1PO24

Poliovirus (type 1, mahoney) in complex with r77975, an inhibitor of viral replication
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Ligand-induced conformational changes in poliovirus-antiviral drug complexes.
pubmed doi rcsb
molecule tags Virus
total genus 5
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1po2400
1RUG4 1EAH4 3JD74 1BEV4 1RUD4 1VBE4 1AL24 4Q4V4 1MQTD 1VBD4 1AR64 4RHV4 2RS34 1HRI4 1RUE4 4Q4W4 1H8TD 1POV0 4Q4Y4 1R084 1PO24 1VRH4 1RUF4 1ASJ4 1RHI4 1RMU4 1AR94 2R074 1HXS4 2X5ID 1RUI4 1VBC4 1COV4 1NCQD 1R094 1D4M4 1RUC4 1VBA4 1RVF4 2HWC4 2HWB4 1NA1D 3J8F4 3JBG4 2RS14 2RM24 2RMU4 2RR14 1PVC4 1PIV4 1AR84 1Z7S4 2R064 2RS54 4GB34 4PDWD 1K5MD 1EV14 1VBB4 1AR74 1RUH4 1HRV4 4Q4X4 1OOPD 1PO14 1RUJ4 2PLV4 2R044
chains in the Genus database with same CATH superfamily
3AE1A 3SFEA 4YXDA 4Q4V4 1VBD4 2WU5A 3P4RA 1HRI4 1RUE4 3AEBA 4Q4W4 2PYJA 3GQKA 1RUF4 2WU2A 2PW9A 2WQYA 3AE3A 2R074 3ABVA 2X5ID 4YT0A 3FI7A 2WDVA 2RS14 1XHXA 3GQHA 1NA1D 3JBG4 4YTMA 2RMU4 2R064 4PDWD 2H89A 3AEFA 2WDQA 2R044 2ACZA 2PYLA 1YQ4A 4YSYA 1EAH4 2R7FA 1MQTD 4Q4Y4 2PZSA 1R084 1PO24 1VRH4 3SUCA 5C2TA 1RHI4 2B76A 1AR94 1VBC4 2FBWA 1RUC4 3AEDA 3J8F4 2RM24 1PIV4 2RS54 3VR9A 3AEAA 1RUH4 1HRV4 4Q4X4 3VRBA 1OOPD 1Z7S4 1RUJ4 4RHV4 2WS3A 1RUG4 4YSZA 1VBE4 3AE4A 1L0VA 1AR64 3SFDA 1ZOYA 3AE9A 1POV0 1XHZA 4YTNA 1RMU4 3CIRA 1HXS4 1NCQD 2WDRA 1R094 1VBA4 2HWB4 3AE2A 2HWC4 3VR8A 1AR84 4GB34 1K5MD 1EV14 1PO14 3JD74 1NENA 1BEV4 1RUD4 1NEKA 1AL24 3P4QA 3VRAA 3AECA 5C3JA 3AE7A 3AE8A 2RS34 1H8TD 3P4PA 2WP9A 1ASJ4 4YTPA 1YQ3A 4KX6A 1RUI4 2H88A 1COV4 1D4M4 3AEGA 1RVF4 1ZP0A 3AE6A 3AEEA 1KF6A 2RR14 1PVC4 1XI1A 3AE5A 2PY5A 1VBB4 1AR74 2EX3A 4YSXA 3P4SA 2PLV4 1KFYA
chains in the Genus database with same CATH topology
1RUG4 1EAH4 3JD74 1BEV4 1RUD4 1VBE4 1AL24 4Q4V4 1MQTD 1VBD4 1AR64 4RHV4 2RS34 1HRI4 1RUE4 4Q4W4 1H8TD 1POV0 4Q4Y4 1R084 1PO24 1VRH4 1RUF4 1ASJ4 1RHI4 1RMU4 1AR94 2R074 1HXS4 2X5ID 1RUI4 1VBC4 1COV4 1NCQD 1R094 1D4M4 1RUC4 1VBA4 1RVF4 2HWC4 2HWB4 1NA1D 3J8F4 3JBG4 2RS14 2RM24 2RMU4 2RR14 1PVC4 1PIV4 1AR84 1Z7S4 2R064 2RS54 4GB34 4PDWD 1K5MD 1EV14 1VBB4 1AR74 1RUH4 1HRV4 4Q4X4 1OOPD 1PO14 1RUJ4 2PLV4 2R044
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUG 4;  1EAH 4;  3JD7 4;  1BEV 4;  1RUD 4;  1VBE 4;  1AL2 4;  4Q4V 4;  1MQT D;  1VBD 4;  1AR6 4;  4RHV 4;  2RS3 4;  1HRI 4;  1RUE 4;  4Q4W 4;  1H8T D;  1POV 0;  4Q4Y 4;  1R08 4;  1PO2 4;  1VRH 4;  1RUF 4;  1ASJ 4;  1RHI 4;  1RMU 4;  1AR9 4;  2R07 4;  1HXS 4;  2X5I D;  1RUI 4;  1VBC 4;  1COV 4;  1NCQ D;  1R09 4;  1D4M 4;  1RUC 4;  1VBA 4;  1RVF 4;  2HWC 4;  2HWB 4;  1NA1 D;  3J8F 4;  3JBG 4;  2RS1 4;  2RM2 4;  2RMU 4;  2RR1 4;  1PVC 4;  1PIV 4;  1AR8 4;  1Z7S 4;  2R06 4;  2RS5 4;  4GB3 4;  4PDW D;  1K5M D;  1EV1 4;  1VBB 4;  1AR7 4;  1RUH 4;  1HRV 4;  4Q4X 4;  1OOP D;  1PO1 4;  1RUJ 4;  2PLV 4;  2R04 4; 
#chains in the Genus database with same CATH topology
 3AE1 A;  3SFE A;  4YXD A;  4Q4V 4;  1VBD 4;  2WU5 A;  3P4R A;  1HRI 4;  1RUE 4;  3AEB A;  4Q4W 4;  2PYJ A;  3GQK A;  1RUF 4;  2WU2 A;  2PW9 A;  2WQY A;  3AE3 A;  2R07 4;  3ABV A;  2X5I D;  4YT0 A;  3FI7 A;  2WDV A;  2RS1 4;  1XHX A;  3GQH A;  1NA1 D;  3JBG 4;  4YTM A;  2RMU 4;  2R06 4;  4PDW D;  2H89 A;  3AEF A;  2WDQ A;  2R04 4;  2ACZ A;  2PYL A;  1YQ4 A;  4YSY A;  1EAH 4;  2R7F A;  1MQT D;  4Q4Y 4;  2PZS A;  1R08 4;  1PO2 4;  1VRH 4;  3SUC A;  5C2T A;  1RHI 4;  2B76 A;  1AR9 4;  1VBC 4;  2FBW A;  1RUC 4;  3AED A;  3J8F 4;  2RM2 4;  1PIV 4;  2RS5 4;  3VR9 A;  3AEA A;  1RUH 4;  1HRV 4;  4Q4X 4;  3VRB A;  1OOP D;  1Z7S 4;  1RUJ 4;  4RHV 4;  2WS3 A;  1RUG 4;  4YSZ A;  1VBE 4;  3AE4 A;  1L0V A;  1AR6 4;  3SFD A;  1ZOY A;  3AE9 A;  1POV 0;  1XHZ A;  4YTN A;  1RMU 4;  3CIR A;  1HXS 4;  1NCQ D;  2WDR A;  1R09 4;  1VBA 4;  2HWB 4;  3AE2 A;  2HWC 4;  3VR8 A;  1AR8 4;  4GB3 4;  1K5M D;  1EV1 4;  1PO1 4;  3JD7 4;  1NEN A;  1BEV 4;  1RUD 4;  1NEK A;  1AL2 4;  3P4Q A;  3VRA A;  3AEC A;  5C3J A;  3AE7 A;  3AE8 A;  2RS3 4;  1H8T D;  3P4P A;  2WP9 A;  1ASJ 4;  4YTP A;  1YQ3 A;  4KX6 A;  1RUI 4;  2H88 A;  1COV 4;  1D4M 4;  3AEG A;  1RVF 4;  1ZP0 A;  3AE6 A;  3AEE A;  1KF6 A;  2RR1 4;  1PVC 4;  1XI1 A;  3AE5 A;  2PY5 A;  1VBB 4;  1AR7 4;  2EX3 A;  4YSX A;  3P4S A;  2PLV 4;  1KFY A; 
#chains in the Genus database with same CATH homology
 1RUG 4;  1EAH 4;  3JD7 4;  1BEV 4;  1RUD 4;  1VBE 4;  1AL2 4;  4Q4V 4;  1MQT D;  1VBD 4;  1AR6 4;  4RHV 4;  2RS3 4;  1HRI 4;  1RUE 4;  4Q4W 4;  1H8T D;  1POV 0;  4Q4Y 4;  1R08 4;  1PO2 4;  1VRH 4;  1RUF 4;  1ASJ 4;  1RHI 4;  1RMU 4;  1AR9 4;  2R07 4;  1HXS 4;  2X5I D;  1RUI 4;  1VBC 4;  1COV 4;  1NCQ D;  1R09 4;  1D4M 4;  1RUC 4;  1VBA 4;  1RVF 4;  2HWC 4;  2HWB 4;  1NA1 D;  3J8F 4;  3JBG 4;  2RS1 4;  2RM2 4;  2RMU 4;  2RR1 4;  1PVC 4;  1PIV 4;  1AR8 4;  1Z7S 4;  2R06 4;  2RS5 4;  4GB3 4;  4PDW D;  1K5M D;  1EV1 4;  1VBB 4;  1AR7 4;  1RUH 4;  1HRV 4;  4Q4X 4;  1OOP D;  1PO1 4;  1RUJ 4;  2PLV 4;  2R04 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...