1POV0

Role and mechanism of the maturation cleavage of vp0 in poliovirus assembly: structure of the empty capsid assembly intermediate at 2.9 angstroms resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
340
structure length
300
Chain Sequence
GAQVSSQKVGAHINYTTINYYRDSASNAASKQIKDVLIKTAPMLNSPNIEACGYLQLTLGNSTITTQEAANSVVAYGRWPEYLRDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRNITLPRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS NATIVE EMPTY CAPSID (TYPE 1)
publication title Role and mechanism of the maturation cleavage of VP0 in poliovirus assembly: structure of the empty capsid assembly intermediate at 2.9 A resolution.
pubmed rcsb
molecule tags Virus
total genus 58
structure length 300
sequence length 340
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00073 Rhv picornavirus capsid protein
0 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pov002
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1pov001
2X5IA 2WZR1 1R084 1PGW2 3J8F2 2BPA2 1RUJ3 2IZWA 1HRI3 1MEC3 1AYN2 3VDDA 1V9U1 1NCQD 4Q4X2 1BEV4 1QQP2 1ZBA1 4Q4W3 5K0UA 2HWC3 4Q4Y3 3VBUC 1RUG3 1NA1B 5A33A 4WM8A 4CDUB 1IHMA 4AEDB 1NA1C 1AYM2 1AR62 1RHI4 3VBRC 1PO12 4CEWC 1GFF2 1RUJ4 1HRI4 1RUI1 5A32B 2HWF2 2WS92 2HWD2 5BNOA 1ASJ3 4CDWB 4Q4W4 2RM23 2HWC4 4EJRA 4Q4Y4 1RUG4 1ND2A 3TN91 4CDWC 2HWB3 3ZFEB 1ND3B 1QJX3 3ZXAC 4NWWA 4YVWC 2WFF1 1RUF1 1ND3C 4CDQA 3JB4C 4CEYC 3JD72 1MQTA 1ASJ4 1VBD2 2R073 2RM24 4GB32 1B35C 1HQNA 2RS52 2FZ2A 1RUD3 4N53B 2HWB4 1K5MB 4RHV3 3ZFGB 1D4M1 2RS31 1NG0A 4PDWB 4N53C 1RMU1 1EAH1 3NAPB 1K5MC 4JGZA 5ABJC 5BNNA 3ZFGC 4LLFA 1PIV1 2QQPA 2MEV3 4JGYA 3JBG3 3NAPC 1C8NA 1VBE1 1C8M1 2X5IB 1EAH3 2R074 1DDLA 3J8F1 1RUD4 1RUE2 5ACA3 3VBFA 1R091 1HRV3 4RR3B 4RHV4 1AYN1 3VDDB 1C8M3 4Q4X1 1NCRA 1H8TA 1QQP1 5K0UB 1PVC2 4N43A 3VDDC 3JBG4 1VBA2 5A33B 1FMD2 5K0UC 1AL0G 2RR12 1NA1D 1QJU2 1AR61 1AYM1 4WM8C 1EAH4 1COV3 3VBSB 1PO11 5A32A 1HXS2 1FOD2 1HRV4 1FPN2 4IV1A 1R1A1 2HWF1 5BNOB 5C4WC 2WWSA 1ND2B 5BNOC 1CD3G 1AR92 1AUYA 1ASJ2 2R042 3CJIC 1EV12 1ND2C 1VBC1 1VAKA 1BBT2 1NOVA 4Y4YA 2XBO2 4CDQB 1X36A 3JD71 1MQTB 1VBC3 1RUH3 1VBD1 1RVF1 4FTEA 1MQTC 4YVSB 1QJY3 2R063 4Z92B 5D8AA 1TMF2 1K5MD 2RMU2 1POV1 1RVF3 4PDWD 5BNNB 1AR82 4JGYB 1RHI3 1PGL2 5AC92 2DF7A 4JGZC 1Z7S1 1E57A 1VBC4 2MEV2 2RS12 1RUH4 1AR71 4RR3A 1M06G 2X5ID 1PO22 3IDEA 1VB2A 1RUE1 1QJZA 2WZR3 2ZTNA 3VBFB 2R064 1TME2 1ZBE2 1NCRB 1H8TB 2HWE2 1AR73 1RVF4 4N43B 1V9U3 4RQPA 4CDUC 1NCRC 1H8TC 1VBA1 3LOBA 1AL22 1ZBA3 3VBSA 4N43C 1VRH2 2RR11 4AEDC 1QJU1 5LK7B 2PLV2 5BNPA 4QPIB 3M8LA 1HXS1 1FOD1 1COV2 4IV1B 4NWVA 1AR74 1RUI3 4IV1C 1AR91 4RS5A 3ZFEC 1RUC2 3TN93 1NY71 4JGZB 1BBT1 4Q4V2 2XBO1 4BCUA 2WFF3 1RUF3 4CDXA 4YVSA 1VBB1 3ZFFA 1MQTD 1RUI4 5DDJ2 1R082 1RUH2 1BMV2 5D8AB 4PDWC 1TMF1 1VBB3 5FOJB 2RMU1 1BEV2 5D8AC 1D4M3 2RS33 1AR81 1PGL1 1RMU3 5AC91 1RUF4 1PGW1 3JB8A 1PIV3 4FTSA 2X5IC 2RS11 1RHI2 1VBE3 1PO21 4RR3C 1RUJ2 1X33A 1HRI2 1MEC2 1TME1 3J8F3 4FTBA 1VBB4 2HWE1 1R093 3HAGA 3DPRB 1AYN3 4Q4W2 4IV3A 1D4M4 2RS34 1OOPA 2HWC2 4Q4Y2 1H8TD 1RMU4 4Q4X3 1RUG2 4RQPB 1HX6A 1AL21 1QQP3 4QPIA 1PIV4 1VRH1 3VBUA 2PLV1 3VBSC 5BNPB 1VBE4 5FMOL 2WS91 2HWD1 1AR63 1AYM3 3VBHA 5BNPC 3VBRA 1PO13 3J8F4 1R094 4GMP1 2RM22 1R1A3 2HWF3 2WS93 4Q4X4 4RS5B 2HWB2 1RUC1 1RUI2 1QJX2 2Y26A 4RS5C 5JZGB 4GMP3 4WM7A 4CDQC 1AR64 2BBVA 4YVWA 4GB31 2ZZQA 1PO14 4CDXB 2RS51 2WLPA 2BFUL 3ZFFB 1POV0 5C9AA 2ZAHA 2R072 3JD73 1R081 5DDJ1 4CDXC 4YVSC 4CEYA 5L7OB 1RUD2 1VBD3 1F2NA 5GKAC 4GB33 1BMV1 4RHV2 2RS53 5J96B 5FMOS 1BEV1 5BNNC 4JGYC 3JBG2 1WCDJ 1POV3 1EAH2 5CFDA 1Z7S3 3JD74 3VBFC 1VBD4 4Y5Z0 1RUJ1 3DPRA 1PVC1 1HRI1 5ACA2 1MEC1 1HRV2 4GB34 2RS54 1C8M2 1RUE3 1FMD1 1OPOA 1NCQA 4Q4W1 4IV3B 1OOPB 2HWC1 4Q4Y1 1RUG1 2BFUS 3VBOA 1PVC3 1R092 4IV3C 1OOPC 1VBA3 3VBUB 1F8VA 1FMD3 2GSYA 1FPN1 4QPIC 1Z7S4 2RR13 1QJU3 3VBHB 1SMVA 4RFT0 3FBMA 3VBRB 4CEWB 1HXS3 1FOD3 3VBHC 1RUE4 1FPN3 1ASJ1 2R041 2RM21 4GH4A 1EV11 5JZGA 5C4WA 1PVC4 2HWB1 4QPGA 1QJX1 1CJDA 1VBA4 1R1A2 1AR93 5CFCA 2RR14 2R043 4WM7B 5C8CA 1EV13 4FSJA 3CJIA 1BBT3 1OHFA 4YVWB 4WM7C 5L7OA 2XBO3 1HXS4 1A6CA 1VBC2 5C9AB 2R071 5J98B 4CEYB 1RUD1 5C9AC 1QJY2 2R062 4RHV1 3S6PA 1B35B 1AR94 2R044 1RVF2 1TMF3 1EV14 2MEV1 3JBG1 2RMU3 1AR83 5ABJB 5AC93 5CFDB 1ZBE1 2RS13 5ACA1 5CFDC 2WZR2 1HRV1 1PO23 2GH8A 1Z7S2 1RB8G 1W39A 3DPRC 1AR72 1NCQB 1TME3 1ZBE3 4RQPC 1V9U2 2HWE3 2RMU4 1OOPD 3VBOB 1NCQC 1ZBA2 2XPJA 1AR84 1NA1A 1AL23 4GMP0 4CDUA 3VBOC 1COV1 1VRH3 4CEWA 2PLV3 4AEDA 2RS14 4WM8B 1PO24 2HWD3 4GH4B 4Q4V1 4CDWA 5C4WB 4GH4C 2TBVA 4QPGB 3TN92 5JZGC 2VQ0A 5CFCB 1AL24 1VRH4 3ZFEA 5C8CB 1ND3A 1RUC3 4QPGC 4SBVA 3CJIB 2PLV4 5CFCC 2WFF2 2BUKA 1RUF2 4Q4V3 5C8CC 3ZFFC 1NY72 1RUH1 1COV4 5L7OC 1B35A 1QJY1 2R061 1R083 5DDJ3 4N53A 1VBB2 1VB4A 1K5MA 2FZ1A 5ABJA 3ZFGA 1D4M2 2RS32 1RUC4 4PDWA 1RHI1 1RMU2 1BEV3 3NAPA 4Q4V4 1PIV2 1VBE2
chains in the Genus database with same CATH superfamily
1F31A 3I2JA 4XAEA 2IFRA 2XLGA 5JSPA 1GANA 3VUOA 1PGW2 1O8PA 2VMGA 3HT2A 1K12A 4MXVA 1DGRA 4OFGA 2ET1A 2Y6GA 1JI6A 4I3GA 4FOYA 4QX7A 1NCQD 4Q0VA 1DFQA 1F15A 4LHSA 2W46A 1J3RA 5T55A 1QOTA 1ZBA1 1E5RA 2WABA 2HWC3 4Q4W3 5DUXA 5DMYA 1ZRFA 1GUIA 3AE9A 2ZACA 1O8SA 4I3PA 4CU8A 1KFYA 2RDQA 4YZ5A 2FCUA 1NA1C 3THDA 1RHI4 4XXPA 2XMLA 2D6NA 5FZMA 4Q26A 5FREA 4CEWC 3OGJA 5H9RA 1DQ0A 3BIWE 3HNMA 1HRI4 5JOWA 1IKQA 1OQDA 3FUQA 3WHTA 1POQA 3OEAA 1ONAA 2JG8C 4AI9A 5FZEA 4JDNA 3M3EA 1ND2A 3TN91 2EXJA 2WINB 2A75A 3WQBA 2WJSA 1ULGA 2HWB3 4JHZA 4AOCA 1OD5A 1JZ5A 3RZLA 1S0GA 2WFF1 4CP9A 4OI2A 4DXZA 2GMEA 1QXRA 3E5QA 4N9HA 1GP4A 3H3LA 3C7EA 3Q8AA 2DVGA 4QX2A 1US3A 4S2DA 4LNVA 4XJWA 1VRBA 1ZM1A 2RM24 3IPVB 4R9DA 3AK0A 4UW5A 1K5JA 2RDRA 5FMBA 1RUD3 3CO2A 4N53B 1O91A 3TNPB 5DUWA 4RHV3 3ZSEA 2GMPA 1D4M1 1NG0A 5EFUA 1H2MA 5JR7B 5K4LA 1VMHA 4CCMA 4JGZA 3VKNA 3D0SA 2FMDA 3HN3A 3LSEA 3N35A 3BTYA 4K1ZA 2J22A 3NAPC 1OURA 1C8M1 2VBBA 3VR9A 3NJVA 2X5IB 2VVFA 1DHKB 2W87A 4PHZA 4JQTA 3ZYPA 1C5HA 5ACA3 1EP0A 4NR1A 1R091 1BHGA 4C1WA 3TB0A 5EQUA 3VDDB 2C6SA 4E2SA 1VMFA 4P14A 5FDBA 4N43A 1LENA 1XSRA 4QB2A 3OGRA 2V72A 2QNKA 3G7DA 1FMD2 5FBZA 5K0UC 1NA1D 2RR12 1HB2A 2H6BA 3FLRA 2JICA 3RS6A 3WUDA 2VMHA 4XUQA 1T2XA 4XMIA 5LA1A 4F8AA 3VBSB 4HVRA 4YW7A 5A32A 4ARYA 1D7PM 1HXS2 1HRV4 2W9XA 4MGTA 3ME2A 2DVBA 3OPWA 4GXLA 2HWF1 4MXWA 4IXLA 5I0RA 4BB3A 2WWSA 1CN1A 5KXDA 1CD3G 1AR92 3HPNA 2ZGMA 1NUKA 3V65A 1ASJ2 3DECA 4NUBA 1EV12 3O1TA 1VBC1 1N1TA 1VAKA 3FFZA 3OYWB 4S2HA 1U5IA 1G9CA 2BYVE 2YFUA 1I5PA 1W06A 5F6LB 4LULA 4CDQB 5I8SA 4AFCA 3A7QA 3FE5A 1ZRRA 3KQRA 3MW3A 4UBHA 3ATGA 3JD71 4V2WA 2ID4A 1NLSA 1RUH3 3OPZA 1QKQA 1CVNA 5B4NA 1RVF1 1LHOA 2PAMA 3K3OA 1MQTC 4OI0A 3ON7A 2R063 5FY0A 5FV3A 2YROA 1F4HA 2EA7A 3AP4A 1UNBA 4AI1A 1POV1 1LODA 4PDWD 1GZTA 2D5HA 2UY9A 1RHI3 3DYMA 3QOPA 3ES1A 3BU0A 2WQYA 2WWJA 5FP7A 4QX3A 1Z7S1 1WW7A 4OHYA 1STMA 2R0HA 4A45A 4ISQA 4RR3A 3DXUA 3Q8EA 4M3CE 5L19A 1M06G 5FZ4A 1URXA 1Y3TA 1FT9A 1TNFA 2Y6HA 4FXKB 2PXJA 3V0BA 1TEIA 1TME2 4XFAA 3USUB 3ZIXA 2W52A 1H8TB 2V4AA 3OGGA 1AR73 5A7PA 4CCLA 2RVAA 4C91A 4OHXA 2JE8A 3CZJA 4MADA 4O9EA 3ZYJB 4UAPA 1NCRC 1VBA1 2JDAA 1AL22 4K8FA 2WT2A 2ETEA 3CDZB 5LK7B 3N9PA 4QX5A 2J1SA 3LDRA 3RG0A 5KHJA 4R9BA 5C6CA 3ZN5A 3ILRA 3B7MA 4QXKA 5JXHA 3HT1A 2WNEA 4JAAA 2XHKA 4A41A 1UW8A 4A4AA 2ZHKA 4CUCA 3HD8B 3M3IA 5JUVA 1DYKA 2PFWA 3IM0A 3AZWA 4L2NA 2NM1A 1XQNA 4QPYA 3MIEA 5FZ7A 1RUI3 1WUVA 1XPWA 2IXKA 4IV1C 5JVVA 2JDNA 1K45A 1CAVB 3HVDA 1C1LA 3L2YA 4RS5A 3ZFEC 1QEXA 1XNBA 1XU2A 3MEPA 2BBAA 4MYEA 3CF6E 2WZEA 3OY8A 5FTTC 3O0XA 5FZIA 4TLFA 4AVVA 2MNGA 4JRAA 3O1RA 1CWPA 1BLZA 4NHYA 2DDUA 4GZ9A 2ZABA 3BIEA 1VBB1 4OUMA 1R1ZA 3ZFFA 5FMCA 4NIDA 5LEKA 1O3TA 3ZXJA 1MQTD 4NE9A 3POYA 3ACLA 4NHLA 1TMF1 5EYYA 4AVSA 4D3WA 4XURA 4M0HA 5FOJB 1H9WA 3WP6A 5D8AC 2EIGA 4Y5TA 3QH6A 2C0ZA 1OUXA 1DGWA 1QF3A 1RMU3 1YC61 3RMYA 1WMEA 2VUCA 1PGL1 1WLDA 1N3QA 1WLWA 1J3QA 4GALA 2FCVA 4HPKB 2BZDA 3W9AA 4BHPA 1JMUB 3WW1A 3ZXEA 5KXBA 4FOVA 4AW7A 3WNMA 2XJUA 2DFCA 1PO21 2BU9A 1CAXA 3RJ2X 2WS3A 2IXCA 3KV9A 3M3QA 1XHZA 1JZ3A 4Q1PA 1Q56A 2YBSA 5FUPA 2VC9A 3I59B 2BEOA 2JENA 3D82A 5FXZA 1W9SA 3GALA 3P5BA 4CCOA 4UF0B 4W65A 1AYN3 4Q4W2 3UNPA 2RS34 1SPPA 1I9RA 2HWC2 2E26A 3GHNA 4GIQA 4COZA 3GZEA 3VL8A 2ZX3A 4AI3A 5IVCA 4QWNA 2DCTA 3INAA 3VKOA 4ZU4A 1VRH1 4HK9A 2HH9A 4YW5A 1ZZCA 1GZWB 1ZZ7A 3J7HA 4HZFA 4D0QA 2WU2A 1PNGA 1LHWA 2WS91 2ZEXA 4KNCA 3FI7A 5CKQA 3TWIA 3EO6A 1QJEA 3VBHA 1WCKA 3VBRA 1PO13 1J1TA 1UOGA 1JZ2A 3U0ZA 1L0VA 1WCQA 1UY4A 3D3AA 1DGWX 3P4RA 2D43A 5CB7A 1OUSA 1XRUA 5GLZA 3BN6A 1G86A 3IMMA 2VQUA 1C1FA 3GZTB 5LWBA 2ZX4A 2LS6A 2VNVA 2HWB2 4F7ZA 4YZ3A 1ZRCA 1AJOA 2JDHA 3PDQA 1YYNA 3VDCA 3ZMOA 4DEQA 4D7SA 5FQ0A 4OZOA 1F9KA 5A6ZA 4QKBA 4WM7A 1MZ6A 5JIAA 1GYKA 3P4QA 5D1IA 4Q0UA 2YG0A 4LUKA 4B4RA 2BBVA 2ZZQA 5DAXA 4CDXB 1LEMA 1F5FA 2JWPA 3DYOA 3MDPA 4HKLA 1LHUA 4AL9A 4FP3A 3GZAA 1POV0 3RJRA 3A4UA 5F2WA 1CPNA 1W6QB 2EXKA 1KJRA 1YNAA 4UFLA 4XIOA 5DDJ1 4YVSC 4RD7A 4FAHA 2JDYA 3AE7A 1JYTA 1RUD2 5GKAC 5FZFA 4YWAA 4QGMA 4RHV2 5BPXA 5LW9A 2RS53 3MUZ1 2WNUC 1U0AA 4DQAA 4BQ5A 4TTGA 1VALA 4Z2AA 2EXHA 1NLQA 2J42A 4L97A 5LATA 4EN0A 5L9RA 4JKKA 4LOSA 4YNIA 4XF9A 2CGOA 1WCUA 2IXHA 3BOPA 2XVLA 5FP8A 5GLTA 3ZN6B 1OF3A 1I6XA 1ULOA 4H7MA 4FFIA 4LA2A 2HBTA 1GNHA 4AHZA 1JOJA 5ACA2 1HRI1 3NJYA 5GZGA 1AXZA 3KHCA 5CG8A 3AE6A 1W3VA 1CIWA 5CA6A 2X09A 3WNLA 4IW3A 2V4VA 2W3JA 1OBNA 4IV3B 3PVOA 1FAYA 1SZBA 1F8VA 4TLGA 2ZGRA 3OBAA 5CU1A 5FPLA 3C7FA 1QJU3 4FPHA 1BKZA 4DOUA 3QD6A 4OUEA 2WIIB 4GULA 3FBMA 3H1WA 1CGPA 2JECA 2QQJA 3SCFA 4CEWB 4YZ2A 4META 2WNVC 1E5SA 1XYOA 4IQPA 2R041 2P37A 2RM21 2OS2A 1QMJA 2CU5A 4LBLA 2WFPA 3WW3A 2PN5A 4LLOA 4Q0SA 5JZGA 2P6CA 5A3WA 2JG8B 3VZNA 2ZMKA 3NQHA 4N8MA 3PMEA 1CJDA 1RINA 3H8UA 3AC0A 4QQLA 2RR14 5C8CA 3GQHA 3MV01 3RDIA 4DZGA 3BTAA 5BXXA 2YC4A 3ZSJA 5I0DA 3ABVA 2J1VA 5E16A 1NZIA 5L7OA 5E89A 1RYYA 4TYSA 2OQ7A 3AMQA 3HJRA 1HXS4 1LHVA 4WV8A 2BGCA 1W04A 5DG1A 5FZBA 3U75A 5JPMB 3HEIA 5LASA 1MS9A 3V0AB 2NYYA 4URAA 3PU8A 2D3SA 2R062 1NT0A 4DXSA 3GBGA 1O5LA 4NPLA 1PMIA 4AVTA 3IB3A 4N7UA 1AR94 3T2QA 3B02A 2VXRA 4FOQA 3WCRA 2ZGLA 2Q5TA 3N9LA 1EV14 3C7HA 1EYBA 2BNMA 2EIEA 1PHMA 1KQRA 2R0FA 1AR83 1K3IA 2XJPA 5G05L 5HI0A 4E27A 2CWSA 3AKSA 4FBFA 5AC93 4IEXA 3VHNA 2YYOA 1NZCA 3SISA 4BWOA 5CFDB 5HXVA 2GP5A 1CPMA 2RS13 3IBMA 1PGSA 4XHXA 1YJLA 1HRV1 1S0IA 3HQXA 4PQQA 4LT5A 2GH8A 2UWAA 2OIIA 1PZ7A 1GLHA 2YUEA 2RJLA 3K4AA 2R1BA 3DPRC 1W2OA 3O7OA 1AR72 1OA2A 2QQLA 3AB0A 1ZBE3 4BLIA 2P34A 4HKWA 4QQPA 4RQPC 3KCXA 1W8OA 3I3BA 1A78A 4M4PA 2HEWF 5FUNA 3VBOB 2XPJA 2RV9A 4LPLA 2ERFA 5F6KA 1QNYA 5FZAA 1IPKA 2YBKA 3MHZA 2P2KA 1UKGA 2VMIA 3SC7X 4CUBA 2R49A 3B94A 3APBA 1H1MA 4CCCA 1OT5A 2PAKA 3FUOA 4IEOA 2LRPA 3AYDA 2WDBA 3NW4A 3B93A 3P3NA 5F5CA 4QPWA 3H3ZA 1Q43A 2HJIA 2FD8A 4XF0A 4IDZA 4YFWA 4Y20A 1UIKA 2AGSA 1G6NA 2VULA 4GH4B 5FPBA 2WN3A 5A3PA 1XNDA 1ZREA 3UGGA 4AGRA 4WVWA 2R16A 4Y1ZA 2Z5WA 5ANNA 4AQSA 3THCA 1SHWB 3KGLA 2FMYA 2W0XA 3FZ3A 5CFCB 1AL24 3U37A 4QHOA 4E4HA 2F17A 4NAOA 2VOXA 1DQ1A 1V6JA 4QPGC 2C9KA 2JDUA 4YT0A 4MH0E 2XDVA 1AX1A 3TEWA 2G9FA 4EN9B 4IGOA 5FZ0A 3WUCA 2PELA 3BKZA 1HLCA 2WKKA 4HXCA 5EP9A 5A3LA 3N7KA 3I3MA 3AYCA 3CEWA 3T3YA 4UOJA 4AAXA 2Q4SA 4H7LA 1IQDC 1B35A 4OUSA 1PK6B 4O9GA 4AVBA 3WD5A 4BQ1A 1R083 3K51A 1X50A 1VP6A 3IPVA 2IVIB 3OUIA 4CTEA 2H0VA 1CIYA 3ZYHA 4N53A 3C2UA 3HBZA 3BTXA 2DVAA 1IKPA 3USSA 4XEZA 4CCDA 4K21A 1RMU2 1O59A 2F4LA 1BEV3 2VE1A 2VTFA 4EYUA 2GAUA 1UYYA 1WD3A 5LB6A 2B46X 3W20A 3POEA 2PHWA 5DABA 3AFGA 3PVEA 3IZOA 4IEVA 4COVA 2ADDA 2WA4A 3R6SA 3VD5A 3WV6A 3AP6A 1W99A 2VUAA 3MGUA 3WDYA 2X5IA 5DXDA 1OQEA 3IAPA 2WZR1 4G4FA 1LNSA 4HMZA 2DCJA 3DEMA 3M3CA 2NP0A 1UZWA 1D2QA 1GBGA 1X7NA 3FLPA 2BPA2 4CXXA 1WW4A 1MEC3 2VZ1A 2WYFA 4PCRA 4ZZ8A 1AYN2 2BWAA 3VDDA 5A6YA 4Y1XA 1GMMA 1XYNA 3E6DA 4XDQA 3NV1A 1CZSA 2PHLA 4PF5A 5BY5A 4HLTA 4FOWA 4WM8A 2SBAA 2DURA 1ZYBA 5CNAA 1IHMA 3WP3A 1KXGA 2Q0AA 2D6KA 4QXCA 3ETQA 4D7TA 1JS9A 1PO12 1WW5A 4XFGA 5FYMA 3AMHA 3TBDA 1S0JA 1UYXA 4XC9A 4H14A 1F5JA 1Z78A 2D98A 2GNDA 4YM1A 5GZDA 5IHRA 2VO5A 4CUAA 3H8OA 2HWD2 3AP9A 5FO9B 2D44A 5FFOC 1ASJ3 4CDWB 2ZCWA 3PNAA 4JKLA 4W6YA 4AFMA 1JYIA 3TOJA 2HWC4 4Q4W4 3M3OA 1OVSA 3WEZA 4Z2WA 1J83A 5FWJA 5ISLA 4KG8A 3PUAA 4COWA 5C8WA 4XILA 5CYYA 1CX4A 5LA2A 3ZFEB 1J84A 4FT8A 4YZ4A 2YHJA 4XETA 3ZXAC 2DCYA 1NYWA 3OYWA 1JYNA 2JE9A 4YVWC 1TQ5A 4XCBA 1HQLA 2EF6A 2YPJA 1ND3C 2D6OX 2ZGQA 4CDQA 3T0BA 1XE0A 4PIZA 1T6BX 3KD4A 2HYKA 4QHBA 5SV5A 1XB9A 3MLLA 2WAOA 2QKDA 2R073 4KH9A 2QQMA 4MGIE 5IT6A 1HQNA 4AVCA 2RS52 2FZ2A 4Q1RA 3J7MA 3POFA 4FPYA 4ZXEA 4FPKA 2HWB4 2Z4FA 3NKGA 2RS31 5EWSA 4TN7A 2P3IA 2CDPA 4ONUA 4QD2A 1EAH1 2B39A 5T54A 3PU3A 1F4AA 1K5MC 2XR4A 3ASIA 1PZ8A 3MW4A 3ZFGC 1NEKA 5FY1A 3MIGA 1N1SA 3JBG3 4OHWA 5FY9A 3O1MA 2UURA 3O1PA 4Q0QA 2DFBA 2CAUA 2QZ2A 3S7IA 1MZ5A 3HNBM 3FMGA 4FPFA 4IESA 5H9SA 3SQOA 3I2OA 4XTPA 3HIFA 3CJXA 4W8JA 1OKQA 4AQTA 1DDLA 5A7NA 4CA9A 1RUD4 2C1FA 1YXWA 1SCSA 4Z82A 1JZ7A 3W5NA 1ACCA 4UYBA 3WDXA 4XCAA 2Q8CA 4XFIA 5KHGA 4RHV4 1C8M3 3WNNA 3EQEA 3USUA 2B8MA 3OUHA 4YRDA 1H8TA 4LR4A 4GKXA 1V0AA 4IEPA 3WDVA 5KWRA 5E1RA 3WF4A 2ZGTA 5FXVA 5A33B 1IG0A 4LE4A 4TZDA 3R05A 2R7FA 4KGQA 1G8WA 1QJU2 2VZRA 3SUCA 3RSJA 1V00A 3N9OA 3MUY1 3PVBB 2QQWA 3U07A 3BPSA 4EV0A 3MF6A 1DF0A 3FHAA 1LHNA 1R1A1 5BNOB 1S0BA 1E5IA 5JSRA 1J3PA 2WSUA 5J1XA 5JOXA 1GWMA 3P4PA 4ASKA 1WMXA 4O65A 1CAVA 4COUA 3TRSB 2GH2A 3KT4A 1GKBA 2OXBA 4IL7A 5DQ0A 5IK5A 4MG2A 1ND2C 4ZZ5A 3I49A 2CGPA 2JD4A 4PLNA 3THTA 1NOVA 2JDKA 3IDCB 3ILNA 4Y33A 5EJ1B 1W6NB 3POIA 4Y26A 3SMHA 4D6QA 4XDOA 4F3JA 3VKMA 4AGVA 5IVEA 4UFIA 4YW6A 4Y1VA 2PHTA 1ZZ8A 4OZXA 4BH9A 4IEZA 3IKWA 4WVMB 3WDWA 4BISA 1JU4A 2ES3A 1VBC3 5FPAA 5JXJA 3RZHA 2WT0A 1W9YA 2LUWA 4HL0A 1D2SA 1OC1A 3W5MA 5GLUA 2O14A 2PYTA 2AZ5A 3AE4A 4BQWA 4K3UA 4U2AA 4YVSB 3JXSA 3ST7A 4LKEA 1QJY3 2DUOA 2HYXA 3FWEA 3LDBA 3K75B 2G9GA 4K7JA 4NPRA 3I3EA 4WVVA 5FYZA 3ZXGA 1XE8A 5FZDA 4LBQB 3BU7A 1JTZX 5KBFA 1K5MD 2WNUB 5CIRA 1L7RA 1O5UA 2XKPA 1RVF3 3POGA 2R6QA 4QKNA 3GCXA 3O1UA 3AEDA 3RFRA 1AR82 4GAZA 2WA3A 5LA9A 4AI0A 5LEJA 3KHBA 2VZUA 3I2HA 5AC92 4JGZC 3OGVA 1CJPA 3Q8BA 1WMDA 1HN0A 1HW5A 5EJZB 2Z2SB 1KF6A 4HPKA 2MEV2 2RS12 5JR2A 3KF3A 2E7AA 5A7QA 3RYPA 1RUH4 1SEFA 2QCSB 2FQPA 1VPHA 4GWNA 4L99A 1S2EA 4AEKA 5A6XA 4LA3A 3K3NA 4K6BA 4P9YA 2R064 2WDQA 1ZBE2 4A7YA 1XXNA 2E53A 3I59A 4YW4A 1C28A 2YBPA 4N9IA 2YDEA 4UF0A 3ENRA 3PJYA 1V9U3 1UMHA 4CDUC 1KGYA 3VZOA 5J48A 5LA0A 1V6IA 4N43C 2RR11 1NQDA 2P3YA 1GZWA 2OX0A 1CZVA 1O3SA 4NIAA 2DVFA 5DAVA 5A3TA 3ZXLA 1SFYA 1BVP1 2VZPA 3M8LA 4R4XA 1HXS1 2ZGKA 3CIHA 4HG6B 1COV2 2XWBB 4P9GA 5C5UA 3D5OA 4NWVA 4QKDA 5DN2A 4LKDA 1FXZA 5FPZA 1AR74 4M00A 2Q1MA 4UW3A 1OI6A 2WNVB 4JDMA 4XAAA 4L9BA 5IFPA 4FFFA 1AR91 1O6UA 2NPIA 5B4XA 1LOEA 4DXTA 1S0CA 1YFUA 4IE5A 4XJ8A 3T0DA 4JQRA 3R4DB 5IK7A 4HN1A 1YFWA 2ENRA 4XF4A 2B9UA 4IE4A 4MOAA 1U5ZA 4UWDA 4Y24A 2B45X 2GNTA 5FP3A 1RUF3 2VECA 4CXWA 5A7WB 1KDKA 4CDXA 2WQZC 3RWKX 4P5YA 1W6PB 3AE8A 1TVGA 1YJKA 4QDQA 1RUI4 4LBOA 1R082 4MGZE 3VL9A 5FLHA 4YXDA 5D21A 2JIJA 3ZYRA 2AREA 1BMV2 4R52A 3PIGA 1BVVA 4PDWC 4QGNA 5J7MA 1ST8A 3SITA 3T2PA 1VBB3 4AAPA 4Y3OA 1SLIA 1BEV2 1IS6A 2XLAA 2ZGOA 5E88A 1LAJA 4I2OA 2XXZA 2XVKA 3C7OA 2C5DA 4I0AA 2XL7A 4QU2A 3VDBA 4QAWA 2QVSB 1PIV3 2VMFA 3ZOIA 4BM8A 4FTSA 1HKDA 1XI1A 3S57A 2D6MA 2QDRA 1VBE3 3ZN6A 1DGLA 2KXLA 2WUHA 1PMHX 4RR3C 4XBLA 1W9FA 3WCSA 4DY5A 5FO8B 1MEC2 4FXGB 1TME1 2E63A 3J8F3 4OHVA 3R0RA 4RA0A 2C24A 4OLLA 5FZOB 3UETA 3WHUA 4AR2A 1H1IA 2IVJA 2VJXA 4NIIA 4F83A 3VD9A 3DPRB 4IV3A 2A7AA 2P1BA 1RMU4 4Q4X3 4RQPB 2OPWA 4HN0A 1Y9MA 1ZZBA 4YG3A 1AL21 1QQP3 1UIJA 2X29A 3L2HA 4QPIA 5EJ3A 4Q0PA 5ERLA 4LHNA 5FP9A 1Q8QA 2PHXA 1UQXA 1G9DA 3ZPOA 5BNPB 3AL5A 5FMOL 4EWEA 1AR63 1AYM3 3WOGA 1AVBA 2BVBA 3NV3A 4QQOA 1LJ7A 3WZ1A 5CEHA 4Q2FA 3I2GA 2BNOA 1DZRA 4E4DX 4J1WA 4GMP1 4UI9L 3H1MA 4LBNA 4YG6A 2WS93 5FZ8A 4RN5A 3BODA 2JG8A 2GP3A 4YTPA 3AXDA 4RS5C 4DUXA 4WZCA 1UZYA 4P5HA 3J9SA 4Y22B 4D6SA 5FBJA 5IAXA 2VUDA 3LIGA 4GB31 4PBPA 1PO14 3BVCA 2GNBA 2PQSA 2BV4A 2R072 1AXYA 4FQ4A 4C8DA 1W2TA 3AP7A 3V0AA 4NJ4A 3ZSLA 3GXUA 4CVUA 1VBD3 1ZA4A 3PHMA 3RVHA 4CP0A 1SLAA 3DUIA 1MS1A 1SFPA 5JCTA 3I97A 1W2UA 2E7TA 5AFEA 1QH7A 2W1WA 2D6LX 5BNNC 4JGYC 2JG9B 3PIJA 3ZPYA 5FYSA 5FIXA 5T3NA 3BYWA 3JBG2 4L11A 3B69A 5F32A 3T08A 4B1MA 1SCRA 2RHPA 4YSFA 1FYUA 5BUVA 1WKYA 1XYPA 3A22A 4RGKA 2LM3A 2A71A 5CFDA 4LO8A 3VGIA 4A44A 4D69A 4LKFA 2VVDA 4M0NA 4EN8B 3DCQA 3VBFC 2X53S 1HV1A 1PVC1 2E6VA 2R30A 4IE7A 4QU1A 4YLZA 3KT1A 1JBCA 1YQCA 1C8M2 2IWGB 2RS54 1RUE3 2GNMA 4DUVA 3WP5A 1SLLA 1DIWA 1SDWA 1XE7A 3NWKA 4Q4W1 3T2OA 1AF9A 1OOPB 2HWC1 4KQ7A 1IGOA 4BIFA 3WP4A 3KLSA 1Y4WA 3C8XA 4IE0A 2BFUS 3VBOA 3VDAA 3OBTA 1R092 4WVZA 1SG3A 2ZAAA 1GP6A 3ECQA 3NRUA 4AFBA 4CU7A 2PZSA 4XYXA 1IPSA 1FPN1 5EZWA 1A8DA 3ABZA 1W6MA 3ZKYA 4DRRA 3IIIA 1SQ4A 2CAVA 1W28A 1SMVA 2K46A 1A8MA 2WO3A 4BOWA 2WNOA 5C7GA 2RDNA 4NHXA 1HV0A 3DKQA 1FOD3 3VBHC 5FPXA 5IFTA 4P9JA 1EY2A 3GF6A 4XUTA 5GLVA 4I01A 3ZYGA 4GH4A 4AZZA 5F3EA 4UT5A 2HWB1 2DWRA 3WG4A 1YWKA 2A6XA 3K4ZA 1UPSA 4LMFA 2D97A 5CFCA 2WP9A 4QKFA 2HLEA 3H1YA 2R043 2X8KA 2DV9A 3N4MA 1BBT3 2PHUA 2W1QA 4XJUA 4YVWB 4WM7C 4ZS2A 2XBO3 3ZN4A 1DYPA 1YHFA 5IVYA 2BWCA 1A6CA 1VBC2 3GJAA 5C9AB 3WQ7A 3AZVA 4MSVA 4Y5SA 2DVDA 1EPWA 1G7YA 1PK6A 1RUD1 4BK5A 3IAQA 3QLQA 1QJY2 3ZO0B 1CONA 2BNNA 4RHV1 4XJZA 3S6PA 5K9YA 3DKWA 2OQ6A 4U36A 3OCPA 2ET7A 3HQRA 1DLCA 3AM2A 1RVF2 1MS4A 5IJRA 3AZXA 3OUJA 5KHKA 2VCMA 2RMU3 2VAUA 5IW0A 3VN4A 1GWKA 5F9TA 2VNGA 1N3OA 1V70A 4C90A 1QXJA 4LHKA 5L9BA 5T52A 3HMYA 4AF9A 4AFAA 4M3CA 1IZ3A 1D0HA 4UFHA 2OW4A 3ZIWA 3KGZA 5ACA1 4LITA 2CWMA 1OLME 3K2OA 1Z7S2 3MBWA 1PVXA 5FZLA 2H89A 4X6QB 3D8CA 1WA6X 1SBFA 1NCQB 3MPPG 3BI3A 5A7OA 4I09A 1RUNA 2XWJB 5HCFA 3GHMA 2Q8OA 1V9U2 2HWE3 2JEMA 4KI5M 4AVAA 1L3JA 4CPBA 4OI1A 1AR84 1GOHA 2A6YA 5T50A 4LBKA 5A1LA 2ACZA 4OHZA 4GMP0 3VRAA 2XG3A 3M2MA 4BXSV 2PLV3 4MGSA 2OUHA 1NENA 2RS14 4BU2A 1MS0A 3HWJA 1ZX5A 2XGXA 4AQ2A 1ZRIA 2HWD3 3ORJA 4PI0A 1Q5OA 5IK8A 5FY7A 3I2KA 4HVOA 4MGQA 1IS4A 3E97A 3I8TA 5JIUA 1NXD1 4Q4V1 3EYPA 4CDWA 4YSXA 5GZFA 3OTFA 4P9LA 3N9MA 3U4SA 4DO0A 1QOSA 2Q30A 2VQ0A 5JZGC 1DQ4A 3ZKUA 2HBUA 2A3WA 2JIGA 4MZUA 2X05A 1OA4A 1RUC3 3T4HB 2YGLA 3ZFEA 4SBVA 2ZOEB 1WLTA 2XJVA 2BUKA 1RUF2 3LPGA 3OBRA 1XNAA 4CU6A 5C8CC 2BGOA 2NMNA 1N47A 3VHRA 3O12A 4Q8KA 2ADEA 1RUH1 1NQJA 3HR9A 4FPGA 4GJYA 4AFDA 1COV4 5FYYA 1B09A 4DY3A 5L7OC 3LIHA 4AXOA 1JYXA 5DZEA 2VMEA 4XUPA 2R061 5A3UA 1BQPA 2VOVA 4OMDA 4AEMA 2EIBA 1VBB2 2ZEYA 2CV6A 5ABJA 3PTRB 2IXIA 2VOWA 1RHI1 5DUUA 1U5YA 2PHFA 5I8YA 4J6GA 1PIV2 3HOBA 1VJ2A 3WW4A 4HANA 4NAMA 2A73B 4MHUA 1UZ0A 4ET7A 2A3YA 3HNYM 1VBE2 4JGZB 5LBCA 1LOFA 2GC3A 3B9CA 4KMQA 1YQ2A 4QB6A 3MICA 2ZX1A 3S30A 2JDPA 3VD7A 2JB4A 4OI4A 1R084 5DZGA 3R4SA 4IEYA 1L7LA 2VMDA 2DU0A 2W94A 1UY1A 3J8F2 1OPMA 2H88A 2K0GA 2PYJA 3LWCA 1RUJ3 2IZWA 4LIVA 4YW2A 5FK7A 1WBLA 1GQPA 1OLMA 1XNTA 3I3QA 1O4ZA 4Q4X2 2BERA 5FJHA 1BEV4 3AE5A 1QQP2 5FK8A 1OKOA 1H2NA 3P6BA 4Q4Y3 3S0MA 2ARXA 2D5FA 3VBUC 1RUG3 1NA1B 5A33A 1ZOYA 2Y6LA 4CDUB 2PQQA 2VCBA 3CL1A 2UU8A 1W05A 2OVUA 3V64A 4YM3A 5BNQA 5JXGA 1QU0A 5FZCA 1AYM2 1AR62 3SXWA 1QOOA 3N7MA 2WBKA 1RUOA 2A6VA 1H30A 2ZEZA 3A0KA 1DGRN 1WLCA 1OMIA 1RUI1 2VW1A 5A32B 3WNKA 1Q3EA 1QY4A 2K9ZA 2WS92 3CNAA 5BNOA 1Q8SA 3OEBA 2D6PA 5C5TA 5DAQA 3FJSA 1WZXA 1UU6A 3WF1A 2YZ4A 5AFBA 4MXWB 2FDFA 4JVAA 1X8MA 3PTYA 1QJX3 4NWWA 4HBNA 4UW4A 1ENRA 5A1FA 3RZMA 1MS3A 5JAXA 1W6NA 2E9QA 1I1EA 5F5IA 3VLBB 3A0NA 4BLJA 1O3RA 3UESA 4CEYC 4WVMA 1UYPA 4A7ZA 1UYZA 4O7XA 4DEVA 3NVCA 1ASJ4 1VBD2 1QWRA 1YI9A 2YGMA 3AE3A 1PZ9A 2I07B 1B35C 1XSQA 3LQCA 2XB6C 4CYDA 4GB34 2Y60A 1LGNA 1JHNA 3AFKA 4BA6A 4BQYA 2VL4A 4NROA 4PDWB 4LBQA 4N53C 4XIKA 1RMU1 2ZA9A 2ZKNA 3GCWA 3RNSA 2WNUA 3NAPB 4K9SA 1HB3A 2PA7A 1W8FA 4JC1A 1ULDA 2MEV3 4LLFA 3LAGA 5FZ9A 3J7NA 3ROUA 4B1LA 3IDBB 5JPNB 1HDKA 5CKMA 1KRIA 5FYUA 1EAH3 2R074 4W6WA 2Y34A 4GQ7A 2ORZA 5FKCA 4ASMB 3AMNA 3ELNA 4QX1A 3N9QA 5JOYA 1AZDA 1RUE2 1YQ6A 4K20A 2TEPA 2H0BA 4RR3B 1AYN1 1LOBA 5JSOA 3T4VA 3J7LA 1EPZA 5ANQA 4BQ3A 3WNXA 5K0UB 3VDDC 4RSUA 3NMBA 3JBG4 3ACHA 1A34A 1OH3A 2R1DA 3H7YA 4JTOA 1AL0G 4NPMA 3AEFA 4SLIA 3BB6A 4PIYA 2W47A 4WM8C 1COV3 3OD4A 5E6HA 2O8OA 4ZHNA 1PO11 4RFRB 5LY2A 3H9AA 4JDOA 1FOD2 5A7SA 3NNLA 3M7AA 1OXCA 2WN2A 5CZKA 2GC0A 3QBQA 1NAEA 3JQWA 5FO7B 3U14A 4C0BA 5C4WC 2VMCA 3FN9A 4E2GA 3JU9A 2WNVA 1JZ4A 3O0WA 2QZ3A 3WQ0A 1DQ2A 1W2AX 4RYDA 5FZ3A 1AUYA 5FYCA 2R042 3CJIC 3BGAA 1W0OA 1X82A 2ZGNA 1BBT2 2UWCA 3E1F1 5KHHA 1PM4A 4NRPA 2PMWB 4BDVB 5IATA 1SBDA 2XBO2 3E5XA 3DGTA 3WR0A 3RPQA 2VVEA 1X36A 3H7JA 4ASLA 5A7WA 1MQTB 3UJOA 5H9PA 2KR2A 1W6PA 1HN1A 1JN2P 3SH3A 1WBFA 3VB9A 3I2FA 5C3OA 3VZJA 3F2ZA 2Q1ZB 3PUIA 3LFMA 1JYWA 4QXBA 5I91A 3RZGA 2RMU2 3P1IA 1AJKA 3KVBA 2AC1A 4GD4A 4D8MA 2ZKLA 5FPVA 4EN6B 3AMMA 1Q8OA 5BNNB 4JGYB 2Y6KA 4LO7A 2Q8EA 3QACA 3POSA 2GALA 4N90A 5GALA 2PYLA 2J1AA 3KCCA 1VBC4 1OQ1A 2FCTA 4S2FA 2GC2A 3NSTA 1DCSA 2X5ID 2JE7A 3CLPA 3IDEA 1ULFA 1VB2A 2VTXJ 1MACA 1QJZA 2ZTNA 3VBFB 3VHPA 1SLTA 1WWYA 4BPZA 5KC5A 3AVRA 1NCRB 1KFXL 2HWE2 4IUGA 3AMPA 4AHYA 5HV0A 1WMFA 1RVF4 5C2TA 4LBMA 4LXLA 1Y7BA 1N1YA 2ZGPA 3DV8A 4XQWA 3MZHA 4RQPA 5C70A 3LOBA 1H8TC 1CAUB 1OA3A 4AE2A 3VBSA 1ZBA3 3WDUA 4D7YA 1KFUL 4OULA 2PW9A 1P8JA 4AEDC 1QJU1 1OFSA 2PLV2 4TSVA 1I5ZA 4IGQA 3NO8A 5BNPA 4D94A 1LOAA 3VD3A 2EALA 3ITQA 4HVQA 5JXIA 1H2LA 1W3XA 2ZPXA 3U1XA 2WZ8A 4AHXA 4ZU7A 1UCXA 2XONA 3KSCA 4FPLA 4IV1B 3S5AA 1S2BA 1UD1A 3X29B 3ZSKA 5IWFA 4IGPA 4Q5OA 1GV9A 1U5XA 1GQGA 4JRLA 2VTXA 4IERA 3LKJA 2AYHA 5M0TA 1RUC2 2NLRA 3TN93 2O8QA 3DYPA 1NY71 1IOAA 4K8RB 2PAEA 4V2VA 4MLOA 4JHTA 1UN1A 4GA9A 3U4XA 1HJGA 1ZZ6A 2G9ZA 3VZKA 5IVBA 2WFF3 2W1SA 1LESA 3AKQA 2BVVA 3B3QE 4LBJA 1GU3A 1KITA 3CIRA 2LTNA 5F5AA 3KWVA 4AHWA 3R4UA 1YLLA 4CE8A 2WRAA 1REFA 3MV11 3WX5A 2J1UA 1TG7A 4XBNA 4YGBA 5E8AA 3WLUA 5LRRA 2OZ6A 1Z0HA 3ZDSA 5HBAA 2P5BA 5I8TA 5D8AB 2B76A 1PM7A 1ODNA 4JTNA 3JCIA 1H2KA 4GKYA 3LFIA 1D4M3 4H55A 2WR9A 1AR81 2JG9A 3DN7A 4MO3M 4PLMA 5HXMA 3TEYA 5AC91 1RUF4 1PGW1 3AYAA 1CZTA 3JB8A 3K46A 5A6QA 1JYVA 4FAGA 2A6ZA 2BTVC 2A1XA 2E51A 2RS11 3CU7A 3D6EA 1DBNA 4UBGA 4A7KA 2AEZA 3UKNA 4LORA 1V6NA 1ENSA 3KV4A 1RUJ2 3AEAA 1LEDA 3LA7A 4FTBA 4NVPA 1VBB4 2ARCA 1R093 1OD3A 3HAGA 4OQ9A 1RTVA 2D7FA 4BXFA 5J3UA 1OOPA 1XJAA 4Q4Y2 1H8TD 3ACIA 1RUG2 1BK0A 5HCAA 5T5JA 4X8NA 1M4WA 4LK6A 2TUNA 1PIV4 2DCKA 2QQOA 3OGSA 3QH7A 4LKSA 4MHRA 1VBE4 2DUQA 1H1AA 5FR3A 4FFGA 5KHIA 3P4SA 3OG2A 4A3XA 1SBEA 1VR3A 2B4KA 2W1UA 1X9PA 2VW0A 3PUQA 3E6CC 2VZTA 4B29A 3J8F4 4FPOB 3DXTA 5CAZA 4XW3A 5CKNA 5LZ6A 3EJKA 5C3JA 3OD0A 3MFCA 1F35A 4YGDA 3Q8FA 2HWF3 2ZGSA 1W03A 5LBEA 4Q4X4 4BJ0A 3ZVXA 3CQOA 5CBLA 1OF4A 2XLFA 2QUOA 1S55A 1QJX2 3GGLA 2Y26A 1ZZ9A 3MW2A 4UFJA 5FJKA 4XOGA 2AH2A 4GMP3 5JZGB 4AQ6A 1RITA 1UOBA 3NV4A 2DU1A 1SDDB 3J4UH 3ZR6A 1AR64 4X6RB 4BZ4A 4YVWA 4GWMA 3RQ0A 2VBPA 3I7DA 2WLPA 5EPAA 2OKXA 4WZFA 4YM2A 4LIUA 2X10A 2ZAHA 5C9AA 2XQRA 1ZRDA 1CX1A 1OVPA 1R081 1VE0A 3JD73 4CDXC 1SLBA 1UOJA 5FXXA 4DXRA 4HONA 5L7OB 3AEBA 2HEVF 1NKGA 1UAIA 2QQKA 1F2NA 2RJKA 2VU9A 4HKOA 5IAVA 1QJFA 2PHRA 2B9VA 4GB33 4YZ1A 3UJQA 1BMV1 4YTMA 4ATEA 3S7EA 5J96B 3TAYA 1BEV1 3WY6A 1UU4A 4QX0A 1JHJA 4XHBA 3KVAA 3LEMA 2JD9A 4W50A 3GYDA 1WCDJ 2PY5A 1POV3 4B7KA 3I2DA 2V5YA 3J26N 4BQXA 4JX0A 4XVHA 1ENXA 4YYOA 1EAH2 1RGSA 1Z7S3 2QQVA 2YU2A 2YMZA 1NXMA 3DF0A 2ZHNA 4Y5Z0 1UX6A 3AYEA 4CCJA 4PLOA 1VBD4 2RG4A 1MEC1 4KWJA 1RIRA 2WWUA 2VOTA 3O1OA 1WW6A 2VM9A 1FMD1 3KT7A 1XC6A 3OPTA 5T5LA 1NCQA 1SLCA 4E2QA 3NJZA 4QQHA 3D0JA 1UZZA 2MPFA 4EWAA 1C3HA 1Y9QA 1LULA 1CAWB 1N3PA 1PVC3 4IV3C 4J1XA 1VBA3 3VBUB 5KC6A 1DQ5A 2WL1A 2GSYA 3FHQA 2WDRA 2JDZA 2WSVA 4QPIC 3RRDA 4NN0A 4IE6A 2XJSA 4FI9A 5C3RA 4ZPIA 2WAAA 3KZ4C 3VRBA 1H8VA 2O1QA 1FNZA 1CQ9A 1W0PA 2VZSA 1RUE4 1XNCA 2OYZA 1H0BA 1FPN3 1ASJ1 5K8SA 2ARAA 1IS3A 1EV11 3AKTA 3NNFA 2J1RA 5I0SA 2JX9A 2AEYA 2W95A 5C3QA 2PTMA 5F2SA 4R8HA 4Y20B 4XUOA 3KV5A 1W9TA 5BV6A 1JU3A 1R1A2 4CUGA 2XUEA 4CCEA 1UX7A 1FNYA 5BYNA 3LEKA 1UMIA 1W6QA 3ILFA 3FBYA 3WINE 1JZ6A 1XHXA 3PUSA 4AYUA 4ZKTB 1ULPA 3SKJE 3UGHA 1Y9GA 2R071 2WO1A 4CEYB 4NO4A 2NMOA 4YGCA 1W8HA 4QM8A 4D6RA 4G9SB 1MVEA 2IXJA 4A3ZA 1B35B 2D3PA 4KU8A 2P17A 3NNMA 1S0DA 1TMF3 3LGRA 3O5SA 2R044 4ATFA 2VZOA 3JBG1 3M1HA 4XPVA 4B7EA 2C26A 3UT0A 3WNOA 4ES8A 4XF1A 2I45A 2QBXA 2GU9A 2FDGA 1KS4A 2NQYA 2YC0A 5CFDC 4KBZA 1NE4A 1PO23 1V6LA 2LROA 2ZBJA 4YM0A 4RGGA 2WZPP 3TYJA 4DNYA 1RB8G 3O14A 1ZP0A 2OZJA 5L73A 3AZYA 3ES4A 4YPJA 3IIAA 3TEXA 2RMU4 4IEUA 3LA3A 1ZBA2 3B00A 1DP0A 2E32A 4R4ZA 3RI9A 2HKXA 5EXOA 1NA1A 3BALA 4CDUA 3VBOC 3LB9A 4KL1A 2QQNA 1VRH3 1XNKA 3EBRA 3GNEA 4DS0A 1H4HA 2GZWA 5HCBA 4CEWA 5I0TA 4WM8B 1ZA7A 2P4EA 4R9CA 4AG4A 3NJXA 5DG2A 3UKVA 1MR5A 4PQ9A 4QB1A 3EXUA 1MPXA 2DBIA 1J1LA 3AL6A 3OOXA 4MVTA 4DFSA 4A6OA 3KS7A 1QHDA 4FFHA 4BE3A 5C4WB 4GH4C 2TBVA 4QPGB 5LBBA 2MHFA 2VH9A 3TN92 2A6WA 3T1LA 1VMJA 4P00B 3LD8A 5I93A 4XF3A 1W8TA 3CJIB 3UV9A 2PLV4 5CFCC 1YQ3A 2WFF2 4Q4V3 4BMBA 5I0UA 1YFXA 1GWLA 2I74A 5FYIA 1WA4A 3ZFFC 3NV2A 2XUMA 3MYXA 2QFEA 5T5OA 4Y1UA 3LEIA 4IEQA 1W8ZA 1W8WA 3UKTA 2WYSA 4NOTA 4GJZA 4ISRA 4LEJA 1QJY1 2AUYA 5DDJ3 2W08A 4AK3A 4YTNA 1JYCA 1PK6C 3MIDA 4R9AA 1RC6A 4A2UA 1VB4A 3H3UA 1RUC4 1D4M2 1UL9A 4PDWA 4XBQA 3P3PA 1QDOA 3TNQA 3H50A 3NAPA 1YCIA 4UW6A 1KEXA 2B42B 2VY0A 1O4TA 3SLIA 5LBFA 1CESA 3ZXKA 3O1SA 5AVAA 1UY2A 4PT6A 5LRSA 5FLJA 1REEA 3D4KA 2VZQA 3VHOA 4DPNA 1DQ6A 5J37A 3B5LB 2YPDA 4I0BA 3RGBA 1BJQA 3GM8A 2BOJA 4CP2A 1HRI3 2CL2A 1TE1B 2YY1A 2EVXA 3CMGA 3OJBA 2G19A 1QGLA 3LCPA 1D4VB 3BPZA 4I02A 5G04L 1V9U1 2IUWA 5CADA 2NN8A 3K48A 3N7JA 4UXAA 5K0UA 5B2GB 5L9VA 2ZS6B 3PJQA 1S0EA 4GWJA 1IQAA 1YRZA 1GOGA 4N7IA 3H42B 1UOFA 3ZYIB 4AEDB 5C71A 4XZPA 3VBRC 4XFBA 1DU3D 1NLRA 1GFF2 2FBEA 1RUJ4 5F1RA 3AEGA 4MV2A 5F3IA 5DAPA 4ITCA 2Q8DA 4COYA 1S1AA 4JZRA 2HWF2 4NIGA 4DIQA 4YW1A 2R7EB 1JOBA 2YU1A 4A6SA 4YSZA 4LUMA 1YFYA 2RM23 3KMHA 3WDTA 5FZ6A 2Y6JA 3PVNA 5DUVA 4EJRA 1W9WA 4Z1VA 1RUG4 1AX2A 1GP5A 4M3CF 4CDWC 2W39A 2BP6A 3RZJA 1ND3B 2VNOA 3C7GA 1G9FA 4LJHA 4KWKA 2WQ8A 4Q27A 5FRAA 3ETPA 5FWEA 1RUF1 3KB5A 3EB7A 1W2NA 3JB4C 4E4SA 4LE3A 3RYRA 4I0WB 4FO9A 1LB2A 2E31A 3BTZA 3JD72 1EUTA 2DTYA 4K1YA 1MQTA 2DCZA 4P08A 4EROA 4LTAA 3SHRA 4PF1A 4PBOA 3ALQA 1OH4A 2V09A 4FPEA 3AX4A 4GB32 3UYJA 1UKRA 3K4DA 1JH5A 1K5MB 2ARBA 1X8EA 2P6HA 1MS5A 2AACA 3MO4A 3OBZA 1UU5A 4S2GA 3ZFGB 5EIYB 2B5HA 4LO6B 1W6OB 4KBBA 3ZXFA 5ABJC 4L8QA 4ZY9A 5D2AA 1PIV1 3SH5A 5BNNA 4JGYA 3POWA 3WXPA 2QQPA 3SFDA 2O0OA 2JKBA 4ARXA 4OQ8A 1C8NA 3LA2A 1VBE1 2FHRA 5GZCA 2VW2A 4OYUA 3ZYFA 4HFSA 1L7QA 3AXEA 1LOFC 2WU5A 4QT6A 2QE3A 3GZUC 3J8F1 4XQDA 3SCGA 4FP2A 3VBFA 4INDA 4E8CA 1HRV3 2FDJA 3PUHA 4EE2A 2W5FA 1J59A 3WVJA 4Q4X1 1NCRA 4CCKA 3ACFA 3T0AA 1QQP1 2CYFA 1PVC2 5FZKA 3JUUA 5GM0A 3TEZA 3BCWA 5DPNA 4CPBD 1FV2A 5LCWL 1VBA2 4K40A 1CAUA 2V73A 4QX8A 3ZR5A 2WLQA 4TWTA 3AJYA 4NHMA 4L92A 2H6CA 5IUQA 2KD7A 1AR61 1AYM1 4QDSA 1EAH4 4Y4RA 3MIBA 4AI2A 5LK5A 3I2IA 4DRVA 3B9IA 3AE1A 2GN3A 1GR3A 2Y6FA 2D3RA 3N36A 1FPN2 1YIPA 5FZ1A 4DMIA 2XL9A 4IV1A 2YC2A 1OLRA 2VZVA 3MPBA 4HSLA 3URFA 2N7GA 3AE2A 1IPJA 2RDSA 5DZFA 3SFEA 4XJ9A 3AJZA 3PMSA 2XHNA 4B8EA 4W4ZA 2CNAA 1ND2B 5BNOC 4NHKA 4IEWA 4LQRA 1YQ4A 1YQ5A 4XUNA 3SCHA 2BDRA 1AXKA 3ZLIA 2UYBA 4CP9B 1TNRA 2CTVA 4Y4YA 5FLIA 3BUCA 2XOMA 1LOGA 2J1TA 1NE6A 4XFCA 1UO9A 1ULEA 2J7MA 4CP1A 1HB4A 1ULCA 1W8UA 1VAVA 4NRQA 1WD4A 1BXHA 1H9PA 1VBD1 1V6KA 3QCWA 2QDNA 1LU2A 3GDBA 5J09A 4FTEA 3ZYBA 5FY5A 1PMJX 1KS5A 2GMMA 4ZXKA 2KM2A 5FAXA 1W0NA 2OA2A 3KQ4B 4P9WA 3GBWA 4Z92B 1O4YA 1UZVA 1GICA 3LE0A 2Y64A 5D8AA 1TMF2 4CRQA 4J25A 2GDFA 4AEJA 5IVVA 1FATA 1KJLA 3HN1A 4XFFA 1RL3A 4AI8A 5LY1A 5CVRA 1PGL2 3LDKA 1JXNA 3WQ1A 3H8XA 2ZX0A 2DF7A 3W58A 4EWDA 4HK8A 5CG9A 1E57A 2EAKA 2ZXQA 4H2AA 2CDOA 2K2SA 3FL7A 3T09A 1AR71 3FX3A 2BRTA 2VG9A 1OSGA 2TNFA 1PO22 1LRHA 1C4RA 2QTWB 1RUE1 3ZSMA 2WZR3 3WF3A 1UY3A 1YQ8A 2Z79A 5SV8A 4E9KA 4YG0A 2XJRA 1PX4A 3IN9A 4N43B 1LOCA 1DZQA 5JOZA 2P3KA 2L9LA 3M70A 4BK4A 2UYAA 1VRH2 2A5ZA 1C5IA 1ODMA 2SLIA 2RJ2A 2I2SA 2JJ6A 2ZZJA 3MF9A 3POBA 4LO5B 5FZHA 2ILMA 4OVEA 3SNMA 5FUIA 4QPIB 1YIFA 4AWDA 4FPCA 1FOD1 3JQXA 4Y1YA 2GC1A 5FYVA 2VXJA 3WG2A 2BGPA 4RL7A 3T1MA 1GSLA 1RJ8A 3F95A 4NRMA 5KXEA 4MGYE 4DINB 5K7PA 2VR4A 2JKXA 2ZJCA 3BOWA 4EN7B 2CY6A 2EX3A 1MZEA 4HOOA 3GQKA 3MIHA 1W90A 1YEWA 1BK1A 1BBT1 2ZHLA 3ZMNA 1K42A 4Q4V2 1H6XA 4FPJA 3ZM8A 2XBO1 4BCUA 1U12A 2F6BA 5GZEA 2VQTA 1J58A 2WQ4A 4DB5A 3A21A 1HIXA 3A23A 5JI7A 4YVSA 3U10A 3S5QA 2BJSA 2QQIA 2V5DA 4V1PA 5IK4A 1AHSA 1MS8A 3N3HA 1LU1A 2WO2A 5DDJ2 5FYBA 5FYHA 2XJTA 3CZUA 3I4IA 3DL3A 4BQ2A 1RUH2 5A1AA 5FOBB 1KDMA 1LCLA 4DUWA 1I3HA 1RXFA 4HSJA 4MUVA 2RMU1 5JI9A 3AKPA 4LBQD 3THPA 2RS33 2BOIA 2Y33A 3NKTA 3AECA 4O61A 2VBDA 4Q8LA 1VLNA 2W2IA 2KA3A 3E5UA 4CCNA 5A70A 1MZFA 5F5QA 2X5IC 3RYKA 4NIHA 4GWIA 4XZUG 1OFNA 1RHI2 4JCKA 3NNJA 4FVVA 3MI8A 1Q8PA 1H4GA 5FYTA 1QDCA 4QDRA 5JLVA 3V0BB 1UXXX 1HRI2 1MVQA 1X33A 5C3PA 2OPKA 1JUHA 1V6OA 2VOKA 3OF1A 4C0HA 2HWE1 1H6YA 2HEYF 2FDHA 4QQ2A 1D4M4 1FX5A 2Y0OA 3PURA 5C33A 4EZHA 4KU7A 1ALYA 1GNYA 1HX6A 2Z69A 2JB8A 1CAWA 3WF2A 1GNZA 1PNFA 5JMOA 4QGLA 2C4XA 2PLV1 3L9JT 3VBUA 3VBSC 2PHDA 4M4RA 1GZCA 5CISA 2CGNA 2HWD1 1S0FA 3MLKA 1BCXA 1QIQA 4QM9A 3N9NA 4FQZA 5BNPC 2YV8A 1G9BA 2NZ9A 2WO7A 2A70A 3EHKA 4LO4B 1W6MB 3NL1A 3CBNA 3SKVA 5JMCA 1LR5A 1R094 2UY8A 4XTMA 2VCCA 2RM22 1R1A3 5DAWA 1DG6A 5JDBA 4ORFA 4RS5B 2XVGA 5F3CA 1NX9A 2FBWA 4E4ZA 1RUC1 1RUI2 4CSWA 3FC0A 5F39A 3OY8B 1UXZA 2EAAA 5GJ6A 1Q8VA 3LOIA 4CDQC 4FCAA 2G1MA 3ACGA 4XFHA 2WC2A 4XE9A 2IC1A 2DTWA 2VCAA 3AP5A 2W68A 2GN7A 2RS51 4KG0A 2BFUL 3VKLA 3LPFA 3ZFFB 1LKNA 3OB8A 1YUDA 1YI7A 3B01A 3VKFC 4Q4Y4 5GLWA 2D93A 3GJBA 4CEYA 1S4CA 4ES9A 2JXAA 3GBFA 1LECA 1APNA 3JZVA 3LF7A 2XH6A 2VQAA 5HV4A 4LHLA 3SEPA 2FDIA 1UMZA 4B3NA 1S2KA 5FMOS 1D0GA 1Y43B 2ZHMA 3WT3A 3V56A 2Y0IA 3HQUA 3LZZA 4PJYA 1A3KA 3HBKA 1XBFA 4HETA 4JKMA 1W8NA 3VZMA 1FV3A 4H3WA 3AEEA 4C1XA 2JG9C 3AVSA 2Q1FA 4PI2A 4OMCA 2VZ3A 3WSOA 2EIDA 3JD74 3VD4A 3T2TA 2XQXA 5FZOA 1CAXB 4ZONA 3FLTA 5KXCA 1RUJ1 3DPRA 1WGPA 2QQUA 1IS5A 1HRV2 4B4QA 3RWNA 4LOTA 3FFQA 1CR7A 4M3CB 4UFKA 2FDKA 2VPVA 2WT1A 3UGFA 1QNWA 3RI8A 1OPOA 4YGEA 3AKRA 2E7QA 2E33A 1SPPB 3IT8A 2DUPA 4Q4Y1 4RGAA 4XACA 1RUG1 3H0OA 1HB1A 2VD7A 5A3OA 1QH6A 4KWLA 1OOPC 4BQ4A 5EV7A 1FMD3 1T6GC 3Q8CA 1Z7S4 2RR13 1E5HA 4E8DA 5FY8A 3W21A 3VBHB 5A3NA 3G6JB 4RFT0 5F3GA 2VGDA 3O0VA 3VBRB 1GOFA 2ORXA 2RE9A 5FY4A 3POJA 1HXS3 4MX3A 2LW8A 1FI2A 5FKBA 2G4IA 4XQ4A 2D40A 4G3YC 1JUIA 4LK7A 5C4WA 1PVC4 2C9AA 3IDAA 4Q29A 4Y22A 1UWWA 4QPGA 1QJX1 1VBA4 5FZGA 4QHZA 1AR93 4XABA 1HQWA 5KR7A 5FQ0B 5T5PA 1XOYA 3Q9OA 3O1VA 4WM7B 1EV13 1JODA 2CSGA 4FSJA 3CJIA 1US2A 3PL0A 4XJAA 5FMDA 1OHFA 2ZMNA 1RXGA 3SH4A 1ZVFA 3OSDA 2R32A 1GQHA 2VNRA 2ZEWA 3C3VA 4KWUA 3U11A 4URTA 3WF0A 4BMEA 5HCHA 1JZ8A 1N1VA 1XU1A 2ATFA 2YB7A 4QMAA 4BYYA 5J98B 4YFZA 1IG3A 1G9AA 2W92A 4IETA 4P9XA 5EYXA 5C9AC 2OT7A 3MFAA 1UF2C 3VV1A 5JWPA 5H9QA 1GZ9A 3VZLA 5F37A 1SACA 2LALA 3E6BA 1HJFA 3LEGA 5IYYA 2IFWA 4M01A 3UK9A 2EXIA 4XXAA 1LTEA 2CHHA 2MEV1 2BW8A 2YXSA 2XKOA 2UWBA 1RJ7A 3WG1A 3KCYA 5ABJB 2DYCA 2ZGUA 1AX0A 5AVPA 3ZXDA 1BZWA 5C3SA 4ZU5A 1ZBE1 1DYOA 1LGBA 1X9TA 1C57A 1PX3A 2WZR2 4XMAA 4YSYA 1ZNPA 1W39A 4WBBA 2A3XA 2DBNA 4XDPA 1TME3 2QJVA 4QXHA 2WDVA 4YW3A 3WG3A 5FPUA 3T30A 1OOPD 1LGCA 1VIWB 1NCQC 3CHXA 4B4PA 2BQPA 4L0PA 4JV4A 2IXLA 3ZX7A 1AL23 1SFNA 2VUJA 4X8PA 5FP4A 1COV1 1BYHA 3AZZA 3MIFA 3FHIB 3KF5A 3RZKA 4TXWA 4AEDA 4P9IA 3I54A 1O7FA 4OCTA 3KV6A 3WNPA 4KX6A 2P3JA 3H8RA 1PO24 3PLQA 3RZZA 5J36A 4A42A 2AENA 4EQVA 2JDMA 3MLJA 4P02B 3EMRA 3NNGA 5L36A 1JOPA 3N7LA 4PIXA 4Z8BA 5IVJA 5TSWA 4CZSA 1OLQA 2Y38A 2ZMLA 5FXWA 4KGGA 3W59A 4CU9A 4Z07A 4ZS3A 2XJQA 1V6MA 1DLLA 1YO8A 5C8CB 1ND3A 4W6XA 1VRH4 1EUUA 3U78A 4I30A 1DZTA 3M4FA 1QXPA 3VR8A 1R64A 2YFZA 2Y8KA 5A80A 3WW2A 1WCSA 4CXYA 1NY72 3SEEA 5APAA 4HT1T 2F4PA 3KM5A 4MGKE 3ZDVA 5IVFA 3CKHA 1UPIA 4NMIA 1KD7A 5FCCA 2W91A 4UFMA 2EICA 5F7UA 3RMXA 3UL2A 3LSDA 5HPOA 3I3DA 4EZ4A 1K5MA 2B7YA 2FZ1A 3ZFGA 2RS32 3IMNA 1ENQA 2J1EA 1JW6A 2ZX2A 2Z42A 5A3MA 5F8PA 4YARA 5EHDA 1TZOA 1W6OA 4AGGA 4Q4V4 1VAMA 1REDA 4BIOA 3IWZA 1UY0A 3K77A 1O3QA 2OUJA 2AR6A
chains in the Genus database with same CATH topology
1F31A 2IFRA 2XLGA 5JSPA 1GANA 3VUOA 1PGW2 2VMGA 3HT2A 4MXVA 1DGRA 4OFGA 2ET1A 4I3GA 4FOYA 1NCQD 4Q0VA 1DFQA 5T55A 1J3RA 1QOTA 1ZBA1 4Q4W3 5DUXA 2HWC3 1ZRFA 2ZACA 4I3PA 4YZ5A 1NA1C 1RHI4 4XXPA 2D6NA 4Q26A 5FREA 4CEWC 3OGJA 5H9RA 1DQ0A 3BIWE 1HRI4 5JOWA 1IKQA 1OQDA 3FUQA 3WHTA 1ONAA 2JG8C 4JDNA 3M3EA 1ND2A 3TN91 2EXJA 2WINB 2A75A 2WJSA 1ULGA 2HWB3 1OD5A 1S0GA 2WFF1 4OI2A 4DXZA 2GMEA 1QXRA 3E5QA 4N9HA 2DVGA 4S2DA 4LNVA 4XJWA 1ZM1A 2RM24 3IPVB 4R9DA 3AK0A 4UW5A 1RUD3 3CO2A 4N53B 1O91A 3TNPB 5DUWA 4RHV3 3ZSEA 2GMPA 1D4M1 1NG0A 5EFUA 1H2MA 5JR7B 4JGZA 3VKNA 3D0SA 2FMDA 3N35A 3LSEA 4K1ZA 3NAPC 1C8M1 2X5IB 2VVFA 1DHKB 3ZYPA 1C5HA 5ACA3 1EP0A 4NR1A 1R091 4C1WA 3TB0A 3VDDB 4E2SA 4P14A 5FDBA 4N43A 1LENA 2QNKA 3G7DA 1FMD2 5FBZA 5K0UC 1NA1D 2RR12 2H6BA 3FLRA 3RS6A 2JICA 3WUDA 2VMHA 4XMIA 4F8AA 3VBSB 4HVRA 5A32A 1HXS2 1HRV4 3ME2A 2DVBA 4GXLA 2HWF1 4MXWA 4IXLA 5I0RA 2WWSA 1CN1A 5KXDA 1CD3G 1AR92 2ZGMA 3V65A 1ASJ2 1EV12 1VBC1 1N1TA 1VAKA 3FFZA 3OYWB 4S2HA 1U5IA 1G9CA 2BYVE 5F6LB 4LULA 4CDQB 5I8SA 4AFCA 3FE5A 3KQRA 1ZRRA 3MW3A 4UBHA 3ATGA 3JD71 1NLSA 1RUH3 3OPZA 1QKQA 1CVNA 1RVF1 1LHOA 2PAMA 1MQTC 4OI0A 2R063 2YROA 2EA7A 3AP4A 4AI1A 1POV1 1LODA 4PDWD 2D5HA 2UY9A 1RHI3 3QOPA 3ES1A 1Z7S1 1WW7A 4OHYA 2R0HA 4ISQA 4RR3A 4M3CE 5L19A 1M06G 1URXA 1Y3TA 1FT9A 1TNFA 4FXKB 3V0BA 1TEIA 1TME2 4XFAA 3USUB 3ZIXA 2W52A 1H8TB 3OGGA 1AR73 4C91A 4OHXA 4O9EA 3ZYJB 1NCRC 1VBA1 1AL22 4K8FA 2WT2A 2ETEA 5LK7B 4QX5A 3RG0A 5KHJA 4R9BA 5C6CA 3ZN5A 3ILRA 3B7MA 4QXKA 3HT1A 2WNEA 4JAAA 2XHKA 1UW8A 2ZHKA 3HD8B 3M3IA 1DYKA 2PFWA 3IM0A 3AZWA 4L2NA 2NM1A 1XQNA 4QPYA 3MIEA 1RUI3 1WUVA 2IXKA 4IV1C 5JVVA 1CAVB 1C1LA 3L2YA 4RS5A 3ZFEC 1XNBA 1XU2A 3MEPA 4MYEA 3CF6E 3OY8A 5FTTC 3O0XA 4TLFA 4AVVA 2MNGA 4JRAA 2ZABA 1VBB1 4OUMA 1R1ZA 3ZFFA 5LEKA 1O3TA 3ZXJA 1MQTD 3POYA 3ACLA 4NHLA 1TMF1 5EYYA 4AVSA 4D3WA 4M0HA 5FOJB 1H9WA 3WP6A 5D8AC 2EIGA 3QH6A 2C0ZA 1QF3A 1DGWA 1RMU3 1PGL1 3RMYA 1WMEA 1WLDA 1N3QA 1WLWA 1J3QA 4GALA 4HPKB 3W9AA 4BHPA 5KXBA 3WW1A 3ZXEA 4FOVA 4AW7A 2XJUA 2DFCA 1PO21 1CAXA 3RJ2X 2IXCA 3M3QA 4Q1PA 1Q56A 3I59B 2BEOA 2JENA 3D82A 3GALA 4W65A 1AYN3 4Q4W2 2RS34 4GIQA 1I9RA 2HWC2 3GHNA 4DFSA 4COZA 3VL8A 2ZX3A 4AI3A 2DCTA 3INAA 3VKOA 4ZU4A 1VRH1 4HK9A 4YW5A 1ZZCA 1GZWB 1ZZ7A 4HZFA 1PNGA 1LHWA 2WS91 4KNCA 3TWIA 3EO6A 3VBHA 1WCKA 3VBRA 1PO13 1J1TA 3U0ZA 1DGWX 2D43A 5CB7A 1XRUA 5GLZA 1G86A 1C1FA 3GZTB 2ZX4A 2HWB2 4F7ZA 4YZ3A 1ZRCA 1AJOA 3ZMOA 1YYNA 4D7SA 5FQ0A 1F9KA 4WM7A 1MZ6A 5JIAA 1GYKA 5D1IA 4Q0UA 4LUKA 4B4RA 2BBVA 2ZZQA 4CDXB 1LEMA 1F5FA 3MDPA 4HKLA 1LHUA 4FP3A 3GZAA 1POV0 3RJRA 3A4UA 1CPNA 1W6QB 1KJRA 1YNAA 2EXKA 4XIOA 5DDJ1 4YVSC 4RD7A 4FAHA 1RUD2 5GKAC 4QGMA 4RHV2 5BPXA 2RS53 2WNUC 1U0AA 4DQAA 1VALA 2EXHA 4L97A 4EN0A 4YNIA 4XF9A 2CGOA 2IXHA 3BOPA 2XVLA 5GLTA 3ZN6B 1I6XA 4H7MA 4LA2A 1GNHA 4AHZA 5GZGA 1JOJA 5ACA2 1HRI1 5CG8A 1AXZA 1CIWA 5CA6A 4IV3B 3PVOA 1FAYA 1F8VA 2ZGRA 5CU1A 1QJU3 4FPHA 1BKZA 4DOUA 3QD6A 2WIIB 4GULA 3FBMA 3H1WA 1CGPA 2JECA 3SCFA 4CEWB 4YZ2A 4META 2WNVC 1XYOA 4IQPA 2R041 2P37A 2RM21 1QMJA 4LBLA 2WFPA 3WW3A 2PN5A 4LLOA 4Q0SA 5JZGA 2JG8B 3VZNA 2ZMKA 3PMEA 1CJDA 1RINA 3H8UA 4QQLA 2RR14 5C8CA 3RDIA 4DZGA 3BTAA 5BXXA 3ZSJA 5E16A 5L7OA 5E89A 4TYSA 3AMQA 1HXS4 1LHVA 4WV8A 2BGCA 5DG1A 5JPMB 1MS9A 3V0AB 2NYYA 2D3SA 2R062 3GBGA 1O5LA 4AVTA 1PMIA 1AR94 4N7UA 3B02A 2VXRA 4FOQA 3WCRA 2ZGLA 2Q5TA 1EV14 1EYBA 2BNMA 1PHMA 2XJPA 1KQRA 1AR83 2R0FA 5HI0A 4E27A 2CWSA 3AKSA 4FBFA 5AC93 4IEXA 3VHNA 2YYOA 1NZCA 3SISA 4BWOA 5CFDB 5HXVA 1CPMA 2RS13 3IBMA 1PGSA 4XHXA 1YJLA 1HRV1 1S0IA 3HQXA 4LT5A 2GH8A 2UWAA 2OIIA 1PZ7A 1GLHA 2YUEA 2RJLA 3O7OA 2R1BA 3DPRC 1AR72 1OA2A 3AB0A 4BLIA 1ZBE3 2P34A 4HKWA 4QQPA 4RQPC 3KCXA 1A78A 2HEWF 3VBOB 2XPJA 2ERFA 5F6KA 1QNYA 1IPKA 2P2KA 1UKGA 2VMIA 2R49A 3B94A 3APBA 1H1MA 2PAKA 3FUOA 4IEOA 3AYDA 3NW4A 3B93A 3P3NA 3H3ZA 1Q43A 2HJIA 4XF0A 4YFWA 4Y20A 1UIKA 2AGSA 1G6NA 2VULA 4GH4B 1ZREA 1XNDA 4AGRA 4WVWA 2R16A 4Y1ZA 2Z5WA 4AQSA 3KGLA 2FMYA 2W0XA 3FZ3A 5CFCB 1AL24 2VOXA 1DQ1A 1V6JA 4QPGC 4MH0E 1AX1A 2G9FA 4EN9B 3WUCA 2PELA 1HLCA 2WKKA 5A3LA 3N7KA 3AYCA 3CEWA 2Q4SA 4H7LA 1B35A 4OUSA 1PK6B 4O9GA 4AVBA 3WD5A 4BQ1A 1R083 3K51A 1X50A 1VP6A 3IPVA 4CTEA 2H0VA 4N53A 3C2UA 3HBZA 2DVAA 1IKPA 3USSA 4XEZA 4K21A 1RMU2 1BEV3 2GAUA 1WD3A 2B46X 2PHWA 4COVA 3AFGA 3PVEA 4IEVA 2WA4A 3R6SA 3WV6A 3AP6A 2VUAA 3MGUA 3WDYA 2X5IA 5DXDA 1OQEA 2WZR1 4G4FA 4HMZA 2NP0A 2DCJA 3M3CA 1D2QA 1GBGA 1X7NA 3FLPA 2BPA2 1WW4A 1MEC3 4PCRA 1AYN2 2BWAA 3VDDA 4Y1XA 1XYNA 3E6DA 4XDQA 3NV1A 4PF5A 2PHLA 5BY5A 4HLTA 4FOWA 4WM8A 2SBAA 2DURA 1ZYBA 5CNAA 1IHMA 3WP3A 1KXGA 2Q0AA 2D6KA 3ETQA 4D7TA 1PO12 1WW5A 4XFGA 3AMHA 3TBDA 1S0JA 4H14A 1F5JA 1Z78A 2D98A 2GNDA 4YM1A 5GZDA 2HWD2 3AP9A 5FO9B 2D44A 5FFOC 1ASJ3 4CDWB 2ZCWA 3PNAA 4AFMA 4W6YA 1JYIA 2HWC4 3TOJA 4Q4W4 3M3OA 4Z2WA 4KG8A 5C8WA 4COWA 4XILA 3ZFEB 1CX4A 4FT8A 4YZ4A 2YHJA 4XETA 3ZXAC 2DCYA 1NYWA 3OYWA 2JE9A 4YVWC 1TQ5A 1HQLA 2EF6A 2YPJA 1ND3C 2D6OX 2ZGQA 4CDQA 4PIZA 3KD4A 2HYKA 4QHBA 5SV5A 3MLLA 2QKDA 2R073 4KH9A 4MGIE 5IT6A 1HQNA 4AVCA 2RS52 2FZ2A 4Q1RA 4FPYA 4FPKA 2HWB4 3NKGA 2RS31 5EWSA 2P3IA 4ONUA 4QD2A 1EAH1 2B39A 5T54A 1K5MC 3ASIA 1PZ8A 3MW4A 3ZFGC 3MIGA 1N1SA 3JBG3 4OHWA 2UURA 4Q0QA 2DFBA 2CAUA 2QZ2A 3S7IA 1MZ5A 4FPFA 3FMGA 4IESA 5H9SA 4XTPA 3HIFA 3CJXA 4AQTA 1OKQA 1DDLA 1RUD4 2C1FA 1YXWA 1SCSA 4Z82A 3WDXA 4RHV4 4XFIA 5KHGA 1C8M3 3EQEA 3USUA 2B8MA 4YRDA 1H8TA 4LR4A 4GKXA 4IEPA 3WDVA 5KWRA 5E1RA 2ZGTA 5A33B 4LE4A 4TZDA 3R05A 4KGQA 1G8WA 1QJU2 3RSJA 1V00A 3PVBB 3U07A 4EV0A 3MF6A 1DF0A 1LHNA 1R1A1 5BNOB 1S0BA 5JSRA 5JOXA 1J3PA 2WSUA 1CAVA 4COUA 3TRSB 2GH2A 3KT4A 1GKBA 4IL7A 5IK5A 1ND2C 2JD4A 4PLNA 3THTA 1NOVA 3ILNA 3IDCB 3SMHA 1W6NB 4F3JA 4Y26A 3VKMA 4AGVA 4Y1VA 2PHTA 1ZZ8A 4OZXA 4BH9A 4IEZA 3IKWA 4WVMB 3WDWA 2ES3A 1VBC3 2WT0A 2LUWA 4HL0A 1D2SA 5GLUA 2PYTA 2AZ5A 4K3UA 4U2AA 4YVSB 3ST7A 1QJY3 2DUOA 3FWEA 4NPRA 2G9GA 4K7JA 4WVVA 3ZXGA 1XE8A 4LBQB 3BU7A 1JTZX 5KBFA 1K5MD 2WNUB 5CIRA 1O5UA 2XKPA 1RVF3 2R6QA 1AR82 2WA3A 4AI0A 5LEJA 5AC92 4JGZC 1CJPA 1WMDA 1HW5A 2Z2SB 4HPKA 2MEV2 2RS12 1RUH4 2E7AA 3RYPA 1SEFA 2QCSB 2FQPA 4GWNA 4L99A 4AEKA 4LA3A 4K6BA 4P9YA 2R064 1ZBE2 4A7YA 1XXNA 2E53A 3I59A 4YW4A 1C28A 4N9IA 2YDEA 3ENRA 3PJYA 1V9U3 4CDUC 3VZOA 5J48A 1V6IA 4N43C 2RR11 1NQDA 1GZWA 1O3SA 2DVFA 3ZXLA 1SFYA 1BVP1 3M8LA 4R4XA 1HXS1 2ZGKA 1COV2 2XWBB 4P9GA 3D5OA 4NWVA 1FXZA 5FPZA 1AR74 4M00A 2Q1MA 4UW3A 1OI6A 2WNVB 4JDMA 4L9BA 1AR91 2NPIA 1LOEA 1S0CA 1YFUA 4XJ8A 4JQRA 3R4DB 5IK7A 4HN1A 1YFWA 2ENRA 4XF4A 2B9UA 4Y24A 1U5ZA 2B45X 2GNTA 1RUF3 2VECA 4CDXA 1KDKA 2WQZC 1W6PB 1YJKA 1RUI4 4LBOA 1R082 4MGZE 3VL9A 5FLHA 3ZYRA 2AREA 1BMV2 4R52A 4PDWC 1BVVA 4QGNA 5J7MA 3SITA 1VBB3 1SLIA 1BEV2 1IS6A 2XLAA 2ZGOA 5E88A 4I2OA 2XVKA 2C5DA 4I0AA 2XL7A 4QU2A 2QVSB 1PIV3 4BM8A 4FTSA 1HKDA 2D6MA 2QDRA 1VBE3 3ZN6A 1DGLA 2KXLA 4XBLA 4RR3C 5FO8B 3WCSA 4DY5A 1MEC2 4FXGB 1TME1 2E63A 3J8F3 4OHVA 3R0RA 4RA0A 4OLLA 3WHUA 4F83A 1H1IA 3DPRB 4IV3A 2A7AA 1RMU4 4Q4X3 4RQPB 4HN0A 4YG3A 1ZZBA 1AL21 1QQP3 1UIJA 2X29A 3L2HA 4QPIA 5EJ3A 4Q0PA 4LHNA 1Q8QA 2PHXA 1G9DA 5BNPB 5FMOL 4EWEA 1AR63 1AYM3 3WOGA 1AVBA 2BVBA 3NV3A 4QQOA 1LJ7A 3WZ1A 4Q2FA 2BNOA 1DZRA 4E4DX 4J1WA 4GMP1 3H1MA 4LBNA 4YG6A 2WS93 3BODA 2JG8A 3AXDA 4RS5C 4WZCA 1UZYA 4P5HA 3J9SA 4Y22B 4GB31 4PBPA 1PO14 2GNBA 2R072 1AXYA 4FQ4A 3AP7A 3V0AA 3ZSLA 1VBD3 1ZA4A 3PHMA 4CP0A 1SLAA 3DUIA 1MS1A 5JCTA 1W2UA 2E7TA 5AFEA 1QH7A 2D6LX 5BNNC 4JGYC 2JG9B 3ZPYA 5T3NA 3JBG2 4L11A 4YSFA 3B69A 1SCRA 2RHPA 1FYUA 5BUVA 1XYPA 2LM3A 2A71A 5CFDA 4LO8A 3VGIA 4D69A 2VVDA 4M0NA 4EN8B 3VBFC 2X53S 1HV1A 1PVC1 2E6VA 2R30A 4YLZA 3KT1A 1JBCA 2RS54 1C8M2 2IWGB 1RUE3 2GNMA 3WP5A 1SLLA 1DIWA 1SDWA 1XE7A 3NWKA 4Q4W1 1AF9A 1OOPB 2HWC1 4KQ7A 1IGOA 4BIFA 3WP4A 3KLSA 2BFUS 3VBOA 3OBTA 1R092 4WVZA 2ZAAA 3ECQA 4AFBA 4XYXA 5EZWA 1FPN1 1A8DA 1W6MA 4DRRA 1SQ4A 2CAVA 1SMVA 1A8MA 4BOWA 1HV0A 1FOD3 3VBHC 5FPXA 4P9JA 1EY2A 3GF6A 5GLVA 3ZYGA 4I01A 4GH4A 2HWB1 2DWRA 3WG4A 1YWKA 2A6XA 1UPSA 5CFCA 2D97A 3H1YA 2R043 2X8KA 2DV9A 3N4MA 1BBT3 2PHUA 4XJUA 4YVWB 4WM7C 2XBO3 3ZN4A 1DYPA 1YHFA 2BWCA 1A6CA 1VBC2 5C9AB 3WQ7A 3AZVA 4MSVA 2DVDA 1EPWA 1G7YA 1PK6A 1RUD1 3QLQA 1QJY2 3ZO0B 1CONA 2BNNA 4RHV1 4XJZA 3S6PA 5K9YA 3DKWA 4U36A 3OCPA 2ET7A 3AM2A 1RVF2 1MS4A 3AZXA 5KHKA 3VN4A 2RMU3 5F9TA 2VNGA 1N3OA 1V70A 4C90A 1QXJA 4LHKA 5T52A 3HMYA 4AF9A 4AFAA 4M3CA 1IZ3A 1D0HA 2OW4A 3ZIWA 3KGZA 5ACA1 2CWMA 1Z7S2 1PVXA 4X6QB 3D8CA 1SBFA 1NCQB 3MPPG 4I09A 1RUNA 2XWJB 5HCFA 3GHMA 2Q8OA 1V9U2 2HWE3 2JEMA 4AVAA 1L3JA 4OI1A 1AR84 2A6YA 5T50A 4LBKA 4OHZA 4GMP0 2XG3A 3M2MA 2PLV3 2RS14 2OUHA 1MS0A 3HWJA 1ZX5A 2XGXA 4AQ2A 2HWD3 1Q5OA 5IK8A 4HVOA 1IS4A 3E97A 3I8TA 5JIUA 1NXD1 4Q4V1 4CDWA 5GZFA 3OTFA 4P9LA 5JZGC 1QOSA 2Q30A 2VQ0A 1DQ4A 2A3WA 4MZUA 3ZFEA 1OA4A 1RUC3 2YGLA 4SBVA 2ZOEB 1WLTA 2XJVA 2BUKA 1RUF2 3OBRA 5C8CC 2NMNA 3VHRA 1N47A 3O12A 4Q8KA 1RUH1 1NQJA 3HR9A 4FPGA 4AFDA 1COV4 1B09A 4DY3A 5L7OC 4AXOA 5DZEA 2R061 1BQPA 2VOVA 4AEMA 1VBB2 2CV6A 5ABJA 2IXIA 2VOWA 1RHI1 5DUUA 1U5YA 2PHFA 5I8YA 4J6GA 1PIV2