1PN5A

Nmr structure of the nalp1 pyrin domain (pyd)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
93
structure length
93
Chain Sequence
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the apoptosis- and inflammation-related NALP1 pyrin domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords NACHT-, LRR- and PYD-containing protein 2
total genus 23
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1pn5A00
4A2QA 2DBFA 2KM6A 2BBRA 2N97A 1A1ZA 2P1HA 2OF5H 1DGNA 1PN5A 4O9FA 2BBZA 4O9LA 1CY5A 3LQRA 4F42A 2A5YB 2O71A 4RHWE 4NQKA 2DBDA 3T6PA 4EWIA 4M9ZA 1Z6TA 2YQFA 2MB9A 4N1LA 3EZQB 2DO9A 4D8OA 2DBHA 1NGRA 4M9SA 2L6AA 1D2ZB 2MN4A 2IB1A 3CL3A 3J63A 2DBGA 2A9IA 2YGSA 4IZAB 3YGSP 3LQQA 3MOPG 4E9MA 3J6JA 4JUPA 2N83A 2N7ZA 2YU0A 4I16A 3YGSC 1N3KA 2MPCA 4UZ0A 1WXPA 1E3YA 4O6XA 1ICHA 2L9MA 4P4HA 2LWEA 4F44A 4N1JA 4FH0A 2LS7A 4QOBA 2NAQA 4O7QA 1UCPA 4RHWA 2KN6A 4N1KA 2D96A 2MS8A 4DWNA 2M5VA 2NSNA 2MS7A 1WH4A 3EZQA 2F1SA 4M9XA 2N1FA 4IZ5E 1YGOA 3QF2A 1A1WA 4P4HI 3MOPK 4A2WA 2GF5A 4JQWA 1D2ZA 2G7RA 4LWDA 4ZBWA 2LWDA 3CRDA 3KATA 1DDFA 2N80A 1WMGA 1C15A 1FADA 1CWWA 1E41A 2N00A 2OF5A 4IZ7B 2VGQA 2B1WA 2YVIA 2HM2Q 2NZ7A 3MOPA
chains in the Genus database with same CATH superfamily
4A2QA 2DBFA 2KM6A 2BBRA 2N97A 2XV9A 1A1ZA 2P1HA 2OF5H 1DGNA 1PN5A 4O9FA 2BBZA 4O9LA 1CY5A 3LQRA 4F42A 2A5YB 2O71A 4RHWE 4NQKA 2DBDA 3T6PA 4EWIA 4M9ZA 1Z6TA 2YQFA 2MB9A 4N1LA 3EZQB 2MJMA 2DO9A 4D8OA 2DBHA 1NGRA 4M9SA 2L6AA 1D2ZB 2MN4A 2IB1A 3CL3A 3J63A 2DBGA 2A9IA 2YGSA 4IZAB 3YGSP 3LQQA 3MOPG 4E9MA 3J6JA 4JUPA 2N83A 2N7ZA 2YU0A 4I16A 3YGSC 1N3KA 2MPCA 4UZ0A 1WXPA 1E3YA 4O6XA 1ICHA 2L9MA 4P4HA 2LWEA 4F44A 4N1JA 4FH0A 2LS7A 4QOBA 2NAQA 4O7QA 1UCPA 4RHWA 2KN6A 4N1KA 2D96A 2MS8A 4DWNA 2M5VA 2NSNA 2MS7A 1WH4A 3EZQA 2F1SA 4M9XA 2N1FA 4IZ5E 1YGOA 3QF2A 1A1WA 4P4HI 3MOPK 4A2WA 2GF5A 4JQWA 1D2ZA 2G7RA 4LWDA 4ZBWA 2LWDA 3CRDA 3KATA 1DDFA 2N80A 1WMGA 1C15A 1FADA 1CWWA 1E41A 2N00A 2OF5A 4IZ7B 2VGQA 2B1WA 2YVIA 2HM2Q 2NZ7A 3MOPA
chains in the Genus database with same CATH topology
4A2QA 2DBFA 2KM6A 2BBRA 2N97A 2XV9A 1A1ZA 2P1HA 2OF5H 1DGNA 1PN5A 4O9FA 2BBZA 4O9LA 1CY5A 3LQRA 4F42A 2A5YB 2O71A 4RHWE 4NQKA 2DBDA 3T6PA 4EWIA 4M9ZA 1Z6TA 2YQFA 2MB9A 4N1LA 3EZQB 2MJMA 2DO9A 4D8OA 2DBHA 1NGRA 4M9SA 2L6AA 1D2ZB 2MN4A 2IB1A 3CL3A 3J63A 2DBGA 2A9IA 2YGSA 4IZAB 3YGSP 3LQQA 3MOPG 4E9MA 3J6JA 4JUPA 2N83A 2N7ZA 2YU0A 4I16A 3YGSC 1N3KA 2MPCA 4UZ0A 1WXPA 1E3YA 4O6XA 1ICHA 2L9MA 4P4HA 2LWEA 4F44A 4N1JA 4FH0A 2LS7A 4QOBA 2NAQA 4O7QA 1UCPA 4RHWA 2KN6A 4N1KA 2D96A 2MS8A 4DWNA 2M5VA 2NSNA 2MS7A 1WH4A 3EZQA 2F1SA 4M9XA 2N1FA 4IZ5E 1YGOA 3QF2A 1A1WA 4P4HI 3MOPK 4A2WA 2GF5A 4JQWA 1D2ZA 2G7RA 4LWDA 4ZBWA 2LWDA 3CRDA 3KATA 1DDFA 2N80A 1WMGA 1C15A 1FADA 1CWWA 1E41A 2N00A 2OF5A 4IZ7B 2VGQA 2B1WA 2YVIA 2HM2Q 2NZ7A 3MOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2Q A;  2DBF A;  2KM6 A;  2BBR A;  2N97 A;  1A1Z A;  2P1H A;  2OF5 H;  1DGN A;  1PN5 A;  4O9F A;  2BBZ A;  4O9L A;  1CY5 A;  3LQR A;  4F42 A;  2A5Y B;  2O71 A;  4RHW E;  4NQK A;  2DBD A;  3T6P A;  4EWI A;  4M9Z A;  1Z6T A;  2YQF A;  2MB9 A;  4N1L A;  3EZQ B;  2DO9 A;  4D8O A;  2DBH A;  1NGR A;  4M9S A;  2L6A A;  1D2Z B;  2MN4 A;  2IB1 A;  3CL3 A;  3J63 A;  2DBG A;  2A9I A;  2YGS A;  4IZA B;  3YGS P;  3LQQ A;  3MOP G;  4E9M A;  3J6J A;  4JUP A;  2N83 A;  2N7Z A;  2YU0 A;  4I16 A;  3YGS C;  1N3K A;  2MPC A;  4UZ0 A;  1WXP A;  1E3Y A;  4O6X A;  1ICH A;  2L9M A;  4P4H A;  2LWE A;  4F44 A;  4N1J A;  4FH0 A;  2LS7 A;  4QOB A;  2NAQ A;  4O7Q A;  1UCP A;  4RHW A;  2KN6 A;  4N1K A;  2D96 A;  2MS8 A;  4DWN A;  2M5V A;  2NSN A;  2MS7 A;  1WH4 A;  3EZQ A;  2F1S A;  4M9X A;  2N1F A;  4IZ5 E;  1YGO A;  3QF2 A;  1A1W A;  4P4H I;  3MOP K;  4A2W A;  2GF5 A;  4JQW A;  1D2Z A;  2G7R A;  4LWD A;  4ZBW A;  2LWD A;  3CRD A;  3KAT A;  1DDF A;  2N80 A;  1WMG A;  1C15 A;  1FAD A;  1CWW A;  1E41 A;  2N00 A;  2OF5 A;  4IZ7 B;  2VGQ A;  2B1W A;  2YVI A;  2HM2 Q;  2NZ7 A;  3MOP A; 
#chains in the Genus database with same CATH topology
 4A2Q A;  2DBF A;  2KM6 A;  2BBR A;  2N97 A;  2XV9 A;  1A1Z A;  2P1H A;  2OF5 H;  1DGN A;  1PN5 A;  4O9F A;  2BBZ A;  4O9L A;  1CY5 A;  3LQR A;  4F42 A;  2A5Y B;  2O71 A;  4RHW E;  4NQK A;  2DBD A;  3T6P A;  4EWI A;  4M9Z A;  1Z6T A;  2YQF A;  2MB9 A;  4N1L A;  3EZQ B;  2MJM A;  2DO9 A;  4D8O A;  2DBH A;  1NGR A;  4M9S A;  2L6A A;  1D2Z B;  2MN4 A;  2IB1 A;  3CL3 A;  3J63 A;  2DBG A;  2A9I A;  2YGS A;  4IZA B;  3YGS P;  3LQQ A;  3MOP G;  4E9M A;  3J6J A;  4JUP A;  2N83 A;  2N7Z A;  2YU0 A;  4I16 A;  3YGS C;  1N3K A;  2MPC A;  4UZ0 A;  1WXP A;  1E3Y A;  4O6X A;  1ICH A;  2L9M A;  4P4H A;  2LWE A;  4F44 A;  4N1J A;  4FH0 A;  2LS7 A;  4QOB A;  2NAQ A;  4O7Q A;  1UCP A;  4RHW A;  2KN6 A;  4N1K A;  2D96 A;  2MS8 A;  4DWN A;  2M5V A;  2NSN A;  2MS7 A;  1WH4 A;  3EZQ A;  2F1S A;  4M9X A;  2N1F A;  4IZ5 E;  1YGO A;  3QF2 A;  1A1W A;  4P4H I;  3MOP K;  4A2W A;  2GF5 A;  4JQW A;  1D2Z A;  2G7R A;  4LWD A;  4ZBW A;  2LWD A;  3CRD A;  3KAT A;  1DDF A;  2N80 A;  1WMG A;  1C15 A;  1FAD A;  1CWW A;  1E41 A;  2N00 A;  2OF5 A;  4IZ7 B;  2VGQ A;  2B1W A;  2YVI A;  2HM2 Q;  2NZ7 A;  3MOP A; 
#chains in the Genus database with same CATH homology
 4A2Q A;  2DBF A;  2KM6 A;  2BBR A;  2N97 A;  2XV9 A;  1A1Z A;  2P1H A;  2OF5 H;  1DGN A;  1PN5 A;  4O9F A;  2BBZ A;  4O9L A;  1CY5 A;  3LQR A;  4F42 A;  2A5Y B;  2O71 A;  4RHW E;  4NQK A;  2DBD A;  3T6P A;  4EWI A;  4M9Z A;  1Z6T A;  2YQF A;  2MB9 A;  4N1L A;  3EZQ B;  2MJM A;  2DO9 A;  4D8O A;  2DBH A;  1NGR A;  4M9S A;  2L6A A;  1D2Z B;  2MN4 A;  2IB1 A;  3CL3 A;  3J63 A;  2DBG A;  2A9I A;  2YGS A;  4IZA B;  3YGS P;  3LQQ A;  3MOP G;  4E9M A;  3J6J A;  4JUP A;  2N83 A;  2N7Z A;  2YU0 A;  4I16 A;  3YGS C;  1N3K A;  2MPC A;  4UZ0 A;  1WXP A;  1E3Y A;  4O6X A;  1ICH A;  2L9M A;  4P4H A;  2LWE A;  4F44 A;  4N1J A;  4FH0 A;  2LS7 A;  4QOB A;  2NAQ A;  4O7Q A;  1UCP A;  4RHW A;  2KN6 A;  4N1K A;  2D96 A;  2MS8 A;  4DWN A;  2M5V A;  2NSN A;  2MS7 A;  1WH4 A;  3EZQ A;  2F1S A;  4M9X A;  2N1F A;  4IZ5 E;  1YGO A;  3QF2 A;  1A1W A;  4P4H I;  3MOP K;  4A2W A;  2GF5 A;  4JQW A;  1D2Z A;  2G7R A;  4LWD A;  4ZBW A;  2LWD A;  3CRD A;  3KAT A;  1DDF A;  2N80 A;  1WMG A;  1C15 A;  1FAD A;  1CWW A;  1E41 A;  2N00 A;  2OF5 A;  4IZ7 B;  2VGQ A;  2B1W A;  2YVI A;  2HM2 Q;  2NZ7 A;  3MOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...