1PP9D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1pp9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1pp9D01
1NTMD 3NWVA 5GTHV 5KLIB 3L75D 2K9JB 3ZOWA 1CNOA 1C52A 5EXQA 1H32A 3A9FA 1AKKA 3WFCC 1F1FA 2ZOOA 3O1YA 2B11B 1S6VB 3CX5W 1KYOD 3SJLA 2HV4A 4WQCA 3KZIV 4DY9A 4RJTA 1IRVA 3A0HV 1IRWA 1DVHA 3O20A 1CXAA 4AX3A 5CIBB 4FA4A 1HZVA 1SQPD 4K3IA 1GIWA 2GB8B 2B10B 1I8PA 1CYCA 1GJQA 3VMAA 2B0ZB 1LS9A 1C7MA 2O3JA 1FI7A 4EIDA 2FYUD 1CIEA 3WU2V 1CSVA 5TJHA 4Y5RA 4KMGA 3OA8A 3RMZA 1W5CT 1H9XA 4FA5A 2L91A 4UB6V 1KYOW 1I6EA 3GW6A 4PWAA 1DT1A 1FJ0A 2LITA 1KB0A 4Q5PA 2QJYB 2OZ1A 4WQEA 3TDKA 3HQ8A 1CYIA 5KLVD 4EDFA 3MK7B 2YCCA 3RN1A 5CICB 1GQ1A 4AAOA 4UB8V 5C9MA 1B7VA 1YEBA 4FANA 451CA 1SQQD 5KAIV 1CSWA 2PCCB 2GIWA 3ZIYA 4FA9A 1DW2A 3H1LD 4PJ0V 3KHUA 3PXTA 3PXSA 1HH7A 3JBTB 1JDLA 3H1JD 3OCDB 3WUIA 4PW9B 4FAVA 1F1CA 2JWAA 1IQCA 5KAFV 1A56A 2CE1A 1CIGA 4O1WA 1SQBD 3H1HD 2BPBB 2V08A 1HRCA 1CRYA 1VYDA 1K3HA 1YEAA 2GC4D 4WQ9A 1CXCA 5AURA 3H1KD 3CXHD 5IY51 1RZ6A 1N9CA 3FWLA 4N0KA 1C6RA 5TISV 1ETPA 4AALA 1U75B 1CHJA 1LMSA 2V07A 3CU4A 1CTYA 1CRGA 5B5EV 1H33A 1RAPA 1IO3A 1E8EA 3SXTA 4WQ8A 4D6TD 3M97X 3DMIA 2GC7D 1I5TA 2QG4A 3L72D 1I6DA 1YIQA 3RLMA 3VNWA 4XYDB 1I8OA 1N90A 1BE3D 4IL6V 3TF5A 4EIFA 1NMLA 1CHIA 5KKZB 1CRJA 1H1OA 1PPJD 4H0KA 2VHDA 1H33B 2XTSB 1QKSA 2B4ZA 3CXHW 1QL3A 2AIUA 4AAMA 2C1DB 3CWBD 1OCDA 1P84D 5DF5A 1MG2D 2ZXYA 3VYMA 1NTZD 1N15A 3O5CA 2MHMA 1AYGA 4FA1A 5H2FV 4WQ7A 3SVWA 2D0SA 1CRHA 2B12B 2DVHA 5DJQC 3PH2B 4YE1A 1H31B 2RN0A 1MZ4A 1CIFA 1GDVA 3OCDA 1QN2A 1BCCD 1HZUA 4JCGA 2N3BA 4QAOA 1CYJA 1E2RA 1RZ5A 2YIUB 1CTJA 2FRCA 2QJKB 2JTIB 1WVEC 2N18C 1OAEA 2YK3A 1CSUA 1CRCA 2BCNB 1CCRA 1A2SA 1CTZA 2EXVA 4J20A 1YFCA 4EICA 2C9XB 2IBZD 1NIRA 2QJPB 1FOCA 4XXLA 3ZOOA 1DVVA 1E29A 4A7PA 2RMZA 3ZCFA 4LJIA 1CCHA 1L0LD 1CEDA 2C1UA 351CA 2Y0CA 2CA3B 3X39A 2I8FA 1NMIA 3ORVA 1FCDC 2N3YA 1YNRA 3HQ6A 4FB1A 1YTCA 5CIEB 2KS1A 2DGEA 4WQDA 2Y0DA 4V2KA 2L4DA 1C2NA 4GYDA 3PLNA 1NNOA 3RN0A 3ZBMA 2FYNB 2CA4B 3PTZA 1C6OA 1L9BC 1YCCA 2KNCB 3PRJA 1L0ND 5DFSA 1KX7A 3H1ID 2N9IA 3HQ9A 1CRIA 2C1DA 3WFBC 1HROA 1COTA 2Q3EA 3CP5A 1NU1D 4L1QA 3VRDA 3A0BV 5E79V 1R0QA 1DIIC 2A06D 3O0RC 3DP5A 1BL9A 2C8SA 3L73D 2BCCD 3WC8A 1CC5A 3PHLA 1HJ5A 2N9YB 3C2CA 4O1QA 1FI3A 1H31A 3BCCD 1IZL0 1N50A 1M70A 1J3SA 1HCMA 1U74B 4GEDB 2BLFB 1LC1A 2CXBA 4NFGB 1M60A 4EIEA 3ZOYA 1S5LV 1H32B 2CE0A 5CIGB 3L4MA 1ZZHA 2MTAC 1DW3A 1A8CA 2FWLA 2JQRA 3WFEC 3L4OA 5C0ZA 1CORA 1I55A 1AOQA 1HJ3A 1YICA 1EZVD 1KIBA 1CHHA 5DJQB 1BGYD 1WEJF 3SWSA 1DW0A 3NBSA 1ZRTD 4L3HA 1LC2A 1RAQA 1C6SA 4PD4D 1I54A 4P4QB 1GKSA 2AI5A 1MG3D 2ZBOA 3DR0A 3ZOXA 155CA 1HJ4A 2PCBB 4AANA 3L74D 2AXTV 1W2LA 1GU2A 1C75A 2N18B 2ZONG 3NBTA 1K3GA 1KB9D 3MK7C 3PXWA 2Y0EA 2ZZS1 5B6QA 2C1VA 5CYTR 3TYIA 2ORLA 4U3FD 3TGUD 3SLEA 3WFDC 1C2RA 1DIQC 3OA8B 1KV9A 1DW1A 1QL4A 3L70D 3HQ7A 5CIDB 1FI9A 4MU8A 5CIFB 2BH5X 3GG2A 1EB7A 1SQXD 5CIHB 3CX5D 5GTIV 2LIRA 1FHBA 1CSXA 4RSZA 2OZ1B 1KX2A 3CYTI 2PACA 1H9YA 3L71D 1L9JC 2YQBA 1QYZA 1NTKD 2D0WA 1SQVD 3ITKA 2N9JA 4H0JA 1CO6A 5B66V 4WQBA 1CIHA 2C2CA 1LFMA 4L3GA 4WQAA 2BGVX 2BH4X 1AOFA 1PP9D 1M6ZA
chains in the Genus database with same CATH superfamily
2C9NY 3NWVA 5AVYB 4DZOA 5KLIB 1SP4A 4I1LA 3A9FA 4N78E 3GF3A 4U7JA 5CBNA 3RL0D 1PP9G 3CCUP 4IL6H 2ZOOA 3O1YA 3CX5W 1IFNA 1QLED 3L75G 1LTBC 2ZXEB 1GD2E 1SQBJ 2D2CD 4QMAA 2OARA 3A0HV 3RBZA 3U59A 1L2PA 1VPCA 3O20A 1HVVA 2NPSB 3ZDMA 1HWTC 1SQPD 3T97A 3SWFA 1VL2A 1NJIQ 1I8PA 1GJQA 5AVSB 5APSA 4H0LB 1FI7A 1GU5A 1JY3N 3OW2O 1Q90D 1NGMB 3CMEP 1ZMEC 1CIEA 3CC7P 3L73E 3WU2V 4D6TJ 2BCCE 3MUDC 4KMGA 4XE5B 3RK3B 1KILE 2JWDA 1EZVG 2M5AA 3FXEA 1AQ5A 1ZXGA 3CCRP 2FYUG 2KOGA 5AVXB 2LITA 1N7LA 1KB0A 1H8AA 3S9OA 1TU3F 1CYIA 4OWFA 2V7QH 1GZLA 5AW9B 5C9MA 3A0BE 5E79E 1B7VA 4OGQB 2N1TA 2E42A 2QEXP 2WMMA 2WSEJ 1CSWA 1URQD 2GIWA 1CI6B 5M1BA 3RK2C 4FA9A 2Q7CA 4PJ0V 2Q1KA 4RKUJ 4U3FG 1ZOYC 3H1JD 1DEBA 1HTLC 3A2AA 3WUIA 4PW9B 2K9JA 3L70G 4FAVA 4WY4C 4XFJA 4L75A 4W7ZA 5KAFV 1J1EC 1CIGA 2BPBB 1CRYA 1VYDA 3MP7B 1YEAA 4WQ9A 5AURA 3L71G 1GW4A 5AVWB 1N9CA 4HH2A 3FWLA 1RY3A 1SQVK 2E76B 2MJZA 1C6RA 5TISV 2N1TC 2R3SA 1SQXE 1LMSA 1JUNA 3CU4A 4L74A 1KYOI 3H1LJ 1L0NK 2OYIA 2IZ0A 2B88A 4MN4C 2FBWC 1M1JB 1RAPA 2B87A 3SXTA 2JKVA 4K3AA 5CBOA 1I5TA 3AE5C 1FZGA 1NU1K 1G2CA 4NPEA 2H43A 1YIQA 1OW7A 2W6BA 3VNWA 3TF5A 2YMYA 3H1KE 2QM7A 3Q5SA 2FXPA 1CHIA 1EQ7A 4PV1B 4WB4A 1NTME 2VHDA 2XTSB 2QSIA 4KHXA 5DJTB 2AIUA 4AAMA 2P10A 1FE6A 3CWBD 2AEJA 1OCDA 2H8PD 1AVYA 1OWAA 2O1JA 1S72P 4OVNF 2OYIC 1QVFO 1L0NJ 2ZXYA 1G1IA 3VYMA 2ZT9C 1NTZD 3M06A 1KYOE 3RK3E 3R2PA 2HODB 5AW2B 2DVHA 2YXRB 1NU1J 3CX5H 3JCUE 1RF0A 5AW7B 1FOSE 1MUUA 3OCDA 1MZ9A 1NH4A 3IN6A 1DH3A 1LT1A 4JCGA 1WRGA 1GW3A 1GL2D 1CTJA 2FRCA 3Q3DA 2JTIB 3G9RA 1WVEC 2R44A 3OJAB 1M57D 4GOFA 1FZEA 1OW8A 2EXVA 2JJLA 3W68A 2C9XB 4XA4A 4IFMA 3HD7A 2OYHB 3A0HE 5GTIH 3TSIA 3V4WA 2RMZA 3ZCFA 5BVZA 1JMMA 1CCHA 1CEDA 3Q5PA 1VQPP 1RF0C 1VQ7P 5KLVE 1HGZA 4JPZB 2KLVA 2N3YA 1JCDA 2YKPA 1HBWA 2AEFA 1X8YA 4YTPC 3L74J 1YTCA 1ZN5A 2Y0DA 3WU2E 1NNOA 1S9KD 1AQTA 2E43A 2FYNB 1L9BC 5GTHH 4AQRD 1QL2A 4N6JA 3V2RA 3FXDA 1CRIA 1Q82Q 1LJ2A 1SQBE 5AW8B 3UIAA 1COTA 4EI2A 1JM0A 3V4QA 1K9MQ 4DJGA 1ZV8A 3VMZA 1DIIC 2BASA 2AEMA 1H89A 1NAYA 4ASVA 4GIFA 1IZNB 5AW3B 2N9YB 1BDCA 4DOJA 3M9BA 1H31A 3BCCD 1IZL0 3G71P 1H88A 3HTKA 2WTYA 1LT9B 1NYHA 4PJ0E 2BLFB 1LWUB 2V4HA 1LC1A 1Z56A 2CXBA 4D6TE 3L73G 1M60A 3CCQP 4EIEA 2FFDB 2BCCG 1H32B 5CCGA 1ZZHA 2MTAC 3SSUA 3RK2D 3GF7A 2FWLA 1XTCC 2JQRA 5C0ZA 5KAFE 3VTPC 4JQ0D 3CWBG 4W80A 2Z5IA 5DJQB 4BRYB 1WEJF 1ZRTD 1FZBA 1PPJE 2E75B 3HTKB 4UB6H 3U1AA 3NXSA 2HR3A 3U1CA 4PD4D 2H88C 4Y99B 1GKSA 2IFNA 5TISE 5APTA 1RE4A 2AI5A 2XZRA 1EXJA 3HE5B 1BGYG 155CA 1M1KQ 3IFMA 2IBZI 1W2LA 4H44C 3KXDA 2WWWA 1YQ3C 2N1TD 4AUWA 3MK7C 2Y0EA 1AVOA 3EFFK 5B6QA 3H32A 2Y9ZA 5KAIH 1VF5B 3KZIE 5CCGC 2WQYC 4K35A 3TGUD 3WFDC 1SQQK 1ZR2A 3N4XA 1ZLLA 1DW1A 1DIPA 2ZXXA 1LP1B 1S1CX 5CIFB 3AE7C 1OIPA 2OGUA 2P7JA 1IJDB 3E1RA 2KNCA 3WUUA 2R5DA 4I7ZC 3O6QA 4RSZA 2OZ1B 3TNUB 5EFWB 1RE4C 2WT7B 3AECC 1H0TB 3C8VA 1CW5A 1KQFB 1SQXG 1FZCA 1LTGC 2IBZE 4H0JA 1CO6A 5B66V 2DW3A 1FBMA 1CIHA 1LTSC 4WQAA 4YXWH 2W27A 2BH4X 2ZT9D 1PP9D 1GK4A 1YJWP 5B5EH 3O6QB 1W2EA 4LGDE 1KQLA 3L75D 1URQC 1EDKA 3ZOWA 1CNOA 1C52A 1L4AB 1N73B 1AJYA 3AEAC 4UB8E 2Q3IA 3WFCC 2KSEA 1NTMG 1S6VB 2LXCB 4H13C 4WQCA 3AEBC 1SQVE 4RJTA 4C7NB 5CCHA 1FZCC 2WPQA 5L8RJ 3H1KJ 3CCMP 1KQSO 1CXAA 1L0NE 4AX3A 3OA7A 4FA4A 1OFCX 1KILA 4GODA 2B10B 4BXLA 1NU1E 1CYCA 1JOCA 3VMAA 4ZKUA 2A06E 4EIDA 3NTNA 2FYUD 1SVFA 2ZYDA 2K9YA 1CSVA 5TJHA 3CMAP 1H9XA 1NO4A 4W7YA 1KB9I 1BE3J 2N9BA 3GW6A 1DT1A 1FJ0A 4Q5PA 2KLUA 3MGNA 2IZ1A 3AEDC 3CC2P 3TDKA 2G3AA 1RF1A 3FGAD 3B5NA 2YIUC 2QJKC 1KILC 1GQ1A 2QRXA 3N7NA 1VQLP 1YEBA 3WMM0 1LNQA 1LTJA 3P8MC 3ZIYA 4JYCA 3H1LD 1OX3A 3KHUA 3PXTA 3JBTB 1L0LK 2E74B 3VP9A 1KFMA 2JWAA 2WITA 1KB9E 2V08A 1VQ4P 4HB1A 1K3HA 2XU6A 1IC2A 2GC4D 5KLVJ 3CXHD 1GL2C 3MIWA 1USEA 2B89A 1X79B 2K3RA 1T8ZA 1SQBG 1YQ4C 1ETPA 4AALA 1U75B 2NPSA 3G6EP 1CTYA 2PRRA 3HUSC 1IO3A 1E8EA 3LIEA 3M97X 4R4MA 3DMIA 5KLIC 1J1DB 1L0LJ 4KJMA 3RLMA 1KD1Q 1BSHA 1X9VA 2PAJA 4PD4H 4IL6V 4EIFA 4D6TG 4H44D 1H1OA 2B9BA 1Q81Q 3CXHW 1LTIC 5CCGD 1S5LH 2KZJA 3GHGA 3OAKA 2C1DB 2OQQA 2QE7H 1YITP 2NPSC 1G1JA 1PPJG 3H1IJ 1GTWA 2KB7P 3VYIA 4WQ7A 2ZYAA 3SVWA 2FXMA 3WU2H 1WMKA 4H0LC 3QWOC 1A02J 3PH2B 1CI6A 5APVA 3D71A 3GHGB 5APXA 3L4FA 1MZ4A 1CIFA 1GDVA 3BATA 3RK3C 1QN2A 2AXTH 3V2PA 2N3BA 3B8EB 2KK7A 1CYJA 1RZ5A 4BWNA 1GDTA 3NMDA 3II6A 3I55P 3Q1MA 2KXPB 1CCRA 1A2SA 3LIDA 4EIJA 2H89C 3S4RA 2QIWA 2I1KA 1FOCA 1M7LA 4OGQC 1HH0A 2YKQA 1DVVA 4A7PA 4WY4B 1Q2NA 2Y0CA 4H13D 4JF7A 2CA3B 1M1JA 3H1LG 2IBZG 2R3CA 1J1EB 3ORVA 2RKLA 3AE6C 1FCDC 2WSFJ 2PP6A 3HQ6A 1NTKK 3BVHA 1SQQE 2CPBA 3EWKA 2DGEA 4V2KA 1SFCB 3RN0A 3ZBMA 3PTZA 1C6OA 4WWIA 5AW0B 3CC4P 1N7SB 2ZJSE 3PRJA 3FWNA 2E76C 1KX7A 2N9IA 4LLHA 1BDDA 3H1HE 2WSSH 3CP5A 2HYNA 1YBKA 1PL5A 1M1JC 3GLMA 1VQOP 3KZIH 1L0NG 1BL9A 2HODA 5CCHD 3L73D 1OW6A 2BCCD 1P84I 3E1IA 1CC5A 1NTKJ 1NU1G 2MKVA 4O1QA 1KILD 1M70A 1SQVJ 1J3SA 5AW1B 4TLFA 4L76A 2A06G 2YKOA 1SQPK 3ZOYA 3S1KA 2CE0A 5CIGB 4M3LA 1DW3A 1T2KC 1A8CA 3L72E 3WFEC 3L4OA 3PH0A 1AOQA 1T3JA 2XDJA 1BE3E 1YICA 1CHHA 1BGYD 3NBSA 2ZVNB 3A3YB 2KZIA 2OYHA 2QVAA 1I54A 4DT0A 4P4QB 1USDA 1MG3D 2ZBOA 3B5ND 1P84E 2JEEA 3CXHH 1EXIA 3CL3D 1GU2A 1C75A 2GUSA 4UB8H 1SQPJ 2ZZS1 5APUA 3KDPB 5CJ4A 2L5GB 2C1VA 5CYTR 3TYIA 2ORLA 3L74G 3F5HA 1K8AQ 1DEEG 1C2RA 4IL6E 1DIQC 3V6IA 3OA8B 5AVVB 3MD0A 1MKMA 3HQ7A 3LW5H 1ZRTE 2IYPA 3GG2A 1BCCE 1SQXD 2K88A 5GTIV 3AE2C 2ZYGA 3CYTI 1H9YA 1VQ5P 1YJNP 1QYZA 5BU8B 1YIJP 2D0WA 2YNYA 3ITKA 3MZWB 2WPVB 3M0AA 1OVVA 3H25A 2NPSD 3RBXA 1M6ZA 3HD7C 1L0LE 1NTMD 1LT9A 4Z1MH 5AVZB 1LWUA 5GTHV 2IPPA 3E7KA 2FFDA 1RE3A 1FJPA 1HGVA 4H0LD 2GM4A 1H32A 2C0WA 1JB0J 4IL6X 3QH9A 3H1JJ 2SPZA 2Z5HA 1U57A 2M3EA 3VP8A 1BSNA 1NKNA 1KYOD 3SJLA 4TT3H 2FYZA 3RK3D 4BRYA 2A45G 1IRWA 1X0TA 5KKZC 1DVHA 3SFDC 2PGDA 3VMXA 4CPGA 2YO2A 1EZVI 3H1IE 2WVRA 3HE5A 3Q2YA 1SS1A 4K3IA 1GIWA 3P8CD 3L75E 5APQA 3IAOA 3AEEC 4OGQD 3MHVA 1LWUC 2B0ZB 1MFZA 2O3JA 4RESB 5H2FH 1NTZK 2FFDC 3PP5A 1PZQA 1KORA 1PIXA 1S4XA 3KYQA 3RL0B 4Y5RA 1JTHB 1DX7A 1N86A 3RMZA 1R5LA 1W5CT 1RQUA 1JY3O 1LP1A 2L91A 1HJBA 1FC2C 2D2CB 4UB6V 1NKZB 1KYOW 2E75C 1EDJA 3AEGC 2QJYB 2OZ1A 3TNUA 1GU4A 1PGJA 4Y99C 3HQ8A 2WT7A 5KLVD 2KUBA 3MK7B 1RH5B 1H0TA 1JMBA 3RN1A 1R5SA 1CZQA 5CICB 4AAOA 1EZVE 3CX5I 2E76D 3I56P 1DD4A 451CA 5KAIV 1JY2O 1NTZJ 2YO3A 3C9IA 3O8ZA 1VF5C 2JO1A 1IK9A 4I7ZB 2A45H 2W6JH 1OVRA 1L4AA 4LC1A 1IQCA 1A56A 2Q6QA 1N73A 4O1WA 1SQBD 2P67A 3L37A 1CXCA 1EC5A 4U3FE 1IO4A 1RZ6A 3L70E 4C7NA 1T2KD 1SQQJ 4IOIH 5AW6B 1CHJA 3VN0A 1Y47A 3CX5E 1URQB 3H1KG 2XV5A 3V2NA 5B5EV 1FDMA 3L71E 4WQ8A 4D6TD 3A0BH 5E79H 2GC7D 2QG4A 1XTGB 1NTKE 2FKWB 1L4AC 3RGUA 2KSJA 3H1HJ 4XYDB 1VQMP 1NMLA 2PFXA 2AXCA 1PPJD 2CPSA 4H0KA 1YHQP 3KPEA 2B4ZA 1BE3G 1W2BO 2FXOA 3CCJP 1LTAC 5GTIE 2W6AA 1MG2D 1N15A 1EDIA 3R4YA 2MHMA 1AYGA 1SLQA 3L72J 1NOHA 4GDOA 2D0SA 1E5WA 1W5CE 4EYYQ 5CCHC 2O01N 2RN0A 1KZUB 1SQPE 1VQ9P 3CCVP 1HZUA 2HFED 2J59M 5GTHE 4QAOA 3BCCJ 3KQGA 2YIUB 2QJKB 2N18C 3HD7D 2YK3A 1CSUA 2BCNB 2IX7C 1M56D 4HJGH 5KLVG 3JSVC 3ABVC 4J20A 1YFCA 4OH8B 2IBZD 2NZ2A 2QJPB 4XXLA 2BEQD 2W90A 3MTUE 1E29A 3M0DA 2K37A 4KT0J 3P32A 4LJIA 2P58A 351CA 3X39A 2LXBA 4C7RA 2QM8A 3M9QA 1NMIA 1KYOH 1BCCJ 4NPFX 2RH0A 1RF1C 1IFJA 2E74C 1YNRA 3B5NC 2ZVOB 1GL2B 4FB1A 2HG5D 3JCUH 5K5GB 1L0LG 2KS1A 2XKMA 1KC8Q 1OZHA 1LTJC 2POHA 2CA4B 1YCCA 3HE4A 3H1JE 1OVUA 1IK7A 3TGUJ 1L0ND 3CCSP 5DFSA 4UB6E 3HUSB 3D6ZA 3HQ9A 2C1DA 3WFBC 3M0DC 4IFFA 1T6AA 1NU1D 2WSCH 2QA4P 4IFDK 3G3ZA 3VRDA 2KS1B 1NAFA 3MUDA 5APYA 2A06D 3V2QA 3O0RC 3DP5A 2E75D 3CCEP 3A0HH 3H1IG 3HE4B 1J1DC 3WC8A 3PHLA 1HJ5A 2V7QJ 5KAIE 3B71A 1FI3A 3VMYA 1N50A 2Y9YA 2O01H 2JR8A 2H7HA 1UIXA 4B86A 1S5LV 1PP9J 4YPCA 1VF5D 2I8DA 1NHLA 1NWQA 1ZR4A 3L75J 1CORA 1I55A 2FYUK 1M8OB 4GT1A 1HJ3A 5B66E 1KIBA 1DW0A 1QX8A 1Q86Q 4L3HA 1JEKA 1LC2A 4AYCA 1RAQA 1C6SA 4WY4A 2OYOA 3CWBE 2OTKE 3T97B 3L74D 3GHGC 5KJ7A 3FX0A 2AXTV 5B5EE 1OXZA 1NTZE 1YTZT 1JY3P 1KB9D 4ZMDA 1DD3A 2OTJP 1IFDA 3L36A 3RK2B 1JY2N 2IFMA 3SLEA 2UWJE 1BGYE 1SFCA 2I1JA 1KV9A 4PJ0H 2HLOA 5CIDB 2FYUJ 2C9LY 1FI9A 2M5AB 4MU8A 1FS0E 4JBZA 1HF9A 1L4AD 1MFTA 1MV8A 1N7SA 1EB7A 1EDLA 3BRVB 2Z4EA 5CIHB 2R32A 1QEXA 1VDFA 5KAFH 2VRSA 4N78D 5C39A 3CD6P 1FHBA 1CSXA 1GK6A 4N3YB 4I2LC 3C1LA 1QL1A 1JY2P 2YQBA 5KJ7C 2N1TB 5TISH 2C2CA 4U3FJ 2M8RA 1LFMA 2KIKA 1FOSF 2BGVX 3L70J 4ZKPA 1NTKG 1JCCA 1SFCC 2WSEH 1SQVG 2K9JB 2ITAA 2W8ZA 5EXQA 3V5BA 1N7SC 1PFIA 1AKKA 1LTTC 3L71J 1FDIA 1F1FA 1K04A 2B11B 2YMKA 2BEZF 2HV4A 1PGOA 3KZIV 1S9KE 2Q5UA 4DY9A 1IRVA 1ZP0C 1U7JA 1YTZI 2WSFH 3WUVA 2NRGA 5CHXA 4PV1C 2LKMA 5CIBB 2OYIB 1HZVA 1D7MA 2CK3H 5BU5A 4O9BA 3A5TA 2ZT9B 2GB8B 1AV1A 2B87B 1G2CB 1LS9A 1C7MA 4PD4I 1E79H 3AE3C 2LR2A 3LW5J 3CCLP 3P7KA 1SQPG 3BRTB 3OA8A 4FA5A 3BCCE 1NVOA 3PJSK 2E74D 3CPWO 2GUVA 1I6EA 4PWAA 1FAVA 2XNXA 3TK1A 2KP8A 1VQ6P 4WQEA 4YXDC 4I6MC 3P8CE 4GKGA 4EDFA 2YCCA 4HYTB 3TYYA 3EFGA 4UB8V 2YXQB 2P2UA 4FANA 1SQQD 2PCCB 1QGKB 4PD4E 4C46A 1DW2A 3PXSA 1HH7A 3AE8C 2OYHC 1JDLA 3OCDB 1F1CA 5AW4B 4NPDA 2P1JA 1KTMA 1X22A 1S5LE 2CE1A 3RL0g 3H1HD 1FZAA 2E5TA 1HRCA 1A02F 2HPCA 3H1JG 3H1KD 5IY51 5CMZA 3TGUE 3IF4A 2M0BA 4JYBA 4N0KA 3CLQA 4WVZA 3F89A 1R8EA 3HD7B 2FYNC 2V07A 1VQKP 2E5YA 2FY8A 2M3BA 1CRGA 1H33A 4GOEA 1S3JA 3AE9C 3SFEC 2HPCB 5AVRB 2JDIH 2AXTE 1PGPA 3L72D 1I6DA 1I8OA 4RO0A 1N90A 1BE3D 1JTHA 1JNMA 1QVGO 5KKZB 1J2JB 1CRJA 1Y9BA 1PP9E 1S5LX 2ZAEB 2K1AA 1H33B 1QKSA 1S2EA 3CI9A 1QL3A 3JC22 1KB9H 1LT9C 1P84D 1RE3C 3H6PA 5DF5A 1M90Q 2IDBA 1KN7A 3A7OA 3O5CA 3D70A 3W67A 4FA1A 5H2FV 5AVTB 1CRHA 2B12B 5DJQC 2Q9IA 1Y8AA 1YYCA 4WY4D 1KMIZ 4YE1A 4HKZH 1H31B 3RL0C 1NTZG 1JO5A 4H44B 3L73J 5KJ7D 2BCCJ 1BCCD 1E2RA 2D2CC 3Q5RA 1FJKA 2KI7B 3CWBJ 2FYUE 3IR9A 1OAEA 3D0WA 2QJYC 3AE4C 1CRCA 1SFCD 1CTZA 4EICA 1AA0A 1NIRA 1PV3A 1N7SD 1CSBA 3ZOOA 2R5BA 1BGYJ 1SQQG 1SQXK 1URQA 3CXHI 1HJ0A 1YI2P 1L0LD 5CJ0A 2C1UA 2I8FA 3M91A 3AE1C 1Q7YQ 1UIIA 4PV1D 5B66H 3GMAA 3H32B 5CIEB 3G4SP 3WUTA 4Y28J 4WQDA 1IFIA 3H1HG 2L4DA 1C2NA 1IFMA 4EOTA 4GYDA 1HUCA 3PLNA 3H1LE 3AEFC 1IFPA 2IYOA 1FDOA 1NTMK 2KNCB 3K5BA 1FU1A 3L35A 3H1ID 3D6YA 1GMJA 1HROA 1RQVA 4H13B 4WBAA 2Q3EA 1SQXJ 4L1QA 2WPRA 3A0BV 1ZW0A 5E79V 1N73C 1VQNP 3CXHE 1R0QA 1FZCB 2C8SA 1PGQA 2JP3A 3SWYA 1KFNA 3L72G 4R4LA 3C2CA 5AVQB 2OTLP 1HCMA 1U74B 4GEDB 4NFGB 3USSA 3EQ2A 1AFOA 4L73A 3L4MA 1NTMJ 2C0XA 3BCCG 1FZFA 5APWA 2WPSA 3M9HA 1KQGB 1EZVD 3HRNA 5DJUB 1K73Q 3SWSA 4ZNCA 2KYVA 1N2DC 3SWKA 1VQ8P 5KTBA 2WZ7A 2GA1A 3DR0A 3ZOXA 1KILB 1HJ4A 2PCBB 4AANA 2J58A 1RHZB 2XNDH 2N18B 5KLVK 3I5CA 1BCCG 2ZONG 3NBTA 1K3GA 3PXWA 1GL2A 2J5UA 4ASWA 4U3FD 1OMIA 1QL4A 3L70D 2BH5X 3BASA 3VOPA 2G8YA 1N8RQ 3CX5D 2WSCJ 2QJPC 3HUSA 4DCKA 2LIRA 1K05A 1WT6A 3TGUG 1KX2A 2PACA 3L71D 5AVUB 1L9JC 1U7MA 3L74E 1RF1B 3B5NB 2ZFCA 1SQBK 2O1KA 1KV4A 1NTKD 3B4SA 1SQVD 1T3UA 2O01J 2N9JA 2W83C 5AW5B 4WQBA 5H2FE 1LTJB 3NFQA 1YJ9P 1LGHB 4L3GA 2A45I 1P84H 1AOFA
chains in the Genus database with same CATH topology
1NTMD 3NWVA 5GTHV 5KLIB 3L75D 2K9JB 3ZOWA 1CNOA 1C52A 5EXQA 1H32A 3A9FA 1AKKA 3WFCC 1F1FA 2ZOOA 3O1YA 2B11B 1S6VB 3CX5W 1KYOD 3SJLA 2HV4A 4WQCA 3KZIV 4DY9A 4RJTA 1IRVA 3A0HV 1IRWA 1DVHA 3O20A 1CXAA 4AX3A 5CIBB 4FA4A 1HZVA 1SQPD 4K3IA 1GIWA 2GB8B 2B10B 1I8PA 1CYCA 1GJQA 3VMAA 2B0ZB 1LS9A 1C7MA 2O3JA 1FI7A 4EIDA 2FYUD 1CIEA 3WU2V 1CSVA 5TJHA 4Y5RA 4KMGA 3OA8A 3RMZA 1W5CT 1H9XA 4FA5A 2L91A 4UB6V 1KYOW 1I6EA 3GW6A 4PWAA 1DT1A 1FJ0A 2LITA 1KB0A 4Q5PA 2QJYB 2OZ1A 4WQEA 3TDKA 3HQ8A 1CYIA 5KLVD 4EDFA 3MK7B 2YCCA 3RN1A 5CICB 1GQ1A 4AAOA 4UB8V 5C9MA 1B7VA 1YEBA 4FANA 451CA 1SQQD 5KAIV 1CSWA 2PCCB 2GIWA 3ZIYA 4FA9A 1DW2A 3H1LD 4PJ0V 3KHUA 3PXTA 3PXSA 1HH7A 3JBTB 1JDLA 3H1JD 3OCDB 3WUIA 4PW9B 4FAVA 1F1CA 2JWAA 1IQCA 5KAFV 1A56A 2CE1A 1CIGA 4O1WA 1SQBD 3H1HD 2BPBB 2V08A 1HRCA 1CRYA 1VYDA 1K3HA 1YEAA 2GC4D 4WQ9A 1CXCA 5AURA 3H1KD 3CXHD 5IY51 1RZ6A 1N9CA 3FWLA 4N0KA 1C6RA 5TISV 1ETPA 4AALA 1U75B 1CHJA 1LMSA 2V07A 3CU4A 1CTYA 1CRGA 5B5EV 1H33A 1RAPA 1IO3A 1E8EA 3SXTA 4WQ8A 4D6TD 3M97X 3DMIA 2GC7D 1I5TA 2QG4A 3L72D 1I6DA 1YIQA 3RLMA 3VNWA 4XYDB 1I8OA 1N90A 1BE3D 4IL6V 3TF5A 4EIFA 1NMLA 1CHIA 5KKZB 1CRJA 1H1OA 1PPJD 4H0KA 2VHDA 1H33B 2XTSB 1QKSA 2B4ZA 3CXHW 1QL3A 2AIUA 4AAMA 2C1DB 3CWBD 1OCDA 1P84D 5DF5A 1MG2D 2ZXYA 3VYMA 1NTZD 1N15A 3O5CA 2MHMA 1AYGA 4FA1A 5H2FV 4WQ7A 3SVWA 2D0SA 1CRHA 2B12B 2DVHA 5DJQC 3PH2B 4YE1A 1H31B 2RN0A 1MZ4A 1CIFA 1GDVA 3OCDA 1QN2A 1BCCD 1HZUA 4JCGA 2N3BA 4QAOA 1CYJA 1E2RA 1RZ5A 2YIUB 1CTJA 2FRCA 2QJKB 2JTIB 1WVEC 2N18C 1OAEA 2YK3A 1CSUA 1CRCA 2BCNB 1CCRA 1A2SA 1CTZA 2EXVA 4J20A 1YFCA 4EICA 2C9XB 2IBZD 1NIRA 2QJPB 1FOCA 4XXLA 3ZOOA 1DVVA 1E29A 4A7PA 2RMZA 3ZCFA 4LJIA 1CCHA 1L0LD 1CEDA 2C1UA 351CA 2Y0CA 2CA3B 3X39A 2I8FA 1NMIA 3ORVA 1FCDC 2N3YA 1YNRA 3HQ6A 4FB1A 1YTCA 5CIEB 2KS1A 2DGEA 4WQDA 2Y0DA 4V2KA 2L4DA 1C2NA 4GYDA 3PLNA 1NNOA 3RN0A 3ZBMA 2FYNB 2CA4B 3PTZA 1C6OA 1L9BC 1YCCA 2KNCB 3PRJA 1L0ND 5DFSA 1KX7A 3H1ID 2N9IA 3HQ9A 1CRIA 2C1DA 3WFBC 1HROA 1COTA 2Q3EA 3CP5A 1NU1D 4L1QA 3VRDA 3A0BV 5E79V 1R0QA 1DIIC 2A06D 3O0RC 3DP5A 1BL9A 2C8SA 3L73D 2BCCD 3WC8A 1CC5A 3PHLA 1HJ5A 2N9YB 3C2CA 4O1QA 1FI3A 1H31A 3BCCD 1IZL0 1N50A 1M70A 1J3SA 1HCMA 1U74B 4GEDB 2BLFB 1LC1A 2CXBA 4NFGB 1M60A 4EIEA 3ZOYA 1S5LV 1H32B 2CE0A 5CIGB 3L4MA 1ZZHA 2MTAC 1DW3A 1A8CA 2FWLA 2JQRA 3WFEC 3L4OA 5C0ZA 1CORA 1I55A 1AOQA 1HJ3A 1YICA 1EZVD 1KIBA 1CHHA 5DJQB 1BGYD 1WEJF 3SWSA 1DW0A 3NBSA 1ZRTD 4L3HA 1LC2A 1RAQA 1C6SA 4PD4D 1I54A 4P4QB 1GKSA 2AI5A 1MG3D 2ZBOA 3DR0A 3ZOXA 155CA 1HJ4A 2PCBB 4AANA 3L74D 2AXTV 1W2LA 1GU2A 1C75A 2N18B 2ZONG 3NBTA 1K3GA 1KB9D 3MK7C 3PXWA 2Y0EA 2ZZS1 5B6QA 2C1VA 5CYTR 3TYIA 2ORLA 4U3FD 3TGUD 3SLEA 3WFDC 1C2RA 1DIQC 3OA8B 1KV9A 1DW1A 1QL4A 3L70D 3HQ7A 5CIDB 1FI9A 4MU8A 5CIFB 2BH5X 3GG2A 1EB7A 1SQXD 5CIHB 3CX5D 5GTIV 2LIRA 1FHBA 1CSXA 4RSZA 2OZ1B 1KX2A 3CYTI 2PACA 1H9YA 3L71D 1L9JC 2YQBA 1QYZA 1NTKD 2D0WA 1SQVD 3ITKA 2N9JA 4H0JA 1CO6A 5B66V 4WQBA 1CIHA 2C2CA 1LFMA 4L3GA 4WQAA 2BGVX 2BH4X 1AOFA 1PP9D 1M6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM D;  3NWV A;  5GTH V;  5KLI B;  3L75 D;  2K9J B;  3ZOW A;  1CNO A;  1C52 A;  5EXQ A;  1H32 A;  3A9F A;  1AKK A;  3WFC C;  1F1F A;  2ZOO A;  3O1Y A;  2B11 B;  1S6V B;  3CX5 W;  1KYO D;  3SJL A;  2HV4 A;  4WQC A;  3KZI V;  4DY9 A;  4RJT A;  1IRV A;  3A0H V;  1IRW A;  1DVH A;  3O20 A;  1CXA A;  4AX3 A;  5CIB B;  4FA4 A;  1HZV A;  1SQP D;  4K3I A;  1GIW A;  2GB8 B;  2B10 B;  1I8P A;  1CYC A;  1GJQ A;  3VMA A;  2B0Z B;  1LS9 A;  1C7M A;  2O3J A;  1FI7 A;  4EID A;  2FYU D;  1CIE A;  3WU2 V;  1CSV A;  5TJH A;  4Y5R A;  4KMG A;  3OA8 A;  3RMZ A;  1W5C T;  1H9X A;  4FA5 A;  2L91 A;  4UB6 V;  1KYO W;  1I6E A;  3GW6 A;  4PWA A;  1DT1 A;  1FJ0 A;  2LIT A;  1KB0 A;  4Q5P A;  2QJY B;  2OZ1 A;  4WQE A;  3TDK A;  3HQ8 A;  1CYI A;  5KLV D;  4EDF A;  3MK7 B;  2YCC A;  3RN1 A;  5CIC B;  1GQ1 A;  4AAO A;  4UB8 V;  5C9M A;  1B7V A;  1YEB A;  4FAN A;  451C A;  1SQQ D;  5KAI V;  1CSW A;  2PCC B;  2GIW A;  3ZIY A;  4FA9 A;  1DW2 A;  3H1L D;  4PJ0 V;  3KHU A;  3PXT A;  3PXS A;  1HH7 A;  3JBT B;  1JDL A;  3H1J D;  3OCD B;  3WUI A;  4PW9 B;  4FAV A;  1F1C A;  2JWA A;  1IQC A;  5KAF V;  1A56 A;  2CE1 A;  1CIG A;  4O1W A;  1SQB D;  3H1H D;  2BPB B;  2V08 A;  1HRC A;  1CRY A;  1VYD A;  1K3H A;  1YEA A;  2GC4 D;  4WQ9 A;  1CXC A;  5AUR A;  3H1K D;  3CXH D;  5IY5 1;  1RZ6 A;  1N9C A;  3FWL A;  4N0K A;  1C6R A;  5TIS V;  1ETP A;  4AAL A;  1U75 B;  1CHJ A;  1LMS A;  2V07 A;  3CU4 A;  1CTY A;  1CRG A;  5B5E V;  1H33 A;  1RAP A;  1IO3 A;  1E8E A;  3SXT A;  4WQ8 A;  4D6T D;  3M97 X;  3DMI A;  2GC7 D;  1I5T A;  2QG4 A;  3L72 D;  1I6D A;  1YIQ A;  3RLM A;  3VNW A;  4XYD B;  1I8O A;  1N90 A;  1BE3 D;  4IL6 V;  3TF5 A;  4EIF A;  1NML A;  1CHI A;  5KKZ B;  1CRJ A;  1H1O A;  1PPJ D;  4H0K A;  2VHD A;  1H33 B;  2XTS B;  1QKS A;  2B4Z A;  3CXH W;  1QL3 A;  2AIU A;  4AAM A;  2C1D B;  3CWB D;  1OCD A;  1P84 D;  5DF5 A;  1MG2 D;  2ZXY A;  3VYM A;  1NTZ D;  1N15 A;  3O5C A;  2MHM A;  1AYG A;  4FA1 A;  5H2F V;  4WQ7 A;  3SVW A;  2D0S A;  1CRH A;  2B12 B;  2DVH A;  5DJQ C;  3PH2 B;  4YE1 A;  1H31 B;  2RN0 A;  1MZ4 A;  1CIF A;  1GDV A;  3OCD A;  1QN2 A;  1BCC D;  1HZU A;  4JCG A;  2N3B A;  4QAO A;  1CYJ A;  1E2R A;  1RZ5 A;  2YIU B;  1CTJ A;  2FRC A;  2QJK B;  2JTI B;  1WVE C;  2N18 C;  1OAE A;  2YK3 A;  1CSU A;  1CRC A;  2BCN B;  1CCR A;  1A2S A;  1CTZ A;  2EXV A;  4J20 A;  1YFC A;  4EIC A;  2C9X B;  2IBZ D;  1NIR A;  2QJP B;  1FOC A;  4XXL A;  3ZOO A;  1DVV A;  1E29 A;  4A7P A;  2RMZ A;  3ZCF A;  4LJI A;  1CCH A;  1L0L D;  1CED A;  2C1U A;  351C A;  2Y0C A;  2CA3 B;  3X39 A;  2I8F A;  1NMI A;  3ORV A;  1FCD C;  2N3Y A;  1YNR A;  3HQ6 A;  4FB1 A;  1YTC A;  5CIE B;  2KS1 A;  2DGE A;  4WQD A;  2Y0D A;  4V2K A;  2L4D A;  1C2N A;  4GYD A;  3PLN A;  1NNO A;  3RN0 A;  3ZBM A;  2FYN B;  2CA4 B;  3PTZ A;  1C6O A;  1L9B C;  1YCC A;  2KNC B;  3PRJ A;  1L0N D;  5DFS A;  1KX7 A;  3H1I D;  2N9I A;  3HQ9 A;  1CRI A;  2C1D A;  3WFB C;  1HRO A;  1COT A;  2Q3E A;  3CP5 A;  1NU1 D;  4L1Q A;  3VRD A;  3A0B V;  5E79 V;  1R0Q A;  1DII C;  2A06 D;  3O0R C;  3DP5 A;  1BL9 A;  2C8S A;  3L73 D;  2BCC D;  3WC8 A;  1CC5 A;  3PHL A;  1HJ5 A;  2N9Y B;  3C2C A;  4O1Q A;  1FI3 A;  1H31 A;  3BCC D;  1IZL 0;  1N50 A;  1M70 A;  1J3S A;  1HCM A;  1U74 B;  4GED B;  2BLF B;  1LC1 A;  2CXB A;  4NFG B;  1M60 A;  4EIE A;  3ZOY A;  1S5L V;  1H32 B;  2CE0 A;  5CIG B;  3L4M A;  1ZZH A;  2MTA C;  1DW3 A;  1A8C A;  2FWL A;  2JQR A;  3WFE C;  3L4O A;  5C0Z A;  1COR A;  1I55 A;  1AOQ A;  1HJ3 A;  1YIC A;  1EZV D;  1KIB A;  1CHH A;  5DJQ B;  1BGY D;  1WEJ F;  3SWS A;  1DW0 A;  3NBS A;  1ZRT D;  4L3H A;  1LC2 A;  1RAQ A;  1C6S A;  4PD4 D;  1I54 A;  4P4Q B;  1GKS A;  2AI5 A;  1MG3 D;  2ZBO A;  3DR0 A;  3ZOX A;  155C A;  1HJ4 A;  2PCB B;  4AAN A;  3L74 D;  2AXT V;  1W2L A;  1GU2 A;  1C75 A;  2N18 B;  2ZON G;  3NBT A;  1K3G A;  1KB9 D;  3MK7 C;  3PXW A;  2Y0E A;  2ZZS 1;  5B6Q A;  2C1V A;  5CYT R;  3TYI A;  2ORL A;  4U3F D;  3TGU D;  3SLE A;  3WFD C;  1C2R A;  1DIQ C;  3OA8 B;  1KV9 A;  1DW1 A;  1QL4 A;  3L70 D;  3HQ7 A;  5CID B;  1FI9 A;  4MU8 A;  5CIF B;  2BH5 X;  3GG2 A;  1EB7 A;  1SQX D;  5CIH B;  3CX5 D;  5GTI V;  2LIR A;  1FHB A;  1CSX A;  4RSZ A;  2OZ1 B;  1KX2 A;  3CYT I;  2PAC A;  1H9Y A;  3L71 D;  1L9J C;  2YQB A;  1QYZ A;  1NTK D;  2D0W A;  1SQV D;  3ITK A;  2N9J A;  4H0J A;  1CO6 A;  5B66 V;  4WQB A;  1CIH A;  2C2C A;  1LFM A;  4L3G A;  4WQA A;  2BGV X;  2BH4 X;  1AOF A;  1PP9 D;  1M6Z A; 
#chains in the Genus database with same CATH topology
 2C9N Y;  3NWV A;  5AVY B;  4DZO A;  5KLI B;  1SP4 A;  4I1L A;  3A9F A;  4N78 E;  3GF3 A;  4U7J A;  5CBN A;  3RL0 D;  1PP9 G;  3CCU P;  4IL6 H;  2ZOO A;  3O1Y A;  3CX5 W;  1IFN A;  1QLE D;  3L75 G;  1LTB C;  2ZXE B;  1GD2 E;  1SQB J;  2D2C D;  4QMA A;  2OAR A;  3A0H V;  3RBZ A;  3U59 A;  1L2P A;  1VPC A;  3O20 A;  1HVV A;  2NPS B;  3ZDM A;  1HWT C;  1SQP D;  3T97 A;  3SWF A;  1VL2 A;  1NJI Q;  1I8P A;  1GJQ A;  5AVS B;  5APS A;  4H0L B;  1FI7 A;  1GU5 A;  1JY3 N;  3OW2 O;  1Q90 D;  1NGM B;  3CME P;  1ZME C;  1CIE A;  3CC7 P;  3L73 E;  3WU2 V;  4D6T J;  2BCC E;  3MUD C;  4KMG A;  4XE5 B;  3RK3 B;  1KIL E;  2JWD A;  1EZV G;  2M5A A;  3FXE A;  1AQ5 A;  1ZXG A;  3CCR P;  2FYU G;  2KOG A;  5AVX B;  2LIT A;  1N7L A;  1KB0 A;  1H8A A;  3S9O A;  1TU3 F;  1CYI A;  4OWF A;  2V7Q H;  1GZL A;  5AW9 B;  5C9M A;  3A0B E;  5E79 E;  1B7V A;  4OGQ B;  2N1T A;  2E42 A;  2QEX P;  2WMM A;  2WSE J;  1CSW A;  1URQ D;  2GIW A;  1CI6 B;  5M1B A;  3RK2 C;  4FA9 A;  2Q7C A;  4PJ0 V;  2Q1K A;  4RKU J;  4U3F G;  1ZOY C;  3H1J D;  1DEB A;  1HTL C;  3A2A A;  3WUI A;  4PW9 B;  2K9J A;  3L70 G;  4FAV A;  4WY4 C;  4XFJ A;  4L75 A;  4W7Z A;  5KAF V;  1J1E C;  1CIG A;  2BPB B;  1CRY A;  1VYD A;  3MP7 B;  1YEA A;  4WQ9 A;  5AUR A;  3L71 G;  1GW4 A;  5AVW B;  1N9C A;  4HH2 A;  3FWL A;  1RY3 A;  1SQV K;  2E76 B;  2MJZ A;  1C6R A;  5TIS V;  2N1T C;  2R3S A;  1SQX E;  1LMS A;  1JUN A;  3CU4 A;  4L74 A;  1KYO I;  3H1L J;  1L0N K;  2OYI A;  2IZ0 A;  2B88 A;  4MN4 C;  2FBW C;  1M1J B;  1RAP A;  2B87 A;  3SXT A;  2JKV A;  4K3A A;  5CBO A;  1I5T A;  3AE5 C;  1FZG A;  1NU1 K;  1G2C A;  4NPE A;  2H43 A;  1YIQ A;  1OW7 A;  2W6B A;  3VNW A;  3TF5 A;  2YMY A;  3H1K E;  2QM7 A;  3Q5S A;  2FXP A;  1CHI A;  1EQ7 A;  4PV1 B;  4WB4 A;  1NTM E;  2VHD A;  2XTS B;  2QSI A;  4KHX A;  5DJT B;  2AIU A;  4AAM A;  2P10 A;  1FE6 A;  3CWB D;  2AEJ A;  1OCD A;  2H8P D;  1AVY A;  1OWA A;  2O1J A;  1S72 P;  4OVN F;  2OYI C;  1QVF O;  1L0N J;  2ZXY A;  1G1I A;  3VYM A;  2ZT9 C;  1NTZ D;  3M06 A;  1KYO E;  3RK3 E;  3R2P A;  2HOD B;  5AW2 B;  2DVH A;  2YXR B;  1NU1 J;  3CX5 H;  3JCU E;  1RF0 A;  5AW7 B;  1FOS E;  1MUU A;  3OCD A;  1MZ9 A;  1NH4 A;  3IN6 A;  1DH3 A;  1LT1 A;  4JCG A;  1WRG A;  1GW3 A;  1GL2 D;  1CTJ A;  2FRC A;  3Q3D A;  2JTI B;  3G9R A;  1WVE C;  2R44 A;  3OJA B;  1M57 D;  4GOF A;  1FZE A;  1OW8 A;  2EXV A;  2JJL A;  3W68 A;  2C9X B;  4XA4 A;  4IFM A;  3HD7 A;  2OYH B;  3A0H E;  5GTI H;  3TSI A;  3V4W A;  2RMZ A;  3ZCF A;  5BVZ A;  1JMM A;  1CCH A;  1CED A;  3Q5P A;  1VQP P;  1RF0 C;  1VQ7 P;  5KLV E;  1HGZ A;  4JPZ B;  2KLV A;  2N3Y A;  1JCD A;  2YKP A;  1HBW A;  2AEF A;  1X8Y A;  4YTP C;  3L74 J;  1YTC A;  1ZN5 A;  2Y0D A;  3WU2 E;  1NNO A;  1S9K D;  1AQT A;  2E43 A;  2FYN B;  1L9B C;  5GTH H;  4AQR D;  1QL2 A;  4N6J A;  3V2R A;  3FXD A;  1CRI A;  1Q82 Q;  1LJ2 A;  1SQB E;  5AW8 B;  3UIA A;  1COT A;  4EI2 A;  1JM0 A;  3V4Q A;  1K9M Q;  4DJG A;  1ZV8 A;  3VMZ A;  1DII C;  2BAS A;  2AEM A;  1H89 A;  1NAY A;  4ASV A;  4GIF A;  1IZN B;  5AW3 B;  2N9Y B;  1BDC A;  4DOJ A;  3M9B A;  1H31 A;  3BCC D;  1IZL 0;  3G71 P;  1H88 A;  3HTK A;  2WTY A;  1LT9 B;  1NYH A;  4PJ0 E;  2BLF B;  1LWU B;  2V4H A;  1LC1 A;  1Z56 A;  2CXB A;  4D6T E;  3L73 G;  1M60 A;  3CCQ P;  4EIE A;  2FFD B;  2BCC G;  1H32 B;  5CCG A;  1ZZH A;  2MTA C;  3SSU A;  3RK2 D;  3GF7 A;  2FWL A;  1XTC C;  2JQR A;  5C0Z A;  5KAF E;  3VTP C;  4JQ0 D;  3CWB G;  4W80 A;  2Z5I A;  5DJQ B;  4BRY B;  1WEJ F;  1ZRT D;  1FZB A;  1PPJ E;  2E75 B;  3HTK B;  4UB6 H;  3U1A A;  3NXS A;  2HR3 A;  3U1C A;  4PD4 D;  2H88 C;  4Y99 B;  1GKS A;  2IFN A;  5TIS E;  5APT A;  1RE4 A;  2AI5 A;  2XZR A;  1EXJ A;  3HE5 B;  1BGY G;  155C A;  1M1K Q;  3IFM A;  2IBZ I;  1W2L A;  4H44 C;  3KXD A;  2WWW A;  1YQ3 C;  2N1T D;  4AUW A;  3MK7 C;  2Y0E A;  1AVO A;  3EFF K;  5B6Q A;  3H32 A;  2Y9Z A;  5KAI H;  1VF5 B;  3KZI E;  5CCG C;  2WQY C;  4K35 A;  3TGU D;  3WFD C;  1SQQ K;  1ZR2 A;  3N4X A;  1ZLL A;  1DW1 A;  1DIP A;  2ZXX A;  1LP1 B;  1S1C X;  5CIF B;  3AE7 C;  1OIP A;  2OGU A;  2P7J A;  1IJD B;  3E1R A;  2KNC A;  3WUU A;  2R5D A;  4I7Z C;  3O6Q A;  4RSZ A;  2OZ1 B;  3TNU B;  5EFW B;  1RE4 C;  2WT7 B;  3AEC C;  1H0T B;  3C8V A;  1CW5 A;  1KQF B;  1SQX G;  1FZC A;  1LTG C;  2IBZ E;  4H0J A;  1CO6 A;  5B66 V;  2DW3 A;  1FBM A;  1CIH A;  1LTS C;  4WQA A;  4YXW H;  2W27 A;  2BH4 X;  2ZT9 D;  1PP9 D;  1GK4 A;  1YJW P;  5B5E H;  3O6Q B;  1W2E A;  4LGD E;  1KQL A;  3L75 D;  1URQ C;  1EDK A;  3ZOW A;  1CNO A;  1C52 A;  1L4A B;  1N73 B;  1AJY A;  3AEA C;  4UB8 E;  2Q3I A;  3WFC C;  2KSE A;  1NTM G;  1S6V B;  2LXC B;  4H13 C;  4WQC A;  3AEB C;  1SQV E;  4RJT A;  4C7N B;  5CCH A;  1FZC C;  2WPQ A;  5L8R J;  3H1K J;  3CCM P;  1KQS O;  1CXA A;  1L0N E;  4AX3 A;  3OA7 A;  4FA4 A;  1OFC X;  1KIL A;  4GOD A;  2B10 B;  4BXL A;  1NU1 E;  1CYC A;  1JOC A;  3VMA A;  4ZKU A;  2A06 E;  4EID A;  3NTN A;  2FYU D;  1SVF A;  2ZYD A;  2K9Y A;  1CSV A;  5TJH A;  3CMA P;  1H9X A;  1NO4 A;  4W7Y A;  1KB9 I;  1BE3 J;  2N9B A;  3GW6 A;  1DT1 A;  1FJ0 A;  4Q5P A;  2KLU A;  3MGN A;  2IZ1 A;  3AED C;  3CC2 P;  3TDK A;  2G3A A;  1RF1 A;  3FGA D;  3B5N A;  2YIU C;  2QJK C;  1KIL C;  1GQ1 A;  2QRX A;  3N7N A;  1VQL P;  1YEB A;  3WMM 0;  1LNQ A;  1LTJ A;  3P8M C;  3ZIY A;  4JYC A;  3H1L D;  1OX3 A;  3KHU A;  3PXT A;  3JBT B;  1L0L K;  2E74 B;  3VP9 A;  1KFM A;  2JWA A;  2WIT A;  1KB9 E;  2V08 A;  1VQ4 P;  4HB1 A;  1K3H A;  2XU6 A;  1IC2 A;  2GC4 D;  5KLV J;  3CXH D;  1GL2 C;  3MIW A;  1USE A;  2B89 A;  1X79 B;  2K3R A;  1T8Z A;  1SQB G;  1YQ4 C;  1ETP A;  4AAL A;  1U75 B;  2NPS A;  3G6E P;  1CTY A;  2PRR A;  3HUS C;  1IO3 A;  1E8E A;  3LIE A;  3M97 X;  4R4M A;  3DMI A;  5KLI C;  1J1D B;  1L0L J;  4KJM A;  3RLM A;  1KD1 Q;  1BSH A;  1X9V A;  2PAJ A;  4PD4 H;  4IL6 V;  4EIF A;  4D6T G;  4H44 D;  1H1O A;  2B9B A;  1Q81 Q;  3CXH W;  1LTI C;  5CCG D;  1S5L H;  2KZJ A;  3GHG A;  3OAK A;  2C1D B;  2OQQ A;  2QE7 H;  1YIT P;  2NPS C;  1G1J A;  1PPJ G;  3H1I J;  1GTW A;  2KB7 P;  3VYI A;  4WQ7 A;  2ZYA A;  3SVW A;  2FXM A;  3WU2 H;  1WMK A;  4H0L C;  3QWO C;  1A02 J;  3PH2 B;  1CI6 A;  5APV A;  3D71 A;  3GHG B;  5APX A;  3L4F A;  1MZ4 A;  1CIF A;  1GDV A;  3BAT A;  3RK3 C;  1QN2 A;  2AXT H;  3V2P A;  2N3B A;  3B8E B;  2KK7 A;  1CYJ A;  1RZ5 A;  4BWN A;  1GDT A;  3NMD A;  3II6 A;  3I55 P;  3Q1M A;  2KXP B;  1CCR A;  1A2S A;  3LID A;  4EIJ A;  2H89 C;  3S4R A;  2QIW A;  2I1K A;  1FOC A;  1M7L A;  4OGQ C;  1HH0 A;  2YKQ A;  1DVV A;  4A7P A;  4WY4 B;  1Q2N A;  2Y0C A;  4H13 D;  4JF7 A;  2CA3 B;  1M1J A;  3H1L G;  2IBZ G;  2R3C A;  1J1E B;  3ORV A;  2RKL A;  3AE6 C;  1FCD C;  2WSF J;  2PP6 A;  3HQ6 A;  1NTK K;  3BVH A;  1SQQ E;  2CPB A;  3EWK A;  2DGE A;  4V2K A;  1SFC B;  3RN0 A;  3ZBM A;  3PTZ A;  1C6O A;  4WWI A;  5AW0 B;  3CC4 P;  1N7S B;  2ZJS E;  3PRJ A;  3FWN A;  2E76 C;  1KX7 A;  2N9I A;  4LLH A;  1BDD A;  3H1H E;  2WSS H;  3CP5 A;  2HYN A;  1YBK A;  1PL5 A;  1M1J C;  3GLM A;  1VQO P;  3KZI H;  1L0N G;  1BL9 A;  2HOD A;  5CCH D;  3L73 D;  1OW6 A;  2BCC D;  1P84 I;  3E1I A;  1CC5 A;  1NTK J;  1NU1 G;  2MKV A;  4O1Q A;  1KIL D;  1M70 A;  1SQV J;  1J3S A;  5AW1 B;  4TLF A;  4L76 A;  2A06 G;  2YKO A;  1SQP K;  3ZOY A;  3S1K A;  2CE0 A;  5CIG B;  4M3L A;  1DW3 A;  1T2K C;  1A8C A;  3L72 E;  3WFE C;  3L4O A;  3PH0 A;  1AOQ A;  1T3J A;  2XDJ A;  1BE3 E;  1YIC A;  1CHH A;  1BGY D;  3NBS A;  2ZVN B;  3A3Y B;  2KZI A;  2OYH A;  2QVA A;  1I54 A;  4DT0 A;  4P4Q B;  1USD A;  1MG3 D;  2ZBO A;  3B5N D;  1P84 E;  2JEE A;  3CXH H;  1EXI A;  3CL3 D;  1GU2 A;  1C75 A;  2GUS A;  4UB8 H;  1SQP J;  2ZZS 1;  5APU A;  3KDP B;  5CJ4 A;  2L5G B;  2C1V A;  5CYT R;  3TYI A;  2ORL A;  3L74 G;  3F5H A;  1K8A Q;  1DEE G;  1C2R A;  4IL6 E;  1DIQ C;  3V6I A;  3OA8 B;  5AVV B;  3MD0 A;  1MKM A;  3HQ7 A;  3LW5 H;  1ZRT E;  2IYP A;  3GG2 A;  1BCC E;  1SQX D;  2K88 A;  5GTI V;  3AE2 C;  2ZYG A;  3CYT I;  1H9Y A;  1VQ5 P;  1YJN P;  1QYZ A;  5BU8 B;  1YIJ P;  2D0W A;  2YNY A;  3ITK A;  3MZW B;  2WPV B;  3M0A A;  1OVV A;  3H25 A;  2NPS D;  3RBX A;  1M6Z A;  3HD7 C;  1L0L E;  1NTM D;  1LT9 A;  4Z1M H;  5AVZ B;  1LWU A;  5GTH V;  2IPP A;  3E7K A;  2FFD A;  1RE3 A;  1FJP A;  1HGV A;  4H0L D;  2GM4 A;  1H32 A;  2C0W A;  1JB0 J;  4IL6 X;  3QH9 A;  3H1J J;  2SPZ A;  2Z5H A;  1U57 A;  2M3E A;  3VP8 A;  1BSN A;  1NKN A;  1KYO D;  3SJL A;  4TT3 H;  2FYZ A;  3RK3 D;  4BRY A;  2A45 G;  1IRW A;  1X0T A;  5KKZ C;  1DVH A;  3SFD C;  2PGD A;  3VMX A;  4CPG A;  2YO2 A;  1EZV I;  3H1I E;  2WVR A;  3HE5 A;  3Q2Y A;  1SS1 A;  4K3I A;  1GIW A;  3P8C D;  3L75 E;  5APQ A;  3IAO A;  3AEE C;  4OGQ D;  3MHV A;  1LWU C;  2B0Z B;  1MFZ A;  2O3J A;  4RES B;  5H2F H;  1NTZ K;  2FFD C;  3PP5 A;  1PZQ A;  1KOR A;  1PIX A;  1S4X A;  3KYQ A;  3RL0 B;  4Y5R A;  1JTH B;  1DX7 A;  1N86 A;  3RMZ A;  1R5L A;  1W5C T;  1RQU A;  1JY3 O;  1LP1 A;  2L91 A;  1HJB A;  1FC2 C;  2D2C B;  4UB6 V;  1NKZ B;  1KYO W;  2E75 C;  1EDJ A;  3AEG C;  2QJY B;  2OZ1 A;  3TNU A;  1GU4 A;  1PGJ A;  4Y99 C;  3HQ8 A;  2WT7 A;  5KLV D;  2KUB A;  3MK7 B;  1RH5 B;  1H0T A;  1JMB A;  3RN1 A;  1R5S A;  1CZQ A;  5CIC B;  4AAO A;  1EZV E;  3CX5 I;  2E76 D;  3I56 P;  1DD4 A;  451C A;  5KAI V;  1JY2 O;  1NTZ J;  2YO3 A;  3C9I A;  3O8Z A;  1VF5 C;  2JO1 A;  1IK9 A;  4I7Z B;  2A45 H;  2W6J H;  1OVR A;  1L4A A;  4LC1 A;  1IQC A;  1A56 A;  2Q6Q A;  1N73 A;  4O1W A;  1SQB D;  2P67 A;  3L37 A;  1CXC A;  1EC5 A;  4U3F E;  1IO4 A;  1RZ6 A;  3L70 E;  4C7N A;  1T2K D;  1SQQ J;  4IOI H;  5AW6 B;  1CHJ A;  3VN0 A;  1Y47 A;  3CX5 E;  1URQ B;  3H1K G;  2XV5 A;  3V2N A;  5B5E V;  1FDM A;  3L71 E;  4WQ8 A;  4D6T D;  3A0B H;  5E79 H;  2GC7 D;  2QG4 A;  1XTG B;  1NTK E;  2FKW B;  1L4A C;  3RGU A;  2KSJ A;  3H1H J;  4XYD B;  1VQM P;  1NML A;  2PFX A;  2AXC A;  1PPJ D;  2CPS A;  4H0K A;  1YHQ P;  3KPE A;  2B4Z A;  1BE3 G;  1W2B O;  2FXO A;  3CCJ P;  1LTA C;  5GTI E;  2W6A A;  1MG2 D;  1N15 A;  1EDI A;  3R4Y A;  2MHM A;  1AYG A;  1SLQ A;  3L72 J;  1NOH A;  4GDO A;  2D0S A;  1E5W A;  1W5C E;  4EYY Q;  5CCH C;  2O01 N;  2RN0 A;  1KZU B;  1SQP E;  1VQ9 P;  3CCV P;  1HZU A;  2HFE D;  2J59 M;  5GTH E;  4QAO A;  3BCC J;  3KQG A;  2YIU B;  2QJK B;  2N18 C;  3HD7 D;  2YK3 A;  1CSU A;  2BCN B;  2IX7 C;  1M56 D;  4HJG H;  5KLV G;  3JSV C;  3ABV C;  4J20 A;  1YFC A;  4OH8 B;  2IBZ D;  2NZ2 A;  2QJP B;  4XXL A;  2BEQ D;  2W90 A;  3MTU E;  1E29 A;  3M0D A;  2K37 A;  4KT0 J;  3P32 A;  4LJI A;  2P58 A;  351C A;  3X39 A;  2LXB A;  4C7R A;  2QM8 A;  3M9Q A;  1NMI A;  1KYO H;  1BCC J;  4NPF X;  2RH0 A;  1RF1 C;  1IFJ A;  2E74 C;  1YNR A;  3B5N C;  2ZVO B;  1GL2 B;  4FB1 A;  2HG5 D;  3JCU H;  5K5G B;  1L0L G;  2KS1 A;  2XKM A;  1KC8 Q;  1OZH A;  1LTJ C;  2POH A;  2CA4 B;  1YCC A;  3HE4 A;  3H1J E;  1OVU A;  1IK7 A;  3TGU J;  1L0N D;  3CCS P;  5DFS A;  4UB6 E;  3HUS B;  3D6Z A;  3HQ9 A;  2C1D A;  3WFB C;  3M0D C;  4IFF A;  1T6A A;  1NU1 D;  2WSC H;  2QA4 P;  4IFD K;  3G3Z A;  3VRD A;  2KS1 B;  1NAF A;  3MUD A;  5APY A;  2A06 D;  3V2Q A;  3O0R C;  3DP5 A;  2E75 D;  3CCE P;  3A0H H;  3H1I G;  3HE4 B;  1J1D C;  3WC8 A;  3PHL A;  1HJ5 A;  2V7Q J;  5KAI E;  3B71 A;  1FI3 A;  3VMY A;  1N50 A;  2Y9Y A;  2O01 H;  2JR8 A;  2H7H A;  1UIX A;  4B86 A;  1S5L V;  1PP9 J;  4YPC A;  1VF5 D;  2I8D A;  1NHL A;  1NWQ A;  1ZR4 A;  3L75 J;  1COR A;  1I55 A;  2FYU K;  1M8O B;  4GT1 A;  1HJ3 A;  5B66 E;  1KIB A;  1DW0 A;  1QX8 A;  1Q86 Q;  4L3H A;  1JEK A;  1LC2 A;  4AYC A;  1RAQ A;  1C6S A;  4WY4 A;  2OYO A;  3CWB E;  2OTK E;  3T97 B;  3L74 D;  3GHG C;  5KJ7 A;  3FX0 A;  2AXT V;  5B5E E;  1OXZ A;  1NTZ E;  1YTZ T;  1JY3 P;  1KB9 D;  4ZMD A;  1DD3 A;  2OTJ P;  1IFD A;  3L36 A;  3RK2 B;  1JY2 N;  2IFM A;  3SLE A;  2UWJ E;  1BGY E;  1SFC A;  2I1J A;  1KV9 A;  4PJ0 H;  2HLO A;  5CID B;  2FYU J;  2C9L Y;  1FI9 A;  2M5A B;  4MU8 A;  1FS0 E;  4JBZ A;  1HF9 A;  1L4A D;  1MFT A;  1MV8 A;  1N7S A;  1EB7 A;  1EDL A;  3BRV B;  2Z4E A;  5CIH B;  2R32 A;  1QEX A;  1VDF A;  5KAF H;  2VRS A;  4N78 D;  5C39 A;  3CD6 P;  1FHB A;  1CSX A;  1GK6 A;  4N3Y B;  4I2L C;  3C1L A;  1QL1 A;  1JY2 P;  2YQB A;  5KJ7 C;  2N1T B;  5TIS H;  2C2C A;  4U3F J;  2M8R A;  1LFM A;  2KIK A;  1FOS F;  2BGV X;  3L70 J;  4ZKP A;  1NTK G;  1JCC A;  1SFC C;  2WSE H;  1SQV G;  2K9J B;  2ITA A;  2W8Z A;  5EXQ A;  3V5B A;  1N7S C;  1PFI A;  1AKK A;  1LTT C;  3L71 J;  1FDI A;  1F1F A;  1K04 A;  2B11 B;  2YMK A;  2BEZ F;  2HV4 A;  1PGO A;  3KZI V;  1S9K E;  2Q5U A;  4DY9 A;  1IRV A;  1ZP0 C;  1U7J A;  1YTZ I;  2WSF H;  3WUV A;  2NRG A;  5CHX A;  4PV1 C;  2LKM A;  5CIB B;  2OYI B;  1HZV A;  1D7M A;  2CK3 H;  5BU5 A;  4O9B A;  3A5T A;  2ZT9 B;  2GB8 B;  1AV1 A;  2B87 B;  1G2C B;  1LS9 A;  1C7M A;  4PD4 I;  1E79 H;  3AE3 C;  2LR2 A;  3LW5 J;  3CCL P;  3P7K A;  1SQP G;  3BRT B;  3OA8 A;  4FA5 A;  3BCC E;  1NVO A;  3PJS K;  2E74 D;  3CPW O;  2GUV A;  1I6E A;  4PWA A;  1FAV A;  2XNX A;  3TK1 A;  2KP8 A;  1VQ6 P;  4WQE A;  4YXD C;  4I6M C;  3P8C E;  4GKG A;  4EDF A;  2YCC A;  4HYT B;  3TYY A;  3EFG A;  4UB8 V;  2YXQ B;  2P2U A;  4FAN A;  1SQQ D;  2PCC B;  1QGK B;  4PD4 E;  4C46 A;  1DW2 A;  3PXS A;  1HH7 A;  3AE8 C;  2OYH C;  1JDL A;  3OCD B;  1F1C A;  5AW4 B;  4NPD A;  2P1J A;  1KTM A;  1X22 A;  1S5L E;  2CE1 A;  3RL0 g;  3H1H D;  1FZA A;  2E5T A;  1HRC A;  1A02 F;  2HPC A;  3H1J G;  3H1K D;  5IY5 1;  5CMZ A;  3TGU E;  3IF4 A;  2M0B A;  4JYB A;  4N0K A;  3CLQ A;  4WVZ A;  3F89 A;  1R8E A;  3HD7 B;  2FYN C;  2V07 A;  1VQK P;  2E5Y A;  2FY8 A;  2M3B A;  1CRG A;  1H33 A;  4GOE A;  1S3J A;  3AE9 C;  3SFE C;  2HPC B;  5AVR B;  2JDI H;  2AXT E;  1PGP A;  3L72 D;  1I6D A;  1I8O A;  4RO0 A;  1N90 A;  1BE3 D;  1JTH A;  1JNM A;  1QVG O;  5KKZ B;  1J2J B;  1CRJ A;  1Y9B A;  1PP9 E;  1S5L X;  2ZAE B;  2K1A A;  1H33 B;  1QKS A;  1S2E A;  3CI9 A;  1QL3 A;  3JC2 2;  1KB9 H;  1LT9 C;  1P84 D;  1RE3 C;  3H6P A;  5DF5 A;  1M90 Q;  2IDB A;  1KN7 A;  3A7O A;  3O5C A;  3D70 A;  3W67 A;  4FA1 A;  5H2F V;  5AVT B;  1CRH A;  2B12 B;  5DJQ C;  2Q9I A;  1Y8A A;  1YYC A;  4WY4 D;  1KMI Z;  4YE1 A;  4HKZ H;  1H31 B;  3RL0 C;  1NTZ G;  1JO5 A;  4H44 B;  3L73 J;  5KJ7 D;  2BCC J;  1BCC D;  1E2R A;  2D2C C;  3Q5R A;  1FJK A;  2KI7 B;  3CWB J;  2FYU E;  3IR9 A;  1OAE A;  3D0W A;  2QJY C;  3AE4 C;  1CRC A;  1SFC D;  1CTZ A;  4EIC A;  1AA0 A;  1NIR A;  1PV3 A;  1N7S D;  1CSB A;  3ZOO A;  2R5B A;  1BGY J;  1SQQ G;  1SQX K;  1URQ A;  3CXH I;  1HJ0 A;  1YI2 P;  1L0L D;  5CJ0 A;  2C1U A;  2I8F A;  3M91 A;  3AE1 C;  1Q7Y Q;  1UII A;  4PV1 D;  5B66 H;  3GMA A;  3H32 B;  5CIE B;  3G4S P;  3WUT A;  4Y28 J;  4WQD A;  1IFI A;  3H1H G;  2L4D A;  1C2N A;  1IFM A;  4EOT A;  4GYD A;  1HUC A;  3PLN A;  3H1L E;  3AEF C;  1IFP A;  2IYO A;  1FDO A;  1NTM K;  2KNC B;  3K5B A;  1FU1 A;  3L35 A;  3H1I D;  3D6Y A;  1GMJ A;  1HRO A;  1RQV A;  4H13 B;  4WBA A;  2Q3E A;  1SQX J;  4L1Q A;  2WPR A;  3A0B V;  1ZW0 A;  5E79 V;  1N73 C;  1VQN P;  3CXH E;  1R0Q A;  1FZC B;  2C8S A;  1PGQ A;  2JP3 A;  3SWY A;  1KFN A;  3L72 G;  4R4L A;  3C2C A;  5AVQ B;  2OTL P;  1HCM A;  1U74 B;  4GED B;  4NFG B;  3USS A;  3EQ2 A;  1AFO A;  4L73 A;  3L4M A;  1NTM J;  2C0X A;  3BCC G;  1FZF A;  5APW A;  2WPS A;  3M9H A;  1KQG B;  1EZV D;  3HRN A;  5DJU B;  1K73 Q;  3SWS A;  4ZNC A;  2KYV A;  1N2D C;  3SWK A;  1VQ8 P;  5KTB A;  2WZ7 A;  2GA1 A;  3DR0 A;  3ZOX A;  1KIL B;  1HJ4 A;  2PCB B;  4AAN A;  2J58 A;  1RHZ B;  2XND H;  2N18 B;  5KLV K;  3I5C A;  1BCC G;  2ZON G;  3NBT A;  1K3G A;  3PXW A;  1GL2 A;  2J5U A;  4ASW A;  4U3F D;  1OMI A;  1QL4 A;  3L70 D;  2BH5 X;  3BAS A;  3VOP A;  2G8Y A;  1N8R Q;  3CX5 D;  2WSC J;  2QJP C;  3HUS A;  4DCK A;  2LIR A;  1K05 A;  1WT6 A;  3TGU G;  1KX2 A;  2PAC A;  3L71 D;  5AVU B;  1L9J C;  1U7M A;  3L74 E;  1RF1 B;  3B5N B;  2ZFC A;  1SQB K;  2O1K A;  1KV4 A;  1NTK D;  3B4S A;  1SQV D;  1T3U A;  2O01 J;  2N9J A;  2W83 C;  5AW5 B;  4WQB A;  5H2F E;  1LTJ B;  3NFQ A;  1YJ9 P;  1LGH B;  4L3G A;  2A45 I;  1P84 H;  1AOF A; 
#chains in the Genus database with same CATH homology
 1NTM D;  3NWV A;  5GTH V;  5KLI B;  3L75 D;  2K9J B;  3ZOW A;  1CNO A;  1C52 A;  5EXQ A;  1H32 A;  3A9F A;  1AKK A;  3WFC C;  1F1F A;  2ZOO A;  3O1Y A;  2B11 B;  1S6V B;  3CX5 W;  1KYO D;  3SJL A;  2HV4 A;  4WQC A;  3KZI V;  4DY9 A;  4RJT A;  1IRV A;  3A0H V;  1IRW A;  1DVH A;  3O20 A;  1CXA A;  4AX3 A;  5CIB B;  4FA4 A;  1HZV A;  1SQP D;  4K3I A;  1GIW A;  2GB8 B;  2B10 B;  1I8P A;  1CYC A;  1GJQ A;  3VMA A;  2B0Z B;  1LS9 A;  1C7M A;  2O3J A;  1FI7 A;  4EID A;  2FYU D;  1CIE A;  3WU2 V;  1CSV A;  5TJH A;  4Y5R A;  4KMG A;  3OA8 A;  3RMZ A;  1W5C T;  1H9X A;  4FA5 A;  2L91 A;  4UB6 V;  1KYO W;  1I6E A;  3GW6 A;  4PWA A;  1DT1 A;  1FJ0 A;  2LIT A;  1KB0 A;  4Q5P A;  2QJY B;  2OZ1 A;  4WQE A;  3TDK A;  3HQ8 A;  1CYI A;  5KLV D;  4EDF A;  3MK7 B;  2YCC A;  3RN1 A;  5CIC B;  1GQ1 A;  4AAO A;  4UB8 V;  5C9M A;  1B7V A;  1YEB A;  4FAN A;  451C A;  1SQQ D;  5KAI V;  1CSW A;  2PCC B;  2GIW A;  3ZIY A;  4FA9 A;  1DW2 A;  3H1L D;  4PJ0 V;  3KHU A;  3PXT A;  3PXS A;  1HH7 A;  3JBT B;  1JDL A;  3H1J D;  3OCD B;  3WUI A;  4PW9 B;  4FAV A;  1F1C A;  2JWA A;  1IQC A;  5KAF V;  1A56 A;  2CE1 A;  1CIG A;  4O1W A;  1SQB D;  3H1H D;  2BPB B;  2V08 A;  1HRC A;  1CRY A;  1VYD A;  1K3H A;  1YEA A;  2GC4 D;  4WQ9 A;  1CXC A;  5AUR A;  3H1K D;  3CXH D;  5IY5 1;  1RZ6 A;  1N9C A;  3FWL A;  4N0K A;  1C6R A;  5TIS V;  1ETP A;  4AAL A;  1U75 B;  1CHJ A;  1LMS A;  2V07 A;  3CU4 A;  1CTY A;  1CRG A;  5B5E V;  1H33 A;  1RAP A;  1IO3 A;  1E8E A;  3SXT A;  4WQ8 A;  4D6T D;  3M97 X;  3DMI A;  2GC7 D;  1I5T A;  2QG4 A;  3L72 D;  1I6D A;  1YIQ A;  3RLM A;  3VNW A;  4XYD B;  1I8O A;  1N90 A;  1BE3 D;  4IL6 V;  3TF5 A;  4EIF A;  1NML A;  1CHI A;  5KKZ B;  1CRJ A;  1H1O A;  1PPJ D;  4H0K A;  2VHD A;  1H33 B;  2XTS B;  1QKS A;  2B4Z A;  3CXH W;  1QL3 A;  2AIU A;  4AAM A;  2C1D B;  3CWB D;  1OCD A;  1P84 D;  5DF5 A;  1MG2 D;  2ZXY A;  3VYM A;  1NTZ D;  1N15 A;  3O5C A;  2MHM A;  1AYG A;  4FA1 A;  5H2F V;  4WQ7 A;  3SVW A;  2D0S A;  1CRH A;  2B12 B;  2DVH A;  5DJQ C;  3PH2 B;  4YE1 A;  1H31 B;  2RN0 A;  1MZ4 A;  1CIF A;  1GDV A;  3OCD A;  1QN2 A;  1BCC D;  1HZU A;  4JCG A;  2N3B A;  4QAO A;  1CYJ A;  1E2R A;  1RZ5 A;  2YIU B;  1CTJ A;  2FRC A;  2QJK B;  2JTI B;  1WVE C;  2N18 C;  1OAE A;  2YK3 A;  1CSU A;  1CRC A;  2BCN B;  1CCR A;  1A2S A;  1CTZ A;  2EXV A;  4J20 A;  1YFC A;  4EIC A;  2C9X B;  2IBZ D;  1NIR A;  2QJP B;  1FOC A;  4XXL A;  3ZOO A;  1DVV A;  1E29 A;  4A7P A;  2RMZ A;  3ZCF A;  4LJI A;  1CCH A;  1L0L D;  1CED A;  2C1U A;  351C A;  2Y0C A;  2CA3 B;  3X39 A;  2I8F A;  1NMI A;  3ORV A;  1FCD C;  2N3Y A;  1YNR A;  3HQ6 A;  4FB1 A;  1YTC A;  5CIE B;  2KS1 A;  2DGE A;  4WQD A;  2Y0D A;  4V2K A;  2L4D A;  1C2N A;  4GYD A;  3PLN A;  1NNO A;  3RN0 A;  3ZBM A;  2FYN B;  2CA4 B;  3PTZ A;  1C6O A;  1L9B C;  1YCC A;  2KNC B;  3PRJ A;  1L0N D;  5DFS A;  1KX7 A;  3H1I D;  2N9I A;  3HQ9 A;  1CRI A;  2C1D A;  3WFB C;  1HRO A;  1COT A;  2Q3E A;  3CP5 A;  1NU1 D;  4L1Q A;  3VRD A;  3A0B V;  5E79 V;  1R0Q A;  1DII C;  2A06 D;  3O0R C;  3DP5 A;  1BL9 A;  2C8S A;  3L73 D;  2BCC D;  3WC8 A;  1CC5 A;  3PHL A;  1HJ5 A;  2N9Y B;  3C2C A;  4O1Q A;  1FI3 A;  1H31 A;  3BCC D;  1IZL 0;  1N50 A;  1M70 A;  1J3S A;  1HCM A;  1U74 B;  4GED B;  2BLF B;  1LC1 A;  2CXB A;  4NFG B;  1M60 A;  4EIE A;  3ZOY A;  1S5L V;  1H32 B;  2CE0 A;  5CIG B;  3L4M A;  1ZZH A;  2MTA C;  1DW3 A;  1A8C A;  2FWL A;  2JQR A;  3WFE C;  3L4O A;  5C0Z A;  1COR A;  1I55 A;  1AOQ A;  1HJ3 A;  1YIC A;  1EZV D;  1KIB A;  1CHH A;  5DJQ B;  1BGY D;  1WEJ F;  3SWS A;  1DW0 A;  3NBS A;  1ZRT D;  4L3H A;  1LC2 A;  1RAQ A;  1C6S A;  4PD4 D;  1I54 A;  4P4Q B;  1GKS A;  2AI5 A;  1MG3 D;  2ZBO A;  3DR0 A;  3ZOX A;  155C A;  1HJ4 A;  2PCB B;  4AAN A;  3L74 D;  2AXT V;  1W2L A;  1GU2 A;  1C75 A;  2N18 B;  2ZON G;  3NBT A;  1K3G A;  1KB9 D;  3MK7 C;  3PXW A;  2Y0E A;  2ZZS 1;  5B6Q A;  2C1V A;  5CYT R;  3TYI A;  2ORL A;  4U3F D;  3TGU D;  3SLE A;  3WFD C;  1C2R A;  1DIQ C;  3OA8 B;  1KV9 A;  1DW1 A;  1QL4 A;  3L70 D;  3HQ7 A;  5CID B;  1FI9 A;  4MU8 A;  5CIF B;  2BH5 X;  3GG2 A;  1EB7 A;  1SQX D;  5CIH B;  3CX5 D;  5GTI V;  2LIR A;  1FHB A;  1CSX A;  4RSZ A;  2OZ1 B;  1KX2 A;  3CYT I;  2PAC A;  1H9Y A;  3L71 D;  1L9J C;  2YQB A;  1QYZ A;  1NTK D;  2D0W A;  1SQV D;  3ITK A;  2N9J A;  4H0J A;  1CO6 A;  5B66 V;  4WQB A;  1CIH A;  2C2C A;  1LFM A;  4L3G A;  4WQA A;  2BGV X;  2BH4 X;  1AOF A;  1PP9 D;  1M6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...