1POGA

Solution structure of the oct-1 pou-homeo domain determined by nmr and restrained molecular dynamics
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
RRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Oct-1 POU homeodomain determined by NMR and restrained molecular dynamics.
pubmed doi rcsb
molecule keywords OCT-1 POU HOMEODOMAIN DNA-BINDING PROTEIN
source organism Homo sapiens
molecule tags Dna binding protein
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1pogA00
1JKQC 1GVDA 1MH4A 1G2HA 1T56A 5EZGA 3CCYA 1W0UA 2XPUA 3JRIA 1AKHA 3PO2J 3MN2A 3E7LA 1QVTA 4XRSA 3PM1A 1I50J 3G1MA 4UUTA 4CYCA 4QSHA 2VPRA 1GUUA 2MSYA 5DTDA 3IH2A 1ETQA 1Q1VA 4M3FA 2B63J 5F0FA 3GTOJ 4X6AJ 2I10A 3H3VK 4BXXJ 5M5YJ 1APLC 2JK3A 3MVPA 3UKGA 3TP3A 4B3AA 4XICA 3LNQA 1B8IB 4Y52J 1B72A 3GTKJ 3S15J 2DTZA 4W1UA 4XK4A 1AU7A 4QIWN 2R0QC 3FISA 1UG2A 1JKOC 2Y2ZA 2YS9A 2MG4A 3S1QJ 3W6VA 3GTPJ 2XPWA 1JT0A 5FKMA 1I3QJ 1MBKA 3JRAA 3BTJA 3BTLA 1MNMC 2OPTA 1XG1A 3GBGA 1YRNB 1ZR2A 2HQ5A 5EG0A 2R92J 4B1RA 4V2GA 2DN0A 5E3LA 4IHVA 4A3MJ 1ETXA 5FKNA 4MFEA 2Y31A 1W0TA 2CJJA 3B6AA 1AHDP 3DCFA 1JTYA 5J1UA 5M5WJ 3S16J 1LFUP 3BTIA 4A3CJ 3BR2A 4L5EA 5IP6A 1OCTC 4RDUA 3NARA 5FKKA 3D1NI 3OIOA 3CMYA 1IG7A 3FKIJ 3HOYJ 2K9NA 3HEFA 3IV5A 2NVQJ 3ZQCA 1X58A 5C4XJ 3Q0WA 5F0HA 1RPWA 1GT0C 1GV2A 2RAEA 1OJLA 4G12A 1U9NA 2DMUA 3OSFA 5EDNA 3BG9A 3A01B 4I6ZA 3Q0VA 3HOUJ 1OFCX 3JRCA 2O9LA 4DZJA 3BQYA 2H1KA 2NS8A 5F0CA 2DA2A 4MO7A 2R5YB 2R5ZA 1MBEA 1IC8A 1VNDA 4A3JJ 1VFCA 3M3YJ 1D5YA 4JP0A 2QF7A 3C2BA 4D5FA 4A3LJ 5EYRA 5J1RA 2EQRA 4DYQA 1JJ6C 2KT0A 1ITYA 3MKLA 3HDDA 1LFBA 4V2FA 4C3HJ 2NOGA 1TWFJ 5J3LA 2M2EA 3S14J 4A3IJ 2D5VA 2VKEA 1QVUA 3LOCA 1TWHJ 3HGGA 2YUSA 1BA5A 2L0KA 3JRHA 1VI0A 3IH4A 3HB9A 3S2DJ 4C2MJ 3H0GJ 2LR8A 4AYBN 1PUFA 2XRLA 9ANTA 2HOTA 5J1YA 2CU7A 5FKOA 4X1EA 2NVYJ 1GDTA 2VI6A 2IBDA 4FISA 1Y1VJ 5F08A 2IAIA 5E3OA 3CDLA 1H88C 3BQZA 1XC5A 3DEWA 4M3DA 4MIMA 2X6OA 1CQTA 1NK2P 4I76A 1WI3A 2IEKA 1WPKA 3K7AJ 4A3KJ 4J19A 2GLOA 3BR0A 2LK2A 1WH5A 3JREA 1LE8B 3OOUA 2K9SA 4ABZA 4JX4A 1IDZA 1E3OC 2E1OA 2NS7A 3LSGA 3SDGA 1RESA 2FD5A 2ECBA 3G1LA 1HLVA 1FEXA 2WV1A 3I4MJ 1K83J 2HXIA 4DW6A 3M4OJ 4B4CA 1UMQA 4BBRJ 2K9QA 1P7IA 1JT6A 1U78A 1NK3P 2GBYA 2PMZN 4EEFG 1IRZA 4C3IJ 3SFIA 3TP0A 2DJNA 1ETOA 2XGDA 2XPVA 5EGOB 3B6CA 1R9TJ 5JLXA 3HOXJ 2ID3A 1ZQ3P 2JJ7A 2VUMJ 5FLVA 3GTQJ 2LVSA 3HBLA 4FE7A 4UUSB 2K40A 3BR5A 2XGCA 2DA1A 2ME0A 2L7ZA 4A3GJ 1P7JA 4D7MA 4MLOA 1IUFA 1U8BA 4LOCA 2XB0X 1I6HJ 2EBIA 1ETWA 2ZB9A 3I4NJ 2L7MP 1IGNA 1BW5A 5GPAA 1Z77A 3A03A 2ECCA 1B8IA 3GTGJ 2DA7A 1O4XA 2FX0A 1UHSA 3S1NJ 4XIDA 4AC0A 2AO9A 1X2NA 2LP0A 5BNGA 1TWGJ 4GFBA 4RBOA 4M3GA 2MW8A 1BL0A 1WGXA 2LKXA 3BR3A 3FK7A 4XRSG 5FJ8J 4JYKA 3OSGA 3JRBA 3ZQHA 4M3BA 1YRNA 4A3DJ 1BJZA 3ZQLA 2DA3A 2DA5A 1A6IA 3RZOJ 1XS9A 2JA7J 3JR9A 2Y0SN 1AKHB 2AHQA 3WHCA 1WCMJ 3FIWA 1ETVA 3LSJA 1QRYA 1ORKA 1JGGA 2HDDA 1JUMA 2JN6A 4UUSA 2E2JJ 2NVXJ 1ETKA 3BG5A 5HODA 2R7ZJ 2JMWA 5C4JJ 3HOZJ 2WB1N 2LLKA 4FCYA 1ZGWA 5E3MA 2TRTA 3HOVJ 5C44J 1HDDC 2M34A 2XB5A 2E2HJ 4HNVA 1B72B 4FE4A 1JJ8C 2ID6A 3A01A 1JTXA 4JX6A 4W97A 3O8GA 2COBA 1F36A 2R5YA 2CUEA 1IDYA 5K7ZA 3ZOBA 2DA4A 3S2HJ 2CUFA 1MBGA 2NVTJ 2LTPA 5K7FA 1ZTRA 2W48A 5EF6A 1ZKGA 3L1PA 1F43A 2CQXA 1HDPA 2XGEA 2E19A 3BTCA 5EG0B 1WH7A 5IOYA 2HI3A 2H8RA 1RETA 3JRDA 1HCRA 1FIPA 4MFDA 1ENHA 2Y9ZA 3JRGA 3IH3A 2M0CA 2JA5J 1TWCJ 2LD5A 5IPAA 3BT9A 2Y9YA 1GV5A 5F27A 3GTLJ 2ME6A 1HF0A 3NAUA 3TW7A 2O8KA 2WAQN 3Q0UA 5IYBJ 2Y30A 2DMNA 2EZLA 2QCOA 3BR1A 4Y7NJ 1DU6A 4A69C 3RKQA 1EF4A 4AUXA 3HGYA 4DZPA 1RKTA 4S0HB 4NDLA 1K61A 1JUPA 1SFOJ 3A02A 1IJWC 3HOWJ 1MBJA 5GP9A 5IOZA 2DMPA 3LSRA 4DYCA 3WHBA 1HOMA 1NTCA 1MH3A 2YU9J 2R5ZB 5FKLA 2XSDC 3BR6A 1MBHA 3RQIA 4D5CA 1QPIA 5IYDJ 4XRMA 2MGQA 2L7FP 2HOAA 1POGA 2JA8J 3Q3SA 3ZQGA 3HKZN 5E3NA 2EZHA 1LE8A 5F04A 3QQAA 5FLMJ 4BY1J 1S7EA 5F1JA 1H8AC 3CQZJ 5EZHA 2FJ1A 2TCTA 4A3BJ 4FTHA 1MSEC 2CQQA 1TC3C 1MSFC 1FTZA 3K2AA 1BW6A 2FQ4A 4M3EA 2M8GX 2CRGA 2HOSA 1TWAJ 3HM5A 3JRFA 1JKPC 2LFBA 3F0CA 3G1OA 3S1MJ 2G0EA 3TEDA 2JWTA 4M6VA 1PUFB 4IHWA 1A5JA 3GTJJ 4A3EJ 2HYJA 3ZQIA 4DYRA 1JUSA 5M3FJ 2X48A 5EGOA 1FIAA 4IEJA 4A3FJ 1H89C 2GM4A 3GTMJ 2EZIA 1T33A 2OF7A 1Z0XA 3ZQFA 1ZR4A 4JX5A 2EZKA 1IV6A 1FJLA 4CYCB 2KDZA 4BBSJ 1Y1WJ 2O7OA 2DMQA 1X2MA 5M5XJ 3QPLA 5DS9A 5K7HA 3S1RJ 5JLWA 1ETYA 1OCPA 3BG3A 4IHXA 2HXOA 2LY9A 1U9OA 4BY7J 2DA6A 2DMTA 2JA6J 3O8HA 3SJMA 2L9RA 5GPCA 2N8GA 5M3MJ 3S17J 5C3EJ 1RKWA 2R93J 3RZDJ 3VPRA 2E2IJ 2P81A 3LSPA 2M9HA 3QPSA 2X9DA 1DU0A 5IP7J 1SANA 3PO3J 3FK6A 1MBFA 3TW6A 1FTTA 1ZK8A 4C3JJ 4D7NA 5IP9J 4IHYA 4BKXA 4A93J 1RR7A 1JKRC 4QTRA 2ELKA 5EEAA 2EH3A 2VKVA 5IYCJ 1VF9A
chains in the Genus database with same CATH superfamily
2CO5A 5E1XA 1G2HA 1HKTA 1MDMB 3EDPA 1WJ5A 2FNAA 1X1DA 3JAMK 3RSNA 3E7LA 1TL8A 4E7HA 4EM1A 3G1MA 3FXRA 4LITA 4BHCA 4U0VA 2RGVA 1ETQA 1Q1VA 2V9VA 3PNYA 2F6CA 3F9KA 2B63J 4S04A 5F0FA 3C1DA 1C0WA 4BXXJ 5B1BH 2JK3A 3MVPA 4KT5C 3K4NA 3UKGA 1J7KA 4XOTA 3GTKJ 3S15J 5FLXK 2HFHA 4IZZA 2DFEA 1AA7A 3FISA 2LREA 2AQEA 1RRJA 3WGHA 2A61A 3S1QJ 2KDOA 2E5NA 2R7VA 2XPWA 3CF5F 3LAJA 1IUYA 2IGOA 1I3QJ 4P5OA 3LSTA 3JRAA 3BTLA 1MNMC 3ECOA 1R1UA 3LWFA 3CTAA 3OYKA 4EATA 1J59A 2QSHX 2V26A 3IAM2 2EIKH 4EJTA 2R92J 2BXYA 1B4AA 3K4LA 4BJTA 2VOOA 4A3MJ 3DTEA 2L2OA 1UELB 3IRRA 3SHFA 3I54A 1JTYA 1SC7A 4BDZA 3S16J 3GW2A 1LFUP 2JUGA 3FKJA 4RDUA 3MFKA 1FBUA 3NARA 5FKKA 4L5IA 5FGMA 3D1NI 5TRDA 3FZVA 3FKIJ 2K9NA 1VZ0A 2EV0A 2M4KA 3IL2A 4J01A 1V3FA 5C4XJ 3OYJA 1RPWA 3FXLA 1GT0C 4CXFA 2VASA 2DMUA 2KZGA 3GZ6A 4UV9A 4G7ZF 4RMNA 1BR2A 4OIOF 1EH8A 1I39A 3ABMH 2O9LA 3LA2A 4UXNA 2PMZA 2DJIA 4II2A 2I8DA 2A5WA 3KZIC 3U1KA 2WADA 3FMQA 2RREA 3K1NA 2QF7A 2PJRB 3RJPA 3NWSA 2G7HA 3KP3A 4DYQA 2KT0A 4P96A 2ADUA 3MKWB 2IS2A 5L3DA 2JPCA 3HDDA 1LFBA 1SD4A 2Z3YA 3JCUC 4V2FA 4C3HJ 1TWFJ 1VQOI 5L3FA 2EA2A 1YFHA 2VKEA 2P5LC 2F2EA 5DV5A 4HG2A 2ZXHA 2I5UA 3J81K 4BNCA 3JRHA 5D8LB 2DOEA 1O3QA 4MTDA 2EK5A 3S2DJ 5B1AH 3HHGA 5F6FA 3CESA 1LQ1A 4C2MJ 4ITVA 4RAZA 1LDJA 5D8KB 3H0GJ 2GA1A 3SYTA 4R79A 3F22A 2XRLA 1MMDA 4CCNA 2PX9A 5LLQA 2HOTA 3M8JA 4XMYA 2VBXA 3SZTA 2NVYJ 5TJJA 2IBDA 2QKLB 5D5UB 2OTLI 2NS0A 4M73A 4PFOA 3J80K 1H88C 1FSHA 1Y8QB 1X1BA 4BS9A 1XC5A 1YQAA 2DAOA 4M3DA 1IRXA 2X6OA 2FXAA 5K5OA 1WPKA 4BDYA 3CCJI 4RLFA 1UB9A 2DK5A 2GLOA 2IA0A 1FWZA 1WH5A 2FOWA 3OOUA 1U5TA 4P9FA 1JHFA 3H5NA 3IHUA 2PQ8A 2OC6A 1E3OC 5CVVA 4Y15A 5EEHA 2NS7A 3GXOA 4NC6A 2R7SA 2XAJA 1LJ9A 3LAPA 2DXIA 2P6TA 2LF8A 2HDCA 3K70D 5KAFC 1FEXA 1WHUA 3PNVA 3QOEA 3BG7A 1D1BA 4UV8A 4L18B 4AWXB 2ELJA 3A0BC 4MHGA 5IT3A 1A04A 2AS5F 3U21A 2W85A 1P7IA 2IGMA 3LSIA 3SZGA 1FOKA 3VYUB 4OWRB 2GBYA 1G59A 2VE8A 4KMFA 2DJNA 4R1HA 2XGDA 3OYLA 3B6CA 1TZLA 3HOXJ 2ID3A 2CFOA 1ZQ3P 4M6YA 2HOEA 2JJ7A 1K6OA 2LVSA 4FE7A 5E20A 1YJNI 1MNDA 1T6SA 4N4OB 2K40A 4XLHA 2XGCA 1D8KA 2HKXA 3WG9A 4A3GJ 1IUFA 2YPRA 3R0JA 3I56I 2XB0X 2BYVE 4IX7A 5GPAA 1J9IA 3A03A 2GWRA 5AONA 2JRTA 5FD6A 4F52A 1B8IA 5FFZA 1JHHA 4F91B 1J75A 4UY8I 2X6XA 2Q2EA 2FX0A 1HXDA 1W36D 2EFNA 2EA4A 4P1WA 4D9JA 1P2FA 4ZH4F 3M1EA 2WWYA 3ONQA 4IOAF 2W57A 3C2GA 4F3QA 1XGMA 3OR2C 1IZ1A 3S93A 4HF1A 5CVIA 2MW8A 1BL0A 4NNJA 3BR3A 1UZCA 3O3KA 4P55A 1MIJA 5GAHJ 2OU2A 4JYKA 2KKOA 4BEHA 4U0YA 1YRNA 4A3DJ 4FT8A 5DYMA 3GFJA 4RGRA 2DA5A 1PP8F 1K78A 2PI0A 1ZG3A 1Z67A 4I98B 2JA7J 3P5JA 2STWA 1CF7A 1HKQA 2MC4A 4F55A 2QZ8A 2UXXA 2DT7B 2V1NA 4XL9A 4BHPA 2W25A 4OINF 3IC7A 2LC2A 2V4JC 2H8WA 2VQLA 3DPTA 1I3AA 3BG5A 2CSOA 4L5JA 2R7RA 1RI7A 3IUOA 2LRDA 3EETA 4BH9A 3QOPA 4ZZLA 5HNHA 2HWVA 2FU4A 5DCMA 1U6GA 4LLNA 4D1QA 2XROA 3BY6A 4Y3OA 1B9MA 5ED4A 5GADJ 2GQQA 1TTYA 1X3UA 3CJRB 3QPTA 3WGGA 4FE4A 3R4KA 2XAQA 2ZXWH 2L01A 2DT5A 2ID6A 2OQGA 3RKYA 1JTXA 5J4YA 4GGGA 4JX6A 4LG0A 1IXRC 1KU3A 3T1BA 4CDGA 1GXQA 1TT0A 3AG3H 5K7ZA 2MLKA 2QGUA 2YSRA 4ZC3A 1I1SA 2MH2A 1YS6A 1F43A 1P6RA 4Z2YA 1HDPA 2XGEA 1FBQA 3BTCA 1PJRA 4IVNA 1WH7A 3TO9A 1YJ9I 1W1WE 3MMYB 2BY2A 5HLIA 2HVSA 1FP2A 3LFKA 3FXKA 1RETA 3LSKA 4BJ6C 1FIPA 3GMEA 4BQQA 3JRGA 1KU2A 3RQ4A 1R22A 2M0CA 2K3FA 5IPAA 4EJWA 1SFKA 4LD5A 5F27A 2X1EA 1HF0A 5F64A 1ZH5A 3TW7A 3N97A 3Q0UA 2ZXIA 2OZ6A 2DMNA 3BR1A 4Y7NJ 4KYWA 1SD7A 4PUSA 3QYEA 3G6EI 1EF4A 2IPQX 2ZMEC 2DQLA 3JSOA 3BZCA 3KYDB 3GFLA 4WX9A 1F5TA 1BI3A 3CP2A 3ZCOA 2DMPA 2WC2A 3VSLA 3PQJA 1ZGAA 3BR6A 1F1ZA 5GTHC 1HC8A 3CCVI 3RQIA 1FNNA 2UXNA 4XKCA 4YFNF 3OL3A 3KP6A 2C6YA 3ZQGA 1S29A 3RKXA 3VWBA 4HNTA 3TMOA 5FO5A 1LE8A 1YTYA 1H8AC 3CQZJ 2IS6A 3H9GA 2ZJRF 5EZHA 4C2UA 1IO2A 3IWFA 3CUQC 4FTHA 2DFFA 4BYYA 1MSFC 1IN5A 1SD6A 1BW6A 3WTXC 2MLGA 3CUOA 2FQ4A 2VL8A 2HOSA 1IRFA 4RM2A 1IXCA 3Q9VA 4LK0F 4KN4X 2CYYA 1XCBA 3F0CA 3HSFA 3G1OA 3K1PA 2G0EA 4IRIA 2JTVA 2BY1A 1Z6TA 3CC7I 1BI2A 4IHWA 1SAXA 3WE2A 4LGWA 5IT9K 1Z3XA 3F8BA 1MD0A 2DLLA 3ZQIA 5H6QA 1T38A 3REOA 3HSRA 4DYRA 2HPIA 3G71I 5M3FJ 1WI9A 3GTMJ 3PIPF 3E6CC 1T33A 4L9JA 3HC7A 4KISA 4PJLA 2VN2A 2P7VB 3LMMA 2VC1A 5D5VB 2VC0A 3S3OA 2X6WA 1L0OC 1Y1WJ 5M5XJ 3QPLA 1QGPA 3PUBA 5LBQA 1UJ8A 3CLQA 5K7HA 2VT3A 3LL7A 2M87A 2HTJA 5H6RA 2LY9A 3VODA 4A5NA 4RLQA 1U5TB 3T8TA 4BY7J 5ILUA 2ISZA 3FHZA 4MTEA 4FX4A 1S7AA 1T2KA 2N8GA 2BVLA 3BCAA 1FY7A 2ZC2A 3FMSA 2FBKA 2V9KA 2YR2A 4IL6C 3H0DA 2E60A 4ZYDA 3EUKL 2NRAC 3DLAA 3PO3J 3S3NA 1MBFA 1NG7A 3D5LA 4Q4ZF 3FXUA 2BBYA 1VQPI 4A93J 1UG0A 4FETA 2ELKA 3OYMA 1IN4A 2X51A 1VF9A 1JKQC 4UHTA 2XF6A 4DGWB 1S6LA 1XD7A 2HQAA 5B3SH 2DW4A 1ZHFA 1T56A 4HX7A 1XTAA 4I01A 3CCYA 3OMYA 1E0EA 1O3TA 1W0UA 2BVMA 1RZ4A 3AG2H 1YX5A 3EUHC 3MZYA 3PSFA 3JRIA 2MD5A 3B73A 1DUXC 3CF2A 1YW8A 2OCCH 1DDNA 1VQLI 1I50J 3I64A 4UUTA 1V54H 2VPRA 1YOVB 4FASD 1U3EM 3RTRA 4CCLA 2V79A 3LQRA 1B59A 3IH2A 5DTDA 2STTA 2YX4A 3FDYA 4AD9A 5E8IA 4Q5SF 2R7TA 4X6AJ 4PGHA 1P4AA 3OS0A 3H3VK 2XV4S 2ZSIB 2W4SA 4IPAA 3GF2A 1PYVA 3U1DA 1XSVA 2HNHA 3TP3A 2M30A 1SVLA 5HLHA 1B8IB 2RVCA 2VOPA 2DODA 2JA2A 3RDIA 4Y52J 2Q2EB 4BJ5C 2FEZA 5LHHA 4QLCU 3HYIA 4JBAA 1SVMA 1JKOC 3M07A 2GOXB 1DP7P 2VQGA 5J6XA 2EV6A 2YS9A 1KU7A 1Z91A 1A31A 3GTPJ 4LLLA 1KQ9A 2JSPA 4A2UA 2DT6A 5FKMA 2M5WA 1MBKA 4ENNA 4A0YA 1WRJA 4BEHB 2GIVA 2WAFA 4XLCA 5CVUA 3BZKA 3HRTA 2OPTA 1XG1A 3GBGA 1YRNB 2QSGX 3RI4A 2D1VA 2R3SA 2HQ5A 3I58A 1VQ6I 1K78B 1WWXA 1P4WA 2RNJA 1YX3A 2HU9A 5LGTA 4MFEA 1CF7B 2QQ9A 1N75A 2J5PA 4PK4A 2EJRA 4HAMA 4CGZA 5M5WJ 4L9TA 1YYVA 4A3CJ 2LYCA 5IP6A 1I1GA 1MJBA 3KP5A 4E7IA 3OYGA 3O2PE 1IG7A 1BI1A 1ZRFA 3VYSB 1KA8A 2ZFUA 5DCMB 3JSPA 3HEFA 3COAC 5CVRA 1EV7A 2QM3A 1VQ5I 2NVQJ 4HDVA 1X58A 3ZQCA 3K69A 1LDKB 3I5UA 3WG7H 5F0HA 4XLEA 3BP8A 1OJLA 2W84A 4G12A 2L3DA 4HSTA 2HQRA 3BG9A 4XSXF 1JE8A 1O57A 1W5SA 3KP2A 4LG3A 2IS4A 2VT2A 2HZDA 3MQ0A 3Q0VA 1OFCX 2K7LA 4CZZA 4ZYGA 4ZJZA 4LG0B 2V9PA 3L2CA 2H1KA 2NS8A 5F0CA 4MO7A 2R5ZA 1R4NB 3H3UA 1VFCA 4BAYA 1U2WA 2BW3A 3HL2A 2XSJC 1D5YA 5D5WB 4JP0A 2AXLA 2BHZA 4YFKF 3C2BA 4A3LJ 2KLOA 5EYRA 5J1RA 2QUFA 3E6DA 3IKVA 2ZJQF 4C30A 2RNGA 1Y0NA 4ZYEA 1J0RA 2O6GE 3J7AO 5ICFA 3PNTA 3ZQ7A 2IRFG 1S3JA 2W82A 2DPDA 3S14J 3F6VA 3ABKH 4I7HA 2XRNA 1HW1A 1X1AA 1S5LC 2H1LA 3J7ZI 1QVUA 3TBIA 3LOCA 4L0ZB 1W5CC 1TWHJ 5JR3A 2YUSA 3G3ZA 5LFAA 4XORA 1M1EB 3AKZA 2F4OB 3HB9A 4G6TB 1R5ID 3E0JB 3HXLA 4CCKA 4M71A 3DBHB 5L3GA 4A12A 2P5VA 4M9SA 3GO5A 1EH6A 4BHBA 3DTKA 3V7RA 1DQUA 4AYBN 4H0EA 9ANTA 3L7WA 1YE9A 2V7FA 1SVOA 3GLLA 1ZLJA 2CU7A 2P0WA 3IAS2 3KEOA 1V5EA 2EIJH 3AAFA 4FISA 3FM5A 2HQNA 4HLXA 3CDLA 3KX2A 3G73A 3DEWA 3W2AA 4NC7A 4XN0A 3V8JA 3E5QA 4XN3A 2L9VA 4QPQA 1W7PD 3NWTA 1WI3A 3F6OA 3WE3A 2CQ7A 2MYSA 3W6KB 4DNCA 3H35A 1LEAA 1OYWA 1X19A 5DM6F 3BR0A 2F5CA 2G7UA 1KGSA 4XKVA 3V8LA 4HBLA 1T95A 3HUGA 1LE8B 4B48A 4CZCA 1VQ8I 1I5ZA 4JX4A 1R23A 2V1DA 3CCUI 1FX7A 4B3XA 2E1OA 5KVRA 1TQMA 1OPCA 3K4BA 3KIOA 4RS8A 4AYBA 3LSGA 4BQAA 2A05A 3SDGA 1S7OA 1RESA 2P5KA 2HR3A 4RAYA 2M1BA 4NB5A 1K83J 3LSHA 3UR3C 4DW6A 4BBRJ 3H3ZA 2XAGA 4BL0B 1JT6A 3BPXA 3BCBA 5HDKA 1IN8A 4HRIA 3M7GA 2PMZN 2MD0A 2HPMA 2LY2A 2M8EA 5B5EC 2XPVA 3V7CA 4I02A 4PJNA 1D0YA 2VUMJ 1VTNC 5H2FC 3HBLA 2XDVA 4AVZA 4B43A 3BR5A 4YG2F 1R5HA 1XB4A 3FM3A 2L7ZA 1RUOA 1Z7UA 4MEXF 2E1MB 5LRRA 3I4NJ 1EA3A 2JT1A 2L7MP 4E7LA 1BW5A 4I99C 2E1CA 1Z77A 2IW5A 3F21A 4HW0A 2KIMA 2WAQA 3CMEI 1UHSA 1LPQA 1QZYA 3HG9A 2O8XA 3WU2C 3H5AA 4GFBA 4RBOA 5DD8A 5L3BA 4WXHA 3KEYA 5L3CA 1WGXA 5FJ8J 2BHYA 1Y56A 3TKYA 2OD5A 3KP7A 3JRBA 3ZQHA 2P6SA 2KPMA 2DCEA 2KIQA 3TL4X 2IS1A 2QSFX 3ZQLA 3L2WA 4ANJA 4N0BA 1OR7A 1W7PA 1XS9A 3L09A 3JR9A 3OYEA 4XONA 1ETVA 1J5YA 5D6EA 3HKZA 2Y0MA 4M74A 3GZ5A 1ORKA 5EJCA 1JGGA 1KU9A 4KT6A 3OY9A 4UUSA 1TQPA 4MQVA 4XBFA 4X0GA 2NVXJ 4WF2A 2NOJB 1AWCA 3KLNA 5HODA 2VE9A 3SDBA 1KYZA 4Y17A 4EM2A 1R71A 3S8PA 2WB1N 4KA4A 2LLKA 3BLYA 3WTUC 4KIBA 2CFXA 1WJCA 2TRTA 1DPRA 1OLTA 1BI0A 2L9NA 1HDDC 2XB5A 4FHTA 2O61A 4CUGA 4WWCA 2EILH 3SEQA 2EPFA 2K85A 3A01A 2XAUA 2FQ3A 2KZVA 1USSA 2BV6A 5DEQA 1A36A 4OMYA 4N9HA 2Q8KA 4E7JA 1XGNA 2COBA 3TGNA 1T39A 2R5YA 1IDYA 2FE3A 3F72A 3M8EA 1X1PA 2CUFA 3F8MA 5KAIC 2LTPA 5K7FA 1ZTRA 1ZELA 3L1PA 2A6EF 1E3HA 1OCZH 3MAJA 5DDGA 3S3MA 4EJUA 2HI3A 1MKMA 4RAFA 1WKMA 4PDKA 5HS7A 2CW7A 1QA6A 1WJFA 1HCRA 5HLGA 4MFDA 2WB1A 3DFGA 2EB7A 1ENHA 1XMKA 5DM7F 1NG6A 3CCMI 1XDUA 1Z9CA 5BPIA 5JFRA 1FMWA 3ROUA 2LD5A 1QZZA 2KL4A 4IO9F 1GV5A 2NYXA 1LVKA 3HZJA 1F4KA 4NQWA 2NVUB 2JQ7A 1ODDA 2M7BA 4AVPA 2GOMA 3HPGA 3RKQA 2CV1A 1H0MA 1Z7LA 3A1YA 2OAZA 1S72I 1SFOJ 1OYYA 1MW7A 4RM3A 2LBFA 3HOWJ 3LSRA 3WHBA 3WTZA 4HZFA 1NTCA 1MH3A 5JVTA 2L5QA 4AU7A 2R5ZB 5FKLA 3DKYA 1U8RA 2KHMA 5JHUA 2BW3B 1BR4A 2L7FP 2HOAA 1POGA 3OWTA 1Z6RA 5CPRB 3Q3SA 3GYHX 3KFWX 4OU0A 2DI3A 2XC7A 5F04A 4HLYA 5FLMJ 5LHGA 1FLIA 4BY1J 4RGXA 2LH9A 5F1JA 4ETSA 2D2WA 5HOOA 3OOPA 2PMUA 4BACA 1MSEC 2CQQA 1TC3C 2GXBA 2UWMA 3DWLE 2M8GX 2CRGA 4R8HA 1TWAJ 3LA3A 3DLLF 2NNYA 2GZWA 2VBYA 2X6YA 3AL0B 5E18F 2DOAA 3W2WA 1MMAA 3S1MJ 1HA8A 4M9ZA 3TEDA 1MJ9A 4XOPA 2QWWA 5HS9A 4OIRF 4M6VA 4XSZF 5CQEA 3KLOA 1EH7A 1XSXA 2ZBKA 4A3EJ 2HYJA 2P7CB 1JUSA 1WJBA 1XMAA 2IXSA 1YIOA 3K4KA 5EGOA 3FMRA 3DV8A 1ZR4A 4DIQA 3ELKA 4S05A 2EZKA 3PJRA 4HV5A 1LKXA 4O3MA 5LGUA 1YI2I 2O7OA 1X2MA 1H9GA 1TNTA 4G7OF 2M0MA 5DS9A 1R4MB 3RPQA 3NEUA 4IHXA 4OIPF 1YLFA 3HUGB 1T0FA 1IN6A 5DUKA 2DMTA 2FSWA 2KFDA 1RKWA 3S32A 3DU5A 4HNUA 4NHJA 2PJPA 2KRCA 2OBPA 1YG2A 3QPSA 5DCFA 1Y39A 4WXCA 2FNPA 5IP7J 1KQ0A 1SANA 1OKRA 4C3JJ 4D7NA 4GYIA 3ML6A 4BKXA 1S8NA 3R6SA 4IHYA 1RR7A 1JI8A 5E1ZB 1BJAA 2VBWA 3RKWA 5EEAA 2Y75A 3E3VA 2JRMA 2EH3A 3K1MA 3VYRB 2JA8J 3H5RA 1GVDA 3FF5A 1FPQA 4IJAA 3T0YA 1SFXA 4E7SA 2ZXJA 2XPUA 3ZP5A 1AKHA 1KONA 3PO2J 3MN2A 4NC8A 1FP1D 1BR1A 4ZDOA 2W00A 3PM1A 3DPUA 4CYCA 2K02A 1ONVA 4LK1F 1EJ9A 1U5TC 2F48A 3DKXA 2MSYA 3FBNB 2KMUA 2QBYA 2VLAA 4I2OA 5M5YJ 1APLC 1GXPA 1B6AA 4IKFA 2CV0A 3JW4A 1J09A 3PFIA 5LEKA 2KP6A 4B3AA 4XICA 3LNQA 2V6CA 3OS1A 2QENA 1B72A 2XIGA 4W1UA 4LB5A 3DQVC 4QIWN 3A2KA 1A6QA 4XKWA 2R0QC 2IP2A 2JVGA 3WTVC 3DBRB 2B9SA 1P4XA 2L9SA 4KDPA 1D8JA 2Y2ZA 3QU6A 4M6XA 2MG4A 5LHIA 2PLYA 3OYIA 3K0LA 4YELA 3M1CA 3CC2I 2IA1A 1R36A 2WAEA 3SXYA 2MH9A 2E34A 3ABLH 5JI6A 3C2HA 3OS2A 1ZR2A 1NH3A 5EG0A 1E3PA 2GA2A 4B1RA 2V1UA 1W7PB 2DN0A 5E3LA 4YIFA 1YS7A 1ETXA 3EYYA 2H09A 1W0TA 4HQMA 4EVIA 2CJJA 3B6AA 4OAZA 3DCFA 2DO7A 2X1DA 2V6EA 5HDNA 5HVQC 4CO8A 3F23A 2XGXA 4M9XA 4ZTFA 1R00A 1FC3A 1WFXA 1SFEA 3CMYA 3F8FA 3OR1C 4EGYA 3HOSA 3HOYJ 4UVAA 1YIJI 3IV5A 2VONA 1YW7A 1UHWA 1ON2A 4EM0B 1U9NA 2QVOA 2XKPA 3WU0A 5EDNA 1VQ4I 1K4TA 4KIGA 2K4JA 3A01B 4I6ZA 5D5XB 3OYFA 1QPMA 3JRCA 3BJAA 4XRFA 1QU3A 4BU2A 4XKBA 1R49A 1FBSA 1EKEA 2R5YB 2CMPA 4F93B 1MBEA 2X85A 2IGKA 4IRGA 1IC8A 1BIAA 3QP6A 4CA0A 4A3JJ 3O6BB 1D0ZA 2MABA 2UZKA 4KFCA 4BXFA 3KZYA 4D5FA 4PJJA 1FZPB 3F8NA 2KISA 2MC3A 1JJ6C 1ITYA 3MKLA 2KJBA 2L4AA 3SFZA 5J3LA 2M2EA 1YO5C 2EFOA 1QHGA 4A3IJ 2OZUA 1O3RA 4EGZA 5BS6A 1ZARA 2CQKA 1T8IA 2P8TA 1BA5A 2L0KA 2Z5UA 4NBQA 2LDUA 2QLZA 2XAFA 3F8CA 3IH4A 2O0YA 4PSWA 1OISA 5J4VA 3K70C 5ICCA 2UV1A 4PJMA 4NQWB 4L9VA 3GEZA 2DDBA 2WY8Q 1OYIA 3HSEA 2WTEA 5GTIC 4UNOA 2LR8A 1QQIA 2W7NA 1PUFA 1D1AA 3W3CA 1TLHB 5FKOA 2ICWG 1FYLA 1GDTA 1DP3A 2VI6A 3DTIA 2LBFB 5F08A 3ZMDA 1R6RA 3I9V2 4B09A 3I71A 5E3OA 1CGPA 2B7EA 1OQYA 3BQZA 4MIMA 4JOMA 3ASOH 1X3ZB 2F5FA 3FXJA 1SEUA 4I76A 5CVJA 4ZYHA 2PFBA 2CWEA 4BE1A 3J81Z 4HEA2 2M4GA 3ERED 2LK2A 5D6FA 2W1OA 2FBIA 5J47A 3CCSI 2K9SA 3LFUA 1TBXA 4ABZA 2W24A 1IW7F 1X3WB 3ZRGA 4A6EA 3OIQA 1W36C 2KRHA 1UHMA 1FOYA 4MQ9F 1HSJA 2VPLA 1PDNC 1I27A 3N05A 2ECBA 1XPXA 1TT5B 1IF1A 5J8CA 1RNLA 2FRHA 4YIRX 2WV1A 4RB1A 2R7UA 3J80Z 4O6JA 4BE2A 3HJEA 2HXIA 1REPC 3M4OJ 1YW9A 2BY3A 4B4CA 2FF4A 1VQ7I 5A2QZ 2K9QA 2DK8A 3CC4I 1ZRDA 4EJVA 3TOBA 4EEFG 4GXOA 3R0AA 4C3IJ 5AIQA 2COMA 3EYIA 3JTGA 3VEPA 4B44A 3CO7C 3GCMA 3BROA 1ETOA 4YIIA 3OYAA 5EGOB 2DFIA 3DP7A 4KMUX 1R1VA 5KK1A 3HPHA 1R9TJ 2XKOA 2YU3A 4ASNA 2X4HA 4Z6YA 1K7AA 2M7AA 2XAHA 5FLVA 1OCOH 5HS8A 2Z1DA 3GUDA 1Z05A 4G94A 1P7JA 3H36A 2JVHA 3D5RC 1YITI 4BQNA 5E8GA 1VQNI 2ZSHB 4E4HA 1J2XA 3DEEA 2ZB9A 2WV0A 3ECHA 3ZMZA 4DBQA 3E1SA 2V1XA 2ECCA 5LEJA 3T5XA 4EMSA 2DA7A 1O4XA 1NHAA 1ON1A 3S1NJ 4AC0A 2OCEA 1FOXA 1STZA 2LP0A 3V4GA 5BNGA 1TWGJ 3QU3A 4E7ZA 2VKDA 1DGWY 1ZAOA 1WJDA 4CH7A 3HRUA 4M3GA 4ZTJA 2VODA 5DUIA 1D3YA 2RV8A 4YRVA 3FK7A 4XRSG 4XR6A 2Y69H 3IRQA 4IQJA 4Y33A 5J40A 5FB2A 5BOXA 4M3BA 3KETA 2E1NA 3H92A 1FYMA 1BJZA 3CDHA 3IWZA 2QYOA 2DA3A 1A6IA 2JSCA 4V19K 4AIDA 5FROA 3HIFA 2Y0SN 1AKHB 3VB2A 3LSJA 4HOBA 2F5DA 5E1WA 2E1MC 2HDDA 1JUMA 2JN6A 2OUMA 4CYDA 5H20A 2ELHA 1YHQI 1ETKA 4LLGF 2QBYB 4GO1A 2DFHA 1RUNA 2LY1A 2R7ZJ 2JMWA 4BQOA 4HYEA 4KUMA 5C4JJ 3HOZJ 4I0BA 5CQGA 2L02A 3J7YJ 1A35A 1FMVA 5K5RA 3KYCB 2QA4I 2XASA 2ISYA 3HOVJ 2EWNA 5C44J 2BZTA 2Y48A 2M34A 2E2HJ 3V42A 1OCRH 4HNVA 1B72B 2HTSA 2JZYA 1FYKA 3ZGKA 3TO6A 3DU6A 3KCCA 3RPUD 4W97A 4HF2A 2M3AA 1MJAA 4YFXF 1B1BA 1ERDA 1F36A 1SAUA 4HA8A 1BIBA 1D0XA 3CCLI 3S2HJ 3OYNA 1O3SA 2Y0SA 1MBGA 3LSMA 2K9MA 2ZO4A 2NVTJ 2R7OA 3DF8A 2CS3A 2W48A 1LFPA 4CICA 5EF6A 3CJQB 3K4JA 4HDUA 2CQXA 3C18A 3QYBA 4IXAA 1WJAA 5EG0B 1ACIA 1ZREA 2GXGA 4XLAA 3W2VA 5IOYA 4A0XA 1I6XA 3PUFA 5EEGA 4OOIA 3JRDA 2FBHA 2E71A 4M72A 2DDAA 1VQ9I 4U87A 1ZRCA 3ULQB 1ZYRF 2Y9ZA 5CJ9A 2K27A 2H27A 4RA2A 1TWCJ 2R7WA 3OV8A 3BT9A 2Z16A 3GTLJ 2ME6A 3EPZA 5HLTA 2WAQN 4U7BA 1IV8A 2VJ4A 1DU6A 1G8XA 2VJ5A 3ZMVA 4H4KC 1QNTA 3HTUA 3E5UA 4AUXA 3VDXA 1RKTA 1IN7A 3BG6A 1P9QC 3ISPA 4S0HB 3GZNB 3MZHA 1K61A 1JUPA 3FHNA 4TV7A 3A02A 2L4MA 4J00A 1IJWC 2DPUA 2Q1ZB 1MBJA 5GP9A 4AIKA 3OYHA 1HOMA 2J5OA 3CCQI 3ZPLA 1G3SA 4PZJA 4Y4RA 2VJIA 3HTSB 4AIJA 3IP4B 3UNGC 2JUCA 2E5ZA 2HYGD 2XSDC 1E2XA 5K1YA 3FXQA 1XCVA 4GRIA 3R60A 2K3PA 2PEXA 4U0WA 4ENMA 4GCVA 2O5RA 3HKZN 5D4SA 1V4RA 2EZHA 3TDZC 5E3NA 2ZJPF 1G3YA 3QQAA 2JPBA 2KJCA 1V5GA 1S7EA 2D1HA 2QQBA 1ZG1A 4ZYAA 2B0LA 3I53A 4QWQA 2TCTA 5K5QA 2HS5A 1FTZA 3P9IA 3K2AA 2OA4A 4DOZA 4RGUA 1XDSA 4M3EA 2CV2A 2O3FA 1Y8RB 1MMNA 2MBFA 2ESHA 3HM5A 3JRFA 2LFBA 3FWEA 1JKPC 3BC8A 2O03A 1HW5A 2DTRA 3RPUA 4DBRA 3OYDA 3K6GA 2R7FA 4U88A 1PUFB 4HF0A 3G4SI 1OMIA 1A5JA 4QPOA 3ZMUA 1SMYF 2A6HF 3H9QA 2GM4A 2X48A 1FIAA 2IVMA 4IEJA 2EZIA 1Z0XA 1TNSA 4JX5A 1G3TA 2MFZA 4ESJA 2ZFWA 2GAUA 1IV6A 4XLPF 2KDZA 2RKHA 4IHTA 5HNFA 3WTWC 3M9AA 2F5VA 2OQRA 5JLWA 1ETYA 2K86A 1P92A 4RGSA 3I59A 4Y13A 1OCPA 2R4GA 3CO6C 3CZ6A 4MNUA 4IHSA 3U9GA 1U9OA 2FMYA 3VFZA 3DPLC 3BZ6A 1BN5A 2DA6A 4EV0A 3K4MA 1L3LA 1BC8C 2A69F 3WTTC 1X1CA 3AL0C 5C3EJ 3S17J 2E7XA 2IA2A 2IT0A 2E2IJ 2E7WA 2P81A 3OIPA 3OL4A 2M9HA 4PJ0C 3LSPA 5IT9Z 2X9DA 3KYLA 4PFPA 1RR8C 1X4PA 2BXZA 2VJJA 1ZLKA 1IRGA 3TW6A 1FTTA 3OYBA 5IP9J 2A6TA 3I55I 3ESWB 1MNEA 1JKRC 4QTRA 3VSKA 2PG4A 2HGCA 3L2VA 2D45A 2VXDA 2LOOA 3WODF 1MH4A 1HSTA 5KCMA 4FQGA 5EZGA 3EQLF 2M45A 3V7SA 3ZR8X 2ZCWA 3GLXA 4N4NB 3VOEA 3C7JA 3HOTA 1QVTA 5ERIA 3PSIA 4XRSA 2A07F 2HEOA 1U0JA 4QSHA 1B9NA 4FX0A 5A2QK 1GUUA 2K9LA 4WK8F 5E79C 2VB6A 2LNBA 3BOQA 4D0PA 2BOLA 4M3FA 4ESBA 3Q5FA 2VIXA 2F4IA 3GTOJ 2BE5F 1MZBA 2I10A 5F1RA 4G6DA 5CLSA 1E17A 4ENJA 3QAHA 1LB2A 4N9IA 5IY5H 1O7LA 2ESNA 5J8FA 2RQQA 5AIPA 1LUJB 2DTZA 4II3A 4XK4A 1AU7A 3WU1B 4RB2C 3J7AY 5FD5A 1UG2A 3FXMA 2VQCA 1Y0UA 2EINH 2BGCA 2ZMEA 3DEUA 3RYRA 1XX5A 3W6VA 4WXDA 1JT0A 2CW8A 1FOWA 3BTJA 4P9UA 3E5XA 2ZKZA 3NRVA 1G3WA 3CCEI 2HDWA 1QBJA 1WZ2A 4I0AA 3S2WA 3TOAA 4F92B 4V2GA 4IHVA 4YEJA 5FKNA 2Y31A 3DKWA 1AHDP 4LB6B 5CKTA 5J1UA 2VQHA 1ULYA 2OV7A 2DOFA 1KYWA 3BR2A 3BTIA 4L5EA 2CH0A 3MKYB 1OCTC 2XF7A 4ON0A 1PP7U 3OIOA 3CUQA 1Z1DA 2KQRA 5JVGF 3NQOA 1R5GA 3RCOA 2IJLA 4AM3A 3Q0WA 2RQPA 5BPDA 3M8FA 3H1CA 4C2TA 1GV2A 2RAEA 4MEYF 3OSFA 4GDFA 2A5YB 3PQKA 5CYVA 3HOUJ 3E6MA 3K10A 4DZJA 2QQ8A 3BQYA 2DQRA 2DA2A 2EIMH 3L2RA 3PFYA 3MKZA 1VNDA 3M3YJ 1OR7C 2CGPA 4BUPA 3RYPA 4Q48A 2EQRA 4JQFA 4G8XA 1HKSA 2IGNA 2NOGA 2QKMB 3T8RA 3LA7A 2D5VA 4UB6C 1XGOA 1QO0D 5ICEA 1FT9A 3HGGA 3KP4A 2XUBA 1TW3A 2K4BA 4UVBA 1X4OA 1VI0A 3A0HC 4CCJA 5JHFA 4I09A 4G6QA 1JXSA 1BC7C 1TP4A 3V8KA 5TGTA 1WVRA 2ZJ2A 3B02A 3TO7A 1TW2A 3D0SA 2QEXI 5J1YA 3K2ZA 4X1EA 3EUAA 3QP5A 1Y1VJ 4DJAA 3ASNH 1KZHA 3L9FA 4U7DA 4NUBA 4UUVA 2IAIA 1BBYA 4LIUA 4XQFA 2NNNA 3CDIA 1CQTA 1NK2P 2IEKA 1HQCA 3EUHA 3TDUC 1YJWI 3K7AJ 4A3KJ 2LKPA 4J19A 2ZNYA 4LFUA 3ZQQA 1S9HA 3JREA 1ZG5A 1ZN2A 3SEZA 3I0TA 3MWMA 1XMXA 2GXAA 3KEQA 3WTSC 1IDZA 3MCZA 1FSEA 3CMMA 1H9TA 1D5VA 2VXZA 3GFIA 1HBXG 2Z9OA 2PMHA 1UFMA 1MMGA 2XHKA 5BMZA 3JAMZ 1BM9A 2FD5A 3G1LA 3W6JB 2FOKA 2Z99A 3ZMSA 1VQMI 2ETHA 1HLVA 1R1TA 3I4MJ 1R58A 4MGRA 4WCGA 3A4CA 4E6KG 5LRSA 4GYGA 1UMQA 4LJZF 2WBMA 1UCRA 3QODA 1U78A 1NK3P 1W5TA 3CLOA 2R7XA 1IRZA 1MDMA 3SFIA 4IQ4A 1AOYA 3TP0A 5KHDA 5B66C 3GVAA 4IF4A 3DXJF 4ZDLA 4A0ZA 2OJED 5JLXA 2EFPA 1W4MA 4CSWA 3GTQJ 4ESFA 5FLXZ 4UUSB 5LD2C 4KICA 2CG4A 1PVEA 2DA1A 4HX8A 3E6BA 2ME0A 3L2UA 4D7MA 4KJZA 2F4MB 1G6NA 4MLOA 1DGRM 1U8BA 4LOCA 3I59B 1I6HJ 3LQQA 3BWGA 2EBIA 1ETWA 2KRFA 2YX7A 4E7KA 4C9YA 1IGNA 5FFXA 4KIFA 1OCCH 4G9YA 3GTGJ 4XLFA 3F3XA 2XF5A 1XSDA 1N78A 3ABTA 3MEXA 4XIDA 2AO9A 1X2NA 2FA5A 2FMLA 3ZXSA 4L0YB 1TQIA 4OAYA 4ZDPA 2LKXA 3MZ8A 2H6BA 4XNFA 5D4RA 3OSGA 3CD6I 1V5FA 2PN6A 3TQNA 2MA3A 1WSUA 4DQ2A 4CHUA 5FRNA 1JGSA 4LMYA 5BQTA 3PIOF 3HRMA 4ENKA 4A6DA 3RZOJ 3QRFF 2F5EA 1GLNA 3GFMA 2AHQA 3WHCA 3AFHA 1WCMJ 2KIFA 3FIWA 3QWLA 4PCQA 1QRYA 2WY7Q 1WJEA 4LIVA 1QZEA 3RIRA 4BE0A 2E2JJ 1T0FC 3CJNA 3KE2A 3BJOA 4B8XA 4O5VA 2H6CA 3ABUA 3JTHA 4AIHA 2L7KA 4FCYA 4IRHA 2VBZA 1ZGWA 5E3MA 3N4MA 2CUJA 2G9WA 3I4PA 3G2BA 4HPQA 2ZNZA 3I3LA 1JJ8C 2R7DA 4RAGA 1MMSA 2A68F 4CCMA 2TDXA 4KN7X 2Q0OA 3PL8A 2EV5A 3O8GA 2ZMEB 3SZPA 2CUEA 1LDDA 3ZOBA 1G4DA 2DA4A 2E36A 1MGTA 2PJRA 1V55H 5DD4A 3P7NA 4K2EA 2HVQA 2HZTA 1ZKGA 5E17F 3QPHA 2FUG2 1VQKI 1T08B 3ZMTA 3GWZA 2E19A 3BPVA 2VKHA 2HYFA 3MD2A 3P9CA 2H8RA 2GIZA 1R7JA 2ACJA 2X0LA 3E97A 4HQEA 4RB0A 3IH3A 4B47A 2JA5J 1RC9A 1F9NA 2HKOA 2LF7A 2DU9A 2Y9YA 1Y6IA 3CUQB 3NAUA 1T98A 2O8KA 4EJOA 1DPUA 4OMZA 5IYBJ 2Y30A 2BY0A 1O7FA 2EZLA 2LG4A 2NXNB 2QCOA 3AG4H 3P9KA 1Z21A 4A69C 4BXUA 4DZPA 3HGYA 2P4WA 5HDGA 3GX4X 5FRMA 3WTYC 2DYRH 4NDLA 3ZN1A 3IKTA 1ZGJA 2AXTC 5IOZA 2CUZA 1N25A 2EFQA 4DYCA 4HSRA 2E35A 2YU9J 3AG1H 3BDDA 2QQAA 2UUZA 2X1CA 3K9TA 4G7HF 1SFUA 1GVJA 1USTA 1MBHA 2AQFA 5GAGJ 4A5MA 4D5CA 1QPIA 5IYDJ 5ILVA 4XRMA 2MGQA 2DYSH 3L2QA 2XVCA 4UVCA 3X2QH 3KZZA 1SD5A 3CJTB 5L3EA 4PSXA 5LGNA 3SQNA 3CCRI 1K79A 2WA0A 5GAEJ 3K4CA 3FX3A 3Q9SA 2FJ1A 4A3BJ 4F7ZA 3OYCA 4HX4A 1GHCA 3DBLB 4PGGA 1HW2A 2EFWA 3BJ6A 1IAWA 3L00A 2RC4A 3KPHA 3ZN0A 3WGIA 2NAZA 4BGDA 2HVRA 2LMDA 4L9NA 4Q47A 3R61A 3QYFA 4OIQF 2CW0F 3H9JA 2LSOA 4EQQA 2LKSA 4UB8C 2JWTA 1XN7A 3FBIB 2A3SA 1BOAA 1LNWA 4RB3C 3D5SC 3GTJJ 1UAAA 2KIUA 1K6YA 4A3FJ 1H89C 1LEBA 2OF7A 3ZQFA 1K4SA 4KITB 1Z3YA 3CP8A 1FJLA 3C3WA 4CYCB 5KNLA 2RDPA 4BBSJ 4KNYA 2DMQA 2Z33A 3HHHA 1PUEE 1WQ2A 1XGSA 1IXSB 2BEOA 3S1RJ 2OTJI 4XLNF 1KQ8A 2K5CA 1BOBA 2HXOA 3BG3A 4HV6A 2DBBA 1RIOH 2CQNA 3CMAI 2R7QA 5ICGA 1N77A 2L54A 1Q1HA 2Z2SB 3HRSA 4CCOA 2JA6J 3O8HA 2RN7A 1D1CA 3SJMA 2H94A 5ILSA 2L9RA 5GPCA 3FXOA 3U2RA 5M3MJ 1LVAA 2R93J 1SMTA 3RZDJ 3VPRA 4IOCF 4E70A 1DU0A 6PAXA 4JK1X 3FK6A 4XM3A 3VYTB 1ZK8A 1QHHD 2PBIA 3ERMA 4ZZDA 5TISC 2VKVA 5IYCJ
chains in the Genus database with same CATH topology
1JKQC 1GVDA 1MH4A 1G2HA 1T56A 5EZGA 3CCYA 1W0UA 2XPUA 3JRIA 1AKHA 3PO2J 3MN2A 3E7LA 1QVTA 4XRSA 3PM1A 1I50J 3G1MA 4UUTA 4CYCA 4QSHA 2VPRA 1GUUA 2MSYA 5DTDA 3IH2A 1ETQA 1Q1VA 4M3FA 2B63J 5F0FA 3GTOJ 4X6AJ 2I10A 3H3VK 4BXXJ 5M5YJ 1APLC 2JK3A 3MVPA 3UKGA 3TP3A 4B3AA 4XICA 3LNQA 1B8IB 4Y52J 1B72A 3GTKJ 3S15J 2DTZA 4W1UA 4XK4A 1AU7A 4QIWN 2R0QC 3FISA 1UG2A 1JKOC 2Y2ZA 2YS9A 2MG4A 3S1QJ 3W6VA 3GTPJ 2XPWA 1JT0A 5FKMA 1I3QJ 1MBKA 3JRAA 3BTJA 3BTLA 1MNMC 2OPTA 1XG1A 3GBGA 1YRNB 1ZR2A 2HQ5A 5EG0A 2R92J 4B1RA 4V2GA 2DN0A 5E3LA 4IHVA 4A3MJ 1ETXA 5FKNA 4MFEA 2Y31A 1W0TA 2CJJA 3B6AA 1AHDP 3DCFA 1JTYA 5J1UA 5M5WJ 3S16J 1LFUP 3BTIA 4A3CJ 3BR2A 4L5EA 5IP6A 1OCTC 4RDUA 3NARA 5FKKA 3D1NI 3OIOA 3CMYA 1IG7A 3FKIJ 3HOYJ 2K9NA 3HEFA 3IV5A 2NVQJ 3ZQCA 1X58A 5C4XJ 3Q0WA 5F0HA 1RPWA 1GT0C 1GV2A 2RAEA 1OJLA 4G12A 1U9NA 2DMUA 3OSFA 5EDNA 3BG9A 3A01B 4I6ZA 3Q0VA 3HOUJ 1OFCX 3JRCA 2O9LA 4DZJA 3BQYA 2H1KA 2NS8A 5F0CA 2DA2A 4MO7A 2R5YB 2R5ZA 1MBEA 1IC8A 1VNDA 4A3JJ 1VFCA 3M3YJ 1D5YA 4JP0A 2QF7A 3C2BA 4D5FA 4A3LJ 5EYRA 5J1RA 2EQRA 4DYQA 1JJ6C 2KT0A 1ITYA 3MKLA 3HDDA 1LFBA 4V2FA 4C3HJ 2NOGA 1TWFJ 5J3LA 2M2EA 3S14J 4A3IJ 2D5VA 2VKEA 1QVUA 3LOCA 1TWHJ 3HGGA 2YUSA 1BA5A 2L0KA 3JRHA 1VI0A 3IH4A 3HB9A 3S2DJ 4C2MJ 3H0GJ 2LR8A 4AYBN 1PUFA 2XRLA 9ANTA 2HOTA 5J1YA 2CU7A 5FKOA 4X1EA 2NVYJ 1GDTA 2VI6A 2IBDA 4FISA 1Y1VJ 5F08A 2IAIA 5E3OA 3CDLA 1H88C 3BQZA 1XC5A 3DEWA 4M3DA 4MIMA 2X6OA 1CQTA 1NK2P 4I76A 1WI3A 2IEKA 1WPKA 3K7AJ 4A3KJ 4J19A 2GLOA 3BR0A 2LK2A 1WH5A 3JREA 1LE8B 3OOUA 2K9SA 4ABZA 4JX4A 1IDZA 1E3OC 2E1OA 2NS7A 3LSGA 3SDGA 1RESA 2FD5A 2ECBA 3G1LA 1HLVA 1FEXA 2WV1A 3I4MJ 1K83J 2HXIA 4DW6A 3M4OJ 4B4CA 1UMQA 4BBRJ 2K9QA 1P7IA 1JT6A 1U78A 1NK3P 2GBYA 2PMZN 4EEFG 1IRZA 4C3IJ 3SFIA 3TP0A 2DJNA 1ETOA 2XGDA 2XPVA 5EGOB 3B6CA 1R9TJ 5JLXA 3HOXJ 2ID3A 1ZQ3P 2JJ7A 2VUMJ 5FLVA 3GTQJ 2LVSA 3HBLA 4FE7A 4UUSB 2K40A 3BR5A 2XGCA 2DA1A 2ME0A 2L7ZA 4A3GJ 1P7JA 4D7MA 4MLOA 1IUFA 1U8BA 4LOCA 2XB0X 1I6HJ 2EBIA 1ETWA 2ZB9A 3I4NJ 2L7MP 1IGNA 1BW5A 5GPAA 1Z77A 3A03A 2ECCA 1B8IA 3GTGJ 2DA7A 1O4XA 2FX0A 1UHSA 3S1NJ 4XIDA 4AC0A 2AO9A 1X2NA 2LP0A 5BNGA 1TWGJ 4GFBA 4RBOA 4M3GA 2MW8A 1BL0A 1WGXA 2LKXA 3BR3A 3FK7A 4XRSG 5FJ8J 4JYKA 3OSGA 3JRBA 3ZQHA 4M3BA 1YRNA 4A3DJ 1BJZA 3ZQLA 2DA3A 2DA5A 1A6IA 3RZOJ 1XS9A 2JA7J 3JR9A 2Y0SN 1AKHB 2AHQA 3WHCA 1WCMJ 3FIWA 1ETVA 3LSJA 1QRYA 1ORKA 1JGGA 2HDDA 1JUMA 2JN6A 4UUSA 2E2JJ 2NVXJ 1ETKA 3BG5A 5HODA 2R7ZJ 2JMWA 5C4JJ 3HOZJ 2WB1N 2LLKA 4FCYA 1ZGWA 5E3MA 2TRTA 3HOVJ 5C44J 1HDDC 2M34A 2XB5A 2E2HJ 4HNVA 1B72B 4FE4A 1JJ8C 2ID6A 3A01A 1JTXA 4JX6A 4W97A 3O8GA 2COBA 1F36A 2R5YA 2CUEA 1IDYA 5K7ZA 3ZOBA 2DA4A 3S2HJ 2CUFA 1MBGA 2NVTJ 2LTPA 5K7FA 1ZTRA 2W48A 5EF6A 1ZKGA 3L1PA 1F43A 2CQXA 1HDPA 2XGEA 2E19A 3BTCA 5EG0B 1WH7A 5IOYA 2HI3A 2H8RA 1RETA 3JRDA 1HCRA 1FIPA 4MFDA 1ENHA 2Y9ZA 3JRGA 3IH3A 2M0CA 2JA5J 1TWCJ 2LD5A 5IPAA 3BT9A 2Y9YA 1GV5A 5F27A 3GTLJ 2ME6A 1HF0A 3NAUA 3TW7A 2O8KA 2WAQN 3Q0UA 5IYBJ 2Y30A 2DMNA 2EZLA 2QCOA 3BR1A 4Y7NJ 1DU6A 4A69C 3RKQA 1EF4A 4AUXA 3HGYA 4DZPA 1RKTA 4S0HB 4NDLA 1K61A 1JUPA 1SFOJ 3A02A 1IJWC 3HOWJ 1MBJA 5GP9A 5IOZA 2DMPA 3LSRA 4DYCA 3WHBA 1HOMA 1NTCA 1MH3A 2YU9J 2R5ZB 5FKLA 2XSDC 3BR6A 1MBHA 3RQIA 4D5CA 1QPIA 5IYDJ 4XRMA 2MGQA 2L7FP 2HOAA 1POGA 2JA8J 3Q3SA 3ZQGA 3HKZN 5E3NA 2EZHA 1LE8A 5F04A 3QQAA 5FLMJ 4BY1J 1S7EA 5F1JA 1H8AC 3CQZJ 5EZHA 2FJ1A 2TCTA 4A3BJ 4FTHA 1MSEC 2CQQA 1TC3C 1MSFC 1FTZA 3K2AA 1BW6A 2FQ4A 4M3EA 2M8GX 2CRGA 2HOSA 1TWAJ 3HM5A 3JRFA 1JKPC 2LFBA 3F0CA 3G1OA 3S1MJ 2G0EA 3TEDA 2JWTA 4M6VA 1PUFB 4IHWA 1A5JA 3GTJJ 4A3EJ 2HYJA 3ZQIA 4DYRA 1JUSA 5M3FJ 2X48A 5EGOA 1FIAA 4IEJA 4A3FJ 1H89C 2GM4A 3GTMJ 2EZIA 1T33A 2OF7A 1Z0XA 3ZQFA 1ZR4A 4JX5A 2EZKA 1IV6A 1FJLA 4CYCB 2KDZA 4BBSJ 1Y1WJ 2O7OA 2DMQA 1X2MA 5M5XJ 3QPLA 5DS9A 5K7HA 3S1RJ 5JLWA 1ETYA 1OCPA 3BG3A 4IHXA 2HXOA 2LY9A 1U9OA 4BY7J 2DA6A 2DMTA 2JA6J 3O8HA 3SJMA 2L9RA 5GPCA 2N8GA 5M3MJ 3S17J 5C3EJ 1RKWA 2R93J 3RZDJ 3VPRA 2E2IJ 2P81A 3LSPA 2M9HA 3QPSA 2X9DA 1DU0A 5IP7J 1SANA 3PO3J 3FK6A 1MBFA 3TW6A 1FTTA 1ZK8A 4C3JJ 4D7NA 5IP9J 4IHYA 4BKXA 4A93J 1RR7A 1JKRC 4QTRA 2ELKA 5EEAA 2EH3A 2VKVA 5IYCJ 1VF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKQ C;  1GVD A;  1MH4 A;  1G2H A;  1T56 A;  5EZG A;  3CCY A;  1W0U A;  2XPU A;  3JRI A;  1AKH A;  3PO2 J;  3MN2 A;  3E7L A;  1QVT A;  4XRS A;  3PM1 A;  1I50 J;  3G1M A;  4UUT A;  4CYC A;  4QSH A;  2VPR A;  1GUU A;  2MSY A;  5DTD A;  3IH2 A;  1ETQ A;  1Q1V A;  4M3F A;  2B63 J;  5F0F A;  3GTO J;  4X6A J;  2I10 A;  3H3V K;  4BXX J;  5M5Y J;  1APL C;  2JK3 A;  3MVP A;  3UKG A;  3TP3 A;  4B3A A;  4XIC A;  3LNQ A;  1B8I B;  4Y52 J;  1B72 A;  3GTK J;  3S15 J;  2DTZ A;  4W1U A;  4XK4 A;  1AU7 A;  4QIW N;  2R0Q C;  3FIS A;  1UG2 A;  1JKO C;  2Y2Z A;  2YS9 A;  2MG4 A;  3S1Q J;  3W6V A;  3GTP J;  2XPW A;  1JT0 A;  5FKM A;  1I3Q J;  1MBK A;  3JRA A;  3BTJ A;  3BTL A;  1MNM C;  2OPT A;  1XG1 A;  3GBG A;  1YRN B;  1ZR2 A;  2HQ5 A;  5EG0 A;  2R92 J;  4B1R A;  4V2G A;  2DN0 A;  5E3L A;  4IHV A;  4A3M J;  1ETX A;  5FKN A;  4MFE A;  2Y31 A;  1W0T A;  2CJJ A;  3B6A A;  1AHD P;  3DCF A;  1JTY A;  5J1U A;  5M5W J;  3S16 J;  1LFU P;  3BTI A;  4A3C J;  3BR2 A;  4L5E A;  5IP6 A;  1OCT C;  4RDU A;  3NAR A;  5FKK A;  3D1N I;  3OIO A;  3CMY A;  1IG7 A;  3FKI J;  3HOY J;  2K9N A;  3HEF A;  3IV5 A;  2NVQ J;  3ZQC A;  1X58 A;  5C4X J;  3Q0W A;  5F0H A;  1RPW A;  1GT0 C;  1GV2 A;  2RAE A;  1OJL A;  4G12 A;  1U9N A;  2DMU A;  3OSF A;  5EDN A;  3BG9 A;  3A01 B;  4I6Z A;  3Q0V A;  3HOU J;  1OFC X;  3JRC A;  2O9L A;  4DZJ A;  3BQY A;  2H1K A;  2NS8 A;  5F0C A;  2DA2 A;  4MO7 A;  2R5Y B;  2R5Z A;  1MBE A;  1IC8 A;  1VND A;  4A3J J;  1VFC A;  3M3Y J;  1D5Y A;  4JP0 A;  2QF7 A;  3C2B A;  4D5F A;  4A3L J;  5EYR A;  5J1R A;  2EQR A;  4DYQ A;  1JJ6 C;  2KT0 A;  1ITY A;  3MKL A;  3HDD A;  1LFB A;  4V2F A;  4C3H J;  2NOG A;  1TWF J;  5J3L A;  2M2E A;  3S14 J;  4A3I J;  2D5V A;  2VKE A;  1QVU A;  3LOC A;  1TWH J;  3HGG A;  2YUS A;  1BA5 A;  2L0K A;  3JRH A;  1VI0 A;  3IH4 A;  3HB9 A;  3S2D J;  4C2M J;  3H0G J;  2LR8 A;  4AYB N;  1PUF A;  2XRL A;  9ANT A;  2HOT A;  5J1Y A;  2CU7 A;  5FKO A;  4X1E A;  2NVY J;  1GDT A;  2VI6 A;  2IBD A;  4FIS A;  1Y1V J;  5F08 A;  2IAI A;  5E3O A;  3CDL A;  1H88 C;  3BQZ A;  1XC5 A;  3DEW A;  4M3D A;  4MIM A;  2X6O A;  1CQT A;  1NK2 P;  4I76 A;  1WI3 A;  2IEK A;  1WPK A;  3K7A J;  4A3K J;  4J19 A;  2GLO A;  3BR0 A;  2LK2 A;  1WH5 A;  3JRE A;  1LE8 B;  3OOU A;  2K9S A;  4ABZ A;  4JX4 A;  1IDZ A;  1E3O C;  2E1O A;  2NS7 A;  3LSG A;  3SDG A;  1RES A;  2FD5 A;  2ECB A;  3G1L A;  1HLV A;  1FEX A;  2WV1 A;  3I4M J;  1K83 J;  2HXI A;  4DW6 A;  3M4O J;  4B4C A;  1UMQ A;  4BBR J;  2K9Q A;  1P7I A;  1JT6 A;  1U78 A;  1NK3 P;  2GBY A;  2PMZ N;  4EEF G;  1IRZ A;  4C3I J;  3SFI A;  3TP0 A;  2DJN A;  1ETO A;  2XGD A;  2XPV A;  5EGO B;  3B6C A;  1R9T J;  5JLX A;  3HOX J;  2ID3 A;  1ZQ3 P;  2JJ7 A;  2VUM J;  5FLV A;  3GTQ J;  2LVS A;  3HBL A;  4FE7 A;  4UUS B;  2K40 A;  3BR5 A;  2XGC A;  2DA1 A;  2ME0 A;  2L7Z A;  4A3G J;  1P7J A;  4D7M A;  4MLO A;  1IUF A;  1U8B A;  4LOC A;  2XB0 X;  1I6H J;  2EBI A;  1ETW A;  2ZB9 A;  3I4N J;  2L7M P;  1IGN A;  1BW5 A;  5GPA A;  1Z77 A;  3A03 A;  2ECC A;  1B8I A;  3GTG J;  2DA7 A;  1O4X A;  2FX0 A;  1UHS A;  3S1N J;  4XID A;  4AC0 A;  2AO9 A;  1X2N A;  2LP0 A;  5BNG A;  1TWG J;  4GFB A;  4RBO A;  4M3G A;  2MW8 A;  1BL0 A;  1WGX A;  2LKX A;  3BR3 A;  3FK7 A;  4XRS G;  5FJ8 J;  4JYK A;  3OSG A;  3JRB A;  3ZQH A;  4M3B A;  1YRN A;  4A3D J;  1BJZ A;  3ZQL A;  2DA3 A;  2DA5 A;  1A6I A;  3RZO J;  1XS9 A;  2JA7 J;  3JR9 A;  2Y0S N;  1AKH B;  2AHQ A;  3WHC A;  1WCM J;  3FIW A;  1ETV A;  3LSJ A;  1QRY A;  1ORK A;  1JGG A;  2HDD A;  1JUM A;  2JN6 A;  4UUS A;  2E2J J;  2NVX J;  1ETK A;  3BG5 A;  5HOD A;  2R7Z J;  2JMW A;  5C4J J;  3HOZ J;  2WB1 N;  2LLK A;  4FCY A;  1ZGW A;  5E3M A;  2TRT A;  3HOV J;  5C44 J;  1HDD C;  2M34 A;  2XB5 A;  2E2H J;  4HNV A;  1B72 B;  4FE4 A;  1JJ8 C;  2ID6 A;  3A01 A;  1JTX A;  4JX6 A;  4W97 A;  3O8G A;  2COB A;  1F36 A;  2R5Y A;  2CUE A;  1IDY A;  5K7Z A;  3ZOB A;  2DA4 A;  3S2H J;  2CUF A;  1MBG A;  2NVT J;  2LTP A;  5K7F A;  1ZTR A;  2W48 A;  5EF6 A;  1ZKG A;  3L1P A;  1F43 A;  2CQX A;  1HDP A;  2XGE A;  2E19 A;  3BTC A;  5EG0 B;  1WH7 A;  5IOY A;  2HI3 A;  2H8R A;  1RET A;  3JRD A;  1HCR A;  1FIP A;  4MFD A;  1ENH A;  2Y9Z A;  3JRG A;  3IH3 A;  2M0C A;  2JA5 J;  1TWC J;  2LD5 A;  5IPA A;  3BT9 A;  2Y9Y A;  1GV5 A;  5F27 A;  3GTL J;  2ME6 A;  1HF0 A;  3NAU A;  3TW7 A;  2O8K A;  2WAQ N;  3Q0U A;  5IYB J;  2Y30 A;  2DMN A;  2EZL A;  2QCO A;  3BR1 A;  4Y7N J;  1DU6 A;  4A69 C;  3RKQ A;  1EF4 A;  4AUX A;  3HGY A;  4DZP A;  1RKT A;  4S0H B;  4NDL A;  1K61 A;  1JUP A;  1SFO J;  3A02 A;  1IJW C;  3HOW J;  1MBJ A;  5GP9 A;  5IOZ A;  2DMP A;  3LSR A;  4DYC A;  3WHB A;  1HOM A;  1NTC A;  1MH3 A;  2YU9 J;  2R5Z B;  5FKL A;  2XSD C;  3BR6 A;  1MBH A;  3RQI A;  4D5C A;  1QPI A;  5IYD J;  4XRM A;  2MGQ A;  2L7F P;  2HOA A;  1POG A;  2JA8 J;  3Q3S A;  3ZQG A;  3HKZ N;  5E3N A;  2EZH A;  1LE8 A;  5F04 A;  3QQA A;  5FLM J;  4BY1 J;  1S7E A;  5F1J A;  1H8A C;  3CQZ J;  5EZH A;  2FJ1 A;  2TCT A;  4A3B J;  4FTH A;  1MSE C;  2CQQ A;  1TC3 C;  1MSF C;  1FTZ A;  3K2A A;  1BW6 A;  2FQ4 A;  4M3E A;  2M8G X;  2CRG A;  2HOS A;  1TWA J;  3HM5 A;  3JRF A;  1JKP C;  2LFB A;  3F0C A;  3G1O A;  3S1M J;  2G0E A;  3TED A;  2JWT A;  4M6V A;  1PUF B;  4IHW A;  1A5J A;  3GTJ J;  4A3E J;  2HYJ A;  3ZQI A;  4DYR A;  1JUS A;  5M3F J;  2X48 A;  5EGO A;  1FIA A;  4IEJ A;  4A3F J;  1H89 C;  2GM4 A;  3GTM J;  2EZI A;  1T33 A;  2OF7 A;  1Z0X A;  3ZQF A;  1ZR4 A;  4JX5 A;  2EZK A;  1IV6 A;  1FJL A;  4CYC B;  2KDZ A;  4BBS J;  1Y1W J;  2O7O A;  2DMQ A;  1X2M A;  5M5X J;  3QPL A;  5DS9 A;  5K7H A;  3S1R J;  5JLW A;  1ETY A;  1OCP A;  3BG3 A;  4IHX A;  2HXO A;  2LY9 A;  1U9O A;  4BY7 J;  2DA6 A;  2DMT A;  2JA6 J;  3O8H A;  3SJM A;  2L9R A;  5GPC A;  2N8G A;  5M3M J;  3S17 J;  5C3E J;  1RKW A;  2R93 J;  3RZD J;  3VPR A;  2E2I J;  2P81 A;  3LSP A;  2M9H A;  3QPS A;  2X9D A;  1DU0 A;  5IP7 J;  1SAN A;  3PO3 J;  3FK6 A;  1MBF A;  3TW6 A;  1FTT A;  1ZK8 A;  4C3J J;  4D7N A;  5IP9 J;  4IHY A;  4BKX A;  4A93 J;  1RR7 A;  1JKR C;  4QTR A;  2ELK A;  5EEA A;  2EH3 A;  2VKV A;  5IYC J;  1VF9 A; 
#chains in the Genus database with same CATH topology
 2CO5 A;  5E1X A;  1G2H A;  1HKT A;  1MDM B;  3EDP A;  1WJ5 A;  2FNA A;  1X1D A;  3JAM K;  3RSN A;  3E7L A;  1TL8 A;  4E7H A;  4EM1 A;  3G1M A;  3FXR A;  4LIT A;  4BHC A;  4U0V A;  2RGV A;  1ETQ A;  1Q1V A;  2V9V A;  3PNY A;  2F6C A;  3F9K A;  2B63 J;  4S04 A;  5F0F A;  3C1D A;  1C0W A;  4BXX J;  5B1B H;  2JK3 A;  3MVP A;  4KT5 C;  3K4N A;  3UKG A;  1J7K A;  4XOT A;  3GTK J;  3S15 J;  5FLX K;  2HFH A;  4IZZ A;  2DFE A;  1AA7 A;  3FIS A;  2LRE A;  2AQE A;  1RRJ A;  3WGH A;  2A61 A;  3S1Q J;  2KDO A;  2E5N A;  2R7V A;  2XPW A;  3CF5 F;  3LAJ A;  1IUY A;  2IGO A;  1I3Q J;  4P5O A;  3LST A;  3JRA A;  3BTL A;  1MNM C;  3ECO A;  1R1U A;  3LWF A;  3CTA A;  3OYK A;  4EAT A;  1J59 A;  2QSH X;  2V26 A;  3IAM 2;  2EIK H;  4EJT A;  2R92 J;  2BXY A;  1B4A A;  3K4L A;  4BJT A;  2VOO A;  4A3M J;  3DTE A;  2L2O A;  1UEL B;  3IRR A;  3SHF A;  3I54 A;  1JTY A;  1SC7 A;  4BDZ A;  3S16 J;  3GW2 A;  1LFU P;  2JUG A;  3FKJ A;  4RDU A;  3MFK A;  1FBU A;  3NAR A;  5FKK A;  4L5I A;  5FGM A;  3D1N I;  5TRD A;  3FZV A;  3FKI J;  2K9N A;  1VZ0 A;  2EV0 A;  2M4K A;  3IL2 A;  4J01 A;  1V3F A;  5C4X J;  3OYJ A;  1RPW A;  3FXL A;  1GT0 C;  4CXF A;  2VAS A;  2DMU A;  2KZG A;  3GZ6 A;  4UV9 A;  4G7Z F;  4RMN A;  1BR2 A;  4OIO F;  1EH8 A;  1I39 A;  3ABM H;  2O9L A;  3LA2 A;  4UXN A;  2PMZ A;  2DJI A;  4II2 A;  2I8D A;  2A5W A;  3KZI C;  3U1K A;  2WAD A;  3FMQ A;  2RRE A;  3K1N A;  2QF7 A;  2PJR B;  3RJP A;  3NWS A;  2G7H A;  3KP3 A;  4DYQ A;  2KT0 A;  4P96 A;  2ADU A;  3MKW B;  2IS2 A;  5L3D A;  2JPC A;  3HDD A;  1LFB A;  1SD4 A;  2Z3Y A;  3JCU C;  4V2F A;  4C3H J;  1TWF J;  1VQO I;  5L3F A;  2EA2 A;  1YFH A;  2VKE A;  2P5L C;  2F2E A;  5DV5 A;  4HG2 A;  2ZXH A;  2I5U A;  3J81 K;  4BNC A;  3JRH A;  5D8L B;  2DOE A;  1O3Q A;  4MTD A;  2EK5 A;  3S2D J;  5B1A H;  3HHG A;  5F6F A;  3CES A;  1LQ1 A;  4C2M J;  4ITV A;  4RAZ A;  1LDJ A;  5D8K B;  3H0G J;  2GA1 A;  3SYT A;  4R79 A;  3F22 A;  2XRL A;  1MMD A;  4CCN A;  2PX9 A;  5LLQ A;  2HOT A;  3M8J A;  4XMY A;  2VBX A;  3SZT A;  2NVY J;  5TJJ A;  2IBD A;  2QKL B;  5D5U B;  2OTL I;  2NS0 A;  4M73 A;  4PFO A;  3J80 K;  1H88 C;  1FSH A;  1Y8Q B;  1X1B A;  4BS9 A;  1XC5 A;  1YQA A;  2DAO A;  4M3D A;  1IRX A;  2X6O A;  2FXA A;  5K5O A;  1WPK A;  4BDY A;  3CCJ I;  4RLF A;  1UB9 A;  2DK5 A;  2GLO A;  2IA0 A;  1FWZ A;  1WH5 A;  2FOW A;  3OOU A;  1U5T A;  4P9F A;  1JHF A;  3H5N A;  3IHU A;  2PQ8 A;  2OC6 A;  1E3O C;  5CVV A;  4Y15 A;  5EEH A;  2NS7 A;  3GXO A;  4NC6 A;  2R7S A;  2XAJ A;  1LJ9 A;  3LAP A;  2DXI A;  2P6T A;  2LF8 A;  2HDC A;  3K70 D;  5KAF C;  1FEX A;  1WHU A;  3PNV A;  3QOE A;  3BG7 A;  1D1B A;  4UV8 A;  4L18 B;  4AWX B;  2ELJ A;  3A0B C;  4MHG A;  5IT3 A;  1A04 A;  2AS5 F;  3U21 A;  2W85 A;  1P7I A;  2IGM A;  3LSI A;  3SZG A;  1FOK A;  3VYU B;  4OWR B;  2GBY A;  1G59 A;  2VE8 A;  4KMF A;  2DJN A;  4R1H A;  2XGD A;  3OYL A;  3B6C A;  1TZL A;  3HOX J;  2ID3 A;  2CFO A;  1ZQ3 P;  4M6Y A;  2HOE A;  2JJ7 A;  1K6O A;  2LVS A;  4FE7 A;  5E20 A;  1YJN I;  1MND A;  1T6S A;  4N4O B;  2K40 A;  4XLH A;  2XGC A;  1D8K A;  2HKX A;  3WG9 A;  4A3G J;  1IUF A;  2YPR A;  3R0J A;  3I56 I;  2XB0 X;  2BYV E;  4IX7 A;  5GPA A;  1J9I A;  3A03 A;  2GWR A;  5AON A;  2JRT A;  5FD6 A;  4F52 A;  1B8I A;  5FFZ A;  1JHH A;  4F91 B;  1J75 A;  4UY8 I;  2X6X A;  2Q2E A;  2FX0 A;  1HXD A;  1W36 D;  2EFN A;  2EA4 A;  4P1W A;  4D9J A;  1P2F A;  4ZH4 F;  3M1E A;  2WWY A;  3ONQ A;  4IOA F;  2W57 A;  3C2G A;  4F3Q A;  1XGM A;  3OR2 C;  1IZ1 A;  3S93 A;  4HF1 A;  5CVI A;  2MW8 A;  1BL0 A;  4NNJ A;  3BR3 A;  1UZC A;  3O3K A;  4P55 A;  1MIJ A;  5GAH J;  2OU2 A;  4JYK A;  2KKO A;  4BEH A;  4U0Y A;  1YRN A;  4A3D J;  4FT8 A;  5DYM A;  3GFJ A;  4RGR A;  2DA5 A;  1PP8 F;  1K78 A;  2PI0 A;  1ZG3 A;  1Z67 A;  4I98 B;  2JA7 J;  3P5J A;  2STW A;  1CF7 A;  1HKQ A;  2MC4 A;  4F55 A;  2QZ8 A;  2UXX A;  2DT7 B;  2V1N A;  4XL9 A;  4BHP A;  2W25 A;  4OIN F;  3IC7 A;  2LC2 A;  2V4J C;  2H8W A;  2VQL A;  3DPT A;  1I3A A;  3BG5 A;  2CSO A;  4L5J A;  2R7R A;  1RI7 A;  3IUO A;  2LRD A;  3EET A;  4BH9 A;  3QOP A;  4ZZL A;  5HNH A;  2HWV A;  2FU4 A;  5DCM A;  1U6G A;  4LLN A;  4D1Q A;  2XRO A;  3BY6 A;  4Y3O A;  1B9M A;  5ED4 A;  5GAD J;  2GQQ A;  1TTY A;  1X3U A;  3CJR B;  3QPT A;  3WGG A;  4FE4 A;  3R4K A;  2XAQ A;  2ZXW H;  2L01 A;  2DT5 A;  2ID6 A;  2OQG A;  3RKY A;  1JTX A;  5J4Y A;  4GGG A;  4JX6 A;  4LG0 A;  1IXR C;  1KU3 A;  3T1B A;  4CDG A;  1GXQ A;  1TT0 A;  3AG3 H;  5K7Z A;  2MLK A;  2QGU A;  2YSR A;  4ZC3 A;  1I1S A;  2MH2 A;  1YS6 A;  1F43 A;  1P6R A;  4Z2Y A;  1HDP A;  2XGE A;  1FBQ A;  3BTC A;  1PJR A;  4IVN A;  1WH7 A;  3TO9 A;  1YJ9 I;  1W1W E;  3MMY B;  2BY2 A;  5HLI A;  2HVS A;  1FP2 A;  3LFK A;  3FXK A;  1RET A;  3LSK A;  4BJ6 C;  1FIP A;  3GME A;  4BQQ A;  3JRG A;  1KU2 A;  3RQ4 A;  1R22 A;  2M0C A;  2K3F A;  5IPA A;  4EJW A;  1SFK A;  4LD5 A;  5F27 A;  2X1E A;  1HF0 A;  5F64 A;  1ZH5 A;  3TW7 A;  3N97 A;  3Q0U A;  2ZXI A;  2OZ6 A;  2DMN A;  3BR1 A;  4Y7N J;  4KYW A;  1SD7 A;  4PUS A;  3QYE A;  3G6E I;  1EF4 A;  2IPQ X;  2ZME C;  2DQL A;  3JSO A;  3BZC A;  3KYD B;  3GFL A;  4WX9 A;  1F5T A;  1BI3 A;  3CP2 A;  3ZCO A;  2DMP A;  2WC2 A;  3VSL A;  3PQJ A;  1ZGA A;  3BR6 A;  1F1Z A;  5GTH C;  1HC8 A;  3CCV I;  3RQI A;  1FNN A;  2UXN A;  4XKC A;  4YFN F;  3OL3 A;  3KP6 A;  2C6Y A;  3ZQG A;  1S29 A;  3RKX A;  3VWB A;  4HNT A;  3TMO A;  5FO5 A;  1LE8 A;  1YTY A;  1H8A C;  3CQZ J;  2IS6 A;  3H9G A;  2ZJR F;  5EZH A;  4C2U A;  1IO2 A;  3IWF A;  3CUQ C;  4FTH A;  2DFF A;  4BYY A;  1MSF C;  1IN5 A;  1SD6 A;  1BW6 A;  3WTX C;  2MLG A;  3CUO A;  2FQ4 A;  2VL8 A;  2HOS A;  1IRF A;  4RM2 A;  1IXC A;  3Q9V A;  4LK0 F;  4KN4 X;  2CYY A;  1XCB A;  3F0C A;  3HSF A;  3G1O A;  3K1P A;  2G0E A;  4IRI A;  2JTV A;  2BY1 A;  1Z6T A;  3CC7 I;  1BI2 A;  4IHW A;  1SAX A;  3WE2 A;  4LGW A;  5IT9 K;  1Z3X A;  3F8B A;  1MD0 A;  2DLL A;  3ZQI A;  5H6Q A;  1T38 A;  3REO A;  3HSR A;  4DYR A;  2HPI A;  3G71 I;  5M3F J;  1WI9 A;  3GTM J;  3PIP F;  3E6C C;  1T33 A;  4L9J A;  3HC7 A;  4KIS A;  4PJL A;  2VN2 A;  2P7V B;  3LMM A;  2VC1 A;  5D5V B;  2VC0 A;  3S3O A;  2X6W A;  1L0O C;  1Y1W J;  5M5X J;  3QPL A;  1QGP A;  3PUB A;  5LBQ A;  1UJ8 A;  3CLQ A;  5K7H A;  2VT3 A;  3LL7 A;  2M87 A;  2HTJ A;  5H6R A;  2LY9 A;  3VOD A;  4A5N A;  4RLQ A;  1U5T B;  3T8T A;  4BY7 J;  5ILU A;  2ISZ A;  3FHZ A;  4MTE A;  4FX4 A;  1S7A A;  1T2K A;  2N8G A;  2BVL A;  3BCA A;  1FY7 A;  2ZC2 A;  3FMS A;  2FBK A;  2V9K A;  2YR2 A;  4IL6 C;  3H0D A;  2E60 A;  4ZYD A;  3EUK L;  2NRA C;  3DLA A;  3PO3 J;  3S3N A;  1MBF A;  1NG7 A;  3D5L A;  4Q4Z F;  3FXU A;  2BBY A;  1VQP I;  4A93 J;  1UG0 A;  4FET A;  2ELK A;  3OYM A;  1IN4 A;  2X51 A;  1VF9 A;  1JKQ C;  4UHT A;  2XF6 A;  4DGW B;  1S6L A;  1XD7 A;  2HQA A;  5B3S H;  2DW4 A;  1ZHF A;  1T56 A;  4HX7 A;  1XTA A;  4I01 A;  3CCY A;  3OMY A;  1E0E A;  1O3T A;  1W0U A;  2BVM A;  1RZ4 A;  3AG2 H;  1YX5 A;  3EUH C;  3MZY A;  3PSF A;  3JRI A;  2MD5 A;  3B73 A;  1DUX C;  3CF2 A;  1YW8 A;  2OCC H;  1DDN A;  1VQL I;  1I50 J;  3I64 A;  4UUT A;  1V54 H;  2VPR A;  1YOV B;  4FAS D;  1U3E M;  3RTR A;  4CCL A;  2V79 A;  3LQR A;  1B59 A;  3IH2 A;  5DTD A;  2STT A;  2YX4 A;  3FDY A;  4AD9 A;  5E8I A;  4Q5S F;  2R7T A;  4X6A J;  4PGH A;  1P4A A;  3OS0 A;  3H3V K;  2XV4 S;  2ZSI B;  2W4S A;  4IPA A;  3GF2 A;  1PYV A;  3U1D A;  1XSV A;  2HNH A;  3TP3 A;  2M30 A;  1SVL A;  5HLH A;  1B8I B;  2RVC A;  2VOP A;  2DOD A;  2JA2 A;  3RDI A;  4Y52 J;  2Q2E B;  4BJ5 C;  2FEZ A;  5LHH A;  4QLC U;  3HYI A;  4JBA A;  1SVM A;  1JKO C;  3M07 A;  2GOX B;  1DP7 P;  2VQG A;  5J6X A;  2EV6 A;  2YS9 A;  1KU7 A;  1Z91 A;  1A31 A;  3GTP J;  4LLL A;  1KQ9 A;  2JSP A;  4A2U A;  2DT6 A;  5FKM A;  2M5W A;  1MBK A;  4ENN A;  4A0Y A;  1WRJ A;  4BEH B;  2GIV A;  2WAF A;  4XLC A;  5CVU A;  3BZK A;  3HRT A;  2OPT A;  1XG1 A;  3GBG A;  1YRN B;  2QSG X;  3RI4 A;  2D1V A;  2R3S A;  2HQ5 A;  3I58 A;  1VQ6 I;  1K78 B;  1WWX A;  1P4W A;  2RNJ A;  1YX3 A;  2HU9 A;  5LGT A;  4MFE A;  1CF7 B;  2QQ9 A;  1N75 A;  2J5P A;  4PK4 A;  2EJR A;  4HAM A;  4CGZ A;  5M5W J;  4L9T A;  1YYV A;  4A3C J;  2LYC A;  5IP6 A;  1I1G A;  1MJB A;  3KP5 A;  4E7I A;  3OYG A;  3O2P E;  1IG7 A;  1BI1 A;  1ZRF A;  3VYS B;  1KA8 A;  2ZFU A;  5DCM B;  3JSP A;  3HEF A;  3COA C;  5CVR A;  1EV7 A;  2QM3 A;  1VQ5 I;  2NVQ J;  4HDV A;  1X58 A;  3ZQC A;  3K69 A;  1LDK B;  3I5U A;  3WG7 H;  5F0H A;  4XLE A;  3BP8 A;  1OJL A;  2W84 A;  4G12 A;  2L3D A;  4HST A;  2HQR A;  3BG9 A;  4XSX F;  1JE8 A;  1O57 A;  1W5S A;  3KP2 A;  4LG3 A;  2IS4 A;  2VT2 A;  2HZD A;  3MQ0 A;  3Q0V A;  1OFC X;  2K7L A;  4CZZ A;  4ZYG A;  4ZJZ A;  4LG0 B;  2V9P A;  3L2C A;  2H1K A;  2NS8 A;  5F0C A;  4MO7 A;  2R5Z A;  1R4N B;  3H3U A;  1VFC A;  4BAY A;  1U2W A;  2BW3 A;  3HL2 A;  2XSJ C;  1D5Y A;  5D5W B;  4JP0 A;  2AXL A;  2BHZ A;  4YFK F;  3C2B A;  4A3L J;  2KLO A;  5EYR A;  5J1R A;  2QUF A;  3E6D A;  3IKV A;  2ZJQ F;  4C30 A;  2RNG A;  1Y0N A;  4ZYE A;  1J0R A;  2O6G E;  3J7A O;  5ICF A;  3PNT A;  3ZQ7 A;  2IRF G;  1S3J A;  2W82 A;  2DPD A;  3S14 J;  3F6V A;  3ABK H;  4I7H A;  2XRN A;  1HW1 A;  1X1A A;  1S5L C;  2H1L A;  3J7Z I;  1QVU A;  3TBI A;  3LOC A;  4L0Z B;  1W5C C;  1TWH J;  5JR3 A;  2YUS A;  3G3Z A;  5LFA A;  4XOR A;  1M1E B;  3AKZ A;  2F4O B;  3HB9 A;  4G6T B;  1R5I D;  3E0J B;  3HXL A;  4CCK A;  4M71 A;  3DBH B;  5L3G A;  4A12 A;  2P5V A;  4M9S A;  3GO5 A;  1EH6 A;  4BHB A;  3DTK A;  3V7R A;  1DQU A;  4AYB N;  4H0E A;  9ANT A;  3L7W A;  1YE9 A;  2V7F A;  1SVO A;  3GLL A;  1ZLJ A;  2CU7 A;  2P0W A;  3IAS 2;  3KEO A;  1V5E A;  2EIJ H;  3AAF A;  4FIS A;  3FM5 A;  2HQN A;  4HLX A;  3CDL A;  3KX2 A;  3G73 A;  3DEW A;  3W2A A;  4NC7 A;  4XN0 A;  3V8J A;  3E5Q A;  4XN3 A;  2L9V A;  4QPQ A;  1W7P D;  3NWT A;  1WI3 A;  3F6O A;  3WE3 A;  2CQ7 A;  2MYS A;  3W6K B;  4DNC A;  3H35 A;  1LEA A;  1OYW A;  1X19 A;  5DM6 F;  3BR0 A;  2F5C A;  2G7U A;  1KGS A;  4XKV A;  3V8L A;  4HBL A;  1T95 A;  3HUG A;  1LE8 B;  4B48 A;  4CZC A;  1VQ8 I;  1I5Z A;  4JX4 A;  1R23 A;  2V1D A;  3CCU I;  1FX7 A;  4B3X A;  2E1O A;  5KVR A;  1TQM A;  1OPC A;  3K4B A;  3KIO A;  4RS8 A;  4AYB A;  3LSG A;  4BQA A;  2A05 A;  3SDG A;  1S7O A;  1RES A;  2P5K A;  2HR3 A;  4RAY A;  2M1B A;  4NB5 A;  1K83 J;  3LSH A;  3UR3 C;  4DW6 A;  4BBR J;  3H3Z A;  2XAG A;  4BL0 B;  1JT6 A;  3BPX A;  3BCB A;  5HDK A;  1IN8 A;  4HRI A;  3M7G A;  2PMZ N;  2MD0 A;  2HPM A;  2LY2 A;  2M8E A;  5B5E C;  2XPV A;  3V7C A;  4I02 A;  4PJN A;  1D0Y A;  2VUM J;  1VTN C;  5H2F C;  3HBL A;  2XDV A;  4AVZ A;  4B43 A;  3BR5 A;  4YG2 F;  1R5H A;  1XB4 A;  3FM3 A;  2L7Z A;  1RUO A;  1Z7U A;  4MEX F;  2E1M B;  5LRR A;  3I4N J;  1EA3 A;  2JT1 A;  2L7M P;  4E7L A;  1BW5 A;  4I99 C;  2E1C A;  1Z77 A;  2IW5 A;  3F21 A;  4HW0 A;  2KIM A;  2WAQ A;  3CME I;  1UHS A;  1LPQ A;  1QZY A;  3HG9 A;  2O8X A;  3WU2 C;  3H5A A;  4GFB A;  4RBO A;  5DD8 A;  5L3B A;  4WXH A;  3KEY A;  5L3C A;  1WGX A;  5FJ8 J;  2BHY A;  1Y56 A;  3TKY A;  2OD5 A;  3KP7 A;  3JRB A;  3ZQH A;  2P6S A;  2KPM A;  2DCE A;  2KIQ A;  3TL4 X;  2IS1 A;  2QSF X;  3ZQL A;  3L2W A;  4ANJ A;  4N0B A;  1OR7 A;  1W7P A;  1XS9 A;  3L09 A;  3JR9 A;  3OYE A;  4XON A;  1ETV A;  1J5Y A;  5D6E A;  3HKZ A;  2Y0M A;  4M74 A;  3GZ5 A;  1ORK A;  5EJC A;  1JGG A;  1KU9 A;  4KT6 A;  3OY9 A;  4UUS A;  1TQP A;  4MQV A;  4XBF A;  4X0G A;  2NVX J;  4WF2 A;  2NOJ B;  1AWC A;  3KLN A;  5HOD A;  2VE9 A;  3SDB A;  1KYZ A;  4Y17 A;  4EM2 A;  1R71 A;  3S8P A;  2WB1 N;  4KA4 A;  2LLK A;  3BLY A;  3WTU C;  4KIB A;  2CFX A;  1WJC A;  2TRT A;  1DPR A;  1OLT A;  1BI0 A;  2L9N A;  1HDD C;  2XB5 A;  4FHT A;  2O61 A;  4CUG A;  4WWC A;  2EIL H;  3SEQ A;  2EPF A;  2K85 A;  3A01 A;  2XAU A;  2FQ3 A;  2KZV A;  1USS A;  2BV6 A;  5DEQ A;  1A36 A;  4OMY A;  4N9H A;  2Q8K A;  4E7J A;  1XGN A;  2COB A;  3TGN A;  1T39 A;  2R5Y A;  1IDY A;  2FE3 A;  3F72 A;  3M8E A;  1X1P A;  2CUF A;  3F8M A;  5KAI C;  2LTP A;  5K7F A;  1ZTR A;  1ZEL A;  3L1P A;  2A6E F;  1E3H A;  1OCZ H;  3MAJ A;  5DDG A;  3S3M A;  4EJU A;  2HI3 A;  1MKM A;  4RAF A;  1WKM A;  4PDK A;  5HS7 A;  2CW7 A;  1QA6 A;  1WJF A;  1HCR A;  5HLG A;  4MFD A;  2WB1 A;  3DFG A;  2EB7 A;  1ENH A;  1XMK A;  5DM7 F;  1NG6 A;  3CCM I;  1XDU A;  1Z9C A;  5BPI A;  5JFR A;  1FMW A;  3ROU A;  2LD5 A;  1QZZ A;  2KL4 A;  4IO9 F;  1GV5 A;  2NYX A;  1LVK A;  3HZJ A;  1F4K A;  4NQW A;  2NVU B;  2JQ7 A;  1ODD A;  2M7B A;  4AVP A;  2GOM A;  3HPG A;  3RKQ A;  2CV1 A;  1H0M A;  1Z7L A;  3A1Y A;  2OAZ A;  1S72 I;  1SFO J;  1OYY A;  1MW7 A;  4RM3 A;  2LBF A;  3HOW J;  3LSR A;  3WHB A;  3WTZ A;  4HZF A;  1NTC A;  1MH3 A;  5JVT A;  2L5Q A;  4AU7 A;  2R5Z B;  5FKL A;  3DKY A;  1U8R A;  2KHM A;  5JHU A;  2BW3 B;  1BR4 A;  2L7F P;  2HOA A;  1POG A;  3OWT A;  1Z6R A;  5CPR B;  3Q3S A;  3GYH X;  3KFW X;  4OU0 A;  2DI3 A;  2XC7 A;  5F04 A;  4HLY A;  5FLM J;  5LHG A;  1FLI A;  4BY1 J;  4RGX A;  2LH9 A;  5F1J A;  4ETS A;  2D2W A;  5HOO A;  3OOP A;  2PMU A;  4BAC A;  1MSE C;  2CQQ A;  1TC3 C;  2GXB A;  2UWM A;  3DWL E;  2M8G X;  2CRG A;  4R8H A;  1TWA J;  3LA3 A;  3DLL F;  2NNY A;  2GZW A;  2VBY A;  2X6Y A;  3AL0 B;  5E18 F;  2DOA A;  3W2W A;  1MMA A;  3S1M J;  1HA8 A;  4M9Z A;  3TED A;  1MJ9 A;  4XOP A;  2QWW A;  5HS9 A;  4OIR F;  4M6V A;  4XSZ F;  5CQE A;  3KLO A;  1EH7 A;  1XSX A;  2ZBK A;  4A3E J;  2HYJ A;  2P7C B;  1JUS A;  1WJB A;  1XMA A;  2IXS A;  1YIO A;  3K4K A;  5EGO A;  3FMR A;  3DV8 A;  1ZR4 A;  4DIQ A;  3ELK A;  4S05 A;  2EZK A;  3PJR A;  4HV5 A;  1LKX A;  4O3M A;  5LGU A;  1YI2 I;  2O7O A;  1X2M A;  1H9G A;  1TNT A;  4G7O F;  2M0M A;  5DS9 A;  1R4M B;  3RPQ A;  3NEU A;  4IHX A;  4OIP F;  1YLF A;  3HUG B;  1T0F A;  1IN6 A;  5DUK A;  2DMT A;  2FSW A;  2KFD A;  1RKW A;  3S32 A;  3DU5 A;  4HNU A;  4NHJ A;  2PJP A;  2KRC A;  2OBP A;  1YG2 A;  3QPS A;  5DCF A;  1Y39 A;  4WXC A;  2FNP A;  5IP7 J;  1KQ0 A;  1SAN A;  1OKR A;  4C3J J;  4D7N A;  4GYI A;  3ML6 A;  4BKX A;  1S8N A;  3R6S A;  4IHY A;  1RR7 A;  1JI8 A;  5E1Z B;  1BJA A;  2VBW A;  3RKW A;  5EEA A;  2Y75 A;  3E3V A;  2JRM A;  2EH3 A;  3K1M A;  3VYR B;  2JA8 J;  3H5R A;  1GVD A;  3FF5 A;  1FPQ A;  4IJA A;  3T0Y A;  1SFX A;  4E7S A;  2ZXJ A;  2XPU A;  3ZP5 A;  1AKH A;  1KON A;  3PO2 J;  3MN2 A;  4NC8 A;  1FP1 D;  1BR1 A;  4ZDO A;  2W00 A;  3PM1 A;  3DPU A;  4CYC A;  2K02 A;  1ONV A;  4LK1 F;  1EJ9 A;  1U5T C;  2F48 A;  3DKX A;  2MSY A;  3FBN B;  2KMU A;  2QBY A;  2VLA A;  4I2O A;  5M5Y J;  1APL C;  1GXP A;  1B6A A;  4IKF A;  2CV0 A;  3JW4 A;  1J09 A;  3PFI A;  5LEK A;  2KP6 A;  4B3A A;  4XIC A;  3LNQ A;  2V6C A;  3OS1 A;  2QEN A;  1B72 A;  2XIG A;  4W1U A;  4LB5 A;  3DQV C;  4QIW N;  3A2K A;  1A6Q A;  4XKW A;  2R0Q C;  2IP2 A;  2JVG A;  3WTV C;  3DBR B;  2B9S A;  1P4X A;  2L9S A;  4KDP A;  1D8J A;  2Y2Z A;  3QU6 A;  4M6X A;  2MG4 A;  5LHI A;  2PLY A;  3OYI A;  3K0L A;  4YEL A;  3M1C A;  3CC2 I;  2IA1 A;  1R36 A;  2WAE A;  3SXY A;  2MH9 A;  2E34 A;  3ABL H;  5JI6 A;  3C2H A;  3OS2 A;  1ZR2 A;  1NH3 A;  5EG0 A;  1E3P A;  2GA2 A;  4B1R A;  2V1U A;  1W7P B;  2DN0 A;  5E3L A;  4YIF A;  1YS7 A;  1ETX A;  3EYY A;  2H09 A;  1W0T A;  4HQM A;  4EVI A;  2CJJ A;  3B6A A;  4OAZ A;  3DCF A;  2DO7 A;  2X1D A;  2V6E A;  5HDN A;  5HVQ C;  4CO8 A;  3F23 A;  2XGX A;  4M9X A;  4ZTF A;  1R00 A;  1FC3 A;  1WFX A;  1SFE A;  3CMY A;  3F8F A;  3OR1 C;  4EGY A;  3HOS A;  3HOY J;  4UVA A;  1YIJ I;  3IV5 A;  2VON A;  1YW7 A;  1UHW A;  1ON2 A;  4EM0 B;  1U9N A;  2QVO A;  2XKP A;  3WU0 A;  5EDN A;  1VQ4 I;  1K4T A;  4KIG A;  2K4J A;  3A01 B;  4I6Z A;  5D5X B;  3OYF A;  1QPM A;  3JRC A;  3BJA A;  4XRF A;  1QU3 A;  4BU2 A;  4XKB A;  1R49 A;  1FBS A;  1EKE A;  2R5Y B;  2CMP A;  4F93 B;  1MBE A;  2X85 A;  2IGK A;  4IRG A;  1IC8 A;  1BIA A;  3QP6 A;  4CA0 A;  4A3J J;  3O6B B;  1D0Z A;  2MAB A;  2UZK A;  4KFC A;  4BXF A;  3KZY A;  4D5F A;  4PJJ A;  1FZP B;  3F8N A;  2KIS A;  2MC3 A;  1JJ6 C;  1ITY A;  3MKL A;  2KJB A;  2L4A A;  3SFZ A;  5J3L A;  2M2E A;  1YO5 C;  2EFO A;  1QHG A;  4A3I J;  2OZU A;  1O3R A;  4EGZ A;  5BS6 A;  1ZAR A;  2CQK A;  1T8I A;  2P8T A;  1BA5 A;  2L0K A;  2Z5U A;  4NBQ A;  2LDU A;  2QLZ A;  2XAF A;  3F8C A;  3IH4 A;  2O0Y A;  4PSW A;  1OIS A;  5J4V A;  3K70 C;  5ICC A;  2UV1 A;  4PJM A;  4NQW B;  4L9V A;  3GEZ A;  2DDB A;  2WY8 Q;  1OYI A;  3HSE A;  2WTE A;  5GTI C;  4UNO A;  2LR8 A;  1QQI A;  2W7N A;  1PUF A;  1D1A A;  3W3C A;  1TLH B;  5FKO A;  2ICW G;  1FYL A;  1GDT A;  1DP3 A;  2VI6 A;  3DTI A;  2LBF B;  5F08 A;  3ZMD A;  1R6R A;  3I9V 2;  4B09 A;  3I71 A;  5E3O A;  1CGP A;  2B7E A;  1OQY A;  3BQZ A;  4MIM A;  4JOM A;  3ASO H;  1X3Z B;  2F5F A;  3FXJ A;  1SEU A;  4I76 A;  5CVJ A;  4ZYH A;  2PFB A;  2CWE A;  4BE1 A;  3J81 Z;  4HEA 2;  2M4G A;  3ERE D;  2LK2 A;  5D6F A;  2W1O A;  2FBI A;  5J47 A;  3CCS I;  2K9S A;  3LFU A;  1TBX A;  4ABZ A;  2W24 A;  1IW7 F;  1X3W B;  3ZRG A;  4A6E A;  3OIQ A;  1W36 C;  2KRH A;  1UHM A;  1FOY A;  4MQ9 F;  1HSJ A;  2VPL A;  1PDN C;  1I27 A;  3N05 A;  2ECB A;  1XPX A;  1TT5 B;  1IF1 A;  5J8C A;  1RNL A;  2FRH A;  4YIR X;  2WV1 A;  4RB1 A;  2R7U A;  3J80 Z;  4O6J A;  4BE2 A;  3HJE A;  2HXI A;  1REP C;  3M4O J;  1YW9 A;  2BY3 A;  4B4C A;  2FF4 A;  1VQ7 I;  5A2Q Z;  2K9Q A;  2DK8 A;  3CC4 I;  1ZRD A;  4EJV A;  3TOB A;  4EEF G;  4GXO A;  3R0A A;  4C3I J;  5AIQ A;  2COM A;  3EYI A;  3JTG A;  3VEP A;  4B44 A;  3CO7 C;  3GCM A;  3BRO A;  1ETO A;  4YII A;  3OYA A;  5EGO B;  2DFI A;  3DP7 A;  4KMU X;  1R1V A;  5KK1 A;  3HPH A;  1R9T J;  2XKO A;  2YU3 A;  4ASN A;  2X4H A;  4Z6Y A;  1K7A A;  2M7A A;  2XAH A;  5FLV A;  1OCO H;  5HS8 A;  2Z1D A;  3GUD A;  1Z05 A;  4G94 A;  1P7J A;  3H36 A;  2JVH A;  3D5R C;  1YIT I;  4BQN A;  5E8G A;  1VQN I;  2ZSH B;  4E4H A;  1J2X A;  3DEE A;  2ZB9 A;  2WV0 A;  3ECH A;  3ZMZ A;  4DBQ A;  3E1S A;  2V1X A;  2ECC A;  5LEJ A;  3T5X A;  4EMS A;  2DA7 A;  1O4X A;  1NHA A;  1ON1 A;  3S1N J;  4AC0 A;  2OCE A;  1FOX A;  1STZ A;  2LP0 A;  3V4G A;  5BNG A;  1TWG J;  3QU3 A;  4E7Z A;  2VKD A;  1DGW Y;  1ZAO A;  1WJD A;  4CH7 A;  3HRU A;  4M3G A;  4ZTJ A;  2VOD A;  5DUI A;  1D3Y A;  2RV8 A;  4YRV A;  3FK7 A;  4XRS G;  4XR6 A;  2Y69 H;  3IRQ A;  4IQJ A;  4Y33 A;  5J40 A;  5FB2 A;  5BOX A;  4M3B A;  3KET A;  2E1N A;  3H92 A;  1FYM A;  1BJZ A;  3CDH A;  3IWZ A;  2QYO A;  2DA3 A;  1A6I A;  2JSC A;  4V19 K;  4AID A;  5FRO A;  3HIF A;  2Y0S N;  1AKH B;  3VB2 A;  3LSJ A;  4HOB A;  2F5D A;  5E1W A;  2E1M C;  2HDD A;  1JUM A;  2JN6 A;  2OUM A;  4CYD A;  5H20 A;  2ELH A;  1YHQ I;  1ETK A;  4LLG F;  2QBY B;  4GO1 A;  2DFH A;  1RUN A;  2LY1 A;  2R7Z J;  2JMW A;  4BQO A;  4HYE A;  4KUM A;  5C4J J;  3HOZ J;  4I0B A;  5CQG A;  2L02 A;  3J7Y J;  1A35 A;  1FMV A;  5K5R A;  3KYC B;  2QA4 I;  2XAS A;  2ISY A;  3HOV J;  2EWN A;  5C44 J;  2BZT A;  2Y48 A;  2M34 A;  2E2H J;  3V42 A;  1OCR H;  4HNV A;  1B72 B;  2HTS A;  2JZY A;  1FYK A;  3ZGK A;  3TO6 A;  3DU6 A;  3KCC A;  3RPU D;  4W97 A;  4HF2 A;  2M3A A;  1MJA A;  4YFX F;  1B1B A;  1ERD A;  1F36 A;  1SAU A;  4HA8 A;  1BIB A;  1D0X A;  3CCL I;  3S2H J;  3OYN A;  1O3S A;  2Y0S A;  1MBG A;  3LSM A;  2K9M A;  2ZO4 A;  2NVT J;  2R7O A;  3DF8 A;  2CS3 A;  2W48 A;  1LFP A;  4CIC A;  5EF6 A;  3CJQ B;  3K4J A;  4HDU A;  2CQX A;  3C18 A;  3QYB A;  4IXA A;  1WJA A;  5EG0 B;  1ACI A;  1ZRE A;  2GXG A;  4XLA A;  3W2V A;  5IOY A;  4A0X A;  1I6X A;  3PUF A;  5EEG A;  4OOI A;  3JRD A;  2FBH A;  2E71 A;  4M72 A;  2DDA A;  1VQ9 I;  4U87 A;  1ZRC A;  3ULQ B;  1ZYR F;  2Y9Z A;  5CJ9 A;  2K27 A;  2H27 A;  4RA2 A;  1TWC J;  2R7W A;  3OV8 A;  3BT9 A;  2Z16 A;  3GTL J;  2ME6 A;  3EPZ A;  5HLT A;  2WAQ N;  4U7B A;  1IV8 A;  2VJ4 A;  1DU6 A;  1G8X A;  2VJ5 A;  3ZMV A;  4H4K C;  1QNT A;  3HTU A;  3E5U A;  4AUX A;  3VDX A;  1RKT A;  1IN7 A;  3BG6 A;  1P9Q C;  3ISP A;  4S0H B;  3GZN B;  3MZH A;  1K61 A;  1JUP A;  3FHN A;  4TV7 A;  3A02 A;  2L4M A;  4J00 A;  1IJW C;  2DPU A;  2Q1Z B;  1MBJ A;  5GP9 A;  4AIK A;  3OYH A;  1HOM A;  2J5O A;  3CCQ I;  3ZPL A;  1G3S A;  4PZJ A;  4Y4R A;  2VJI A;  3HTS B;  4AIJ A;  3IP4 B;  3UNG C;  2JUC A;  2E5Z A;  2HYG D;  2XSD C;  1E2X A;  5K1Y A;  3FXQ A;  1XCV A;  4GRI A;  3R60 A;  2K3P A;  2PEX A;  4U0W A;  4ENM A;  4GCV A;  2O5R A;  3HKZ N;  5D4S A;  1V4R A;  2EZH A;  3TDZ C;  5E3N A;  2ZJP F;  1G3Y A;  3QQA A;  2JPB A;  2KJC A;  1V5G A;  1S7E A;  2D1H A;  2QQB A;  1ZG1 A;  4ZYA A;  2B0L A;  3I53 A;  4QWQ A;  2TCT A;  5K5Q A;  2HS5 A;  1FTZ A;  3P9I A;  3K2A A;  2OA4 A;  4DOZ A;  4RGU A;  1XDS A;  4M3E A;  2CV2 A;  2O3F A;  1Y8R B;  1MMN A;  2MBF A;  2ESH A;  3HM5 A;  3JRF A;  2LFB A;  3FWE A;  1JKP C;  3BC8 A;  2O03 A;  1HW5 A;  2DTR A;  3RPU A;  4DBR A;  3OYD A;  3K6G A;  2R7F A;  4U88 A;  1PUF B;  4HF0 A;  3G4S I;  1OMI A;  1A5J A;  4QPO A;  3ZMU A;  1SMY F;  2A6H F;  3H9Q A;  2GM4 A;  2X48 A;  1FIA A;  2IVM A;  4IEJ A;  2EZI A;  1Z0X A;  1TNS A;  4JX5 A;  1G3T A;  2MFZ A;  4ESJ A;  2ZFW A;  2GAU A;  1IV6 A;  4XLP F;  2KDZ A;  2RKH A;  4IHT A;  5HNF A;  3WTW C;  3M9A A;  2F5V A;  2OQR A;  5JLW A;  1ETY A;  2K86 A;  1P92 A;  4RGS A;  3I59 A;  4Y13 A;  1OCP A;  2R4G A;  3CO6 C;  3CZ6 A;  4MNU A;  4IHS A;  3U9G A;  1U9O A;  2FMY A;  3VFZ A;  3DPL C;  3BZ6 A;  1BN5 A;  2DA6 A;  4EV0 A;  3K4M A;  1L3L A;  1BC8 C;  2A69 F;  3WTT C;  1X1C A;  3AL0 C;  5C3E J;  3S17 J;  2E7X A;  2IA2 A;  2IT0 A;  2E2I J;  2E7W A;  2P81 A;  3OIP A;  3OL4 A;  2M9H A;  4PJ0 C;  3LSP A;  5IT9 Z;  2X9D A;  3KYL A;  4PFP A;  1RR8 C;  1X4P A;  2BXZ A;  2VJJ A;  1ZLK A;  1IRG A;  3TW6 A;  1FTT A;  3OYB A;  5IP9 J;  2A6T A;  3I55 I;  3ESW B;  1MNE A;  1JKR C;  4QTR A;  3VSK A;  2PG4 A;  2HGC A;  3L2V A;  2D45 A;  2VXD A;  2LOO A;  3WOD F;  1MH4 A;  1HST A;  5KCM A;  4FQG A;  5EZG A;  3EQL F;  2M45 A;  3V7S A;  3ZR8 X;  2ZCW A;  3GLX A;  4N4N B;  3VOE A;  3C7J A;  3HOT A;  1QVT A;  5ERI A;  3PSI A;  4XRS A;  2A07 F;  2HEO A;  1U0J A;  4QSH A;  1B9N A;  4FX0 A;  5A2Q K;  1GUU A;  2K9L A;  4WK8 F;  5E79 C;  2VB6 A;  2LNB A;  3BOQ A;  4D0P A;  2BOL A;  4M3F A;  4ESB A;  3Q5F A;  2VIX A;  2F4I A;  3GTO J;  2BE5 F;  1MZB A;  2I10 A;  5F1R A;  4G6D A;  5CLS A;  1E17 A;  4ENJ A;  3QAH A;  1LB2 A;  4N9I A;  5IY5 H;  1O7L A;  2ESN A;  5J8F A;  2RQQ A;  5AIP A;  1LUJ B;  2DTZ A;  4II3 A;  4XK4 A;  1AU7 A;  3WU1 B;  4RB2 C;  3J7A Y;  5FD5 A;  1UG2 A;  3FXM A;  2VQC A;  1Y0U A;  2EIN H;  2BGC A;  2ZME A;  3DEU A;  3RYR A;  1XX5 A;  3W6V A;  4WXD A;  1JT0 A;  2CW8 A;  1FOW A;  3BTJ A;  4P9U A;  3E5X A;  2ZKZ A;  3NRV A;  1G3W A;  3CCE I;  2HDW A;  1QBJ A;  1WZ2 A;  4I0A A;  3S2W A;  3TOA A;  4F92 B;  4V2G A;  4IHV A;  4YEJ A;  5FKN A;  2Y31 A;  3DKW A;  1AHD P;  4LB6 B;  5CKT A;  5J1U A;  2VQH A;  1ULY A;  2OV7 A;  2DOF A;  1KYW A;  3BR2 A;  3BTI A;  4L5E A;  2CH0 A;  3MKY B;  1OCT C;  2XF7 A;  4ON0 A;  1PP7 U;  3OIO A;  3CUQ A;  1Z1D A;  2KQR A;  5JVG F;  3NQO A;  1R5G A;  3RCO A;  2IJL A;  4AM3 A;  3Q0W A;  2RQP A;  5BPD A;  3M8F A;  3H1C A;  4C2T A;  1GV2 A;  2RAE A;  4MEY F;  3OSF A;  4GDF A;  2A5Y B;  3PQK A;  5CYV A;  3HOU J;  3E6M A;  3K10 A;  4DZJ A;  2QQ8 A;  3BQY A;  2DQR A;  2DA2 A;  2EIM H;  3L2R A;  3PFY A;  3MKZ A;  1VND A;  3M3Y J;  1OR7 C;  2CGP A;  4BUP A;  3RYP A;  4Q48 A;  2EQR A;  4JQF A;  4G8X A;  1HKS A;  2IGN A;  2NOG A;  2QKM B;  3T8R A;  3LA7 A;  2D5V A;  4UB6 C;  1XGO A;  1QO0 D;  5ICE A;  1FT9 A;  3HGG A;  3KP4 A;  2XUB A;  1TW3 A;  2K4B A;  4UVB A;  1X4O A;  1VI0 A;  3A0H C;  4CCJ A;  5JHF A;  4I09 A;  4G6Q A;  1JXS A;  1BC7 C;  1TP4 A;  3V8K A;  5TGT A;  1WVR A;  2ZJ2 A;  3B02 A;  3TO7 A;  1TW2 A;  3D0S A;  2QEX I;  5J1Y A;  3K2Z A;  4X1E A;  3EUA A;  3QP5 A;  1Y1V J;  4DJA A;  3ASN H;  1KZH A;  3L9F A;  4U7D A;  4NUB A;  4UUV A;  2IAI A;  1BBY A;  4LIU A;  4XQF A;  2NNN A;  3CDI A;  1CQT A;  1NK2 P;  2IEK A;  1HQC A;  3EUH A;  3TDU C;  1YJW I;  3K7A J;  4A3K J;  2LKP A;  4J19 A;  2ZNY A;  4LFU A;  3ZQQ A;  1S9H A;  3JRE A;  1ZG5 A;  1ZN2 A;  3SEZ A;  3I0T A;  3MWM A;  1XMX A;  2GXA A;  3KEQ A;  3WTS C;  1IDZ A;  3MCZ A;  1FSE A;  3CMM A;  1H9T A;  1D5V A;  2VXZ A;  3GFI A;  1HBX G;  2Z9O A;  2PMH A;  1UFM A;  1MMG A;  2XHK A;  5BMZ A;  3JAM Z;  1BM9 A;  2FD5 A;  3G1L A;  3W6J B;  2FOK A;  2Z99 A;  3ZMS A;  1VQM I;  2ETH A;  1HLV A;  1R1T A;  3I4M J;  1R58 A;  4MGR A;  4WCG A;  3A4C A;  4E6K G;  5LRS A;  4GYG A;  1UMQ A;  4LJZ F;  2WBM A;  1UCR A;  3QOD A;  1U78 A;  1NK3 P;  1W5T A;  3CLO A;  2R7X A;  1IRZ A;  1MDM A;  3SFI A;  4IQ4 A;  1AOY A;  3TP0 A;  5KHD A;  5B66 C;  3GVA A;  4IF4 A;  3DXJ F;  4ZDL A;  4A0Z A;  2OJE D;  5JLX A;  2EFP A;  1W4M A;  4CSW A;  3GTQ J;  4ESF A;  5FLX Z;  4UUS B;  5LD2 C;  4KIC A;  2CG4 A;  1PVE A;  2DA1 A;  4HX8 A;  3E6B A;  2ME0 A;  3L2U A;  4D7M A;  4KJZ A;  2F4M B;  1G6N A;  4MLO A;  1DGR M;  1U8B A;  4LOC A;  3I59 B;  1I6H J;  3LQQ A;  3BWG A;  2EBI A;  1ETW A;  2KRF A;  2YX7 A;  4E7K A;  4C9Y A;  1IGN A;  5FFX A;  4KIF A;  1OCC H;  4G9Y A;  3GTG J;  4XLF A;  3F3X A;  2XF5 A;  1XSD A;  1N78 A;  3ABT A;  3MEX A;  4XID A;  2AO9 A;  1X2N A;  2FA5 A;  2FML A;  3ZXS A;  4L0Y B;  1TQI A;  4OAY A;  4ZDP A;  2LKX A;  3MZ8 A;  2H6B A;  4XNF A;  5D4R A;  3OSG A;  3CD6 I;  1V5F A;  2PN6 A;  3TQN A;  2MA3 A;  1WSU A;  4DQ2 A;  4CHU A;  5FRN A;  1JGS A;  4LMY A;  5BQT A;  3PIO F;  3HRM A;  4ENK A;  4A6D A;  3RZO J;  3QRF F;  2F5E A;  1GLN A;  3GFM A;  2AHQ A;  3WHC A;  3AFH A;  1WCM J;  2KIF A;  3FIW A;  3QWL A;  4PCQ A;  1QRY A;  2WY7 Q;  1WJE A;  4LIV A;  1QZE A;  3RIR A;  4BE0 A;  2E2J J;  1T0F C;  3CJN A;  3KE2 A;  3BJO A;  4B8X A;  4O5V A;  2H6C A;  3ABU A;  3JTH A;  4AIH A;  2L7K A;  4FCY A;  4IRH A;  2VBZ A;  1ZGW A;  5E3M A;  3N4M A;  2CUJ A;  2G9W A;  3I4P A;  3G2B A;  4HPQ A;  2ZNZ A;  3I3L A;  1JJ8 C;  2R7D A;  4RAG A;  1MMS A;  2A68 F;  4CCM A;  2TDX A;  4KN7 X;  2Q0O A;  3PL8 A;  2EV5 A;  3O8G A;  2ZME B;  3SZP A;  2CUE A;  1LDD A;  3ZOB A;  1G4D A;  2DA4 A;  2E36 A;  1MGT A;  2PJR A;  1V55 H;  5DD4 A;  3P7N A;  4K2E A;  2HVQ A;  2HZT A;  1ZKG A;  5E17 F;  3QPH A;  2FUG 2;  1VQK I;  1T08 B;  3ZMT A;  3GWZ A;  2E19 A;  3BPV A;  2VKH A;  2HYF A;  3MD2 A;  3P9C A;  2H8R A;  2GIZ A;  1R7J A;  2ACJ A;  2X0L A;  3E97 A;  4HQE A;  4RB0 A;  3IH3 A;  4B47 A;  2JA5 J;  1RC9 A;  1F9N A;  2HKO A;  2LF7 A;  2DU9 A;  2Y9Y A;  1Y6I A;  3CUQ B;  3NAU A;  1T98 A;  2O8K A;  4EJO A;  1DPU A;  4OMZ A;  5IYB J;  2Y30 A;  2BY0 A;  1O7F A;  2EZL A;  2LG4 A;  2NXN B;  2QCO A;  3AG4 H;  3P9K A;  1Z21 A;  4A69 C;  4BXU A;  4DZP A;  3HGY A;  2P4W A;  5HDG A;  3GX4 X;  5FRM A;  3WTY C;  2DYR H;  4NDL A;  3ZN1 A;  3IKT A;  1ZGJ A;  2AXT C;  5IOZ A;  2CUZ A;  1N25 A;  2EFQ A;  4DYC A;  4HSR A;  2E35 A;  2YU9 J;  3AG1 H;  3BDD A;  2QQA A;  2UUZ A;  2X1C A;  3K9T A;  4G7H F;  1SFU A;  1GVJ A;  1UST A;  1MBH A;  2AQF A;  5GAG J;  4A5M A;  4D5C A;  1QPI A;  5IYD J;  5ILV A;  4XRM A;  2MGQ A;  2DYS H;  3L2Q A;  2XVC A;  4UVC A;  3X2Q H;  3KZZ A;  1SD5 A;  3CJT B;  5L3E A;  4PSX A;  5LGN A;  3SQN A;  3CCR I;  1K79 A;  2WA0 A;  5GAE J;  3K4C A;  3FX3 A;  3Q9S A;  2FJ1 A;  4A3B J;  4F7Z A;  3OYC A;  4HX4 A;  1GHC A;  3DBL B;  4PGG A;  1HW2 A;  2EFW A;  3BJ6 A;  1IAW A;  3L00 A;  2RC4 A;  3KPH A;  3ZN0 A;  3WGI A;  2NAZ A;  4BGD A;  2HVR A;  2LMD A;  4L9N A;  4Q47 A;  3R61 A;  3QYF A;  4OIQ F;  2CW0 F;  3H9J A;  2LSO A;  4EQQ A;  2LKS A;  4UB8 C;  2JWT A;  1XN7 A;  3FBI B;  2A3S A;  1BOA A;  1LNW A;  4RB3 C;  3D5S C;  3GTJ J;  1UAA A;  2KIU A;  1K6Y A;  4A3F J;  1H89 C;  1LEB A;  2OF7 A;  3ZQF A;  1K4S A;  4KIT B;  1Z3Y A;  3CP8 A;  1FJL A;  3C3W A;  4CYC B;  5KNL A;  2RDP A;  4BBS J;  4KNY A;  2DMQ A;  2Z33 A;  3HHH A;  1PUE E;  1WQ2 A;  1XGS A;  1IXS B;  2BEO A;  3S1R J;  2OTJ I;  4XLN F;  1KQ8 A;  2K5C A;  1BOB A;  2HXO A;  3BG3 A;  4HV6 A;  2DBB A;  1RIO H;  2CQN A;  3CMA I;  2R7Q A;  5ICG A;  1N77 A;  2L54 A;  1Q1H A;  2Z2S B;  3HRS A;  4CCO A;  2JA6 J;  3O8H A;  2RN7 A;  1D1C A;  3SJM A;  2H94 A;  5ILS A;  2L9R A;  5GPC A;  3FXO A;  3U2R A;  5M3M J;  1LVA A;  2R93 J;  1SMT A;  3RZD J;  3VPR A;  4IOC F;  4E70 A;  1DU0 A;  6PAX A;  4JK1 X;  3FK6 A;  4XM3 A;  3VYT B;  1ZK8 A;  1QHH D;  2PBI A;  3ERM A;  4ZZD A;  5TIS C;  2VKV A;  5IYC J; 
#chains in the Genus database with same CATH homology
 1JKQ C;  1GVD A;  1MH4 A;  1G2H A;  1T56 A;  5EZG A;  3CCY A;  1W0U A;  2XPU A;  3JRI A;  1AKH A;  3PO2 J;  3MN2 A;  3E7L A;  1QVT A;  4XRS A;  3PM1 A;  1I50 J;  3G1M A;  4UUT A;  4CYC A;  4QSH A;  2VPR A;  1GUU A;  2MSY A;  5DTD A;  3IH2 A;  1ETQ A;  1Q1V A;  4M3F A;  2B63 J;  5F0F A;  3GTO J;  4X6A J;  2I10 A;  3H3V K;  4BXX J;  5M5Y J;  1APL C;  2JK3 A;  3MVP A;  3UKG A;  3TP3 A;  4B3A A;  4XIC A;  3LNQ A;  1B8I B;  4Y52 J;  1B72 A;  3GTK J;  3S15 J;  2DTZ A;  4W1U A;  4XK4 A;  1AU7 A;  4QIW N;  2R0Q C;  3FIS A;  1UG2 A;  1JKO C;  2Y2Z A;  2YS9 A;  2MG4 A;  3S1Q J;  3W6V A;  3GTP J;  2XPW A;  1JT0 A;  5FKM A;  1I3Q J;  1MBK A;  3JRA A;  3BTJ A;  3BTL A;  1MNM C;  2OPT A;  1XG1 A;  3GBG A;  1YRN B;  1ZR2 A;  2HQ5 A;  5EG0 A;  2R92 J;  4B1R A;  4V2G A;  2DN0 A;  5E3L A;  4IHV A;  4A3M J;  1ETX A;  5FKN A;  4MFE A;  2Y31 A;  1W0T A;  2CJJ A;  3B6A A;  1AHD P;  3DCF A;  1JTY A;  5J1U A;  5M5W J;  3S16 J;  1LFU P;  3BTI A;  4A3C J;  3BR2 A;  4L5E A;  5IP6 A;  1OCT C;  4RDU A;  3NAR A;  5FKK A;  3D1N I;  3OIO A;  3CMY A;  1IG7 A;  3FKI J;  3HOY J;  2K9N A;  3HEF A;  3IV5 A;  2NVQ J;  3ZQC A;  1X58 A;  5C4X J;  3Q0W A;  5F0H A;  1RPW A;  1GT0 C;  1GV2 A;  2RAE A;  1OJL A;  4G12 A;  1U9N A;  2DMU A;  3OSF A;  5EDN A;  3BG9 A;  3A01 B;  4I6Z A;  3Q0V A;  3HOU J;  1OFC X;  3JRC A;  2O9L A;  4DZJ A;  3BQY A;  2H1K A;  2NS8 A;  5F0C A;  2DA2 A;  4MO7 A;  2R5Y B;  2R5Z A;  1MBE A;  1IC8 A;  1VND A;  4A3J J;  1VFC A;  3M3Y J;  1D5Y A;  4JP0 A;  2QF7 A;  3C2B A;  4D5F A;  4A3L J;  5EYR A;  5J1R A;  2EQR A;  4DYQ A;  1JJ6 C;  2KT0 A;  1ITY A;  3MKL A;  3HDD A;  1LFB A;  4V2F A;  4C3H J;  2NOG A;  1TWF J;  5J3L A;  2M2E A;  3S14 J;  4A3I J;  2D5V A;  2VKE A;  1QVU A;  3LOC A;  1TWH J;  3HGG A;  2YUS A;  1BA5 A;  2L0K A;  3JRH A;  1VI0 A;  3IH4 A;  3HB9 A;  3S2D J;  4C2M J;  3H0G J;  2LR8 A;  4AYB N;  1PUF A;  2XRL A;  9ANT A;  2HOT A;  5J1Y A;  2CU7 A;  5FKO A;  4X1E A;  2NVY J;  1GDT A;  2VI6 A;  2IBD A;  4FIS A;  1Y1V J;  5F08 A;  2IAI A;  5E3O A;  3CDL A;  1H88 C;  3BQZ A;  1XC5 A;  3DEW A;  4M3D A;  4MIM A;  2X6O A;  1CQT A;  1NK2 P;  4I76 A;  1WI3 A;  2IEK A;  1WPK A;  3K7A J;  4A3K J;  4J19 A;  2GLO A;  3BR0 A;  2LK2 A;  1WH5 A;  3JRE A;  1LE8 B;  3OOU A;  2K9S A;  4ABZ A;  4JX4 A;  1IDZ A;  1E3O C;  2E1O A;  2NS7 A;  3LSG A;  3SDG A;  1RES A;  2FD5 A;  2ECB A;  3G1L A;  1HLV A;  1FEX A;  2WV1 A;  3I4M J;  1K83 J;  2HXI A;  4DW6 A;  3M4O J;  4B4C A;  1UMQ A;  4BBR J;  2K9Q A;  1P7I A;  1JT6 A;  1U78 A;  1NK3 P;  2GBY A;  2PMZ N;  4EEF G;  1IRZ A;  4C3I J;  3SFI A;  3TP0 A;  2DJN A;  1ETO A;  2XGD A;  2XPV A;  5EGO B;  3B6C A;  1R9T J;  5JLX A;  3HOX J;  2ID3 A;  1ZQ3 P;  2JJ7 A;  2VUM J;  5FLV A;  3GTQ J;  2LVS A;  3HBL A;  4FE7 A;  4UUS B;  2K40 A;  3BR5 A;  2XGC A;  2DA1 A;  2ME0 A;  2L7Z A;  4A3G J;  1P7J A;  4D7M A;  4MLO A;  1IUF A;  1U8B A;  4LOC A;  2XB0 X;  1I6H J;  2EBI A;  1ETW A;  2ZB9 A;  3I4N J;  2L7M P;  1IGN A;  1BW5 A;  5GPA A;  1Z77 A;  3A03 A;  2ECC A;  1B8I A;  3GTG J;  2DA7 A;  1O4X A;  2FX0 A;  1UHS A;  3S1N J;  4XID A;  4AC0 A;  2AO9 A;  1X2N A;  2LP0 A;  5BNG A;  1TWG J;  4GFB A;  4RBO A;  4M3G A;  2MW8 A;  1BL0 A;  1WGX A;  2LKX A;  3BR3 A;  3FK7 A;  4XRS G;  5FJ8 J;  4JYK A;  3OSG A;  3JRB A;  3ZQH A;  4M3B A;  1YRN A;  4A3D J;  1BJZ A;  3ZQL A;  2DA3 A;  2DA5 A;  1A6I A;  3RZO J;  1XS9 A;  2JA7 J;  3JR9 A;  2Y0S N;  1AKH B;  2AHQ A;  3WHC A;  1WCM J;  3FIW A;  1ETV A;  3LSJ A;  1QRY A;  1ORK A;  1JGG A;  2HDD A;  1JUM A;  2JN6 A;  4UUS A;  2E2J J;  2NVX J;  1ETK A;  3BG5 A;  5HOD A;  2R7Z J;  2JMW A;  5C4J J;  3HOZ J;  2WB1 N;  2LLK A;  4FCY A;  1ZGW A;  5E3M A;  2TRT A;  3HOV J;  5C44 J;  1HDD C;  2M34 A;  2XB5 A;  2E2H J;  4HNV A;  1B72 B;  4FE4 A;  1JJ8 C;  2ID6 A;  3A01 A;  1JTX A;  4JX6 A;  4W97 A;  3O8G A;  2COB A;  1F36 A;  2R5Y A;  2CUE A;  1IDY A;  5K7Z A;  3ZOB A;  2DA4 A;  3S2H J;  2CUF A;  1MBG A;  2NVT J;  2LTP A;  5K7F A;  1ZTR A;  2W48 A;  5EF6 A;  1ZKG A;  3L1P A;  1F43 A;  2CQX A;  1HDP A;  2XGE A;  2E19 A;  3BTC A;  5EG0 B;  1WH7 A;  5IOY A;  2HI3 A;  2H8R A;  1RET A;  3JRD A;  1HCR A;  1FIP A;  4MFD A;  1ENH A;  2Y9Z A;  3JRG A;  3IH3 A;  2M0C A;  2JA5 J;  1TWC J;  2LD5 A;  5IPA A;  3BT9 A;  2Y9Y A;  1GV5 A;  5F27 A;  3GTL J;  2ME6 A;  1HF0 A;  3NAU A;  3TW7 A;  2O8K A;  2WAQ N;  3Q0U A;  5IYB J;  2Y30 A;  2DMN A;  2EZL A;  2QCO A;  3BR1 A;  4Y7N J;  1DU6 A;  4A69 C;  3RKQ A;  1EF4 A;  4AUX A;  3HGY A;  4DZP A;  1RKT A;  4S0H B;  4NDL A;  1K61 A;  1JUP A;  1SFO J;  3A02 A;  1IJW C;  3HOW J;  1MBJ A;  5GP9 A;  5IOZ A;  2DMP A;  3LSR A;  4DYC A;  3WHB A;  1HOM A;  1NTC A;  1MH3 A;  2YU9 J;  2R5Z B;  5FKL A;  2XSD C;  3BR6 A;  1MBH A;  3RQI A;  4D5C A;  1QPI A;  5IYD J;  4XRM A;  2MGQ A;  2L7F P;  2HOA A;  1POG A;  2JA8 J;  3Q3S A;  3ZQG A;  3HKZ N;  5E3N A;  2EZH A;  1LE8 A;  5F04 A;  3QQA A;  5FLM J;  4BY1 J;  1S7E A;  5F1J A;  1H8A C;  3CQZ J;  5EZH A;  2FJ1 A;  2TCT A;  4A3B J;  4FTH A;  1MSE C;  2CQQ A;  1TC3 C;  1MSF C;  1FTZ A;  3K2A A;  1BW6 A;  2FQ4 A;  4M3E A;  2M8G X;  2CRG A;  2HOS A;  1TWA J;  3HM5 A;  3JRF A;  1JKP C;  2LFB A;  3F0C A;  3G1O A;  3S1M J;  2G0E A;  3TED A;  2JWT A;  4M6V A;  1PUF B;  4IHW A;  1A5J A;  3GTJ J;  4A3E J;  2HYJ A;  3ZQI A;  4DYR A;  1JUS A;  5M3F J;  2X48 A;  5EGO A;  1FIA A;  4IEJ A;  4A3F J;  1H89 C;  2GM4 A;  3GTM J;  2EZI A;  1T33 A;  2OF7 A;  1Z0X A;  3ZQF A;  1ZR4 A;  4JX5 A;  2EZK A;  1IV6 A;  1FJL A;  4CYC B;  2KDZ A;  4BBS J;  1Y1W J;  2O7O A;  2DMQ A;  1X2M A;  5M5X J;  3QPL A;  5DS9 A;  5K7H A;  3S1R J;  5JLW A;  1ETY A;  1OCP A;  3BG3 A;  4IHX A;  2HXO A;  2LY9 A;  1U9O A;  4BY7 J;  2DA6 A;  2DMT A;  2JA6 J;  3O8H A;  3SJM A;  2L9R A;  5GPC A;  2N8G A;  5M3M J;  3S17 J;  5C3E J;  1RKW A;  2R93 J;  3RZD J;  3VPR A;  2E2I J;  2P81 A;  3LSP A;  2M9H A;  3QPS A;  2X9D A;  1DU0 A;  5IP7 J;  1SAN A;  3PO3 J;  3FK6 A;  1MBF A;  3TW6 A;  1FTT A;  1ZK8 A;  4C3J J;  4D7N A;  5IP9 J;  4IHY A;  4BKX A;  4A93 J;  1RR7 A;  1JKR C;  4QTR A;  2ELK A;  5EEA A;  2EH3 A;  2VKV A;  5IYC J;  1VF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...