1PNEA

Crystallization and structure determination of bovine profilin at 2.0 angstroms resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
b'AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
publication title Crystallization and structure determination of bovine profilin at 2.0 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Actin binding protein
total genus 39
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1995-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1pneA00
1PRQA 5FEGA 1CQAA 2V8FA 1D1JA 4X1LA 2VK3A 2B95A 1ACFA 5EM1A 1PNEA 3NULA 3CPTB 1HLUP 2V8CA 1SKOB 1J3WA 1FIKA 2JKFA 3UB5P 3LGOA 1VETA 2ZL1A 5EVEA 1SZVA 1Y4OA 4D60A 3MS6A 4X1MA 1CJFA 3NECA 2PBDP 5FEFA 3L7HA 3U4LP 5FDSA 3MSHA 3LEQA 1VETB 1A0KA 2HZ5A 1G5UA 1VEUA 1CF0A 1FILA 5EM0A 4X25A 1AWIA 2BTFP 1F2KA 1K0KA 3T1SA 4QWOA 3L9KA 3D9YA 4FTXA 3T1XA 2E8JA 2PAVP 2JKGA 1Z09A 2ZL1B 2ACGA 3KYEA 1VEUB 3T1RA 4FUWA 1PFLA 3CHWP 3CPTA 3DAVA 1YPRA 4ESPA 3T1QB 2PRFA 3T12B 1SKOA 5EV0A
chains in the Genus database with same CATH superfamily
3E2KA 2Z6CA 5G4ZA 2HPBA 4OP8A 2GJ3A 3LICA 2DMWA 1RGYA 3UN7A 3UE3A 3V5MA 3G6OA 1OJGA 1U60A 3TG9A 1KGEA 3K3CA 1KVMA 2Y2MA 1BLPA 1FIKA 3V67A 4DJ2A 2O9AA 1XJ2A 1K38A 3VFHA 3DWKA 3SH8A 3I7JA 4JF5A 3GV9A 4DXCA 1W7FA 4DXBA 1ZHHB 1XGJA 3E4PA 1AXBA 4S2IA 1XPBA 2WKEA 4Y0UA 3LEQA 1FCNA 2JBFA 1GA0A 4WLAA 3IWIA 1BLHA 1YLZA 4DN0A 1DRMA 1VQQA 5AQBA 2K7SA 3BLSA 3G34A 4HBTA 2HDUA 4GZBA 2VGJA 4KUKA 4BMWA 4MN7A 1ZG6A 2JKGA 4L0LA 4ZDXA 1G6OA 1YMSA 2HGVA 1L3LA 1IOUA 3FG8A 1UWNX 4R0QA 1ESIA 2ZMVA 4BBTA 5KSCA 5A93A 2XA7M 4F94A 4HQAA 2OLUA 5EVID 1DP9A 4Y0TA 5EV0A 2BASA 2HV1A 1KDSA 3QP2A 5KIZA 3N7WA 4N9LA 1MBLA 1K55C 1S1YA 2JKTM 4WUJA 4BD0A 1W8YA 3WS1A 2ZQ7A 4YWZA 3N8LA 4DDSA 4HNBA 4ZAMA 4OPRA 1IYSA 2AVXA 5F82A 4NKPA 4NXEA 4C6YA 2FFYA 4ZJ1A 3JYIA 3P7NA 3LYXA 3MS6A 2IA2A 2C5WB 5K5BA 1BUEA 5FI2A 2W3GA 1LSXA 2X71A 5A8BA 1ALQA 5HAIA 2GNXA 5DFXA 2P08A 3FV7A 4GW9A 3S22A 1CEFA 2BG1A 4X68A 5HWTA 4KQRA 2VV7A 2ZQ9A 1K4FA 4I38A 3WS0A 3UB6A 4FTXA 4GN2A 1KE3A 4BWIA 2OSUA 3LY3A 1NRFA 5L09A 2KLIA 4ETZA 2QMIA 3OLOA 4LV2A 1HTZA 4I3AA 5HL6A 2D01A 3LR0A 4L9EA 1HVBA 3C7VA 2Y2QA 1PWDA 3T4SA 2X01A 1D7EA 3R7WB 1E25A 4ZTKA 4JGOA 3QNCA 4EUVA 3FYZA 4I5SA 3VP3A 3MXSA 2QPNA 1P9RA 4X53A 1YLWA 4N1HA 2V8FA 1CI8A 1D1JA 2QKPA 5HDDA 1JVJA 5HSQA 3NULA 4R4SA 2V1ZA 3A3EA 3S7OA 3W2ZA 4X69A 2P9VB 5D3OA 1NJ4A 4L9FA 2PU4A 1XXMA 2OWJA 3S7PA 3KX0X 5F68A 3OC2A 4GOGA 1IKIA 2D02A 1YMXA 5F6AA 2VZWA 3LFVA 5DF8A 2ZMFA 4LFUA 5GLAA 1ES2A 4OPQA 5CECA 1K6RA 4JF4A 4K91A 5FL3A 1J9MA 4BLMA 2EFUA 2J7VA 3UE1A 1TDLA 3EOIA 3EQUA 4FH2A 1T1AA 2VKSA 5FDSA 1A0KA 1VEUA 2O9BA 4JGPA 4CLCE 4F3LB 4NETA 1LL9A 4R6LA 1L0EA 3Q82A 1LT0A 3L9KA 2EX8A 3IF5A 2E8JA 5FAOA 2WKRA 3FKWA 4LV3A 2B18A 1DP8A 1ES4A 2UWXA 3RTYA 4DE1A 3O86A 4OLGA 4JXVA 2HDQA 3T4KA 4GLQA 4GS9B 3IWQA 4LRZE 2Y91A 4KQOA 2EA9A 2WKPA 4KZ5A 1TS8A 2L4RA 1KDWA 2JCHA 2HP9A 3BW6A 4LCLA 1GHPA 5CGSA 3HLEA 2Z2LB 4KZAA 1KE0A 3NI9A 3UO9A 4PM8A 4OLDA 3E4QA 2WKHA 3FWLA 3UDFA 3RFBA 4JPMA 4RA7A 5TFQA 3OOVA 1SKFA 2ZD8A 3PBOA 3ZG9B 1OTBA 1TDGA 3UDXA 3W4QA 2HDRA 1LL8A 3PR6A 5CTNA 4S2OA 4N92A 4X1MA 2J9PA 4UQIM 2KX6A 2C6WB 5EE8A 2Y2PA 1I2WA 2W3EA 4CQHA 3BFCA 2EXBA 4HH2A 1FCOA 4C75A 5BOHA 2FFFB 1OTEA 4HY8A 5F1FA 2YKFA 2PD8A 1MPLA 4B4ZA 3ZGAB 1ZG4A 5DKLA 1N9LA 3PXPA 1ONHA 2XD1A 3BLMA 1KGFA 3ZG7B 2WYXA 3UDIA 4BENA 5IT5A 2PHYA 1G28A 3F1OB 3GSGA 2ZC5B 4WMCD 1XX2A 1E3UD 4JXSA 5C5KA 1YPRA 3DTIA 4OPZA 1ESUA 5EVIB 2XH9A 3UNWA 4QPRA 4S2JA 2V1BA 5HDSA 1GSWA 2A49A 4BL3A 4D2OA 1PWGA 4OKPA 4LRYC 3GVBA 4RX3A 2R78A 4HI4A 1JNUA 2IWCA 3OPHA 1K57C 2O9CA 2WGWA 1RGZA 3NOPC 4PMAA 3KSHA 5IHVA 4E3MA 3LIAA 4B4XA 2PR5A 2VA0A 1MC0A 3BQ8A 4RVAA 4DE0A 2V9AA 2B5RA 5CXWA 4EQ1A 1E3UA 4MBHA 3VSKA 4WEKA 3L7HA 5FQ9A 1TS7A 4EUZA 5M1AA 1K56D 2Y2JA 3LIEA 3ZDJA 2JN7A 3QP8A 1UGUA 4XUZA 4EWFA 2GDNA 3E4OA 2INWA 1K0KA 2QJ7A 5GHYA 3R7WA 4IBXA 2VV8A 4WF0A 4X6TA 1EROA 1NLYA 3OPRA 3AGFA 2WKQA 1N9BA 3IXHA 4CLCD 1UWPX 3AGDA 5J7EA 4IUKA 3FC7A 3HLWA 4JLFA 5E2FA 3FZCA 5E43A 5CHJA 1PFLA 3MQQA 3UE6A 2P9VA 1D06A 4HOIA 1NLZA 1TD5A 1LLBA 4IBRA 1FR1A 5DF9A 1K56A 4P6ZS 2Q0OA 4LPZA 1MKMA 4K0WA 3SW1A 3M6HA 4E6XA 4R38A 3HREA 5AQ9A 3T4QA 2V8CA 5KSHA 4S2KA 2K2NA 1DJBA 1ODVA 4O01A 4RQ9A 2XFTA 2ZC6B 4IEDA 2W3FA 4PPRA 4ZRRA 3MBZA 3BFFA 4IVIA 2QWSA 3PBRA 4Y3IA 4CLCA 4H6JA 3LI8A 3K2NA 4CPKA 2XR0A 3CWFA 3G2ZA 3IX8A 4F3LA 5TBMB 1Z6FA 4HJ4A 2ZOIA 3B47A 4EBNA 2V0UA 2ZQCA 5G4YA 3P01A 1K4EA 1K6SA 4QD4A 4HJ6A 4WBGA 1VETB 2H5SA 1KVLA 3E0YA 2XFSA 2HZ5A 1GSVA 1YLJA 4OONA 3BQAA 4GS9A 4FCFA 4MEZA 4EBPA 3PYPA 3T4TA 3GRJA 2JHEA 5EOOA 2H0YA 3WRTA 3NOTC 3HL9A 1H5XA 2LB9A 1Z09A 3GDIA 3RXXA 3M6BA 3OCLA 2IWDA 1CEGA 1RCJA 1E4DA 5HWWA 5EVIC 2OLVA 1OMEA 3DTEA 2V0WA 3OBFA 4NG2A 4B88A 4Z1WA 1Y54A 5CEDA 4KZ3A 3N8RA 3D72A 4OQHA 3CMZA 1WA9A 2OAP1 1FQGA 3VMAA 2HF6A 4UQIS 1P97A 4Y15A 5HAQA 1NRJA 4YNRA 4KZ6A 3A3FA 5AQ7A 5DTSA 2WADA 5DF7A 3VFFA 5J8XA 1G6AA 3DW0A 4WZ5C 3S4XA 5AQAA 1BLCA 2PU2A 5F83A 3TW8A 5IS1A 4NEED 1BSGA 4EEUA 2XEPA 1OPXA 2XQZA 2QJ5A 2KDKA 3HVFA 3UY6A 3MQOA 1OJ5A 2ZC7A 4HBUA 2PBYA 1NWZA 3JVVA 5FA7A 2EFXA 5EUAA 5M19A 3F1OA 4RX2A 3HLDA 4KQDA 3O88A 1XP4A 1V9YA 3ISGA 4KG2A 2WGWB 3F1NB 3A3JA 4S2NC 4PKYG 4PM6A 2P74A 4MDZA 5EVIA 5FAPA 1ES5A 2XSSA 3D3OA 3UB7A 1Q2QA 1X0OA 2Y2GA 5DJUA 4YINA 3TRCA 1LHYA 4AFIA 4O8GA 1VB6A 1P0ZA 4NK3A 2W0NA 4DMZA 2W3DA 1KE4A 3P98A 4HP9A 4IHQA 2O99A 5GLBA 2J8YA 3T50A 1ZTUA 2XROA 5FAQA 2B95A 4R70A 1FSYA 5EM1A 4WZ5A 4DJ3A 1XFQA 3GQZA 1V9ZA 1M40A 2KOIA 1W5DA 3BM6A 4MCWA 2H0TA 1HD8A 3IT9A 4BBUA 3ZNTA 4K0XA 3ITBA 3C2WA 4XT2B 3BWLA 3UB8A 5FATA 3Q7ZA 2RL3A 4E3OA 4NXBA 1XJ6A 2NUPC 3OZHA 5L8MA 5JYOA 4YFMA 3NECA 2ZOHA 1KGGA 1L0GA 1PZOA 5FQMA 3U4LP 1YKDA 3M2KA 4S2NA 3SS4A 1MXOA 2QZ6A 3TE8A 3VV4A 3G35A 4P6ZM 3OPPA 2PYPA 1CI9A 5EFWA 1BLSA 3NIAA 4FD8A 3NC8A 3B33A 3MZEA 4GKUA 2JKRI 2W1TB 1T19A 1YAXA 3WS2A 1P9WA 1DP6A 4CLCB 1BZAA 4H6JB 3UMEA 4GB7A 3MZDA 3U2AA 3RH8B 5TR7A 5L2FA 3HUOA 1SDEA 2ZM2A 2PRFA 1OT6A 3DTMA 5EPHA 3LR3A 4GHIA 4CJNA 2PAVP 1PRQA 3SS5A 5FEGA 3LIBA 4X1LA 4UA7A 1K54C 3QP1A 4R3JA 4FOFA 4HEFA 1IYQA 5AJGA 1L2SA 1DY6A 5DTKA 2EX6A 5TBMA 3KSGA 4DF6A 1MZUA 3Q81A 1SKOB 1FR6A 3BY9A 4Y5FA 5FDHA 2CC1A 2XRNA 5U47A 3HJIA 1VETA 4MBKA 1O07A 3KYZA 4BJPA 3DTKA 3BRMA 1PYYA 4MBFA 3PTEA 5MC7A 3WS4A 4Q0JA 1OT9A 5HARA 3EWKA 2Y59A 1LL5A 4PM5A 3ICYA 4BQMA 2VJWA 1SCWA 4EQIA 3G31A 2HP5A 4EXOA 1TS0A 4E3KA 2PYRA 3F1PB 3VE3A 3WS5A 4XXRA 1GSXA 2DCFA 1NXYA 3FPWA 1WE4A 3IX3A 4OOMA 1CF0A 5FQIA 1XGIA 5EECA 1TF1A 3UE0A 4JKTA 4KZBA 3W4OA 1NYYA 2JE5A 2L0WA 3G2YA 3IWOA 1NZOA 1NZUA 3BY8A 4O0PA 1ONGA 2ACGA 3MFXA 1TS6A 4EESA 5J3WA 3VE4A 1K54A 3JPUA 4ETXA 5L10A 3C4OA 3DAVA 4GD6A 5G18A 5CERA 4HHDA 3T4JA 4LGWA 3UMDA 5CGXA 4OOLA 3NOUC 4ZJ2A 5DVAA 3PBQA 1OTIA 3UB9A 2L1MA 4A5RA 1CQAA 2EX9A 3IF6B 4P6BA 3VP2A 1DJCA 3CUEC 2ZM0A 1PI5A 2RCXA 3WRZA 3FKVA 2M7UA 4WYYA 1GA9A 3LIDA 4N9KA 2HJEA 4LV1A 5AVFA 4EU0A 2EWVA 3BJNA 3PBNA 1IYPA 5HPIA 3EQVA 3W4PA 1MWSA 3HLBA 3LY4A 4HJ3A 2ZJ9A 3GECA 1CK3A 1JTGA 1N4OA 3ZCZA 5HPFA 4QY6A 2PBDP 3G32A 3F1NA 4H8RA 1I2SA 1ZC2A 4NXFA 3MSHA 2DNSA 5F1GA 1FCMA 3FPVA 5CEBA 2Y2OA 1EWZA 2Y2NA 4WM9A 4WMCA 2HDSA 3BFGA 3T1XA 4C3QA 1OTAA 2Y79A 1S4RA 2FZ0A 3O3VA 4CLCC 3LEZA 1JTDA 3K3DA 3BYDA 3T1RA 3IH9A 3D4FA 5CX7A 2NUTC 3CUEA 3VOYA 3GR2A 2FH5A 3EGXC 3B3XA 1EW0A 3EEAA 2Y2KA 4I3IA 1RP5A 1T1CA 4R23A 3UPOA 5HFOA 4XT2A 1JWZA 1VM1A 4PM9A 3DWZA 1PNEA 1HLUP 2ZLYA 3ZG8B 4DE2A 3ULFA 1K25A 3SZTA 3GMWA 1S67L 5KZHA 1YSQA 1GHIA 5A92A 3CLOA 5FQQA 3KSFA 3TOIA 3IBJA 4QHCA 4U0XA 3ZVWA 1EI5A 4EBLA 4BD1A 1YLPA 4HESA 4GHIB 4PHTA 4UA9A 1HZOA 1PZPA 2W1TA 1YQSA 2JKTI 2Q9NA 1G5UA 3A3IA 2P04A 4XUXA 3OPLA 1AWIA 1F2KA 4GCZA 3T1SA 1FOFA 4QWOA 3V50A 4KG6A 4QY5A 2WAFA 3TJZC 4KZ4A 4OP5A 4G3WA 3Q7VB 3A0RA 4HP4A 1PW1A 2H10A 2J3TD 3CI6A 1S0WA 2WK0A 4II7A 5FASA 5HX9A 3HBRA 4Y2FA 2GX5A 4GNUA 3MF0A 4ID4A 3T1QB 1NYMA 4OQIA 3EEHA 1SKOA 4PKYA 3IF6C 1SDNA 2XGNA 1F98A 4I39A 3CZDA 3S7NA 4M4XA 2J9OA 3HUNA 4OH0A 4MN6A 3ZHHA 1L0FA 1ACFA 1LSWA 5CHMA 1LSVA 2PD7A 4P85A 3BEBA 1Q2PA 1LI9A 5HZHA 2XD5A 5TGFA 3DBAA 2WZXA 2Y8HA 3CITA 3F1PA 1YT4A 1XJ3A 3UB5P 5EVEA 3H82B 1Y4OA 3P09A 4OQGA 4KZ7A 4MN5A 1OTDA 1H8YA 4S2LA 1PW8A 5FEFA 4L9GA 5HWVA 3HJKA 5GHXA 1G68A 1GCEA 3ZFZA 5EM0A 4X25A 5CTMA 1KOUA 2PR6A 4DRTA 1S4SA 5EOEA 3MXQA 3T4OA 2GZAA 3MFDA 3QP4A 3A3DA 1BYWA 4EETB 3H7WB 3SOIA 1C3BA 1SHVA 1ERQA 2V1AA 2Z6DA 2G2WA 3NJAA 3KYEA 3IF6A 3SH7A 4UHUA 4BL2A 1MWUA 2XF3A 3MJQA 4FUWA 2EWWA 5I5LA 4QU3A 5J4EA 1IFQA 4DKIA 4EV4A 3T12B 5HD3A 2CMNA 4QB8A 4R1GA 3ZG0A 2M7VA 1S66L 4E3NA 5JYPA 2A24B 3R4KA 5DFYA 3CPTB 2UV0E 4LLOB 3LUQA 1W8QA 4GJ4A 4U0TA 4Q0IA 5F69A 4ARZB 2LB5A 1ERMA 4ZJ3A 4R3AA 1WYBA 2ZM8A 4KZ9A 3A0VA 3IXGA 2WKIA 1Y28A 5FQKA 3Q1FA 4D60A 3MXRA 1CJFA 3KSIA 1I5QA 1W63M 4IVKA 3G30A 4O7DA 3NHQA 2VGLS 4WELA 4P87A 1T18A 2XLNA 2EXAA 3SS3A 3RXWA 5KMWA 4UA6A 5CGWA 4ZBEA 4JBFA 1MWRA 5L07A 1BT5A 1QMFA 1FILA 4RYEA 4KUOA 3IBRA 3OCNA 1NY0A 3BECA 4MLLA 1K55A 2VX8A 2WGIA 1JWPA 4UEYA 4E3JA 1PWCA 3QP6A 1YLYA 4BBVA 2W1RA 3ITAA 3UPPA 2P7JA 5M18A 2Z2MB 4JGQA 3T4LA 3PAEA 3C30A 4IUHA 3CHWP 3KO6A 4G3KA 4R4RA 4JF6A 3IS2B 3B42A 2W3HA 1S6RA 3VSLA 2DRWA 2R9WA 2WGVA 1XKZA 5E2EA 4NXGA 4E04A 5HDCA 3NY4A 3VOZA 2J80A 4K08A 3W8KA 3IH8A 3ZG5A 2R9XA 1H3QA 2X02A 4WL9A 4Z9QA 3LGOA 2ZL1A 1N9NA 4Y17A 1SZVA 2Q9MA 2ZQDA 5A90A 1JWVA 2MJ6A 1W63Q 1PIOA 1F5MA 2JC7A 2J3WA 4OQ0A 3RJUA 2Y2IA 2WAEA 2ZQAA 4WEJA 3VP4A 3AGEA 4HH3A 5AVEA 1BTLA 2QHKA 3O87A 5FQJA 3Q7VA 2XDMA 2A2LA 4FSFA 3G4PA 4JGRA 4LENA 4E6WA 1T1BA 3CAXA 3CG5A 4I3JA 2G2UA 3MZFA 4M3KA 3V3RA 4ME4A 2VGKA 3LIFA 4JXWA 2I72A 2XK1A 1STZA 4S2MA 1H8MA 5CRFA 2V2FF 3WWXA 3C4PA 2Y55A 5FSRA 4HIAA 2PT7A 2WZZA 3BFDA 3QNBA 3IXBA 2Y4AA 1DJAA 4KENB 3Q07A 4ESPA 5DKKA 3NCKA 3QP5A 3VP1A 3LI9A 4KG5A 5HW3A 2QYBA 5LBRA 3HLFA 3H82A 2VK3A 3ZVTA 1XA1A 2IWBA 2HJ9C 4IJGA 5F5YA 3UPNA 3KYQA 5GHZA 3IX4A 4X56A 4Y13A 2PDRA 4GD8A 4GDNA 3V39A 1J3WA 1ES3A 4MNRA 2JKRM 4Q0HA 5DJTA 2B02A 1O7EA 5GLCA 4KQQA 4JXGA 3ZYTA 2OAQ1 1F9IA 2I9VA 2ZC4B 2XA7S 3SH9A 2O0YA 3MKEA 3CJMA 3HLCA 4B93A 4EERA 2V20A 5E2GA 1MWTA 2ZBBA 2OV5A 3N4IA 5GLDA 2ZQ8A 3PBSA 3BFEA 2H28A 3H7WA 3MMHA 4Y7PA 4OOYA 2EX2A 3C7UA 3LCEA 4B9OA 2OOLA 1YLTA 2YKHA 2HP6A 5TJJA 4WZ4A 3H9WA 3C8CA 4Q8IA 1YSPA 1BULA 3VP0A 2VLGA 2Y2HA 3A0SA 1W79A 1IKGA 2Y2LA 1IELA 4GDBA 2A24A 5CHUA 5FI7A 4N1XA 5I94A 2E8IA 3CPTA 3MKFA 3IHAA 1VHMA 3S7QA 3GTCA 2WUQA 4OPYA 4ARZA 4DDYA 2ZC3B 5HAPA 2VGLM 1ZKJA 3HUMA 3N8SA 1XA7A 1PI4A 5EVLA 4E3IA 1MY8A 3M2JA 2G7UA 3O5YA 4LRXC 5FI6A 3IHBA 3IQAA 1YM1A 3PHYA 4LCMA 4R3BA 3MQ0A 3PBTA 2VV6A 3HCYA 3QHYA 1H8ZA 2JKFA 1TVFA 1IYOA 3C38A 1GHMA 4KZ8A 2A3UA 1WYCA 2W27A 1XFNA 4P0MA 4UAAA 3S1YA 4U3TA 5HD5A 4G3VA 4PAUA 5E2HA 2M1CA 5A91A 4E3LA 2ZMAA 3ZNYA 3E98A 1QMEA 3IXDA 1L0DA 1XJ4A 4FH4A 4Y0OA 3TSGA 3ZQ5A 3JVUA 4WN5A 4QJGA 4PM7A 5HL1A 3NDEA 4MMNA 5IU1A 2BTFP 3D9YA 1M6KA 3IS2A 3MR0A 4EW7A 3LR4A 1H0MA 4EEPA 1K57A 4YOFA 3C5AA 3HLGA 3V3SA 1N9OA 3N6IA 4S2PA 4DE3A 1FSWA 4OVDA 2J3TC 2ZL1B 4X55A 1VEUB 2K31A 3LO7A 1LI0A 3PAGA 5GL9A 3LR5A 1TEMA 3VOLA 2OWHA 2VEAA 3NBLA 4LV0A 3NDGA 1IEMA 3E2LA 1MKIA 2BLSA 1S1ZA 5DTTA 3EGDC
chains in the Genus database with same CATH topology
1PRQA 5FEGA 1CQAA 2V8FA 1D1JA 4X1LA 2VK3A 2B95A 1ACFA 5EM1A 1PNEA 3NULA 3CPTB 1HLUP 2V8CA 1SKOB 1J3WA 1FIKA 2JKFA 3UB5P 3LGOA 1VETA 2ZL1A 5EVEA 1SZVA 1Y4OA 4D60A 3MS6A 4X1MA 1CJFA 3NECA 2PBDP 5FEFA 3L7HA 3U4LP 5FDSA 3MSHA 3LEQA 1VETB 1A0KA 2HZ5A 1G5UA 1VEUA 1CF0A 1FILA 5EM0A 4X25A 1AWIA 2BTFP 1F2KA 1K0KA 3T1SA 4QWOA 3L9KA 3D9YA 4FTXA 3T1XA 2E8JA 2PAVP 2JKGA 1Z09A 2ZL1B 2ACGA 3KYEA 1VEUB 3T1RA 4FUWA 1PFLA 3CHWP 3CPTA 3DAVA 1YPRA 4ESPA 3T1QB 2PRFA 3T12B 1SKOA 5EV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRQ A;  5FEG A;  1CQA A;  2V8F A;  1D1J A;  4X1L A;  2VK3 A;  2B95 A;  1ACF A;  5EM1 A;  1PNE A;  3NUL A;  3CPT B;  1HLU P;  2V8C A;  1SKO B;  1J3W A;  1FIK A;  2JKF A;  3UB5 P;  3LGO A;  1VET A;  2ZL1 A;  5EVE A;  1SZV A;  1Y4O A;  4D60 A;  3MS6 A;  4X1M A;  1CJF A;  3NEC A;  2PBD P;  5FEF A;  3L7H A;  3U4L P;  5FDS A;  3MSH A;  3LEQ A;  1VET B;  1A0K A;  2HZ5 A;  1G5U A;  1VEU A;  1CF0 A;  1FIL A;  5EM0 A;  4X25 A;  1AWI A;  2BTF P;  1F2K A;  1K0K A;  3T1S A;  4QWO A;  3L9K A;  3D9Y A;  4FTX A;  3T1X A;  2E8J A;  2PAV P;  2JKG A;  1Z09 A;  2ZL1 B;  2ACG A;  3KYE A;  1VEU B;  3T1R A;  4FUW A;  1PFL A;  3CHW P;  3CPT A;  3DAV A;  1YPR A;  4ESP A;  3T1Q B;  2PRF A;  3T12 B;  1SKO A;  5EV0 A; 
#chains in the Genus database with same CATH topology
 3E2K A;  2Z6C A;  5G4Z A;  2HPB A;  4OP8 A;  2GJ3 A;  3LIC A;  2DMW A;  1RGY A;  3UN7 A;  3UE3 A;  3V5M A;  3G6O A;  1OJG A;  1U60 A;  3TG9 A;  1KGE A;  3K3C A;  1KVM A;  2Y2M A;  1BLP A;  1FIK A;  3V67 A;  4DJ2 A;  2O9A A;  1XJ2 A;  1K38 A;  3VFH A;  3DWK A;  3SH8 A;  3I7J A;  4JF5 A;  3GV9 A;  4DXC A;  1W7F A;  4DXB A;  1ZHH B;  1XGJ A;  3E4P A;  1AXB A;  4S2I A;  1XPB A;  2WKE A;  4Y0U A;  3LEQ A;  1FCN A;  2JBF A;  1GA0 A;  4WLA A;  3IWI A;  1BLH A;  1YLZ A;  4DN0 A;  1DRM A;  1VQQ A;  5AQB A;  2K7S A;  3BLS A;  3G34 A;  4HBT A;  2HDU A;  4GZB A;  2VGJ A;  4KUK A;  4BMW A;  4MN7 A;  1ZG6 A;  2JKG A;  4L0L A;  4ZDX A;  1G6O A;  1YMS A;  2HGV A;  1L3L A;  1IOU A;  3FG8 A;  1UWN X;  4R0Q A;  1ESI A;  2ZMV A;  4BBT A;  5KSC A;  5A93 A;  2XA7 M;  4F94 A;  4HQA A;  2OLU A;  5EVI D;  1DP9 A;  4Y0T A;  5EV0 A;  2BAS A;  2HV1 A;  1KDS A;  3QP2 A;  5KIZ A;  3N7W A;  4N9L A;  1MBL A;  1K55 C;  1S1Y A;  2JKT M;  4WUJ A;  4BD0 A;  1W8Y A;  3WS1 A;  2ZQ7 A;  4YWZ A;  3N8L A;  4DDS A;  4HNB A;  4ZAM A;  4OPR A;  1IYS A;  2AVX A;  5F82 A;  4NKP A;  4NXE A;  4C6Y A;  2FFY A;  4ZJ1 A;  3JYI A;  3P7N A;  3LYX A;  3MS6 A;  2IA2 A;  2C5W B;  5K5B A;  1BUE A;  5FI2 A;  2W3G A;  1LSX A;  2X71 A;  5A8B A;  1ALQ A;  5HAI A;  2GNX A;  5DFX A;  2P08 A;  3FV7 A;  4GW9 A;  3S22 A;  1CEF A;  2BG1 A;  4X68 A;  5HWT A;  4KQR A;  2VV7 A;  2ZQ9 A;  1K4F A;  4I38 A;  3WS0 A;  3UB6 A;  4FTX A;  4GN2 A;  1KE3 A;  4BWI A;  2OSU A;  3LY3 A;  1NRF A;  5L09 A;  2KLI A;  4ETZ A;  2QMI A;  3OLO A;  4LV2 A;  1HTZ A;  4I3A A;  5HL6 A;  2D01 A;  3LR0 A;  4L9E A;  1HVB A;  3C7V A;  2Y2Q A;  1PWD A;  3T4S A;  2X01 A;  1D7E A;  3R7W B;  1E25 A;  4ZTK A;  4JGO A;  3QNC A;  4EUV A;  3FYZ A;  4I5S A;  3VP3 A;  3MXS A;  2QPN A;  1P9R A;  4X53 A;  1YLW A;  4N1H A;  2V8F A;  1CI8 A;  1D1J A;  2QKP A;  5HDD A;  1JVJ A;  5HSQ A;  3NUL A;  4R4S A;  2V1Z A;  3A3E A;  3S7O A;  3W2Z A;  4X69 A;  2P9V B;  5D3O A;  1NJ4 A;  4L9F A;  2PU4 A;  1XXM A;  2OWJ A;  3S7P A;  3KX0 X;  5F68 A;  3OC2 A;  4GOG A;  1IKI A;  2D02 A;  1YMX A;  5F6A A;  2VZW A;  3LFV A;  5DF8 A;  2ZMF A;  4LFU A;  5GLA A;  1ES2 A;  4OPQ A;  5CEC A;  1K6R A;  4JF4 A;  4K91 A;  5FL3 A;  1J9M A;  4BLM A;  2EFU A;  2J7V A;  3UE1 A;  1TDL A;  3EOI A;  3EQU A;  4FH2 A;  1T1A A;  2VKS A;  5FDS A;  1A0K A;  1VEU A;  2O9B A;  4JGP A;  4CLC E;  4F3L B;  4NET A;  1LL9 A;  4R6L A;  1L0E A;  3Q82 A;  1LT0 A;  3L9K A;  2EX8 A;  3IF5 A;  2E8J A;  5FAO A;  2WKR A;  3FKW A;  4LV3 A;  2B18 A;  1DP8 A;  1ES4 A;  2UWX A;  3RTY A;  4DE1 A;  3O86 A;  4OLG A;  4JXV A;  2HDQ A;  3T4K A;  4GLQ A;  4GS9 B;  3IWQ A;  4LRZ E;  2Y91 A;  4KQO A;  2EA9 A;  2WKP A;  4KZ5 A;  1TS8 A;  2L4R A;  1KDW A;  2JCH A;  2HP9 A;  3BW6 A;  4LCL A;  1GHP A;  5CGS A;  3HLE A;  2Z2L B;  4KZA A;  1KE0 A;  3NI9 A;  3UO9 A;  4PM8 A;  4OLD A;  3E4Q A;  2WKH A;  3FWL A;  3UDF A;  3RFB A;  4JPM A;  4RA7 A;  5TFQ A;  3OOV A;  1SKF A;  2ZD8 A;  3PBO A;  3ZG9 B;  1OTB A;  1TDG A;  3UDX A;  3W4Q A;  2HDR A;  1LL8 A;  3PR6 A;  5CTN A;  4S2O A;  4N92 A;  4X1M A;  2J9P A;  4UQI M;  2KX6 A;  2C6W B;  5EE8 A;  2Y2P A;  1I2W A;  2W3E A;  4CQH A;  3BFC A;  2EXB A;  4HH2 A;  1FCO A;  4C75 A;  5BOH A;  2FFF B;  1OTE A;  4HY8 A;  5F1F A;  2YKF A;  2PD8 A;  1MPL A;  4B4Z A;  3ZGA B;  1ZG4 A;  5DKL A;  1N9L A;  3PXP A;  1ONH A;  2XD1 A;  3BLM A;  1KGF A;  3ZG7 B;  2WYX A;  3UDI A;  4BEN A;  5IT5 A;  2PHY A;  1G28 A;  3F1O B;  3GSG A;  2ZC5 B;  4WMC D;  1XX2 A;  1E3U D;  4JXS A;  5C5K A;  1YPR A;  3DTI A;  4OPZ A;  1ESU A;  5EVI B;  2XH9 A;  3UNW A;  4QPR A;  4S2J A;  2V1B A;  5HDS A;  1GSW A;  2A49 A;  4BL3 A;  4D2O A;  1PWG A;  4OKP A;  4LRY C;  3GVB A;  4RX3 A;  2R78 A;  4HI4 A;  1JNU A;  2IWC A;  3OPH A;  1K57 C;  2O9C A;  2WGW A;  1RGZ A;  3NOP C;  4PMA A;  3KSH A;  5IHV A;  4E3M A;  3LIA A;  4B4X A;  2PR5 A;  2VA0 A;  1MC0 A;  3BQ8 A;  4RVA A;  4DE0 A;  2V9A A;  2B5R A;  5CXW A;  4EQ1 A;  1E3U A;  4MBH A;  3VSK A;  4WEK A;  3L7H A;  5FQ9 A;  1TS7 A;  4EUZ A;  5M1A A;  1K56 D;  2Y2J A;  3LIE A;  3ZDJ A;  2JN7 A;  3QP8 A;  1UGU A;  4XUZ A;  4EWF A;  2GDN A;  3E4O A;  2INW A;  1K0K A;  2QJ7 A;  5GHY A;  3R7W A;  4IBX A;  2VV8 A;  4WF0 A;  4X6T A;  1ERO A;  1NLY A;  3OPR A;  3AGF A;  2WKQ A;  1N9B A;  3IXH A;  4CLC D;  1UWP X;  3AGD A;  5J7E A;  4IUK A;  3FC7 A;  3HLW A;  4JLF A;  5E2F A;  3FZC A;  5E43 A;  5CHJ A;  1PFL A;  3MQQ A;  3UE6 A;  2P9V A;  1D06 A;  4HOI A;  1NLZ A;  1TD5 A;  1LLB A;  4IBR A;  1FR1 A;  5DF9 A;  1K56 A;  4P6Z S;  2Q0O A;  4LPZ A;  1MKM A;  4K0W A;  3SW1 A;  3M6H A;  4E6X A;  4R38 A;  3HRE A;  5AQ9 A;  3T4Q A;  2V8C A;  5KSH A;  4S2K A;  2K2N A;  1DJB A;  1ODV A;  4O01 A;  4RQ9 A;  2XFT A;  2ZC6 B;  4IED A;  2W3F A;  4PPR A;  4ZRR A;  3MBZ A;  3BFF A;  4IVI A;  2QWS A;  3PBR A;  4Y3I A;  4CLC A;  4H6J A;  3LI8 A;  3K2N A;  4CPK A;  2XR0 A;  3CWF A;  3G2Z A;  3IX8 A;  4F3L A;  5TBM B;  1Z6F A;  4HJ4 A;  2ZOI A;  3B47 A;  4EBN A;  2V0U A;  2ZQC A;  5G4Y A;  3P01 A;  1K4E A;  1K6S A;  4QD4 A;  4HJ6 A;  4WBG A;  1VET B;  2H5S A;  1KVL A;  3E0Y A;  2XFS A;  2HZ5 A;  1GSV A;  1YLJ A;  4OON A;  3BQA A;  4GS9 A;  4FCF A;  4MEZ A;  4EBP A;  3PYP A;  3T4T A;  3GRJ A;  2JHE A;  5EOO A;  2H0Y A;  3WRT A;  3NOT C;  3HL9 A;  1H5X A;  2LB9 A;  1Z09 A;  3GDI A;  3RXX A;  3M6B A;  3OCL A;  2IWD A;  1CEG A;  1RCJ A;  1E4D A;  5HWW A;  5EVI C;  2OLV A;  1OME A;  3DTE A;  2V0W A;  3OBF A;  4NG2 A;  4B88 A;  4Z1W A;  1Y54 A;  5CED A;  4KZ3 A;  3N8R A;  3D72 A;  4OQH A;  3CMZ A;  1WA9 A;  2OAP 1;  1FQG A;  3VMA A;  2HF6 A;  4UQI S;  1P97 A;  4Y15 A;  5HAQ A;  1NRJ A;  4YNR A;  4KZ6 A;  3A3F A;  5AQ7 A;  5DTS A;  2WAD A;  5DF7 A;  3VFF A;  5J8X A;  1G6A A;  3DW0 A;  4WZ5 C;  3S4X A;  5AQA A;  1BLC A;  2PU2 A;  5F83 A;  3TW8 A;  5IS1 A;  4NEE D;  1BSG A;  4EEU A;  2XEP A;  1OPX A;  2XQZ A;  2QJ5 A;  2KDK A;  3HVF A;  3UY6 A;  3MQO A;  1OJ5 A;  2ZC7 A;  4HBU A;  2PBY A;  1NWZ A;  3JVV A;  5FA7 A;  2EFX A;  5EUA A;  5M19 A;  3F1O A;  4RX2 A;  3HLD A;  4KQD A;  3O88 A;  1XP4 A;  1V9Y A;  3ISG A;  4KG2 A;  2WGW B;  3F1N B;  3A3J A;  4S2N C;  4PKY G;  4PM6 A;  2P74 A;  4MDZ A;  5EVI A;  5FAP A;  1ES5 A;  2XSS A;  3D3O A;  3UB7 A;  1Q2Q A;  1X0O A;  2Y2G A;  5DJU A;  4YIN A;  3TRC A;  1LHY A;  4AFI A;  4O8G A;  1VB6 A;  1P0Z A;  4NK3 A;  2W0N A;  4DMZ A;  2W3D A;  1KE4 A;  3P98 A;  4HP9 A;  4IHQ A;  2O99 A;  5GLB A;  2J8Y A;  3T50 A;  1ZTU A;  2XRO A;  5FAQ A;  2B95 A;  4R70 A;  1FSY A;  5EM1 A;  4WZ5 A;  4DJ3 A;  1XFQ A;  3GQZ A;  1V9Z A;  1M40 A;  2KOI A;  1W5D A;  3BM6 A;  4MCW A;  2H0T A;  1HD8 A;  3IT9 A;  4BBU A;  3ZNT A;  4K0X A;  3ITB A;  3C2W A;  4XT2 B;  3BWL A;  3UB8 A;  5FAT A;  3Q7Z A;  2RL3 A;  4E3O A;  4NXB A;  1XJ6 A;  2NUP C;  3OZH A;  5L8M A;  5JYO A;  4YFM A;  3NEC A;  2ZOH A;  1KGG A;  1L0G A;  1PZO A;  5FQM A;  3U4L P;  1YKD A;  3M2K A;  4S2N A;  3SS4 A;  1MXO A;  2QZ6 A;  3TE8 A;  3VV4 A;  3G35 A;  4P6Z M;  3OPP A;  2PYP A;  1CI9 A;  5EFW A;  1BLS A;  3NIA A;  4FD8 A;  3NC8 A;  3B33 A;  3MZE A;  4GKU A;  2JKR I;  2W1T B;  1T19 A;  1YAX A;  3WS2 A;  1P9W A;  1DP6 A;  4CLC B;  1BZA A;  4H6J B;  3UME A;  4GB7 A;  3MZD A;  3U2A A;  3RH8 B;  5TR7 A;  5L2F A;  3HUO A;  1SDE A;  2ZM2 A;  2PRF A;  1OT6 A;  3DTM A;  5EPH A;  3LR3 A;  4GHI A;  4CJN A;  2PAV P;  1PRQ A;  3SS5 A;  5FEG A;  3LIB A;  4X1L A;  4UA7 A;  1K54 C;  3QP1 A;  4R3J A;  4FOF A;  4HEF A;  1IYQ A;  5AJG A;  1L2S A;  1DY6 A;  5DTK A;  2EX6 A;  5TBM A;  3KSG A;  4DF6 A;  1MZU A;  3Q81 A;  1SKO B;  1FR6 A;  3BY9 A;  4Y5F A;  5FDH A;  2CC1 A;  2XRN A;  5U47 A;  3HJI A;  1VET A;  4MBK A;  1O07 A;  3KYZ A;  4BJP A;  3DTK A;  3BRM A;  1PYY A;  4MBF A;  3PTE A;  5MC7 A;  3WS4 A;  4Q0J A;  1OT9 A;  5HAR A;  3EWK A;  2Y59 A;  1LL5 A;  4PM5 A;  3ICY A;  4BQM A;  2VJW A;  1SCW A;  4EQI A;  3G31 A;  2HP5 A;  4EXO A;  1TS0 A;  4E3K A;  2PYR A;  3F1P B;  3VE3 A;  3WS5 A;  4XXR A;  1GSX A;  2DCF A;  1NXY A;  3FPW A;  1WE4 A;  3IX3 A;  4OOM A;  1CF0 A;  5FQI A;  1XGI A;  5EEC A;  1TF1 A;  3UE0 A;  4JKT A;  4KZB A;  3W4O A;  1NYY A;  2JE5 A;  2L0W A;  3G2Y A;  3IWO A;  1NZO A;  1NZU A;  3BY8 A;  4O0P A;  1ONG A;  2ACG A;  3MFX A;  1TS6 A;  4EES A;  5J3W A;  3VE4 A;  1K54 A;  3JPU A;  4ETX A;  5L10 A;  3C4O A;  3DAV A;  4GD6 A;  5G18 A;  5CER A;  4HHD A;  3T4J A;  4LGW A;  3UMD A;  5CGX A;  4OOL A;  3NOU C;  4ZJ2 A;  5DVA A;  3PBQ A;  1OTI A;  3UB9 A;  2L1M A;  4A5R A;  1CQA A;  2EX9 A;  3IF6 B;  4P6B A;  3VP2 A;  1DJC A;  3CUE C;  2ZM0 A;  1PI5 A;  2RCX A;  3WRZ A;  3FKV A;  2M7U A;  4WYY A;  1GA9 A;  3LID A;  4N9K A;  2HJE A;  4LV1 A;  5AVF A;  4EU0 A;  2EWV A;  3BJN A;  3PBN A;  1IYP A;  5HPI A;  3EQV A;  3W4P A;  1MWS A;  3HLB A;  3LY4 A;  4HJ3 A;  2ZJ9 A;  3GEC A;  1CK3 A;  1JTG A;  1N4O A;  3ZCZ A;  5HPF A;  4QY6 A;  2PBD P;  3G32 A;  3F1N A;  4H8R A;  1I2S A;  1ZC2 A;  4NXF A;  3MSH A;  2DNS A;  5F1G A;  1FCM A;  3FPV A;  5CEB A;  2Y2O A;  1EWZ A;  2Y2N A;  4WM9 A;  4WMC A;  2HDS A;  3BFG A;  3T1X A;  4C3Q A;  1OTA A;  2Y79 A;  1S4R A;  2FZ0 A;  3O3V A;  4CLC C;  3LEZ A;  1JTD A;  3K3D A;  3BYD A;  3T1R A;  3IH9 A;  3D4F A;  5CX7 A;  2NUT C;  3CUE A;  3VOY A;  3GR2 A;  2FH5 A;  3EGX C;  3B3X A;  1EW0 A;  3EEA A;  2Y2K A;  4I3I A;  1RP5 A;  1T1C A;  4R23 A;  3UPO A;  5HFO A;  4XT2 A;  1JWZ A;  1VM1 A;  4PM9 A;  3DWZ A;  1PNE A;  1HLU P;  2ZLY A;  3ZG8 B;  4DE2 A;  3ULF A;  1K25 A;  3SZT A;  3GMW A;  1S67 L;  5KZH A;  1YSQ A;  1GHI A;  5A92 A;  3CLO A;  5FQQ A;  3KSF A;  3TOI A;  3IBJ A;  4QHC A;  4U0X A;  3ZVW A;  1EI5 A;  4EBL A;  4BD1 A;  1YLP A;  4HES A;  4GHI B;  4PHT A;  4UA9 A;  1HZO A;  1PZP A;  2W1T A;  1YQS A;  2JKT I;  2Q9N A;  1G5U A;  3A3I A;  2P04 A;  4XUX A;  3OPL A;  1AWI A;  1F2K A;  4GCZ A;  3T1S A;  1FOF A;  4QWO A;  3V50 A;  4KG6 A;  4QY5 A;  2WAF A;  3TJZ C;  4KZ4 A;  4OP5 A;  4G3W A;  3Q7V B;  3A0R A;  4HP4 A;  1PW1 A;  2H10 A;  2J3T D;  3CI6 A;  1S0W A;  2WK0 A;  4II7 A;  5FAS A;  5HX9 A;  3HBR A;  4Y2F A;  2GX5 A;  4GNU A;  3MF0 A;  4ID4 A;  3T1Q B;  1NYM A;  4OQI A;  3EEH A;  1SKO A;  4PKY A;  3IF6 C;  1SDN A;  2XGN A;  1F98 A;  4I39 A;  3CZD A;  3S7N A;  4M4X A;  2J9O A;  3HUN A;  4OH0 A;  4MN6 A;  3ZHH A;  1L0F A;  1ACF A;  1LSW A;  5CHM A;  1LSV A;  2PD7 A;  4P85 A;  3BEB A;  1Q2P A;  1LI9 A;  5HZH A;  2XD5 A;  5TGF A;  3DBA A;  2WZX A;  2Y8H A;  3CIT A;  3F1P A;  1YT4 A;  1XJ3 A;  3UB5 P;  5EVE A;  3H82 B;  1Y4O A;  3P09 A;  4OQG A;  4KZ7 A;  4MN5 A;  1OTD A;  1H8Y A;  4S2L A;  1PW8 A;  5FEF A;  4L9G A;  5HWV A;  3HJK A;  5GHX A;  1G68 A;  1GCE A;  3ZFZ A;  5EM0 A;  4X25 A;  5CTM A;  1KOU A;  2PR6 A;  4DRT A;  1S4S A;  5EOE A;  3MXQ A;  3T4O A;  2GZA A;  3MFD A;  3QP4 A;  3A3D A;  1BYW A;  4EET B;  3H7W B;  3SOI A;  1C3B A;  1SHV A;  1ERQ A;  2V1A A;  2Z6D A;  2G2W A;  3NJA A;  3KYE A;  3IF6 A;  3SH7 A;  4UHU A;  4BL2 A;  1MWU A;  2XF3 A;  3MJQ A;  4FUW A;  2EWW A;  5I5L A;  4QU3 A;  5J4E A;  1IFQ A;  4DKI A;  4EV4 A;  3T12 B;  5HD3 A;  2CMN A;  4QB8 A;  4R1G A;  3ZG0 A;  2M7V A;  1S66 L;  4E3N A;  5JYP A;  2A24 B;  3R4K A;  5DFY A;  3CPT B;  2UV0 E;  4LLO B;  3LUQ A;  1W8Q A;  4GJ4 A;  4U0T A;  4Q0I A;  5F69 A;  4ARZ B;  2LB5 A;  1ERM A;  4ZJ3 A;  4R3A A;  1WYB A;  2ZM8 A;  4KZ9 A;  3A0V A;  3IXG A;  2WKI A;  1Y28 A;  5FQK A;  3Q1F A;  4D60 A;  3MXR A;  1CJF A;  3KSI A;  1I5Q A;  1W63 M;  4IVK A;  3G30 A;  4O7D A;  3NHQ A;  2VGL S;  4WEL A;  4P87 A;  1T18 A;  2XLN A;  2EXA A;  3SS3 A;  3RXW A;  5KMW A;  4UA6 A;  5CGW A;  4ZBE A;  4JBF A;  1MWR A;  5L07 A;  1BT5 A;  1QMF A;  1FIL A;  4RYE A;  4KUO A;  3IBR A;  3OCN A;  1NY0 A;  3BEC A;  4MLL A;  1K55 A;  2VX8 A;  2WGI A;  1JWP A;  4UEY A;  4E3J A;  1PWC A;  3QP6 A;  1YLY A;  4BBV A;  2W1R A;  3ITA A;  3UPP A;  2P7J A;  5M18 A;  2Z2M B;  4JGQ A;  3T4L A;  3PAE A;  3C30 A;  4IUH A;  3CHW P;  3KO6 A;  4G3K A;  4R4R A;  4JF6 A;  3IS2 B;  3B42 A;  2W3H A;  1S6R A;  3VSL A;  2DRW A;  2R9W A;  2WGV A;  1XKZ A;  5E2E A;  4NXG A;  4E04 A;  5HDC A;  3NY4 A;  3VOZ A;  2J80 A;  4K08 A;  3W8K A;  3IH8 A;  3ZG5 A;  2R9X A;  1H3Q A;  2X02 A;  4WL9 A;  4Z9Q A;  3LGO A;  2ZL1 A;  1N9N A;  4Y17 A;  1SZV A;  2Q9M A;  2ZQD A;  5A90 A;  1JWV A;  2MJ6 A;  1W63 Q;  1PIO A;  1F5M A;  2JC7 A;  2J3W A;  4OQ0 A;  3RJU A;  2Y2I A;  2WAE A;  2ZQA A;  4WEJ A;  3VP4 A;  3AGE A;  4HH3 A;  5AVE A;  1BTL A;  2QHK A;  3O87 A;  5FQJ A;  3Q7V A;  2XDM A;  2A2L A;  4FSF A;  3G4P A;  4JGR A;  4LEN A;  4E6W A;  1T1B A;  3CAX A;  3CG5 A;  4I3J A;  2G2U A;  3MZF A;  4M3K A;  3V3R A;  4ME4 A;  2VGK A;  3LIF A;  4JXW A;  2I72 A;  2XK1 A;  1STZ A;  4S2M A;  1H8M A;  5CRF A;  2V2F F;  3WWX A;  3C4P A;  2Y55 A;  5FSR A;  4HIA A;  2PT7 A;  2WZZ A;  3BFD A;  3QNB A;  3IXB A;  2Y4A A;  1DJA A;  4KEN B;  3Q07 A;  4ESP A;  5DKK A;  3NCK A;  3QP5 A;  3VP1 A;  3LI9 A;  4KG5 A;  5HW3 A;  2QYB A;  5LBR A;  3HLF A;  3H82 A;  2VK3 A;  3ZVT A;  1XA1 A;  2IWB A;  2HJ9 C;  4IJG A;  5F5Y A;  3UPN A;  3KYQ A;  5GHZ A;  3IX4 A;  4X56 A;  4Y13 A;  2PDR A;  4GD8 A;  4GDN A;  3V39 A;  1J3W A;  1ES3 A;  4MNR A;  2JKR M;  4Q0H A;  5DJT A;  2B02 A;  1O7E A;  5GLC A;  4KQQ A;  4JXG A;  3ZYT A;  2OAQ 1;  1F9I A;  2I9V A;  2ZC4 B;  2XA7 S;  3SH9 A;  2O0Y A;  3MKE A;  3CJM A;  3HLC A;  4B93 A;  4EER A;  2V20 A;  5E2G A;  1MWT A;  2ZBB A;  2OV5 A;  3N4I A;  5GLD A;  2ZQ8 A;  3PBS A;  3BFE A;  2H28 A;  3H7W A;  3MMH A;  4Y7P A;  4OOY A;  2EX2 A;  3C7U A;  3LCE A;  4B9O A;  2OOL A;  1YLT A;  2YKH A;  2HP6 A;  5TJJ A;  4WZ4 A;  3H9W A;  3C8C A;  4Q8I A;  1YSP A;  1BUL A;  3VP0 A;  2VLG A;  2Y2H A;  3A0S A;  1W79 A;  1IKG A;  2Y2L A;  1IEL A;  4GDB A;  2A24 A;  5CHU A;  5FI7 A;  4N1X A;  5I94 A;  2E8I A;  3CPT A;  3MKF A;  3IHA A;  1VHM A;  3S7Q A;  3GTC A;  2WUQ A;  4OPY A;  4ARZ A;  4DDY A;  2ZC3 B;  5HAP A;  2VGL M;  1ZKJ A;  3HUM A;  3N8S A;  1XA7 A;  1PI4 A;  5EVL A;  4E3I A;  1MY8 A;  3M2J A;  2G7U A;  3O5Y A;  4LRX C;  5FI6 A;  3IHB A;  3IQA A;  1YM1 A;  3PHY A;  4LCM A;  4R3B A;  3MQ0 A;  3PBT A;  2VV6 A;  3HCY A;  3QHY A;  1H8Z A;  2JKF A;  1TVF A;  1IYO A;  3C38 A;  1GHM A;  4KZ8 A;  2A3U A;  1WYC A;  2W27 A;  1XFN A;  4P0M A;  4UAA A;  3S1Y A;  4U3T A;  5HD5 A;  4G3V A;  4PAU A;  5E2H A;  2M1C A;  5A91 A;  4E3L A;  2ZMA A;  3ZNY A;  3E98 A;  1QME A;  3IXD A;  1L0D A;  1XJ4 A;  4FH4 A;  4Y0O A;  3TSG A;  3ZQ5 A;  3JVU A;  4WN5 A;  4QJG A;  4PM7 A;  5HL1 A;  3NDE A;  4MMN A;  5IU1 A;  2BTF P;  3D9Y A;  1M6K A;  3IS2 A;  3MR0 A;  4EW7 A;  3LR4 A;  1H0M A;  4EEP A;  1K57 A;  4YOF A;  3C5A A;  3HLG A;  3V3S A;  1N9O A;  3N6I A;  4S2P A;  4DE3 A;  1FSW A;  4OVD A;  2J3T C;  2ZL1 B;  4X55 A;  1VEU B;  2K31 A;  3LO7 A;  1LI0 A;  3PAG A;  5GL9 A;  3LR5 A;  1TEM A;  3VOL A;  2OWH A;  2VEA A;  3NBL A;  4LV0 A;  3NDG A;  1IEM A;  3E2L A;  1MKI A;  2BLS A;  1S1Z A;  5DTT A;  3EGD C; 
#chains in the Genus database with same CATH homology
 1PRQ A;  5FEG A;  1CQA A;  2V8F A;  1D1J A;  4X1L A;  2VK3 A;  2B95 A;  1ACF A;  5EM1 A;  1PNE A;  3NUL A;  3CPT B;  1HLU P;  2V8C A;  1SKO B;  1J3W A;  1FIK A;  2JKF A;  3UB5 P;  3LGO A;  1VET A;  2ZL1 A;  5EVE A;  1SZV A;  1Y4O A;  4D60 A;  3MS6 A;  4X1M A;  1CJF A;  3NEC A;  2PBD P;  5FEF A;  3L7H A;  3U4L P;  5FDS A;  3MSH A;  3LEQ A;  1VET B;  1A0K A;  2HZ5 A;  1G5U A;  1VEU A;  1CF0 A;  1FIL A;  5EM0 A;  4X25 A;  1AWI A;  2BTF P;  1F2K A;  1K0K A;  3T1S A;  4QWO A;  3L9K A;  3D9Y A;  4FTX A;  3T1X A;  2E8J A;  2PAV P;  2JKG A;  1Z09 A;  2ZL1 B;  2ACG A;  3KYE A;  1VEU B;  3T1R A;  4FUW A;  1PFL A;  3CHW P;  3CPT A;  3DAV A;  1YPR A;  4ESP A;  3T1Q B;  2PRF A;  3T12 B;  1SKO A;  5EV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...