1PNTA

Crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords ACID PHOSPHATASE
total genus 63
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pntA00
2NZVG 2E4UA 5EWLB 1SXHA 3RH0A 4P1ZA 5DLEA 3OO0A 3KYIB 4HNSA 5CNMA 5TPZA 4F06A 1E2BA 3N75A 4RXMA 3SG0A 4H60A 3EQZA 5FWXB 3MQ4A 4WUTA 1PNTA 1QQBA 3I5AA 2LBPA 2IPMA 3MMNA 2MSWA 5IUKC 1XHEA 3F7NA 4L4UA 3CFYA 2BGGA 2RJOA 3RVQA 2GX6A 1K68A 2A9RA 4MYRA 1Z16A 3CZCA 4N47A 2PUBA 1JHZA 1C0EA 2RDMA 3QEMA 2CHFA 4YCSA 4XXHA 7ABPA 1YMUA 5HSGA 3JVDA 2RGYA 2WJWA 3JS5A 5IX8A 1FFGA 2FXIA 1M5TA 5DCLA 2E4WA 1A2OA 4QYWA 5TPWB 1ZH2A 1DBWA 2A9PA 3Q15C 4KK3A 4LDZA 5C5EA 3KG2A 2ID7A 1J56A 3T8YA 4LDAA 3KS9A 1C4WA 4TLLB 3SAJA 2TMYA 1DC7A 3OLXA 4MR9A 1L5ZA 4RK0A 2FMHA 2NT4A 2QVCA 4KFCA 5EWLA 1DBQA 1LBIA 3BREA 5KQLA 3OLZA 3W9SA 1D4ZA 2E4YA 4IRXA 4EGSA 1AB5A 1QQAA 4KK4A 4YRZA 4EYQA 1JYFA 4ETIA 1NXVA 3MM4A 3O2SB 1JLKA 1SXGA 1YIOA 5FWYB 1A0OA 1QMPA 3FGZA 1RPJA 2F8TA 3L49A 4YO7A 5B3JA 3N0RA 3H5OA 4MS3A 1OXBB 4LE0A 4Z0NA 5KC8A 4KREA 5TPWA 1M2FA 4KRFA 2VK2A 1NXWA 3CG4A 3LKBA 3HSYA 4MS1A 1Z13A 2PKXA 3RVPA 3TMYA 5BRAA 2FTKE 5IEBA 2YHAA 2WJAA 3BRSA 1MB0A 2FEPA 4ZJPA 4KQ9A 2P4UA 4OATA 1JFTA 4W5NA 2JVKA 5TQ2A 1ZDMA 2KYRA 2L17A 3HV2A 3O2QB 3GWGA 3NNDA 2PUEA 3HEBA 5KQGA 1MVOA 1E6MA 5D2CA 4RS3A 4RK5A 4KZKA 2JB9A 3VNAA 5JNRA 5JNVA 1ZITA 3LKVA 3T95A 1GLGA 5EWJB 1FSPA 1ZHHA 3G85A 3CTPA 1LK0A 2MSKA 3F6PA 3H5LA 4IMIB 4MR8A 4WT7A 3UK0A 3OM0A 4G0QA 3CS3A 4XARA 4D6XA 4F12A 1FFSA 2FQXA 1VLZA 3NHZA 3OM1A 3HK2A 3OO1A 3G1WA 3NNSA 2FQWA 2L18A 3OMWA 4YS6A 2O20A 3VNBA 5T7BA 1SD5A 1NXXA 3Q41A 3DLBA 4RK7A 4H3KB 3LTEA 2L2QA 3EODA 1W25A 3EAFA 6CHYA 4EVRA 5DTEA 1DRJA 1JX6A 4RU1A 4UHKA 1ABFA 4MQEA 3RQIA 3HZHA 4PYRA 3RVLA 1IIBA 4G0OA 2NZUG 3O74A 5BQ3A 1VKRA 5DGCA 3NHMA 8ABPA 3LUFA 3ROFA 4IMJB 2FMKA 2WY2D 1XHFA 3Q9SA 5IBQA 1MB3A 4OG2A 4RSMA 3H1GA 2PAFA 4P98A 4RK1A 4JAVC 3QELB 4Z4IA 4F3TA 1DCFA 4MQFA 2R4QA 3ILYA 3JVIA 3KHTA 4LRQA 4IILA 2QV0A 2FLKA 2PLNA 4MR9B 3TB6A 3C97A 5KI6A 1P6QA 4MS1B 1BAPA 3BRQA 1F4VA 2WRZA 3QK7A 4OTZA 4RKQA 5TQ0B 4OBBA 1QP0A 1ZY2A 1BDJA 5TQ0A 4DN6A 1RXEA 4RY9A 5JS1A 4O5AA 3Q7SA 1D5WA 2FMIA 2MYPA 3LFTA 2AYZA 3ROTA 2M1ZA 1JWLA 3H6GA 1QO0D 5ABPA 3QLVA 3L6UA 4RZSA 3H5WA 1JF8A 2E4VA 4EVQA 3A10A 4G0ZA 4G0XA 1U0SY 2GKGA 2QZJA 1M2EA 2X7XA 3KSMA 3LUCA 3QEKA 3HXMA 2ZAYA 4ZMRA 5FWXA 5TQJA 3MA0A 4QYMA 3OQOA 3JPYA 1YK1A 3CNBA 1RNLA 1GUBA 1T34A 3O21A 1JYEA 1AB6A 2CWDA 3KCNA 4RXUA 2PL9A 3TX6A 4OLAA 1RZRA 3M6MD 2ID9A 3UUGA 3H5VA 4MQEB 4HNRA 1U8TA 3IPAA 1D1PA 1USGA 1A04A 4Q6BA 5DKFA 2PUGA 1LJLA 2LUOA 3GRCA 1QPZA 1ZAYA 4W5QA 2ZWMA 1DP4A 3KJXA 5KC9A 4G86A 5TPZD 1MAVA 2R48A 4EYOA 4MS4A 1APBA 2R47A 1QNLA 1Z2EA 1FFWA 3QLUC 3SQNA 1DRKA 3H75A 1JL3A 4RV5A 2XDYA 4N76A 4KMRA 1Y1LA 2NUBA 1GUDA 2HQOA 3LUDA 3D02A 4G0MA 4PEVA 1E6LA 1DC8A 2VUIB 3EDCA 5FBHA 1BVHA 2PE5A 2YHBA 1YMVA 5HKOA 2MYTA 1KRXA 2QR3A 4MRMB 4N41A 3OQNA 5HM6A 1DJMA 1KGSA 1JDNA 4YWHA 1Z2DA 3OLYA 3QX8A 1VRVA 1SRRA 4N0PA 4RK4A 2FMFA 1RXIA 4JA2A 3RVOA 5JNWA 4W5OA 4JB0A 3JTEA 1M5UA 4F11A 3RVSA 4MS4B 1USIA 3H6HA 3IP9A 3D8UA 4RWEA 1R8JA 4NCBA 1PHRA 3F6CA 1Z15A 4KPYA 2F8SA 5TQ2B 3CLKA 4E7OA 1ZGGA 3HJFA 5FBKA 4S04A 2JCGA 3MF4A 4XFKA 2IPNA 4YV7A 6ABPA 4MLCA 1TMYA 2OQRA 3EULA 3RVRA 4Z4FA 5CNIA 3CU5A 4JP1A 3SNKA 4EUKA 3T6KA 1PEAA 1ISRA 2QXYA 1NXPA 4FE4A 3O1IC 2FEWB 3C3WA 4GPAA 4ETNA 3FFWA 5BR1A 2VYCA 3SM9A 3KYJB 3IP5A 4PZ0A 1QP7A 4PE5B 3A3KA 1DZ3A 1MIHA 3C3MA 4HYEA 4Q6WA 4XLTA 1VPWA 4RK6A 3QELA 4MR7B 1GCAA 2E4XA 1CYEA 4M88A 4EY3A 1RZRD 1JDPA 1EWVA 3OMXA 4IGAA 4LZLA 2IKSA 2LP4Y 5I4CA 4FB4A 3M9WA 4LX8A 4L85A 5KWSA 4W5RA 5B3JC 5CNJA 2FN9A 2PUFA 4O1IA 4EYGA 3NBMA 3BILA 3QX9A 4IF4A 2IPAB 4TLMB 3HVRA 2JBAB 3RVMA 5BRJA 3GYBA 3C6QA 3E3MA 3A0RB 3LUJA 3OQMA 3FMVA 2PL1A 3QEMB 1ABEA 2QU7A 1ZN2A 4MQFB 3I45A 1I3CA 5C5CA 2L19A 5EWMB 1U2QA 2V0NA 3I42A 5F64A 4H3HB 3GBPA 4KQCA 1ZGZA 2B4AA 1KMIY 1U04A 1DG9A 4DADA 1ISSA 5PNTA 1PNRA 3LUGA 4NQRA 2Q5CA 3TD9A 2QW1A 1JBEA 3HUTA 5IUJC 3GL9A 4KVFA 5JNSA 4MR7A 1NXOA 5JNUA 4MGEA 2FEKA 2PJUA 3E61A 1TJYA 3K4HA 4EYKA 3A0UA 3GA5A 3SY8A 4KNYA 1EHCA 4B09A 1GCGA 5CNKA 1QKKA 3S99A 5IUNC 3BBLA 2P9HA 5HQJA 1DCMA 1DCKA 2JRLA 3LUAA 3H5TA 3LUKA 3EGCA 1ZVVA 4F8JA 4WXEA 1TVMA 1YVUA 3O75A 4LE2A 3H1EA 2PMCA 3UKJA 4ETMA 3HDVA 2A9OA 2IOYA 1D2AA 1QO0A 4MR8B 3URMA 3DBIA 1K66A 2H0AA 3JY6A 3O2JA 4D6YA 2OENG 4RY8A 3IP7A 1UDRA 4MLDA 3RVJA 4E7PA 3N0XA 4XASA 2QSJA 3OLWA 1F51E 5IC5A 3R0JA 3RVKA 5ED4A 3B2NA 9ABPA 4UHJA 1BA2A 4GNRA 3CKMA 2AYXA 1U2PA 3EJWA 2W42A 1WETA 3CRNA 3HS3A 4FE7A 1E6KA 4JASB 2VUHB 3LOPA 3TO5A 2FQYA 1BDIA 1LBHA 1L5YA 1CHNA 3GT7A 4QPJC 1NXTA 2PUCA 4MRMA 3T38A 3HUUA 1ZESA 4YP9A 3N6VA 2MSLA 3K9CA 2PUDA 1Z18A 4YR7A 5IEJA 1EAYA 1USKA 3FDFA 4W5TA 1TLFA 2FW0A 3IDOA 4RXTA 5EWMA 2LPMA 3CHYA 3DGEC 4NICA 5IULC 3F73A 3N8IA 4Z99A 1JH9A 1LJUA 2FLWA 3GV0A 5CHYA 5FWYA 3Q7TA 4ML3A 4RKRA 3RVNA 1Z26A 1FQWA 2FN8A 3O1JC 4Z9BA 1KRWA 1URPA 2JBAA 4WXMA 4Q7EA 2H3HA 4Y9TA 2HJ9A 3CG0A 2FVYA 5JNTA 1W9HA 4CBVA 1YS6A 3FFTA 4OLBA 1YS7A 2HPHA 4NV3A 2A9QA 4S05A 1B00A 1Z17A 3HCWA 3N0WA 4YGXB 3NNNA 3N53A 1P8AA 2IPLA 2QVGA 3KTOA 4Z9AA 5KQPA 1YK0A 1YTUA 1NTRA 1EFAA 3OLVA 3ILHA 3IP6A 4WZZA 4KV7A 3CZ5A 2J48A 2WMYA 5T3YA 4DQDA 1CEYA 3P9YA 4JOQA 1P6UA 4RY0A 4LE1A 1PEYA 1DBPA 1S8NA 2CHEA 4HNQA 2JVJA 3O1HB 3QLTA 4QICA 4MPTA 3HM9A 1JFSA 2E4ZA 2RJNA 3JPWA 2GWRA 3IPCA 3KLNA 4JB2A 5KQMA 4NCAA 4WWHA 1XWWA 3GBVA 1EWTA 3DZDA 2HQRA 3EQ2A 2GI4A 2WWVD 1NATA 5GQSA 4XAQA 1H9CA 4EVSA 4Z4GA 3MIZA 1QP4A 1ZH4A 4ZPJA 3H1FA 4TMYA 2HQBA 3C3KA 4N0QA 2NT3A 1BDHA 5TE9A 4G0YA 5EWJA 1Z25A 3DGFC 1TM2A 2MYNA 1OXKB 1Z12A 2WB4A 2FSPA 3QLUA 1PUXA 4Z4HA 3MYYA 2MYUA 4Z4CA 2IDMA 4RDCA 4N03A 2PUAA 1NXSA 2CD7A 2HSGA 4O1HA 4Z4EA 1SXIA 1HEYA 3H5IA 4G97A 3DLHA 2B1JA 1NY5A 2DRIA 2M98A 4D74A 3M9XA 4YLEA 3KLOA 3LUHA 1EWKA 4PICA 2N9UA 4MAAA 1P2FA 5GOTA 3HO1A 1D1QA 4TN5A 2IYNA 3Q7RA 4MS3B 2JVIA 2JK1A 3LMKA 3KKEA 2GBPA 5JS2A 2LIVA 2I6FA 3I09A 3FFXA 3HDGA 5E3JA 4ZYLA 1JFVA 4G0PA 4ZMSA 3QLVC 2FKAA 2R25B
chains in the Genus database with same CATH superfamily
3NOXA 2PX8A 3FUXA 1IUPA 4U7WA 5U4QA 2W6QA 1U1CA 3AQ4A 2YICA 3R3UA 1RHQA 4CMJA 1Y4AE 1RWQA 1ZXXA 3G68A 3KYIB 1ORHA 3E7PA 5TNXA 3U26A 1W75A 3GLQA 3M82A 5C8ZA 3O4HA 5C7IO 4UTRA 3R5JA 4M1ZA 1XQ1A 1UPFA 2F67A 2RB4A 3KV3O 5T4HA 2Y1DA 1XHEA 4C30A 4BXOA 3CEMA 4L4UA 4R1PA 3ZDXB 3TUJC 3DWFA 2F2TA 2YBEA 1E2IA 4HZIA 3WQQA 1K68A 2A9RA 1WCV1 4HRAA 2PWAA 4J16C 2RDMA 1XEFA 2CHFA 4DV7B 1BDBA 3DAGA 3HJTA 4UOEA 4JT8A 2RGDA 3JD4A 1KY5A 2ZRMA 3JZIA 4K1XA 4MUKA 3Q9NA 3FOAA 4LDPA 4E94A 2AMJA 5TPWB 4W8GA 4Q4AB 1ZH2A 2P2ZA 2VYQA 3N8KA 2APJA 2LCFA 2PZFA 4XD7A 3PIRA 1D2GA 4X1IB 3T8YA 4OA5A 2P4QA 1R4NB 1R6BX 3B6JA 3D31A 2W6PA 3T7SA 4ZI2A 4BKQA 1F2DA 3HY4A 3KSAC 5EY5B 2WJVA 3HUDA 4PRYA 4YAWA 2ZR8A 5JTTA 1S7GA 1XRMA 3LLSA 1P81A 1UPUA 2VTDA 1E2FA 3DFMA 5CK5A 4JY7A 2AG0A 1QQTA 3IJ5A 2AEFA 2GR9A 1XD2B 4A1OA 1A7JA 1QGOA 4ETIA 3MM4A 4UAVA 3DC2A 4XD7D 1X1CA 3FR8A 4L5BA 2UVQA 4IUCS 4C7OB 1FFXA 1NONA 4FDAA 5DT9A 3B9RA 2BISA 1H3NA 2DBQA 3KXDA 2C98A 4DE5A 5B3JA 1WP4A 1YHYA 4S1OA 2P6OA 3GRAA 3TMYA 1C8LA 3K4QA 2QUHA 4GMDA 3PFIA 1N4DA 2VZEA 3BD9A 2WJAA 4DUGA 2VHZA 2WTAA 3BRSA 2O8BB 3EGIA 1KDTA 4IQ4A 4WA8A 1OBVA 3BF8A 4KQ9A 3RTBA 1EM8A 4AQDA 1P2UA 1L7PA 4DWJA 1SHTX 1OXSC 1TKBA 3HFRA 1KC3A 1QCCA 1TQ6A 2SKCA 4MYUA 1HK7A 1N8SA 1O58A 2HA2A 3PENA 2V55B 4HEA6 3C2QA 2XOXA 4WLEA 1WOYA 5ERYA 1WBJB 3ISJA 1KETA 4ND5A 4AX4A 4AIRA 1DFIA 1JJIA 2RD2A 2X13A 5HP4A 2DQKA 5JDIC 3ZD8A 1NAIA 2BMEA 2CXOA 4NH0A 3TW6A 4NI5A 3FCAA 1HDIA 2C7OA 4ESHA 3FWHA 3OKPA 4KKVA 2XEXA 4JODA 2JJ2D 3OX4A 1PKEA 2HBZA 4P4GA 1JLLA 2FHPA 3B52X 4R2HA 5FTKA 4COOA 4US0R 3CTPA 2GTPA 4ZEXA 4HGQA 2CZCA 3DFUA 4IIYA 1JHXA 3DE6X 1ISGA 2IPOA 4GLJA 1LTQA 3AJ9A 4XM1A 2F6RA 2R6GA 4EA7A 1CEXA 4XR4A 1I7DA 4G1MB 1IEQA 3UN1A 1OXXK 1K8RA 3WGVA 1ACJA 1U7UA 5JNLA 2ZYAA 4ZK6A 2G67A 4TSFA 1CUBA 2OCAA 2IZOA 3B1YA 3WNZA 4FM9A 4UW9A 4MPJA 4C2AA 1EMDA 1UMBB 3RAPR 1ZD2P 4FHDA 1CS0A 4MWBA 3OU7A 3D2AA 2EBHX 5AKLA 3VTKA 4UHKA 4BOYA 4ZO8A 2JZNA 5KJ6A 2Q7DA 4JKYA 2IYAA 1ZRHA 3MWGA 3LVRE 3VR3D 4AJNA 3VH2A 4ZGGA 2YVUA 1VKRA 5F9FA 1XK7A 5HW0A 1N2ZA 4URXR 3ROFA 4ZN6A 1XTUA 1SAYA 2Y1CA 3R7LA 3V9PA 4QBHA 1CX9B 2FUNB 2NO7A 5SY9A 5K6TA 3A9SA 3TXXA 3ZTTA 1GGEA 2BTQA 3WFJA 2O0JA 5IASA 1YFKA 1BXGA 3COVA 4JBXA 2BH2A 2HMYB 1TM1E 4DYVA 4GKKB 2M2IA 4FMCB 5FTJA 2W2LD 4C05A 2ZS9A 1X6VA 3DDUA 4LMBA 4WZAE 2JS7A 4AXBA 4WLOA 5JEEA 4BNWA 5IKEA 4F8EA 3PHBE 4FGLA 4LJ7A 5CLLA 2W2NA 3QOWA 3PS9A 4R2IA 3ZVNA 3RREA 3NWBA 3QMMA 5BV1A 1JU4A 3PJDA 5FOVA 3UMGA 3KOZA 1AGXA 3O93A 2B94A 3ZS8A 1B74A 1ZJZA 3PFHA 2HTFA 4GKBA 5DISB 4LV8B 2WTUA 1V7ZA 1SQ5A 3BMOA 1CD5A 2QR5A 1R16A 4O2AA 4NONA 4ERXA 5AOAA 3L6UA 4EJFA 3RFXA 4JA0A 6ADHA 4LI3X 3NEYA 1HDXA 3DBHA 3SHWA 3TNFA 1D2NA 2AN4A 1RKXA 2UU9B 1T9ZA 3FAKA 1AOXA 1U0LA 2JCXA 2FZLA 4ALNA 2FEOA 4RPKA 2H2WA 1IVYA 1U7HA 1UP6A 2PKQO 4RPGA 4TWRA 4IGKA 4RIEA 5CCBA 2GBLC 3WLRA 2ZE6A 4WK2B 4ROTA 4U0JA 5FYQA 5FR2A 1M6HA 5GZ3A 4ZYTA 1NQWA 1UBMS 5CRIA 3WLOA 1A9XA 2NTJA 4S1NA 4XUGB 1U8TA 2ZRQA 2QJTA 4CLOA 1WCIB 1XXHB 1D1PA 2LRHA 3CONA 4KMSA 4ZHQA 1YS9A 1JH8A 1NGSA 2GRUA 3T41A 4XA8A 2ZIZA 4ZCRA 2JJ1A 1TM5E 4L57A 3PWZA 5JT1A 4DG9A 3LSTA 2ZWMA 2FI1A 1OJLA 2Q1WA 2VQDA 1V5GA 2WSLA 2V4UA 3DMGA 4E21A 5K0SA 2FDCA 1QNLA 1LXCA 3AYZB 5EXXA 5T64A 3C6KA 3ELWA 3NATA 4OYRA 3ZDZB 1OGYA 4DIEA 4XYMA 4QFCA 2YXLA 2DHEA 1UBUS 2NSYA 1OBHA 1GUDA 2CFOA 3DZKA 1G5TA 3D02A 3LY9A 3U49A 4E08A 1DELA 5KU7A 1R8SA 5GVSA 4B44A 1IN4A 3H2SA 4HGYA 4UNQA 4DJDC 1NLFA 2AFVA 2Z6VA 3B1KA 4QECA 2C9OA 3F3YA 4IFIA 1XKTA 3MINA 4P4SB 3JV7A 2Z1MA 1NRWA 2PVCA 3O3MB 3OCCA 2MCFA 3ZV5A 4W5OA 5LLSA 3CVWA 4I9FA 2EF1A 2VN8A 1SVMA 3W9BA 3EEBA 3LT2A 2DR2A 5DSZA 5C52B 3FZEA 1YDEA 2BLLA 2ZDGA 4EKNB 2QGNA 3OKFA 1OPXA 5CMLA 5TLSA 5ESDA 1PR5A 3JCZA 3S6JA 1SMKA 2WYVA 1BHQ1 2UKDA 3H42B 4K0RA 1AMUA 1TC2A 5DYWA 1UJ4A 3HWRA 4BUZA 3LVFO 4YV7A 3RVRA 4FBLA 1VJCA 1QYIA 2JGFA 2Z58A 1V8FA 1ZOSA 3BJMA 5K3DA 5ELXA 2JG3A 2BRUA 3WNCA 1J06A 2WMDA 1G2QA 3NVDA 2GEVA 2P5YA 2X0JA 2FEWB 4P34A 3BMNA 2P6PA 3ZJUA 3Q3GE 1Q0RA 4C4XA 4A9AA 1L9XA 4J94A 1JHMA 1W19A 5CITA 1ZD1A 2KBFA 4X20A 2WWFA 5WRFA 1WQ3A 1DZ3A 2WV9A 1M6NA 4LV6A 3D64A 2HLPA 3PHJA 4IDEA 4WLNA 3GIWA 4XLTA 1NN5A 1U4NA 4JKIA 3I23A 4MR7B 1BOOA 4KODA 3LECA 4G9BA 1K63A 3WGIA 1YRYE 4P3PA 1NJ8A 5J58A 2JLWA 5CLJA 3TLAA 1MX3A 4GOXA 2MIIA 1CR1A 1JB1A 3M9WA 5BWOA 5JI3E 4AUEA 3MERA 4PZAA 1ZIOA 3OEYA 4IXNA 4KJZA 4U2FA 1CDDA 1CF2O 3U7HB 3VTAA 3S55A 3EMDA 2WNSA 4QBIA 4X64B 5GV7A 4BPBA 1U1GA 2GT1A 3NZEA 2VZLA 4NBLA 4H27A 1WX1A 5CEFA 3EGDB 3SSOA 1FPQA 1PGQA 2GEKA 2YV1A 3N2KA 2HQ1A 3DE2X 4GH5A 5TX7A 2H2GA 3HFGA 1RP1A 5FOQA 1IZ8A 4C01A 2P1ZA 3ZQUA 4HDNB 1X1EA 3UCEA 4MWGA 4COKA 2AIRA 2YQZA 4O6VA 5H80A 1B8UA 1Z5PA 4L3VA 1QM5A 3RRJA 2JLUA 1IN8A 1V2HE 4XYGA 2QP4A 3RYHB 1QAMA 3I76A 3RBAA 2VBGA 4EB6B 4OMDA 4WJKB 2EWWA 1PWEA 2XRFA 4TUYF 3L9XA 5G0SA 1KR5A 3DJFA 5EE3A 5A3JA 1OASA 1OFTA 4ID9A 2VXOA 3EWNA 1ID8A 4WK0B 4YI3A 3ICEA 5JNUA 4ZDJA 1OX4A 3AF6A 3MTJA 1N2XA 2ZE7A 2PXXA 5AK3A 3AGPA 5CX1A 2ZYRA 5DTJA 3SY8A 4K0KB 3D8RA 3PX7A 4A0FA 1XOIA 4KIWA 4M36A 4AKSA 4YAIA 5EMHA 4QXMA 2WLSA 5B1YA 4NP6A 2V7EA 3TLKA 1KQGA 3GJYA 1R50A 3HI4A 3OE4A 4TMZA 1DCKA 1BRTA 1ZYUA 2JRLA 3RS0A 1YAHA 3BA6A 4OHZA 4YLYA 1K9SA 2YS6A 4KCGA 1M1YE 2ANBA 2EHDA 3B85A 5M04A 1XQVA 5JSUA 4IGFA 3KJEA 1PTJC 1BGXT 4QGGA 3I2GA 1AS2A 2DFVA 3CRMA 3EWSA 3QOYA 2Z8YM 3ETGA 3E9YA 4PYIA 3JWGA 1ODLA 2YWXA 3K1JA 4WA7A 2QLMA 1BD4A 4KDFA 3NHWA 3RADC 1OF1A 2ZTLA 5I9SA 5DRTA 4D8XA 3VH4A 3OZTA 4M7WA 3GRVA 1XCMA 1UANA 1PD1A 1O9GA 2Z5GA 4C2BA 4V3BA 3KUUA 3IIMA 4JSRA 4FMCF 1G66A 1QFMA 4NBNA 4BQPA 4O59O 4F5ZA 4PX5A 3E5MA 3KLBA 4P2BA 2BE9A 4AY3A 3OCZA 1NNLA 1P4GA 3EPLA 1GZ5A 1DE0A 3KKPA 1II8A 2CFSA 4KRGA 1YCHA 3TSWA 4YRQA 3N6VA 2XPCA 3E8MA 3K9CA 4LJ5A 3UZUA 1KDRA 1Z45A 3GJ6A 4C4RA 4KE8A 4F93B 4TPKA 3AEXA 1N2SA 1USKA 4W5TA 3A7DA 3I2HA 3AB7A 3AM3A 8MHTA 1WABA 1NBMA 4P08A 3F73A 4MCAA 2VJCA 3N8IA 4N3CA 5HS6A 5EESA 1E9RA 3TLGA 4XQEA 2VP9A 4Z9BA 2GILA 1A5ZA 1X9IA 4QQRA 1KSJA 2WPDA 2FPIA 5IM4A 1N1DA 1YRHA 1QOZA 3C5VA 1RXVA 2YNMD 4H4EA 3AP3A 2O23A 4BP3A 4GECA 3T7CA 4B32A 1E59A 1W2GA 2PSJA 3RS8A 1T4CA 4LJ4A 1KQFA 3EE6A 1N4AA 2PQ2A 3BK2A 1AM4D 2ZJ3A 4X97A 4ZQFA 2FRDA 1J4AA 2N1MA 3OE1A 1U8AA 4KQWA 1UUFA 5IC6A 3EBOA 3UMVA 1W34A 3JWJA 3K1ZA 1CQPA 5ERXA 4FHCA 1D6NA 3WA7A 4P32A 2CLOB 4YRLA 1NTRA 4HD8A 3TQFA 4A8HA 2NMVA 2OO3A 1LBQA 3IURA 1Q2XA 2Z1DA 1Y80A 1UPXA 3T3OA 4IV5A 1PLLA 1RHKA 4QJBA 4CMBA 1RVV1 2DBZA 2I7DA 3SYNA 3OP4A 3HM9A 2ZFUA 4IIEA 3WYCA 3ZV7A 4RQUA 2JEYA 4DEYA 4KHPB 1UH5A 1XZIA 4I1SA 3FTCA 1YVEI 4WWHA 2B98A 2EJWA 3RTGA 5CA1F 1L6IA 4EELA 2B2CA 2A0WA 1F48A 2HT6A 2PGXA 2Z83A 4GKAA 3V8EA 3V8VA 3REOA 3ZIAD 1XK6A 2I7TA 2ZS8A 3PSHA 4PFQA 1MB9A 1WCXA 2XKAA 1ATZA 2ZU6A 4QHSA 4W6ZA 3W8EA 3IEUA 8LDHA 1C0IA 1YASA 1CUVA 3BRCA 5JXIA 4U7DA 1BGVA 5DNEA 4FGWA 1CY8A 4LXGA 3GRRA 5C5IA 5CXQA 2WWWA 5JSHA 5A3VA 3AZOA 4DUZB 2WB4A 2QRGA 2W2XA 1HNXB 1LLUA 1T1JA 5B2ZA 4HNAB 2QTAA 5EIOA 5K03A 2H1FA 4Z4CA 3WE7A 2PBFA 2JIBA 2ZUCA 4JYBA 2WJ6A 3DL7A 3A9VA 1POXA 1DTWB 1CBUA 2HSGA 2HZ7A 3D4LA 1AKQA 1DJQA 1B3BA 3GUVA 2W6JD 2E6KA 3HY3A 3PUVA 4TROA 2QYOA 1HQKA 1L7VC 5FNVA 2Q4DA 4EJ2A 2C9YA 4YLEA 1JVBA 2HLDA 1EWKA 1RI2A 1R5BA 3ORRA 3EIXA 4RETA 4WKOA 5KYNA 2OCYC 4P8RA 4YRDA 2JA2A 3OPYI 2A4KA 2E82A 3P0RA 2VT6A 1K5GA 1SA0A 4U6SA 1ZD3A 5TMBA 4TVKA 3TPCA 2RH9B 1XROA 3VNRA 5HR5A 4P58A 3WRVA 2OXRA 3DOJA 3HI6A 1YOBA 5IYZF 2EL9A 1V3TA 1X7WA 2GZMA 3K35A 1A72A 2YVQA 4NOKA 4CTNA 2YC4C 3QKTA 2H92A 3BIOA 1THGA 1R2QA 5AMXA 1YA8A 1XZLA 4MAMA 3PQ7A 3I9NA 3MTBA 4FW9A 2G7ZA 5E3JA 1VJRA 3GG2A 3LPAA 4N5LA 3E0QA 4E31A 3GXBA 2NZVG 3ZK8A 3BXHA 1TQ4A 4KO1S 1N77A 4LF9B 4LISA 2KJQA 3NHSA 3AP1A 4OHMA 1NBIA 2KW5A 4BNGA 1A9RA 1EXWA 1AUVA 3BTUA 4RXMA 2BFAA 3QX3A 1QWOA 2OR3A 4UBLA 2R96A 4QDXA 3DEAA 1VHWA 4TMXA 1DQNA 5I01A 3SQMA 4GWLA 3H83A 3K2BA 4V0ME 4NENB 2P6RA 1RQ7A 3F7NA 4RABA 4DABA 3DBHB 4OLHA 1G7TA 2VDLB 5DLPA 4CIVA 3L3BA 2CMDA 1J49A 1Q19A 2B34A 1Z16A 5IABA 1D5CA 1J9EA 1ZJJA 1C0EA 1G0NA 4Q3LA 3ZH9B 4MH0R 1N57A 5B3AA 1NX9A 3CKLA 2WVHA 3BXFA 2JFOA 2AVDA 5F1YA 1TYDE 3KHSA 4GSLA 3IDZA 5IDQA 1GPJA 3JTMA 4Q7MB 2BTOA 3O9ZA 3S4YA 3BDIA 4LHVA 2R6JA 1DS6A 1ZGHA 4JOBA 1J56A 4ZI3A 4L4YA 5THKA 2R84A 5GJBA 2OHIA 1XEWX 1Q0UA 1H2ZA 2W7TA 4TLLB 821PA 5JV5A 2ZUEA 5J5VA 3ZX4A 2Q1TA 3BRWD 2IOFA 3QZUA 5BWBA 3BTSA 3KQSA 3FWKA 2H17A 3O8DA 1VCNA 3UJ9A 4B2YA 4EG6A 4YV0A 5I7HA 4G0WA 1AH2A 4B6FA 1K5HA 5H02A 2IY9A 5FPSA 1GFIA 3W6UA 1EYZA 3PDIA 3HCAA 4AJJA 5G02A 1Y6GA 2IXDA 3CZ4A 1U8UA 3F0TA 3N0TA 4GRIA 1CY4A 3VO1A 1TEZA 5L8VA 4GNKA 3I52A 5DF1A 3O2SB 5DB4A 1KDZA 2J41A 3ORFA 4QXQA 3T3NA 2AJCA 2AZMA 2HDOA 2NYRA 4X44A 4DR1B 3ST7A 1GP2A 1MT0A 1PRYA 3MTQA 3Q85A 4N18A 4Q3DA 2E37A 3CC8A 4HWPA 5AJHA 4MS3A 1M72A 4WZAA 3TXYA 4N0MA 1FMTA 1PV4A 4MS1A 5JRDS 2QUIA 3AO0B 1LA2A 2PM8A 2FX2A 2YVLA 3FYDA 4H7EA 1AMNA 3U1BA 2WF6A 1TO1E 3G0OA 3KZKA 3UV7A 1V35A 4O4IF 1CNMA 3AW9A 3HB4X 1MB0A 1GZVA 1SBTA 1GZHB 2OL4A 3HABA 5DM1A 4A6PA 5JI2E 5JXHA 1KNQA 3GFTA 1MV5A 1CIPA 3OZBA 5FL7A 4A4DA 1QG4A 2FGJA 1YQUA 4KIGA 3UGJA 1D7AA 3B5JA 3G2NA 3JYPA 2L17A 4YYZA 2QMHA 4DRXB 2QAIA 2P77A 3IE2A 4F9FA 5JWRA 4RVHA 4F91B 1E6MA 1L4UA 3QWAA 3MWEB 4AZ3A 1RMQA 4TV8F 4WESB 4G24A 4JJIA 2XRMA 5DX1A 4LUCA 1J22A 4MGIR 4LS3A 4RJ2A 5AUQA 3OT1B 4V0QA 4FKZA 3BE4A 3QUQA 5DNCA 1Z4PX 2DHQA 4RHFA 4CMEA 2I4RA 2CYBA 1I4TD 4K88A 3CLHA 4UJ5A 2X9NA 3PKIA 3G9XA 1QSGA 3VSAA 4D4HA 1IN5A 2BFMA 3ESCA 3OM1A 5CYOA 3HK2A 5JJKA 1YZNA 3ENKA 1FMLA 1OPRA 5F4BA 4BMNA 5ARDA 3TOZA 3H9QA 4IVPA 3SEAA 4LDJA 2WG0A 3WOVA 1NXXA 3II6X 2FMXA 1V7QA 5IAGA 3LTEA 4CM5A 3TRIA 4I9GA 4W9MC 2C9MA 2IYEA 2OBYA 4TT3D 1R74A 2OXTA 2OZEA 2WSSD 2NXNA 4RU1A 5AHOA 4V2UA 4J9UE 3HZHA 3D2BA 2BMVA 4LQ4A 2LNDA 2DGDA 5C51B 2DXIA 3G89A 1C1DB 2ECKA 3RFUA 3U13A 3NHMA 4GP9A 4XH9B 4AJOA 1L4FA 4LSWA 2I62A 4UFOA 3S8MA 4ZVRA 3TGPA 2NNWB 1KEEB 5E2AA 3UAGA 3KQHA 3L6CA 4PC3A 3RT9A 2O52A 2HX1A 3RJ5A 4QXRA 3UWMA 4Q9LA 1CYDA 4JHXA 1A8UA 4FCTA 4EKIA 3EBLA 1MJGM 1YGYA 3FW1A 2PJDA 5FCDA 4D9FA 4AUNA 4YT4A 1HH4A 1UJMA 3AF2A 5K4AA 4Z0TA 1T5DX 4DSTA 3IHKA 1Y63A 3EVZA 3ZQ4A 2K7FA 1YR1A 5I7AA 3K20A 4NK4A 1XQWA 2I2DA 2GRJA 4OKIA 2DAPA 1FTYA 2WKPA 4IL5A 3CA8A 1DEKA 3NDRA 5D84A 3TCXB 5IHPA 1M5RA 2A5YB 1J0AA 3AIKA 2XVZA 1KJQA 1GQSA 4PX3A 2PXAA 4IZ6A 3MPUA 4I8XA 4UPDA 4YAUA 3NIFB 3O4IA 5JPDA 3WDLA 3GEGA 4L5YA 4ZPXA 3UWOA 3TGWA 5KTKA 4WY8A 1Q1QA 1CVRA 4R40A 2JAUA 3U6KA 4ZC1A 1RWKA 3FF1A 3QKWA 2EDCA 1I1HA 2GPYA 2JGIA 3FUCA 3TLMA 5AM3A 4LZWA 2FB9A 5KNCD 5A9TA 2H7VA 4ZVNA 1KH3A 1UK6A 2NADA 4OB6A 3KKZA 2NYVA 2VS1A 2WU8A 1QIFA 3ZJYA 2C0CA 4D4KA 3TOXA 5BWLA 4CEJB 2QOEA 4FQ5A 1IAVA 3LDGA 1RSZA 3T5AA 4AKEA 4BKMA 1E2HA 2W8BA 4DYDA 1TF2A 1EH5A 2R8BA 5J4HA 1ZK4A 3LCUA 2VA9A 3TUZC 1K6XA 1XKXA 5AKGA 3QVVA 5E3IA 4M0DA 1FMCA 1TMKA 2GFHA 2ID9A 2HLHA 3NUGA 4Y2HA 5HTOA 2NPFA 3UK6A 3KB6A 2R68A 2H5IA 2WG1A 5DXFA 1EDOA 2WAYA 4MGYR 4PZCA 4Q4LA 1UZUA 3M0EA 4TL9A 1JA0A 1XSEA 3UGKA 4IX9A 4V39A 2A3NA 2OG1A 2Y1GA 4FWIB 4BKUA 3C8UA 4EECA 4KLNA 5DW0A 4GICA 3LQ2A 5I9TA 1K5PA 1DG3A 4HPXB 5ILGA 1MPTA 4MV7A 5ALUA 1T2UA 4BNYA 4RV9A 5LQUA 4FS8A 4DA6A 3V80A 1NLMA 4I3FA 2BMFA 4JQSA 3VDMA 1NI4B 2C0QA 4G0MA 1F8YA 1MJNA 3AETA 1S02A 2HSZA 5AVJA 4G0NA 2PE5A 3CUTA 3AVQA 3CJQA 2J4DA 3F8TA 4C22A 5JSYA 4F1KA 3OQNA 4F9GA 2I7XA 2IW1A 3VR5H 4B71A 2VTBA 3R4CA 1G63A 3R6WA 4GR9A 2G1PA 6LDHA 4BNDB 4EI2A 4OXNA 4Z1MD 4ZEMA 7AT1A 2IV3A 1KEKA 1SIWA 4F96A 3TTVA 3VGPA 2JGAA 4B48A 1HRKA 5D00A 3CO0S 3GP5A 1BQ3A 3L1VA 3OFKA 1GV0A 4ID3A 4EHKA 5IVPA 1J23A 1D4FA 1AQYA 3W8RA 2VSOA 1KU0A 3KBBA 1TF7A 3WJ2A 3N7AA 3NBUA 1WMSA 3J7TA 1Q77A 4H1WA 4LK2A 4ZQBA 3JQGB 2D06A 3EULA 2P75A 5CM9C 4X3OA 4C3ZA 1HZJA 2F90A 1C7QA 1GJRA 1XTZA 4WBNA 4X3PA 3UK1A 4BLRA 3CNQS 1JKIA 2X7HA 3AJRA 1EWRA 1VPEA 4JZKA 3UPDA 2VF8A 4UM5A 2J45A 1T6BY 5ENVA 4F3YA 5JATA 2XT0A 1MJFA 1WPXA 3TTYA 1SC1A 1VL2A 2HQSA 3FFWA 1ZEJA 1JG2A 3VUEA 5CB4B 5MN6A 3I62A 4HADA 2Q9UA 1C9YA 2XWPA 3G2HA 1BW9A 3KYJB 4YXWD 4BBZA 4NMHA 5AI0A 4AMVA 3H8JA 3GLGE 2X6QA 3DDZX 3R3HA 1SUDA 4HYEA 4KDCA 4NCJA 4AYWA 4E11A 3QELA 2ATVA 3HBFA 3K6RA 1UT6A 1WKBA 2Y0BA 1WHSA 1EA7A 1E9FA 1Z6TA 5JWHA 4G2NA 1YR7A 3ZY4A 5HQ3B 4TKVB 3BRWA 3GJTA 4L9AA 5EEGA 4EB6A 1KOGA 5MGNA 1JHDA 5BUSA 2NG1A 2C29D 3JZMA 2GBLA 5AK6A 4PXAA 4CM1A 4DPLA 2PUFA 4O1IA 5JFOA 1DADA 2HC9A 3ROGA 1EDEA 1GIAA 4O08A 3FX2A 4OHUA 3V8BA 4BQEA 3HR8A 1X1TA 1AGRA 5MFZA 3AVYA 2QI9C 2W2KB 1CULC 3DYBA 4G5SA 2D1TA 3R3XA 4ZU6X 5ULLA 2ZYTX 3MELA 1OA1A 1IBKB 2PFSA 3EPKA 2B69A 4I4TF 5LA6F 1XMJA 3NIGB 1UADA 3UJ6A 3C3XA 3EXHA 1RI5A 3K09A 4P38A 3TAHA 3AKZA 1A1SA 4U63A 2AC2A 2NU7B 3SFZA 2ZJOA 3TIFA 1CNEA 3NV9A 1VL5A 1GKUB 2W4IA 2B4AA 1JPVA 2H1CA 3OY2A 1RYDA 1HI9A 3D43A 4PXYA 1UL1X 2HRCA 4R68A 4TQGA 5PNTA 2HF8A 1DTEA 3S2ZA 4YBRA 2QD3A 1LDYA 1C29B 2J3MA 2GK4A 2D7CA 1M54A 2HSEA 3PNPA 1EVEA 1TQ2A 2JFFA 2PRZA 2X3FA 3DDOA 4KX5A 3ZDEA 2GDZA 3KO8A 1J2TA 3NX4A 3ZN2A 3PPVA 3HBAA 4NAUA 3PJFA 5NLLA 4ZYXA 3PNSA 1NXQA 1QKKA 4FOOA 1YSCA 1KK2A 3ENVA 2J6CA 3HFJA 3K5WA 3BK7A 4FN4A 2ETVA 4RACA 5ICFA 1PVOA 2RHJA 1U2RA 3QG1A 3VZPA 2I2AA 4OGKA 2V6JA 4N48A 2FUCA 2H6EA 1MRNA 1YVUA 3SOPA 2N47A 2O54A 1H05A 4GBGA 3NAQA 1FU4A 1DAKA 1H4SA 4LCBA 2IIPA 3I9LA 1YCFA 2TMGA 3PUXA 3ZJTA 3ON5A 1Y8ZA 5TT0A 3IP7A 4ECEA 3OZVA 3HFSA 1CLEA 1DQRA 4MRNA 3FOBA 1U8ZA 4LGCA 2PS1A 4A6XA 3AHIA 4M1YA 4G6ZA 5ED4A 3GEHA 2IK8A 3O2NA 9ABPA 1QV9A 1UMDB 3I2KA 4YJ3F 2HRBA 1DOHA 1U2PA 4JWKA 4LY9A 3OZWA 2GJSA 3FOZA 1XZHA 2OKCA 4EAAA 3R40A 1XZQA 2FQYA 3AILA 4FVTA 5KYWB 4E2XA 1CR6A 4QPJC 1KMHB 3BMXA 5AUOB 5SZHB 3LC0A 4EY8A 1ISMA 1HLFA 1SOUA 3E1KA 4CQLA 3D3EA 2XQFA 4JLOA 2M9MA 1JSLA 1ZUD1 2MSLA 2ZI7A 3AKYA 4YJ2B 2VQFB 2ZYIA 4JBHA 1PR4A 3A4NA 1XDUA 2XRZA 1REQB 1KP9A 2OO5A 2JCBA 3A25A 4BEWA 2IH2A 1HX7A 5IULC 2Q5LA 3ID6C 4MB6A 2P9FA 2W6IA 4K9DA 2WQZA 2DMRA 3T3HA 1SVSA 2CXNA 1LFAA 2JDID 1V43A 1KRWA 2FJUA 2WJIA 3N2LA 4YJ3B 1EUDA 1FNCA 4ZVMA 3TNYA 2DR0A 3FCUB 3ND8A 4M1WA 2B7BA 2H3HA 4Q9IA 4O2RA 1ONOA 3LL4A 3CX7A 3OETA 2YCLA 4NIMA 1W9HA 1IHDA 3UWSA 1OGIA 3W2IA 1UC9A 4L8FA 4BX2A 1RPAA 2YHSA 4E12A 4YRSA 3N0WA 4D44A 2ATCA 1FUKA 3M4YA 3P2YA 2Y4NA 2Y67A 5A6VA 3DWIA 1YTUA 5C81A 3H18A 3D6FA 2ST1A 1B7GO 3ZWXA 5E3HA 1L5MA 3OQIB 5AOBA 4ZZIA 3UXEA 3V8PA 4BNVA 3RSFA 4D4JA 5AWFC 2C2YA 2G6TA 1G42A 1V1MB 1FTGA 3FMIA 1C3VA 2QTLA 3E3LA 4YJGA 2OGUA 1SXJB 5AH0A 1JEJA 4J6EA 1F8XA 4JB2A 3ESBA 3NETA 4ND6A 2MHCA 4GT1A 1ZINA 4PQEA 1RQ2A 2K6GA 5K0GA 1VJDA 1S96A 4R1LA 2WWVD 5BVHB 1S8AA 3IKLA 4HB0A 1I1NA 1TUBB 2ASVA 1NDUA 1IBLB 3UAVA 2F4VB 5CM8B 2RHOA 3I0NA 3PD0A 4NPAA 3RR2A 1PX0A 2C82A 3GLHA 1YR8A 1RLTA 2ZRDA 1PTJA 1XJWA 3HWWA 4S24A 3ZWNA 5JC8A 3GGCA 4FC7A 4AJHA 2ZG6A 2NWQA 1SXQA 3CUKA 2JGLA 1SZJG 2JAWA 2GSDA 1LTKA 2QORA 3FWNA 1GRRA 1I33A 1WVGA 1OYWA 3AHDA 4PW0A 4V24A 3WLJA 2GYVA 5M34A 3LF1A 4F4UA 2GM5A 1LQTA 2CJPA 4RTSA 3OU2A 2IS1A 1ICEA 3SKXA 3DP7A 2HJVA 5I7WA 2IY7A 1VJ0A 2XKJE 3SD7A 4CLRA 1QV6A 2NTEA 3RUEA 1IHOA 3HDTA 1V7PC 3MJEA 2P7IA 4QDKA 3IMFA 3VOAA 2HPZA 3ZZMA 1BU5A 4XTCS 3IAUA 2IWRA 3BZWA 1QRTA 1UWKA 5EHZA 4Q9DA 2TSYB 3EG9B 3AIMA 4V2IA 3SQWA 1O6FA 4HSEA 3NVAA 1Y9EA 2C20A 4AG3A 1JJ7A 4YT2A 1HTWA 1E61A 2BFFA 1ULZA 2P2DA 3I32A 3OCXA 1K89A 2GJAA 4I4TB 2XE7A 3C7AA 4NAVA 3E70C 5LA6B 4D9EA 4MARA 4CW7A 5JDCC 2YZ7A 3IQWA 1QCZA 1E7WA 1KJ9A 2HFJA 2G9VA 1FXWF 1T5BA 3DMHA 3H99A 3PC6A 3RABA 2NXEA 3EZ2A 3ZE9A 5C80A 1AHIA 4P4SA 1GNRA 2DLDA 1YRWA 4EG0A 1H1LB 3HDYA 1UDXA 1XN4A 4NS1A 4P33A 1GQQA 3TIVA 3A6JA 4WCFB 5D5QA 2BEKA 2QY6A 1HEUA 4OLFA 1EUYA 4UREA 2M32A 4KNVA 4BO1A 1CJSA 3TRKA 1CZNA 1UEJA 2JFHA 4IAOA 4OFBA 2IPMA 3MJFA 2CMFA 2BFOA 2IX9A 1DJLA 2OXFA 3IR6A 4MUEA 1N2OA 4OXXA 3TPFA 3WKEA 3T1TA 3JQAD 2JF0A 4ZV7A 2GX6A 3QMPA 2VHYA 3KHKA 4BMOB 5BPHA 5CG2A 1E1NA 5IYZB 2ZP1A 2IYQA 4A8TA 3N05A 1DBVO 1NT4A 2PRYA 2B5OA 5AM4A 2C83A 4MVJM 4DIUA 4CT0A 3JVDA 4KYVA 2QM0A 4FFVA 3G0IA 4B8ZA 1XVTA 3ILSA 4Y18A 5KKAA 4BVAA 6AT1A 4HH3C 5K7SA 4IO1A 2NUAA 2X9VA 1U7ZA 5C53B 2P2NA 1M0TA 2XXBA 2ZVDA 2ONCA 1ULSA 4QOIA 4BRUA 3B9PA 3PPWA 1R64A 2G0NA 3SE7A 1MB4A 1YZYA 2V98A 4LXQA 3FUVA 2X6RA 4URWR 1VLMA 1DXQA 2Y2VA 3B2QA 2ZSFA 4OHCA 3W3AA 2H1OA 2FDRA 2GJ8A 4BO9A 4W5JA 1GEEA 4IEIA 4CYMA 4D42A 3TQHA 2GCEA 5KIAA 1NJFA 3OWHA 4YK7A 1WTAA 1QR6A 1B6SA 3KJZA 2RBKA 3OH8A 2ZJ6A 4IIJA 3CSDA 1N6LA 3AEUB 1JYFA 3H0KA 5IMSA 4WHMA 4EPYA 3AVXA 3JAMA 3NAMA 1H9AA 1Z28A 4NEHB 3U9SA 1JLKA 1E3QA 5KREA 4K5QA 4UTZA 4HWTA 5DE3A 4DR3B 2Z57A 3KAPA 5AOVA 1E1YA 5A0TA 4GZ3A 1QIGA 4KVZA 4M1QA 4HNTA 1O9HA 5TPWA 2P2YA 2G1JA 1UK9A 4WKGA 3TIGA 1USWA 1Y3AA 4CKEA 1D2MA 3R0VA 3RRNA 3RU3A 4CQMA 5EYPB 4MA5A 3E81A 2NZ8A 4GP6A 4MZXA 3ELDA 3DE7X 3I04A 2JLRA 2P4UA 2WNHA 4PNHA 4POOA 1GUZA 4RKWA 4DJTA 3OHSX 1ZDMA 5J5CA 3FPSA 3I73A 2RHLA 5B57C 1NUPA 4KL8S 2D59A 1U8FO 2FQ1A 4LSMA 4FYJA 4WN3A 2O2CA 3GWGA 4OBXA 2V4MA 3N76A 3WYGA 3PLRA 1MVOA 3MSXA 1YB5A 5H7XA 3DXZA 2HL6A 4M6WB 2IEYA 1XTSA 2W83A 4LXYA 2IS4A 1YDGA 5JNVA 4DGQA 3LKVA 2GD0A 2Y0DA 5AKXA 5EWJB 2FSSA 3BK1A 1SD2A 5FFNA 5LP1A 4D26A 4GP7A 4N8SA 1USUA 5H9WA 4MCHA 4PG4A 3ZBUA 1WXFA 1BYIA 1XZNA 2HA3A 2IVZA 1EUZA 1RMTA 1IN6A 3FIUA 3I1JA 4NF2A 4XDGA 1Z6AA 3U7QA 1ZP6A 1PAUA 1T8RA 2NTVA 2WU0A 3OEWA 4LQCA 1JFFA 1UJ5A 1H4TA 2EX1A 4AURA 3L0YA 4NS4A 5K05A 1L3BA 3GGOA 2BE7A 1S2GA 3DOHA 3A6GA 2L18A 4AJLA 3GT4A 1JDZA 4HX9A 1RCTE 1L6RA 4IDGA 5EE0A 3T5CA 4CLOB 1S8FA 1B6RA 3B7PA 4UUQA 1M1ZA 4ER5A 4CMIB 3Q1KA 3TGLA 1W25A 1DEHA 4Q18A 6CHYA 4V1CB 4DV3B 1RWOA 3F98A 4YJDA 5EMKA 4DLZA 1EFPB 221PA 4PYRA 4RPHA 1PDVA 1P9LA 4BZWA 2PUHA 5E8RA 1A7UA 2E5LB 2Q49A 1CF4A 4OUDA 2BFDA 4QLAA 3QVTA 2GF0A 1I7LA 1FTWA 1PJBA 3L02A 5A4JA 1P6XA 8ABPA 3PNVA 1L4MA 3WQSB 2WY2D 3Q9SA 1ABBA 1GKKA 1T3TA 1MB3A 1PJZA 3DZJA 4BQFA 4RIIA 5EJGA 1WXHA 3COZA 5AKYA 5LQSA 2FPGB 2GM4A 1XKLA 1Y6JA 2TRSB 2ZSHA 4F3TA 2YWHA 4MQFA 4R7TA 2R4QA 3JR7A 1WY7A 1GG8A 3V48A 3LM8A 2PPVA 4ESVA 1RQNA 5J2UB 2XMCA 3AL2A 3O82A 3SQOA 4PQYA 4LHYA 1NDHA 1NZDA 2Z4TA 1EK2A 3DTVD 1WMAA 4OMUA 3WISA 1QE5A 2KE5A 5CD1A 1VMEA 1ODCA 2W5UA 3PFKA 4KI0A 4CM8B 3ADBA 2RGRA 3C5CA 2BEWB 2QRVA 1KP2A 3QW4B 1LPOA 3A6DA 4L7VA 2R1VB 5JJIA 2EL7A 3TI9A 1CJKC 3IIKA 2AYZA 1NW7A 1U8EA 2XNDA 3H16A 4I1RA 4GMGA 3P45A 1JDJA 3QFHA 4HF7A 3QLVA 1MEJA 3AUKA 9LDTA 4LJRA 1Q7CA 1M2GA 3QHAA 3QW2A 3M1YA 4LZZA 3IVGA 4XQ9A 3R5KA 4HX5A 3H9EO 2FSVA 2XUHA 4OXYA 4CI9A 4GQIA 4K9KA 3K5HA 3WBFA 1N9GB 3MJDA 2AZDA 3W8FA 2N1BA 2DH5A 2ESRA 4K9LA 4LBYA 4UTNA 4E5UA 3QBDA 4MYDA 4PO8A 4RGVA 4XUDA 5AHXA 3BN3A 3D1VA 1V3VA 4QAQA 5DHSA 1HDCA 2EBWA 4EMBA 3INNA 1CTQA 1DKMA 1MO2A 1NAHA 1D0VA 1RCUA 1S4MA 2AD1A 4I4IA 1EFPA 5EIBC 5G4KA 4BFTA 2IYPA 3UMSA 4PV7A 2WQ6A 1KZ6A 3PLAE 3LDUA 4EEKA 2XOKD 3FNGA 2RHDA 1P18A 1FIUA 4MDEA 4M1EA 5HCIA 3ETHA 4URVR 3HL4A 4PXSA 3LE8A 2BSAA 1ZAYA 1O95C 4NZPA 5JQGF 3KKKA 4IH1A 1JMVA 3LS2A 1MOQA 1MABB 1DFHA 1JAYA 2HAEA 2WAOA 2H57A 3MTIA 2J3LA 3P4YA 4ZVUA 1WBDA 4V0SA 4PEVA 4GI3A 1F7VA 4NV0A 4AMBA 1OXUA 3BGSA 1EUCB 2FZVA 2G83A 1GU0A 4J9VA 4OJKA 4PYOA 2OM2A 4OI0A 4Q9AA 1Q11A 2CFRA 1VHTA 2BH9A 2FPKA 4AULA 4EO4A 3QI2A 5C3UA 4R2JA 1JDNA 3WOHA 1QRUA 4CKWA 5FKJA 2XT9A 2QZ4A 1YBVA 2REBA 2FSHA 3EDQA 2C7QA 1WD7A 4RVOA 3C0KA 1BO6A 3CLUD 5ITZB 1M5UA 2NXWA 3AI1A 4JLVA 4S1TA 4R3NA 5BXQC 2K2QB 3D4IA 2IIVA 3LDAA 4NU0A 5JD3A 2DQZA 3FNBA 3FGNA 3BKWA 4HQNA 3K0FB 3KJNA 4FC6A 3WQBA 3MJRA 1VE5A 1ENZA 3MF4A 3S40A 2XTNA 5JYBA 4ACBA 1NW3A 2GZAA 5CVCA 2WTMA 1GQYA 3QUBA 1GFWA 4UMDA 3SIXA 1X8JA 4N3AA 1Y9DA 4ZOCA 1KJJA 3SZLA 2I4OA 2GAJA 3G0BA 3K9NA 1VZ2A 5LOVF 1H0HA 1U0EA 2BFCA 1FFXB 2NTYC 3GG9A 3JAWA 1P3Y1 4WBXC 4KXLA 3T6KA 2QXYA 1Y7PA 3KIPA 4ZZ3A 1ZZEA 1MTOA 3L7MA 1RYHA 3FBWA 3GN1A 4DGSA 1D9ZA 4GI2A 4F6CA 1YC2A 5J3JA 4I4CA 2P9JA 4ADSG 5F76A 1NNI1 1OZ0A 2ORED 2PAAA 3L4SO 4IXMA 3TD6A 4PZDA 3HR7A 4Q6WA 2EERA 4DT1A 2Q4BA 4HLNA 3JQEA 1NBME 3WL8A 3HUFA 1XPOA 1QJCA 1OT3A 3CKKA 4P92A 3NDBB 2JI6A 2A0UA 5KOJB 2TECE 2CDRA 1CYEA 1CUUA 2JZCA 3UMCA 5AW2A 2B1IA 5DWQA 1Z06A 4ZAYA 3IO5A 4FKMA 5JCXA 1H0SA 1LX6A 4FSXA 4YACA 5JS7A 2O59A 1TAGA 4QYIA 1N0WA 1KTVA 5EIHA 4Q7LA 5A5GA 1V9LA 4U1RA 4G5RA 3IOCA 2WK1A 3QENA 3QX9A 2P4SA 4B1FA 4D4IA 1O03A 4EG5A 4ETWA 2V4ZA 4QWMA 1X74A 1VMAA 4AWAA 5I8PA 2P0EA 3KOUA 2QIOA 3OPYA 4JX9A 1E58A 3NT4A 4G5FA 2XOEA 2E49A 2HF2A 2PL1A 3AUXA 3CF0A 2P69A 2V8OA 2BEJA 4TYYA 4P2GA 1ZM7A 1Y37A 2C58A 4GIBA 4OIFA 1DO0A 4MQFB 3U4AA 4MVJE 3OIUA 3EF1A 1HUQA 4RWZA 1SH7A 4HVLA 4D9IA 4D81A 3Q3JB 4LWOA 2XHZA 1SHKA 2XA2A 4OIMA 3W9YA 3O4JA 3F7OA 5EZ5A 3MB8A 4RSGA 1B6TA 2VNSA 3W05A 3RF7A 3PEYA 1GRVA 3FDJA 4DA8A 1PJ2A 5DBFA 1J8VA 5AHKA 1EI9A 2WJ4A 1P29A 2BSXA 4M98A 2PN1A 5AW9A 4H08A 4G0VA 4MW5A 1T3SA 2GAOA 4O1MA 4B6EA 5K20A 3U3XA 3BE6A 4IFEA 1PU2A 3F8WA 5GY7A 4TZ6A 4JVOA 1H2WA 2Q28A 2BTEA 2WUDA 3QFSA 3OQ6A 3Q5GA 4RGQA 4XB6B 5HQJA 2NV0A 3MMZA 1PZMA 4CV3A 5JE8A 3ONFA 3EGCA 4YFYA 2OZLB 4Z86A 3P9IA 4BU1A 2O8EB 3HZRA 1NG1A 2JJ8A 4NEQA 3H1EA 1Z75A 4OQ4A 5FO1A 1G6OA 2QE6A 4FGSA 2VUUA 2A9OA 3AEQA 3ZKWB 1DIAA 1I3OA 2CJXA 2YX1A 5TSDA 5DTRA 1XL1A 3UA3A 1IOLA 2GEFA 1Y5NA 3B13B 4OFXA 1M1XB 2ZB3A 4RY8A 5LB4A 2BR4A 3N0XA 5F21A 3SIRA 3ERCA 1C50A 4K46A 4LXUA 4AROA 5LZ5A 2W90A 4ZCSA 3OSUA 1B0PA 4JOSA 2XXJA 2ZZKA 4HXGA 1T3HA 5B6JA 4EIWA 5HS4A 1JKFA 3NVKI 4UHJA 5DX0A 4DF3A 2NP6A 2ZB8A 1JDTA 1SC6A 3CKMA 3LA8A 3DC7A 2AFHE 4I1UA 3QJGA 3RUCA 2GJKA 2IHVA 3IPLA 3D81A 4KNWA 3B7GA 4I9HA 1LBHA 5U4XA 1NXTA 3OLCX 1JECA 2EKBA 4GE3A 4LSZA 1P9NA 4OHRA 4ZEWA 3ROZA 4YRGA 4Z1OA 1AHNA 5KB3A 4YP9A 4YMTA 4JI5B 4C87A 2XTJA 2C2HA 4JJFA 2UZ1B 4XWAA 1BKDR 3SZMA 3CM0A 1A27A 3VISA 3GUUA 3V4ZA 4A8JC 4D9JA 1E5TA 1EAYA 4II2A 3ORYA 4O4IA 3UHAA 1GNQA 1N92A 5JBIA 5BO5A 1ZGJA 3NRBA 3MOSA 1AZLA 4GEGA 4D98A 3PDCA 3WB2A 4EG7A 1LWOA 4D57A 3RLFA 1CUEA 4UFPA 3GV0A 3Q7TA 3RVNA 1JTEA 1L7NA 4CU5A 1OI3A 2FN8A 2HWYA 3F4BA 4IWYA 2QG9A 2PV0A 3DQQA 3WBKA 1TK9A 2Z3WA 2J3HA 1JIJA 1V1MA 3EVCA 3HYSA 2UZ3A 2H0QA 1OMOA 4UUMA 2IZ0A 2WTEA 1C0KA 4BLVA 1IBCA 4DC0A 4QU5A 1BHSA 5JLJA 4YGXB 4AKGA 5BSEA 3KQVA 3M7IA 4G23A 3AOEC 3BHIA 3L6BA 1HORA 3NBZC 5ENZA 1RE0A 1L5NA 1DAGA 2CLKB 3DBLB 3GAAA 4Z9AA 1N9GA 3ZDYB 1SIOA 2CFIA 2NUTB 4M9UA 3K94A 3WYNA 1EFAA 2C2ZA 2VDNB 4RDHA 3UXMA 5IJAA 3RIHA 4EG8A 5CA0B 5MDHA 2H1HA 2EIHA 3Q5DA 4QAJA 1EIWA 2CHQA 3BULA 4BIMA 3H87A 1L3CA 4QXAA 1GTZA 1IPEA 3BFKA 1LQ2A 1DIBA 2ZXFA 3O1HB 4AMGA 2FR8C 2FJPA 3Q87B 2RJNA 2YV4A 5FFFA 4U9HS 2R1TB 1MEOA 2NLOA 2WF9A 1EWTA 3DM9B 3DZDA 3KEQA 1GL9B 1X7WB 1E1KA 2PKCA 5LYJF 1ORIA 4MOWA 4TRMA 3I34X 4TUYB 1VXRA 1M10A 3ANTA 1ZW6A 4IQ0A 3H1FA 4ZPJA 4LYDA 3WIVA 4H15A 5B3LA 1T91A 3IX7A 3E9ZA 1MZPA 4M9QA 1EJ6A 6REQA 3TH5A 5EWJA 2Y1EA 1T4GA 3MWLA 2RI1A 1TM2A 3BXPA 4H7JA 2VPXA 1SVNA 5LBUA 1VSUA 4DXAA 1PUXA 1PFGA 3MYYA 4ARAA 1RBQA 5B7QA 2I6XA 4KEAA 1JR2A 2CD7A 2B8JA 2P8JA 4KR9A 3DEIA 2NV2B 1TVEA 4IKEA 3H5IA 4YRAA 3WFIA 5CYPA 3SE0A 4QA9A 1JAIA 2M98A 2ZI5A 3NGMA 4LOHA 4RQAA 4OSPA 1YONA 4X54A 5EJMA 3SMQA 2WT9A 3U3MA 1DDOA 1XLTA 4BMPB 1Z07A 2OGWA 1ZI8A 3FB1A 4TKUA 5LOVB 1XWIA 4MIKA 4UBNA 1ZVKA 3LG2A 3W78A 1EP1B 3ZXXA 4OQFA 2IYNA 5JCOA 2P27A 1VZ3A 5IXYA 2UUCB 3D54D 3UMJA 3EYWA 3KQPA 5JD6A 3B1ZA 4EI7A 2JK1A 1SUFA 2ODBA 3PGMA 3O4RA 3QGMA 3CRRA 3QKRA 4PY2A 2A67A 4WINA 5EUCA 2NO4A 3DHVA 4PLTA 4N7RA 3PVCA 2PGLA 1OAOA 2A58A 3H2BA 4NZZA 2NOAA 3KUXA 3TVTA 3C6MA 3B8HA 2WDZA 5JMOA 4I46A 2H1IA 1I9GA 1UPCA 3NO4A 4G2TA 5DCUA 3GVHA 2V7QA 2PBLA 3R76A 5ES3A 4BLSA 1J6UA 1XA4A 5DU2A 2CJFA 3LBYA 5A03A 3VPCA 4FNAA 1OU0A 3OE5A 1CG6A 3IAM6 4FHZA 3CGWA 1T6YA 3A58B 3O8NA 1HWYA 4OHPA 1ODTC 1NURA 2J6HA 4BBPA 1N36B 1RKVA 3CFYA 4ANFA 1A71A 1O97D 2RBEA 2RJOA 3NOQA 4OJQA 3QPDA 4AS2A 5JMPA 3NOVA 1W0JD 3U2QA 4XVCA 2MSNA 2PD4A 4YJGB 1HFKA 2ODQA 5HPYB 4B85A 3WXBA 4GLFA 4BY9E 3DVSX 1KI1A 5KYKA 1JALA 1DAEA 1GRNA 1P7YA 1SUPA 4EM6A 1ZK3A 5IX8A 1C1HA 2YWBA 4RADA 2JLYA 2R1UA 3BQMB 3JWPA 1GTG1 3L7LA 1OYVA 3BTOA 3PQCA 1WUHS 4I9UA 4QYWA 4KK3A 4U7JA 3SX4A 2RH8A 1WDMA 2O3JA 5DM4A 5T4BA 3OPQA 3G23A 5ALWA 1JEDA 3S2YA 1TAUA 1NHWA 3C16C 1DRVA 5BNFA 2OE2A 3PEEA 2NO1A 3CPJB 3F5QA 3H5RA 3R24A 2IHYA 1FP6A 2JZOA 3KVOA 1X13A 1MX1A 2XQVA 2WD9A 3EXHC 1RFLA 3K09C 3MXOA 3OPMA 3GFBA 4HXFB 1B93A 1ILEA 4ZT6A 3MUEA 1BCSB 2OC4A 2W00A 1FVOA 4Z8XA 3ITKA 4AG6A 2BJHA 2FR8A 3FN4A 3M5DA 3NQ41 4CG1A 3PKJA 1I5EA 3L0SA 4LTMA 3A1DA 3KKMA 1TIBA 3LYHA 4KP7A 4PGMA 1KY3A 2RIPA 4YB8A 3HKBA 2QLLA 2ODWA 3PUHA 4V0RA 4YMUA 3EF3A 4UHBA 3L9WA 1QMPA 1B15A 1FP4B 4EHNA 3VH1A 3HQ4O 3L49A 2V58A 2CLLB 1DWOA 1ML4A 1G5HA 3ANYB 4LE0A 3KBOA 2BMJA 1L7XA 3D6JA 1JNXX 3KD2A 3OURA 1PDOA 3WY9A 4I5IA 1ZC4A 5E9AA 4BCBA 1SURA 3PEVA 2J0UB 4I8DA 4RENA 2R8OA 4M7OA 4MP6A 2JKYA 3SR0A 4P53A 2Z43A 3AB8A 3OCWA 2OC9A 1RPNA 2EBFX 1W85A 4TWJA 3HBNA 4YRPA 4AN4A 3O2QB 1JIKA 3GLHE 4D80A 3COSA 2IUSA 1R6XA 1IHUA 4EW3A 5D2CA 4C03A 4JMPA 3VHXA 3H1TA 5BSTA 1EUCA 1T0UA 3WWPA 2NGRA 3ZE6A 2J6BA 4E88A 1TKCA 2AL7A 4DLVA 2ZIGA 2I65A 1Y4UA 1MCZA 3G85A 1ZIYA 4TL8A 4DJAA 1LK0A 1N9ZA 2EW1A 4J7XA 3CNOA 5DLDA 3UK0A 4FLFA 2GXAA 1JQ3A 3EZNA 3WGYA 5IVIA 4KR7A 3LJKA 4BN0A 3F9CA 3WL6A 2J9FA 4IJMA 1L7QA 4CF5A 4AB1A 1XF1A 3HGTA 4UM9D 1ZI6A 3DMNA 4ZT4A 3C98A 5IT9A 2QNBA 3DEHA 1SXJA 4ZU1X 4AJIA 2FQWA 4GDMA 4R8SA 5D3ZA 2DYKA 3OMWA 5HUHA 1PN3A 2H59A 3AX6A 1V8DA 3ZWYA 4C0QC 1AQJA 4D2IA 3CEAA 4OHKA 1HTBA 4JUAA 3OD5A 3PHLA 1WA5A 1QFZA 4UZEA 1L8AA 4WFJA 3PGKA 3BIXA 2BGJA 1Q3HA 5DTEA 3E05A 3FI0A 3TQQA 1QXSA 1BGWA 3V9AA 1UMCB 1YOVB 2W6ZA 4IGEA 3OQJA 1GLNA 1A8SA 3DB2A 4P86A 4MAFA 4F60A 1TC1A 3HXKA 4BGIA 3PHHA 2VWGA 3PIDA 3GOHA 4GRAA 3F67A 1T1IA 3I6YA 1WG8A 1FDOA 5BN5B 3ESRA 4Q15A 4HAWA 4HQRA 2IL1A 2D2EA 5EQTA 1C30B 2FWAA 4CQNA 1C4KA 4X20B 2QV0A 2PSFA 4FYMA 1LVUA 2IZZA 2GPTA 4S2EA 2NUPA 4BNIA 3AHEA 3INGA 4ZO7A 2IDZA 2XWSA 2GAFA 3CISA 4M83A 3W9UA 4MLZA 4DQKA 5D5PA 4EHAA 2W6ID 5B3KA 3IJRA 1U98A 1DKLA 3FUWA 4QPNA 3W3ZB 4Z5XA 1Z0KA 5AW7A 2PKYX 3GJ4A 2OSBA 4O5AA 3EAQA 1ACMA 4RV4A 5EJ8A 2OHXA 4XSVA 3O31A 3K0SA 4DCJA 2C77A 1OFHA 3DMPA 1F6WA 1ZNQO 2CK3D 5A6SB 3T0FA 1MR3F 3OPXA 2PSSA 2PO7A 3C87A 1V8ZA 1JF8A 2OFWA 5EKTA 2FDXA 4Y2JA 5FULA 2OMEA 3IMKA 1SBCA 5LYYA 4F4DA 2ADMA 2ADFA 1Z8HA 1I1OA 3BSYA 4ZMRA 3PBKA 4OGWA 4BFUA 3AFNA 1RE1A 5H8WA 4QYMA 2ACKA 1CCWA 2YJ4A 3V32A 4FMDF 1PS0A 2P3QA 2R2GA 3BJIC 4US1R 1Y5RA 3LW7A 1QH1A 5CDFA 1GUBA 2PG3A 4P0QB 2ATEA 4DV1B 3ZQ6A 4PLYA 2ZI9A 5D51S 3NGLA 1RZRA 1EG7A 5CU7A 4ARZB 4D4LA 2WIDA 3DV2A 4B3GA 3QBJA 4I6EA 1K86A 4K6OA 3FTFA 2ISSD 1R6UA 5HIJA 3QVMA 1ETHA 2QMOA 2YIJA 1XTJA 2ZJFA 2F7SA 2ZE8A 4RPJA 3PUWA 4DEVA 4XX1A 4NYMQ 4LMPA 1XCPA 3MTEA 4Y9RA 5KAMA 1PUJA 4E51A 1E5DA 4PHFA 4ZOBA 4IP0A 2YVAA 4Z9XA 2PZJA 4RV5A 3QEJA 3DFKA 4J4BA 4YECA 2XKKA 3EW7A 2VOJA 2PWZA 4BWYA 2VA8A 3GF4A 2VTBB 1CSEE 1TMGE 4QXPA 1XNGA 2QN6A 2WILA 3MTGA 4FYPA 3MGKA 2YFHA 3BH6A 1TZCA 1XZDA 3TQOA 1DJMA 1KGSA 4NOMA 3RVDA 1VYTA 3B3JA 1LD3A 1VRVA 1QGUA 3EARA 4MULA 1NASA 3HP1A 5B7NA 4NBTA 2P41A 3KKNA 4JB0A 4JS0A 3C48A 4ISBA 1XRNA 2EF0A 2WIJA 5C4GB 4AI6A 1Z0SA 1J9GA 3EK2A 3GT3A 4G09A 4PPFA 5B55A 5K09A 1FYDA 2D6FA 1MEEA 3AEYA 2CXRA 4I2VA 3HJFA 1RWWA 2OB1A 2PYZA 4CHTA 1D7OA 1KI6A 1AXGA 1MC5A 1NL3A 2OD2A 2YV3A 3OMLA 2P9YA 3PR3A 4JVNA 3VBCA 4CMGA 1LKZA 4ZOQI 1TM3E 5HZGA 2ZM6B 1UC5B 2GNPA 3PQ6A 3A9WA 3R9IA 3LU1A 2TS1A 3T34A 5BNZA 4QXOA 2EWVA 5F51A 1P80A 4M1KA 3BWDD 3ETCA 4I0WB 1H2FA 4QBKA 4UDYX 5BOVA 3LKZA 4CTOA 5FA8A 4NMLA 1GYQA 2CDCA 1E9AA 1VI6A 2G25A 1W76A 3GRKA 3HCBA 2BKUA 3WV5A 2EKPA 4UVEA 1MIHA 1L7DA 3GHYA 2JLCA 1BXGB 1WCYA 3EY9A 1VPWA 4RK6A 4WFKA 1I5OA 4C6SA 2D2XA 1BVRA 2PD6A 4MUXA 1DJPA 1K7YA 2QJWA 3KVRA 4NJOA 1JU3A 1OX6A 1VMKA 3QXXA 4GXTA 1SCNE 4JL5A 5F3DA 1W52X 2AXNA 2WYWA 1ZR4A 2ADOA 1NJGA 2P2SA 3UC9A 3FPCA 7REQB 4EGCB 3IMCA 4BNLA 4IZHA 4S12A 2AX4A 5FO0A 3IODA 1E1QA 4P5EA 3MRSA 1H6CA 1NKSA 1J0EA 5GJVC 3GYBA 2L42A 3NORA 1P39A 3LQQA 1K6EA 1FXWA 1KVQA 4EX7A 1PGNA 4KLAA 4OHBA 2QRHA 4ZIRA 3QEMB 3ZCPA 1Y82A 5K2OA 3DZCA 4Q4CA 2IITA 1YB1A 1MRZA 3TZLA 3UAXA 5A71A 3Q7QA 1X7XB 2RGAA 3O9MA 5DXJA 4BLWA 3K9FC 1J1UA 3JALB 1U3UA 5DX8A 1YQDA 3FROA 4RNDB 5AI5A 3W3AD 1KKUA 1D04A 1P7VA 3OE7D 4WOJA 5LMUB 1AGNA 4PX9A 2Q6IA 3T0GA 4K9PA 3HUTA 4DFDA 4KVFA 2XB8A 1NYTA 2ZIWB 3KWFA 3BF7A 3W8NA 1P3JA 2IYVA 2ZTSA 3O3NB 5DTMA 2ODNA 3K4HA 4WKNA 3WGZA 2I34A 4CR6A 1O2DA 2AT1A 4X3CA 1NVFA 2ZPUA 4KNYA 4M21A 4GC5A 3K1AB 1YUMA 5JS8A 1PZHA 3D8SA 3FMPB 3WZLA 5JJ5A 2ZRGA 2ETXA 3N5KA 3BBLA 4PINA 2UZIR 1NW9B 1T8UA 3DW3X 5DXAA 3O84A 3LT1A 5K3FB 5DN6D 3B3FA 1Q20A 2VJPA 3H5TA 4AJKA 1DPFA 2JAPA 4GGMX 4JYCA 1I6KA 1KY2A 1KZ9A 1NSYA 4LHZA 3CMCO 3AR3A 3L84A 4KUHA 3RTCA 1NVTA 3RKSA 3UKJA 1KTIA 3VQTA 2ZAIA 2EGGA 2FOIA 3Q72A 2VSFA 2ASEA 4NV1A 2V0CA 1NG9A 2J9ZB 4YR9A 1QO0A 3LVBA 2QP9X 4LY3A 3OT1A 3AKCA 4MLDA 5JPCA 2D1QA 4V02A 3LTNC 5JU6A 1MC1A 1AQLA 2BFEA 5E0KB 1W96A 2FPSA 5BN4B 4BECA 2BEUB 4EY5A 4H7PA 5KHAA 2B9VA 2I3BA 4FCVA 1O94D 3MWEA 4MRRA 4QNNA 5M29A 2I8LA 4DUGD 1XD2A 2FR0A 2VVTA 2OT3B 2PGJA 2ZYDA 4FE7A 1E6KA 2XUGA 3NTOA 4Y6QA 4C7BA 2MDTA 4LYGA 1NJ5A 3IR7A 5CJ2A 3P9PA 3EWAA 4NATA 1L5YA 3KT0A 3LX5A 1CQWA 1T15A 4RW0A 4XWTA 2PUCA 4Z0PA 2X5XA 1OI4A 2YMQA 1HLGA 1F6DA 5GTDA 1VIYA 2GJ4A 5BW6B 3UYKA 1Z18A 1JUDA 1JWBB 2P3LA 2FW0A 4XKJA 1GN9A 1RZ3A 1JG3A 2LPMA 5ANRB 3H4MA 5HG0A 3TVDA 3VGJA 3WGMA 4HGRA 2WJYA 3OQ1A 4DV0B 4RTJA 3E2MA 2QROA 4PG6A 2JFPA 3W4KA 5EIEA 1SNYA 4RKRA 2CL0X 2VAVA 1X92A 2HJGA 5G40A 2IE0A 5AQEA 4UQPA 5J40A 4EI9A 3CW9A 4ZDKA 1P2VA 2IUTA 4UBKA 4YRRA 1M83A 3CVUA 3PDIB 4MVJH 1J20A 1V8OA 3RU7A 4I4LA 1JR3D 3DOOA 4D8YA 2XXAA 1E9CA 1PYOA 2PX4A 1L5GB 2X9GA 1SOVA 5DK6A 4JBGA 2PL5A 4CF7A 2RGNA 1QZUA 3R7BA 3WHKA 4IQ8A 1X19A 1XXHE 3OLVA 3IP6A 4WZZA 3S27A 1COWA 1E4EA 3N2ZB 3KPUA 3BG5A 2F1OA 3OWOA 3P9YA 4FNMA 2ZRNA 4QRIA 1MG0A 2O1SA 3PFCA 2YWFA 4FFNA 4LE1A 5FPQA 3R74A 3UWPA 1PEYA 5AW4A 5JROA 5KJ1A 3AERB 2NO0A 3GLKA 4FOSA 1FUIA 3QKSB 4YT5A 3ZX5A 4CL3A 4OHWA 2CYCA 5KQMA 2M6SA 3IPCA 3KLNA 4XR9A 4YIKA 2CL5A 3DHYA 4X8HA 2OZPA 2EV9A 2DM6A 2XNCA 2OCLA 1T3GA 2FSGA 4G5QA 3TX2A 5HJEA 4ND7A 2QG6A 4F97A 3HU5A 4MW0A 1L9KA 3EPJA 2HGZA 1L1FA 3PC8C 4FDLA 3WZMA 3STTA 2HU8A 3JWHA 5ICMA 4DCSA 4KSBA 3T4UA 1E60A 1EP9A 3ANXA 4QFMA 3R7SA 1Z25A 1YQGA 1KJZA 4CKCB 1QIKA 1OXKB 1XTKA 1Z12A 1PR1A 2BI7A 1XZGA 1E3WA 3GVPA 4FYYA 1FC0A 4Z4HA 2QE7D 4UHDA 1SN7A 1DARA 3JARB 3LK7A 3Q3VA 4PU0A 1D2EA 2XR1A 4RVUA 5JYDA 3D8BA 4DVJA 2JI9A 1I10A 5A0VA 3OOHA 1P17A 1M6VB 3NHYA 3P4XA 4IKOA 4J43A 4K3UA 4KQHA 2WF8A 4OHOA 1E1LA 4GX0A 4ZP1A 4ZA2A 2FETA 5BQ5A 3DLHA 3QVOA 3HJAA 3ZH2A 3SYMA 2DHCA 2I54A 2ZSEA 4MP8A 3VR3A 3IPYA 1UDBA 2PZGA 5CA0F 4LZNA 1XDZA 3FWZA 1RRVA 1Z08A 3E9QA 4NFHA 4DTCA 1E2PA 2N9UA 4G37A 4ZICA 3CVVA 3QUTA 4BYMA 1M76A 2QLFA 4XM2A 1WPQA 1WW8A 4LC1A 4D82A 5EHNA 2QPTA 3DR5A 2DECA 2I6SA 1TU0A 1U63A 2JVIA 2WZBA 3K9QO 3WKCA 3S68A 2ZT7A 3DMRA 3TQIA 5IPFA 1SEPA 5JXJA 2LV8A 1TA9A 3B3AA 1GOTA 3ROQA 2GZ2A 3OHPA 3VC1A 4KLCA 3JAKB 2OCPA 2YZ2A 4LQLA 4E5PA 5FJJA 4EUSA 1W4LA 5KVQA 4B17A 3PJGA 4L4XA 3EMKA 1ULAA 2FU5C 4ZMSA 1RPZA 2QVZX 4Y2PA 3AFIA 3O6VA 3CE6A 5EWLB 3M34A 5KSOA 1D4AA 2VK8A 4PVDA 1M1UA 5CB0A 1AK1A 1ORWA 1AQ6A 2AFHB 3GI1A 3K0KA 3NRJA 2YY7A 3HYRA 4MWEA 5DLEA 3D7SA 4CM3A 4G8DA 1S9HA 1U5BA 4B0OA 5GP1A 5B1DA 4LKOA 2OBBA 4LEIA 4C1BA 2Q27A 2WYOA 2ORYA 2VDKB 4G25A 2BMDA 3G7NA 3L4BA 4RF3A 3UFXB 3T3PB 1X7XA 3QOFA 3TG8A 4G9GA 2PUVA 3P26A 1L5OA 1OBOA 2CJWB 2W2KA 4Q1BA 1ZA2A 1E9SA 3X43A 3VPGA 3R3WA 4X63A 2MU1A 4INAA 4X6XA 3QX7A 4JR2A 5G3ZA 1YMUA 4G5XA 4B3FX 1C7JA 4WMLA 4U4AA 2Q0XA 1Y7HA 5KJFA 1FFGA 4BC0A 3AQIA 1M5TA 1P73A 2C5GA 3L0PA 3ROKA 5EUBA 1TUEA 4GX1A 1EFDN 1FQOA 1I3NA 1GTRA 3OP1A 4G5GA 4DLNA 4OQLA 1NE7A 1RS0A 1ECLA 4YPFA 4AN1A 3ACDA 1S1MA 4MHOA 1IU9A 3A1WA 3HB9A 4HFNA 2RH4A 3B1XA 1OWPA 5AKEA 1XIVA 4JYZA 4L4RA 3AUYA 4DV6B 1QFSA 4HFJA 3Q7EA 4FI3C 3B1JA 1B3RA 3IKMB 3DNPA 1OLOA 3L82B 4LJSA 4QIHA 4IR7A 2YWJA 4RK0A 2VSYA 5CPFA 1EVKA 4QOJA 3PGXA 3HL0A 4OI2A 4PCVA 4RA9B 2CL7X 4ALKA 1V11B 4LC9A 5AW8A 5BYAA 1ZRMA 2QEQA 2X4GA 3RTDA 1EE2A 2XE6A 3DT9A 3WRYC 5JY1A 4II3A 1RU3A 1WD5A 2ZYVX 3JAKA 3OA2A 2WZCA 5A9RA 4I50A 3STWA 4MYTA 4UUAA 2DLCX 2V7GA 1SZDA 3EC2A 4WBNB 3KX2A 5TR9A 1U9YA 3ICQB 1NUTA 1YJAA 3PXUA 5JVDA 2FWBA 4EY7A 2HK8A 3QE9Y 3WLKX 4HRVA 2D8MA 4ZI7F 5E6UB 3QE3A 3RYIA 1UPBA 2NQ2C 3NWEA 2CXSA 3NVMB 5CHEA 2GRAA 1WQ1R 1YRQA 2JGMA 1EVZA 2ECFA 3FKQA 5DYNA 2FEPA 2A5DA 1UOOA 1YC5A 3AEZA 3AV3A 4HATA 5TF0A 3U40A 1XZEA 2BMWA 1ZMTA 4A92A 4ZVLA 3E53A 2A7QA 4UHHA 4BMSA 1UJ6A 2ATXA 3V1YA 2HLDD 1VGRA 2OCXA 4UJ3A 3EAGA 1DTWA 2F3PA 4WH0A 4TLEA 4Y1FA 4BZZA 4JUBA 3A1TA 4BMXA 5JTUA 1RM3A 2ZSJA 1H0KA 1G7CA 1TT7A 3BYZA 1DT5A 1IWOA 1W6UA 1ZITA 2WKSA 4U9UA 4EOGA 3UPUA 2X15A 1NI4A 1S8OA 4LVNA 1I14A 2C59A 7ADHA 1BC5A 2LKCA 4MR8A 2MSKA 4WDQA 3VI4B 2I2FA 1CEQA 3B9QA 5K6AC 1MW8X 3GCZA 2JI7A 4ZRNA 2B83A 2VJBA 1FOEB 1V4BA 1LSJA 3B1VA 3LP5A 2Z3ZA 4DNQA 1GV1A 1GU1A 2I87A 1CB7A 2VP4A 4M8KA 5BUQA 1AKTA 1LZKA 1T1EA 1H22A 2H4WA 2H29A 2O2XA 2WUFA 2Y9PB 3IS3A 3M70A 3NNSA 4HXEB 4O4LF 5DO9A 2QT9A 2HO5A 4RK7A 2QAJA 2W98A 3WQHA 1VI2A 1JHVA 1DC6A 3JZDA 1Q22A 2UYQA 3NTRA 4QUBA 5FHQA 2IXAA 1CVLA 3GFOA 2BGTA 1Q5PA 1R18A 3HYNA 4TSFD 4TTTS 4U3JA 4TWBA 4DYHA 2W8BB 3AU9A 1CDEA 1K2WA 2O1XA 2NZUG 3FYTA 3VPBA 2JLAA 3N2GB 1TJ3A 1KXJA 4OFWA 3KQWA 3U1TA 3V2HA 1NMXA 2CUTA 4MWCA 1PUIA 3RFVA 2HXGA 2QT1A 3U3KA 3X1WA 4MUAA 3HNOA 1HYHA 2YXPX 2V6FA 2JCSA 1IY8A 3DFFA 1BZYA 1XMSA 5AXCA 1N2CE 1PIWA 2AJDA 2XQKA 1CV2A 2FY8A 2R66A 3LY7A 2JK0A 3FWPA 1P7ZA 5TMEA 5E4YA 1G20E 4LRQA 1U2DC 1ADYA 1V5IA 2PS9A 4IILA 4PS1A 2GN6A 2FWIA 5EE9A 2Y9MB 1IIRA 1DBIA 2V6IA 2YN0A 4IHJF 4D45A 1Z4JA 1DBRA 5KI6A 4RFLA 1NVKA 3FOFC 1QP0A 4C7JA 3P96A 1KF0A 4OBBA 3DAOA 4U8HA 5IKOA 1TTQB 1QG6A 1KYIA 2PIAA 1VCOA 2ZJ2A 3WYAA 2UYHA 4RE6A 5HZMA 3CB2A 4RA6B 1S0UA 2NO9A 2Q6OA 2WC1A 1Z0ZA 2VP6A 3C15C 3PQ3A 4J0JA 3B36A 1U8XX 4R41A 3WYBA 1S2OA 3CX6A 3TCKA 1TGYA 3E3AA 3FAZA 3HCFA 2AQIA 1KOJA 3BSWA 5GAJA 5IC4A 4EBBA 4F56A 1J1IA 1QPGA 5BV7A 1NBMD 2OFPA 1OAAA 2VDWA 3MOGA 3PDJA 4IOJA 4QZVA 5HYVA 2VJYA 5LL6P 4MUYA 2AOTB 2Q07A 3A10A 4G0XA 3SXUB 4DTIA 3QWBA 2GEDA 3ZZUA 5DM70 5JY6A 1M34B 1I0IA 1OIVA 2P5TB 2VH5R 4GPBA 4MB2A 3I5UA 4TKZA 2FN4A 3LUPA 4GVXA 4ITRC 3ZI7A 4AS1A 4ZAZA 4D79A 1XN1A 2ES4A 2WG2A 3GROA 1CR0A 1YK1A 5D7BA 2FWRA 1PP4A 3AYXB 2PZ8A 3ETLA 3O21A 4V38A 5DW3A 1UBNA 4HX2A 4YAEA 5ICCA 1UF9A 1ECCA 2G9UA 1V71A 4OLAA 4BLPA 2ZZNA 4BFLA 3IHLA 2W22A 3RNOA 5CLFA 1UMBA 3D1JA 3FPBA 3ZR4B 1KI3A 1AN0A 3U4MA 2BY4A 5HUJA 5FI3A 3GZ4A 5KJCA 3Q8KA 4LF8B 4DPKA 2HIGA 2B61A 1IH8A 2CF6A 2R65A 1W1UA 1VA5A 3EB9A 4GM0A 4K05A 2ZWIA 1SCJA 2XSZD 3DUWA 2PD3A 2RGBA 1Q0PA 3QLUC 2H16A 3SQNA 5IH7A 2NZYA 2GCIA 4ZVQA 1SKMA 3RANA 3LUDA 1E0JA 3RUAA 2BRUC 1E6LA 1T43A 1V25A 4NKRA 5LZ7A