2HTLC 2KHAA 2MKWA 2HRPL 1KIUB 4Z3EA 2BZDA 4G72B 3CGTA 3IMTA 5BVPH 5GS2H 1OTSC 2V2TB 1IAIL 4OV5A 4MD4B 2Y07L 5C0CA 1GGYA 2IADA 1BD2A 3AW5A 1WWAX 4WGWB 4BH7A 5EBMB 2FJFA 1FVCB 2ATKA 1BZ7A 5FECA 2G2PA 1MREH 3OKDA 5GISH 2VM3A 2Z7UA 3SE9H 5E2TH 3G5WA 25C8H 4HUMB 4WAFA 2V3DA 4Z9KB 1NEUA 2CK0H 1N8ZA 3QJFB 3WDHA 1IO4C 3MV9A 4JY5L 4OB5L 3G6AB 5D2LF 1IQWH 1V3KA 1UXMA 3N41F 2HVKA 5HYSA 3GSOB 2G3MA 3VFOB 5GZOA 4I77L 1C5BH 1R3LA 1Z9NA 3NZ8A 3PWPA 3RL1B 4YMPA 1RH8A 1JK8A 4YSOA 3I2CL 1VCAA 5L4JA 3VE0B 3MCLL 3NABL 3ALWA 5SWSE 4J3XA 1Z5YD 2OAAA 3SDCB 4ISVA 2IH8A 4ZS7H 1AO7E 4BEIA 4F7CA 3DKHA 1KEMH 1OAKL 2H3NB 5I26A 3CU1A 3ATDA 3GS4A 4XP4L 3VFPA 3Q1SL 3ZZQA 4FNRA 1QSEE 4P5TA 4R4BB 1U3JA 3P4OB 3QEHB 4GS7B 1QUNA 1G1OA 5EBLA 3WJLC 1BAFH 1X9QA 3QHFH 4MNQB 3UZQB 4F2MB 1TZHB 3EDFA 2ZPKL 1E9QB 1KJMA 5HGHB 4FC3E 4TQPA 3NCWA 5AZ2H 1IM9B 1HT6A 2J4WH 3PL6C 5E6IC 5T5NG 2VC2B 4IS6B 2NQDA 3IJSB 5INDA 1IKFH 1N6UA 2XTJB 3I50L 3NJIA 1JRHH 5T1KD 2IH1A 4X6DE 1ZPUA 2Z1PA 1BV8A 3PCYA 4EIGB 1ICTA 1BVKB 2O5YH 3VRJA 1ZE3H 2H26B 4TSCH 1BZEA 1L9PA 3W9DA 4LLUA 5DD5L 1TG8A 2Q2EB 4I3RH 4N1EA 3CPLA 5L9DL 4J3OC 3GSQB 4OQTL 1YUKB 2PWHA 2Q20A 2H32H 1I8LA 5F0PB 2OMVB 4HS3A 1F0LA 3UMTA 2V3EA 2ESVB 3U4AA 3DMMB 4R5TA 4Y1AD 2CKBA 1CDHA 3N43B 3WKYA 1X5IA 1BWMA 1SY6L 5KOVC 2DQUL 5HPMA 4L9LA 4DOHE 3QO0A 4W9LC 2O6DA 4PCTA 3B3BA 1I1FA 3RI5K 3GXNA 1WAEA 1L7IL 1NGPL 2F7RA 1E3XA 5C0BB 2VABB 4IQHA 3S36H 2GSIA 3FT4B 4WF7A 1PD0A 1O6SB 3GGWB 1EZLA 4QHLB 5IB3B 2VB5A 1X7SA 3IM1A 1U8IA 1C5CL 3FZUC 5DXWA 1INDL 2NX5A 2WN2A 4QGYA 2Y23A 3RZCB 2DZEA 4DP2X 4G82A 3OQRA 1CGYA 5EDSA 4JKMA 4P57B 3AG3B 5E08H 3DVIA 1KXVC 2X6AA 4F91B 1MFMA 3MBED 5AKVA 4RA0C 3AG4B 2DQMA 2AC0A 5JZ7D 2J43A 2ZUQC 4UT9A 2GTZB 4DKEL 4F8QA 2PW2A 5KYXB 1NIDA 2R8SH 1GS7A 4CVWA 3OZKA 5IM7A 2E74C 3ELQA 4Z7UB 4RFNB 2Q7AA 2OZ4H 3DVNB 3WYRA 4Y8AA 2ZJSL 4B0MB 2E76C 1CTNA 1HSAA 1AR1D 1FYTB 3OAWA 4ZW5A 3BWSA 1KYAA 4P23C 2H45A 2VR5A 3GC3A 3QFGA 4OSUH 3UJJL 2IDTA 4LXFA 3CZEA 2W65A 5MEQB 2MRYA 5GZND 4EI0A 1Q72L 3Q01A 5HVHB 1FDLH 3PU7A 5KEZA 1SJEA 2FR4A 1UH3A 2A6JB 3PE9A 4PYHA 1OSZB 3CPUA 2NR6D 1MCFA 5JO5B 4UM8A 3TIDA 4EXKA 3TYGH 4XCFL 1T22B 4F7EA 5H37A 2YPVH 3IMVA 3BOVA 4GAGH 1NC4B 4GQZA 2JFCA 4PV8B 2V5YA 2A6IA 4OI8A 4U6HB 4IOFD 4R0LA 4D9QD 1QFWH 3GMNB 2DMBA 5ALCH 4OY9A 1CGSH 1NL0L 4YDIL 2MCAA 4C59B 4L2LA 5DHYB 3RJDA 4PJBA 2IPTL 4HHWA 3IJYB 3GHEH 1QLFB 3AABA 3ASOB 2ARJA 2Z35A 4R96A 1WP6A 5AW0B 3A23A 1G9HA 3F3HA 3GSNB 3AY2A 3AM8C 5HDBF 2BSSB 4FYTA 2YUZA 4J4PA 5DD1L 1E5UI 4DP9X 3E9UA 2EDHA 3O2WL 3GBNH 1BQHG 1JWMB 3QGVA 4NZ8A 3IS0X 1GMEA 4B9YA 4A7QA 4IU3A 4W70A 4CGTA 1Q0EA 1YPZE 5HYJB 4WNSA 4OCWL 1U8HA 4OUUA 2DL9A 1KGXA 3EYUL 1I7RA 1NMCC 1JRHI 1NCDL 2CO4A 4XNQB 1S7WB 1WZ1L 2IFFH 1E6JH 2X6UA 2XKNA 3RTQD 3PHOA 3T9WA 4U6YB 1HHKA 1L3NA 4HXBH 4JDZA 5FYJL 5IHZB 1E6OH 1KBGH 2FX8H 2WZ0A 2LFEA 3QB7C 1MRCH 2DN7A 2K8QA 4JL2A 2F19L 3QUMB 3BD5A 4FKHA 4R3SB 1JGVH 1NCCH 2Q8BH 3MGOB 4LCWA 1PQZA 1LDSA 2XVLA 3ARGD 5E5MB 4ELMF 5JHDB 3NG5A 3RX9A 3LVTA 4Y4KA 3WS6C 1PNDA 2AITA 5JQ6H 2YGVA 4M7JH 5D6DC 4MBRA 4RIRA 3EKCA 2VLRD 2HX9A 5IB1A 1MDAA 1XIWC 2ZP9A 4U1MB 2YBGA 5E23A 2F58H 5EORH 1WUNT 2GSGA 1DBBH 2J6EL 2CGZA 5IW1B 1LDPL 3NDZE 2IQ9L 1WFIA 1XX9C 4NQDE 2ZKWA 3WIHA 4HIIB 1G6RL 3L5XH 1JTTA 3IGAB 5HY9B 1QYGL 2BM3A 2JTDA 1EJOH 4IDLA 4HJEA 1QA9A 3ORJA 3MYZA 1WF5A 3DRTA 1T0MB 3IETA 4JY6B 5DA0B 1F3DH 1NCTA 3S2AA 4JZOB 2FNWA 5F7BA 1A4KB 3ASNB 4LNRA 3V4LA 4BSJA 4CBZA 1J1XH 4Y5VC 5K9QI 1XVSA 1GGCL 3EAKA 4LPCA 2CPCA 2X2JA 3KPOA 4XBPB 3T3PE 1VACA 2VTFA 5CLZA 1PCSA 4PWJA 5FA4A 2J8UE 1KPUA 2GTQA 2SEBA 1R4XA 2NXYD 4QRPE 4YHMH 3VX1A 1W15A 3IBEA 1Y7VA 3CDGB 4N24A 3F85A 3QI9D 1OAYL 2QMJA 5BV7L 4FL4B 2PWGA 3WTUA 3CDZA 2BZCA 5T1KA 1WRFA 1ZEAH 1X3DA 4OD2A 2E4FA 2FSEB 4N6QA 1FFOB 5D5MB 2WO2B 4MRCA 2CGRH 1HXYA 5D8JL 1PG7W 4KRNA 4KK8D 3QIUD 2XWEA 8PAZA 1U3NA 2X4RB 3VVWA 4X5RA 3OB0H 4UQ2A 4FXGA 4YJZL 5BJTA 2JLLA 4KHTH 1RVFL 1R3IH 1Y0LB 5C09E 4R2GB 5H94A 1UT1A 4DO6A 4Y1AA 4WW1B 5F0LB 3BGAA 1QFWI 5DUMH 1S7SB 2VO5A 4LVEA 3UAJD 2BSED 4JVUA 4QXVA 4JRWA 1I1YB 2QVFB 4FFYL 2FBJH 2MCPL 2HYMA 2H2PD 2E56A 4QXWA 1BFTA 3TA3D 4OFVA 4DVRH 1ZGLB 4MZ3A 3NPZB 4OIIL 3JT2A 3P77A 5DFVC 2VDLB 2R56L 5KYWB 5JDSB 4FQXB 3EH4B 2QJDA 3FCGA 5E0FA 4N8PA 4BZ1H 2ZX9A 1H19A 4W9HC 2HZHA 3MBEA 4NQCB 3VD0A 3DJ9A 3G08B 3QXUA 3HE6C 3PABA 1Z9SB 1BD2B 3IRCA 4Z7QE 3UPRB 2L7EA 2Y07H 1CUOA 4S10A 1I8IA 3PFQA 1MI5E 1DFXA 1CK0H 2H0JA 5CD3A 5IMMB 3BX7C 1AKPA 5D7EA 3CZUB 3QZWG 4JM2C 1HE7A 1YEFH 3AY4C 4Q0XL 3I6SA 3U1SL 4EN3A 4K3DH 4JY5H 4U1SB 3C87A 4OB5H 2HVKB 1XH2A 4UAHA 1EXGA 2WO4A 5CJBA 5FGSA 4A7UA 1AGFA 2NR6A 4QTHB 1SVCP 3NZ8B 5IMKA 4I77H 4YX2L 3ECBA 3CZFB 5J12B 3BVNB 3GXTA 4BUHA 5E4OA 3I2CH 4XRCA 3MCLH 3NABH 4HZLA 1D6VH 2AJSH 1JZDC 4QYAA 3JV4B 1P9MC 1P5UC 4LASL 4F7CB 3WSQL 4XNMA 4JZNA 2BRQA 4XXCA 5DK2A 1A1MB 4YBLB 1OAKH 3BIBX 1MOEA 4P5TB 4K8RD 3Q1SH 1MCSA 1QUNB 4E9VA 5L4MA 4BHUI 3O4LD 4UZSA 4K5OA 1RERA 3D30A 4PBXA 4R7LA 5D1XB 1VKXB 4A38A 6PCYA 3HZVB 3VXPA 2IALA 3NH7L 4QRSA 3WS3B 4Q97A 3B2UD 1ZS8B 3VD4A 4O9HL 1ED3B 2CLZB 1F3RB 4HLZH 4I48A 3WEMA 5FXCH 3I50H 4BFEA 5CD5C 4PH8A 4WTWA 2XTSA 2YD1A 3MJ7A 2JKWA 4QWWC 3UJIL 3UDWC 4RVBA 3Q8CA 4UOW0 4MXQD 3R7QA 3IDIA 4LCYA 3OHXB 2B08A 3RTQA 5I23A 2WXRA 3FRUB 5KS9B 1LQSR 4K3EL 4HA1A 2DBLH 2OXHA 4CMHC 3CPLB 1VHPA 5DD5H 7TAAA 3RHWF 4OGQC 3JWNE 3M86A 4OQTH 5AYQA 3ARGA 1UXWA 3SIKA 4B60A 3UGXA 2CKBB