1PP9D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1pp9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1pp9D01
1GKSA 1NTZD 2RMZA 1W5CT 3A9FA 2VHDA 1J3SA 3WUIA 2RN0A 1CIFA 4PJ0V 2N18C 3CP5A 2FWLA 1CIEA 1N9CA 4KMGA 1DIQC 4EIFA 1FJ0A 2QJPB 3NBTA 4PW9B 4FA9A 5KLIB 1M70A 2GIWA 4MU8A 1I5TA 2Y0DA 1LMSA 1SQVD 1N90A 3PLNA 5CIDB 2B4ZA 5DJQB 1LFMA 4WQ7A 1CRHA 4JCGA 4WQCA 2BGVX 4J20A 1I6DA 1H33A 3C2CA 1H1OA 5IY51 1HRCA 1R0QA 1C52A 1DIIC 2L91A 4UB6V 4WQBA 1C7MA 1CTYA 1SQPD 1IZL0 2OZ1B 1CNOA 1MG3D 3KZIV 1KIBA 1YNRA 1PP9D 3O20A 3O1YA 1I6EA 2ZOOA 1A8CA 3CU4A 1YIQA 5KKZB 3O5CA 5CICB 2MTAC 1HH7A 2CE1A 1CHJA 5C0ZA 5TJHA 2ORLA 1DVHA 1CXAA 1H9XA 1MZ4A 1GDVA 4XXLA 3ZIYA 5AURA 1P84D 3DR0A 4WQ8A 3NBSA 3SVWA 1FHBA 1CORA 1BGYD 2C1UA 3NWVA 3OA8A 4NFGB 3H1ID 2FRCA 4WQEA 1DW0A 1CHHA 3HQ8A 3X39A 4L3GA 1RAQA 1I55A 1OAEA 3RLMA 1WVEC 2D0SA 2GC4D 4V2KA 4P4QB 3GG2A 4L1QA 1H32A 2Q3EA 2ZONG 1HZVA 2O3JA 1C2RA 2PCBB 1HCMA 3ZOXA 1FI3A 1H31A 1EZVD 3CX5D 2JQRA 1CXCA 1N50A 1L0ND 1VYDA 3PXSA 1KYOW 2BCCD 4LJIA 4U3FD 1DW2A 1E8EA 1QL4A 5KLVD 2CE0A 2B10B 4PWAA 2GC7D 1LC2A 2C2CA 5CYTR 4AAOA 3L75D 1BCCD 4IL6V 1YICA 2LITA 4O1WA 1RZ5A 4EIEA 1CSXA 3WFBC 2YCCA 3L4OA 1S6VB 3CX5W 2D0WA 5DF5A 3H1JD 3PHLA 3L73D 1E29A 3WFEC 3TDKA 1A56A 1CIGA 1H32B 3BCCD 3ORVA 1YCCA 1HZUA 2PCCB 3RN1A 5TISV 1A2SA 1CSUA 2IBZD 1IO3A 3TYIA 3KHUA 2V07A 1CSVA 2MHMA 1H33B 4AAMA 2FYNB 5B6QA 1C2NA 1DW3A 1KX2A 1AYGA 5CIBB 2ZZS1 1I8OA 2JTIB 2N9IA 3ZOYA 4RSZA 2OZ1A 3PH2B 1CRJA 4FA5A 351CA 3RMZA 3TF5A 1S5LV 155CA 1RZ6A 4EIDA 4Q5PA 2ZBOA 2N3BA 2C9XB 3OCDA 3ZBMA 2KNCB 1CRYA 1I54A 1PPJD 3SXTA 1KYOD 5E79V 3SJLA 4K3IA 4WQDA 1AOQA 1KB0A 2B0ZB 1L0LD 1NMLA 3MK7B 4WQ9A 1CCHA 4AX3A 4EICA 1CIHA 1DVVA 4D6TD 3OA8B 3H1HD 3DMIA 1C75A 2GB8B 1CEDA 3HQ6A 1QKSA 3L71D 1CYCA 1U75B 1SQQD 3GW6A 1IRVA 3CXHW 1AOFA 2V08A 3M97X 1CCRA 2N18B 2PACA 1GQ1A 3WC8A 1ZRTD 4WQAA 3CWBD 4EDFA 1COTA 1U74B 2C1DB 4GYDA 1ETPA 2BPBB 2CA3B 1NTMD 2YQBA 1L9JC 4GEDB 1BE3D 4Y5RA 2AXTV 2BH4X 5DJQC 1NU1D 1CC5A 2ZXYA 2BH5X 1EB7A 1LS9A 1AKKA 3JBTB 3PTZA 2XTSB 2L4DA 4PD4D 4O1QA 3O0RC 4A7PA 1CTZA 2FYUD 5KAIV 5CIEB 2BLFB 3CYTI 4N0KA 3SLEA 3ZOWA 3PXTA 1N15A 5B66V 1K3HA 1YFCA 2AI5A 3L74D 1FI9A 1SQXD 1C6OA 3ITKA 1LC1A 1HJ5A 2N9YB 2HV4A 3H1LD 1F1FA 2CXBA 3VNWA 3RN0A 2EXVA 2QJYB 1CSWA 2DGEA 3L72D 4FAVA 3TGUD 1HROA 3VYMA 3VMAA 3SWSA 2Y0EA 5CIHB 3L70D 3ZCFA 1NIRA 1KX7A 1GIWA 3OCDB 1M6ZA 1C6SA 1WEJF 2B11B 1NTKD 4L3HA 1JDLA 4UB8V 1QL3A 4FA4A 1YTCA 2KS1A 3A0HV 2A06D 2YIUB 2I8FA 2K9JB 2C1DA 4AALA 1KV9A 4AANA 1CRCA 1E2RA 1IQCA 1M60A 1IRWA 1CRGA 3WU2V 1KB9D 5EXQA 2AIUA 1DT1A 5DFSA 1NNOA 5GTIV 3ZOOA 2N3YA 5GTHV 1L9BC 3A0BV 1HJ4A 1MG2D 1CO6A 3PXWA 4YE1A 4FB1A 2DVHA 5KAFV 4RJTA 4H0KA 5C9MA 1QYZA 2Y0CA 3CXHD 2JWAA 1DW1A 1W2LA 1FCDC 1CYJA 2CA4B 2QJKB 1GU2A 1QN2A 3WFDC 2N9JA 5B5EV 1H31B 2B12B 1F1CA 3FWLA 3HQ9A 1NMIA 2BCNB 1I8PA 1ZZHA 2C1VA 1OCDA 451CA 4FANA 3VRDA 3DP5A 1BL9A 4H0JA 2QG4A 4QAOA 3HQ7A 3L4MA 5CIGB 1FI7A 1SQBD 5CIFB 4XYDB 3WFCC 1FOCA 1CYIA 4DY9A 1CRIA 1YEAA 1RAPA 4FA1A 1K3GA 1B7VA 1GJQA 5H2FV 3H1KD 3MK7C 2C8SA 1CHIA 2LIRA 1YEBA 1H9YA 1C6RA 1CTJA 2YK3A 3PRJA 1HJ3A
chains in the Genus database with same CATH superfamily
1KFMA 1JUNA 1GKSA 1NTZD 1W5CT 3A9FA 2ZYDA 1J3SA 3WUIA 1SQPE 3KZIH 2IFMA 1T2KC 4Y99B 1KZUB 1N9CA 4D6TE 2DW3A 1FJ0A 3NBTA 4U3FG 1ZR4A 2FY8A 1I5TA 2BASA 3KPEA 2K88A 2B4ZA 3KQGA 3O6QA 4WQ7A 2H8PD 1CRHA 1BGYE 2B88A 1L0NG 1I6DA 1H33A 1ZRTE 1IK7A 2C0XA 1NH4A 1DIIC 3L71J 1LP1A 1UIIA 1C7MA 1CNOA 1MG3D 3KZIV 5C39A 4XA4A 3V2PA 1S9KE 2KYVA 1YNRA 2K1AA 3H1IE 4N3YB 1I6EA 1A8CA 3CMEP 3TNUA 3O5CA 2E76D 1HH7A 2C9LY 1DX7A 1DEEG 1LTAC 1GMJA 1H9XA 1GDVA 2POHA 2WWWA 4XXLA 3ZIYA 3M0DC 1USEA 1LTJB 1QX8A 1N7SB 3BATA 4WQ8A 5KAIE 3JC22 3SVWA 4JQ0D 1FHBA 1USDA 1SQQE 2KSJA 2QJYC 3Q5PA 2KZJA 2XNXA 4I7ZC 2ITAA 1FJKA 1OZHA 1CHHA 3HQ8A 2KI7B 3AEBC 1Y9BA 1EZVG 4JYBA 2KNCA 1L0NE 1RAQA 1I55A 2KIKA 4HJGH 3F89A 1N73C 2NPSA 1HBWA 1HZVA 1C2RA 2PCBB 1NU1K 2WQYC 1R8EA 3WMM0 1GL2C 2JQRA 3GHGC 2Q7CA 2O01J 2WZ7A 1VF5B 1N50A 2FXOA 1L0NK 2A45I 5AW4B 2R5DA 4W7YA 2IYOA 4L74A 5B66H 3L70E 5CCGD 4PJ0H 1FDOA 2YMKA 3L75D 1LP1B 4IL6V 2LITA 3C1LA 1BSNA 1RZ5A 1JY3P 3H1HG 3WFBC 3L4OA 4W7ZA 1RF1C 3H1JD 1AVOA 3L73D 1CZQA 1OVUA 1BE3G 3A0BE 3B5NB 2IPPA 3RN1A 2IBZD 3WUUA 1DH3A 2OYIA 1CSVA 1SFCB 1C2NA 2OYHA 3H1HJ 1KX2A 4N6JA 1JTHA 1KB9H 1I8OA 2I1KA 1KN7A 2OZ1A 5AW9B 1S5LV 4EIDA 2WPVB 3MUDA 2R44A 3OCDA 1KORA 2KNCB 3H1JG 2NRGA 1FZBA 1FJPA 5K5GB 3L70G 4WQDA 4EIJA 4N78E 4MN4C 4WQ9A 1R5SA 3CCRP 4EICA 1GL2A 3OA8B 1PPJG 1NTMK 4WY4D 3DMIA 2CPSA 1CEDA 1ZXGA 4GT1A 1KTMA 3ABVC 4WY4A 1CYCA 1YJ9P 1IFJA 4YTPC 1IRVA 1X8YA 3BRTB 1M56D 3CL3D 2PGDA 1JEKA 1AQTA 1RH5B 2WPQA 2I1JA 3CLQA 5APWA 1GQ1A 3U1AA 5CCHA 3M06A 3RL0g 3CCMP 5KLIC 2C1DB 1ETPA 2CA3B 4H44C 5APXA 1NTKE 5AVXB 5DJQC 1X79B 3LW5H 3B5NA 3CPWO 1CC5A 2ZXYA 2BH5X 2HFED 1RQUA 4UB8H 1SFCA 3F5HA 1SQBK 1KQFB 1T2KD 3RK3E 4PD4D 4O1QA 1LWUC 4PV1D 1N7SD 4N0KA 3PXTA 1GK4A 2NPSB 2YNYA 3AE9C 1OVRA 2FFDC 1NTZK 2IBZG 5APYA 3EFGA 5B5EH 2N1TB 1LC1A 1HJ5A 2N9YB 1CI6A 4N78D 4YXWH 1QVFO 1VQNP 3VYMA 3VMAA 2BCCJ 2Y0EA 3L70D 3CCSP 1NTKJ 1QLED 1YBKA 3L72J 3V2RA 1N8RQ 4WY4B 2IBZI 1NWQA 2B11B 2E76C 2LR2A 3CCVP 2W83C 5CBOA 1RE4C 1NU1E 1LT9B 2C1DA 2R3CA 1E2RA 4C7RA 1GK6A 3AECC 1EXJA 3AE4C 2HLOA 3FWNA 1IRWA 1CRGA 4H0LB 2AIUA 1DT1A 4NPFX 4UB6E 1NNOA 2OYHB 1L9BC 3RL0D 2DVHA 1YTZI 1LWUA 3CD6P 1P84I 3CCQP 1URQD 5BVZA 4ZKUA 1SLQA 2Y0CA 1ZMEC 3B4SA 2CA4B 3S1KA 1VQKP 1QN2A 4R4LA 5AVRB 3HTKA 1PV3A 1H31B 3JCUH 3GHGA 1Q90D 5AW8B 5KJ7C 4IFFA 1NMIA 2BCNB 4D6TJ 1NKNA 1H8AA 1U57A 1NU1G 2WSFH 2W90A 451CA 2E75D 4FANA 4U3FJ 4U3FE 3HQ7A 5CIGB 3A2AA 1Q7YQ 4XYDB 2LXBA 1JY2O 3P8CE 3WU2H 2HPCA 1RAPA 5CCGA 4FA1A 1IFNA 1K3GA 4OVNF 2FYUE 3AEDC 2Y9ZA 3L35A 4K35A 5AW2B 1J1EC 1YEBA 4DZOA 1KC8Q 2AEFA 1H9YA 4RKUJ 1CTJA 3RK2C 1J2JB 3H1LG 1HJ3A 2QIWA 2OARA 1LT1A 2VHDA 1CIFA 1SVFA 4LC1A 1MUUA 2FBWC 4KMGA 1PP9E 1PP9J 3AEAC 1SQQJ 1DIQC 4EIFA 2QJPB 3RBXA 4FA9A 2M5AB 1FZCC 2RKLA 2JWDA 1SQVD 3PLNA 3G71P 2BCCE 1SQXK 3A3YB 1K05A 5KLVE 5KLVJ 3M9BA 1HRCA 2NPSD 3CX5H 1NTME 1FZEA 2JDIH 1VL2A 1N86A 3EFFK 3RBZA 2ZYAA 1HJBA 5APSA 3BCCJ 1FAVA 1PP9D 3O1YA 3CMAP 3CU4A 5KKZB 4NPDA 2CE1A 5TJHA 2ORLA 1CSBA 4BXLA 4ZMDA 2KLUA 3MTUE 1P84D 2KK7A 4C7NB 1H0TB 1L0LJ 1ZW0A 5H2FH 1VQ8P 1M90Q 4TT3H 2A06E 1DW0A 3CCLP 2D2CC 3L37A 1URQA 2AXTE 3HUSC 2ZT9B 4ZNCA 1MFZA 2N9BA 4L3GA 2P7JA 3G6EP 2M3BA 4HYTB 1J1DC 2D0SA 2GC4D 4V2KA 1NKZB 2W8ZA 2M8RA 1M57D 3AE6C 1H32A 2Q3EA 2YIUC 2P1JA 2ZONG 2M5AA 1HCMA 1FI3A 1H31A 2K3RA 4PD4H 3M0DA 1E5WA 2IFNA 1HVVA 2WITA 1VYDA 3PXSA 1EQ7A 2G8YA 1DW2A 3P7KA 1KD1Q 4Z1MH 1CW5A 2CE0A 3L70J 1L0NJ 2IZ0A 5CYTR 2K37A 3TK1A 3SFEC 1BCCD 3L73J 2QSIA 1KILB 1OWAA 1S6VB 2K9YA 3SWKA 2D0WA 5DF5A 2HPCB 3WFEC 1CIGA 2QJKC 2O1JA 4EI2A 2PCCB 1CSUA 2O01N 1IO3A 2V4HA 1BCCE 1H33B 1VQ9P 1SS1A 3L4FA 5APVA 4C7NA 3L73G 1AYGA 1IC2A 1RE3C 2JTIB 1NHLA 3LIDA 3ZOYA 1S9KD 4RSZA 1URQC 3MP7B 3A0HE 3V2NA 1RHZB 1CRJA 1S3JA 2M3EA 4WBAA 1SQVG 4GIFA 5GTIE 2C9XB 3ZBMA 2O01H 2IZ1A 3H1KJ 1KYOD 2IX7C 4QMAA 4K3IA 1FS0E 4K3AA 2J5UA 2XU6A 1KQGB 1L0LD 1CCHA 2ZVOB 2YXRB 3CC2P 4AX3A 2FYZA 1CIHA 4D6TD 2WSCH 1Q81Q 1NO4A 3P8CD 2QE7H 5CBNA 1NOHA 3CC4P 1C75A 1GZLA 2GB8B 2XKMA 4HKZH 2H43A 5CMZA 1QKSA 3L71D 1BCCG 1CCRA 1NTZJ 1A02J 1PFIA 2Y9YA 5KAIH 2PACA 4IFDK 1KILA 3WC8A 1ZRTD 1S5LH 4EDFA 5BU5A 2BPBB 2W6AA 1NYHA 3Q1MA 1JMMA 1L9JC 3L71E 1VQLP 1IO4A 2W27A 2AXTV 3A0BH 4PD4I 1SQXG 5L8RJ 3G9RA 1NU1D 1HF9A 1H0TA 1LS9A 1AKKA 3AEGC 3RK3C 3MGNA 4H44D 1LGHB 3PTZA 2B9BA 1S5LX 1MFTA 2L4DA 4DT0A 1CTZA 3OA7A 2FYUD 1KQSO 5KAIV 1SQPK 5CIEB 1M8OB 2BLFB 1EXIA 3VMYA 5AVUB 3AE7C 1SQBJ 3TGUE 4ASWA 1PGPA 2UWJE 3NMDA 2YXQB 1YFCA 2AI5A 1PL5A 3QWOC 4PV1C 5KTBA 1LTJC 2Q6QA 1N7SC 1F1FA 2CXBA 1CSWA 4FAVA 3TGUD 2J59M 1YJWP 4OGQC 1K8AQ 4I7ZB 3ZCFA 4L73A 3MUDC 3OCDB 3V2QA 1Z56A 3S4RA 5AVVB 3VP8A 4DJGA 1NTKD 1T3JA 4L3HA 3E1IA 4UB8V 1YHQP 2PAJA 2XNDH 2L5GB 3L74G 3H32B 3AE1C 3H1KG 1VQPP 1LTTC 1GL2B 1IQCA 1PGJA 2QM7A 3WU2V 2ZXXA 1KMIZ 5EXQA 5GTIV 5APQA 1K04A 2N3YA 5GTHV 2CPBA 3A0BV 3HD7A 2FYUG 2XZRA 2G3AA 2WSEJ 1CO6A 4YE1A 5KAFV 3R2PA 3VYIA 5AVSB 2E74C 1N7LA 3AEEC 1H88A 2YKQA 1JY3N 2Z5HA 4H0KA 5C9MA 1QYZA 2MKVA 3CXHD 3VP9A 1FCDC 4TLFA 1GU2A 2B12B 1F1CA 3FWLA 3K5BA 1L0LG 1ZV8A 5AW6B 2FYNC 1P84H 1SFCC 5AW1B 1P84E 5CCHD 2BEZF 1GW4A 1BL9A 2QG4A 2XV5A 3V4QA 1E79H 1AJYA 3Q5SA 1IK9A 1FI7A 2KUBA 3C9IA 1SQBD 5CIFB 1EZVI 2WT7A 3OAKA 1FOCA 4DY9A 2CK3H 3CXHH 1LNQA 3CWBE 3R4YA 3JSVC 1X9VA 5KLVG 1YI2P 1GJQA 1JY3O 2PP6A 3H1KD 1L0LK 2AXTH 3H32A 2KOGA 2JEEA 4B86A 4ZKPA 3NTNA 1NU1J 2HG5D 3SSUA 4JPZB 5CJ4A 1ZLLA 2JR8A 3PRJA 1GDTA 1BGYG 2SPZA 3FXDA 1MKMA 4JYCA 2N18C 3CP5A 2FWLA 1OMIA 1CIEA 1KQLA 4XE5B 3A7OA 1LT9A 4GODA 4PW9B 5KLIB 1M70A 4MU8A 2JO1A 3TNUB 2Y0DA 4H44B 1NJIQ 4PD4E 5KLVK 3A0HH 3EWKA 1LMSA 1N90A 5CIDB 3VOPA 1LJ2A 3H1LE 3U1CA 4JCGA 2BGVX 4J20A 2A45G 5IY51 3MZWB 3IN6A 2E74D 4UB8E 1R0QA 4EYYQ 5AVWB 2L91A 3HE5A 3T97A 1IFDA 4GOEA 2E43A 3CI9A 4UB6V 1LWUB 1NAYA 4D6TG 1CTYA 1SQPD 3FX0A 5M1BA 1G1JA 1KIBA 2WT7B 3BCCE 1XTCC 3O20A 1WMKA 2WSCJ 3TYYA 1M1JC 3WU2E 1W5CE 1YIQA 2NPSC 5CICB 1KYOH 2MTAC 1DVHA 4PJ0E 1KYOE 1CXAA 3O6QB 2N1TC 2B89A 3DR0A 1HGVA 1IFIA 2WPRA 1BGYD 3O8ZA 3CXHI 4XFJA 2QEXP 2FYUK 3NWVA 4NFGB 3H1ID 2FRCA 4WQEA 1S1CX 3HRNA 5APTA 4NPEA 2H7HA 3HD7B 1EZVE 3L36A 3CX5E 4WY4C 3PJSK 3L75E 3B5ND 1JY2P 1RY3A 3WUVA 3X39A 2E76B 1BCCJ 1OAEA 4H13D 1L4AC 3RLMA 1N2DC 1WVEC 2KSEA 2WMMA 3CC7P 3GLMA 1LT9C 2KP8A 1LTIC 1EZVD 3C8VA 1SQQG 3CX5D 1LTJA 1T6AA 3RL0B 1N7SA 1GU4A 1CXCA 1KFNA 1FZFA 2W6JH 1L0ND 3USSA 4H0LC 3HD7D 3NXSA 2AEMA 1QL4A 1G2CA 2GC7D 3IAOA 3H1HE 2C2CA 4AAOA 1PGQA 4YPCA 1YICA 4O1WA 3KXDA 1JO5A 1CSXA 2YCCA 3Q2YA 1L2PA 3PHLA 1E29A 3TDKA 2JP3A 2JKVA 3BCCD 3ORVA 1HZUA 1NTZG 3KHUA 2MHMA 2GM4A 4AAMA 1FC2C 4GOFA 1NTKK 2AEJA 2BEQD 4IL6H 3CXHE 3VMZA 5CIBB 3LIEA 1KILD 2N9IA 3RK2D 3H6PA 5B5EE 3SFDC 351CA 3TF5A 2FXPA 155CA 1RZ6A 2OQQA 2ZBOA 2N3BA 1M7LA 2IBZE 4DCKA 1EDKA 1QL2A 4GKGA 1I54A 1RF1A 1KB9I 2E75B 1OVVA 3L74J 3G4SP 3H1JE 1H89A 1PIXA 1KB0A 2I8DA 1T8ZA 4H13B 2B0ZB 3MK7B 1NMLA 1YIJP 1K9MQ 2OYIB 1DVVA 1JCCA 2QRXA 5DJTB 1JCDA 3Q5RA 3HQ6A 2FKWB 1AQ5A 1SQVE 1L4AD 3HE5B 3T97B 2O1KA 3H1KE 3GW6A 2R3SA 2YO3A 3M97X 4Y99C 5AVTB 1WRGA 3D6YA 4GYDA 3RK3D 1NTMD 2YQBA 4OH8B 2HODB 3E7KA 1GD2E 1GU5A 3OJAB 4Y5RA 1NTKG 2OYOA 4WWIA 1Y47A 2N1TA 4WB4A 4L75A 5H2FE 3H1IJ 2LXCB 3EQ2A 1UIXA 3D71A 2XTSB 3BRVB 4IFMA 1EDLA 3MHVA 4W80A 3O0RC 4A7PA 4KT0J 3CWBJ 1L0LE 1NVOA 2OTKE 3SLEA 3V6IA 2E5YA 1SP4A 1N15A 5B66V 1SQVJ 1K3HA 2KB7P 1NTMJ 5GTHE 1FI9A 3S9OA 1JOCA 3RN0A 2EXVA 2QJYB 2DGEA 3L72D 1LTBC 1JNMA 2B87A 3SWSA 1JB0J 2ZAEB 3AE5C 3BVHA 3HUSB 2ZT9C 2OTLP 1G2CB 1FDMA 1VQ5P 1DEBA 1M6ZA 4RO0A 1PPJE 1C6SA 1YQ3C 4FA4A 1YTCA 3N4XA 2KS1A 3A0HV 1ZOYC 4OGQD 1N73B 2W6BA 2YIUB 4AYCA 4AALA 1ZR2A 3GHGB 1CI6B 5AVZB 2AXCA 1VF5C 1AFOA 1KB9D 4YXDC 2YMYA 1QL1A 1RQVA 1MG2D 4FB1A 2N1TD 3H1JJ 1OXZA 2Q5UA 2WSSH 3JCUE 4RJTA 3MIWA 1A02F 2JWAA 1DD4A 1SFCD 2C9NY 1YITP 1DW1A 3D0WA 1RF1B 1BSHA 1HWTC 3B5NC 4H0LD 1FZAA 1RF0A 2E42A 3FGAD 1FDIA 4R4MA 1OCDA 3BCCG 3VRDA 2B87B 2Z4EA 3L4MA 2JJLA 3GF7A 1VQ4P 2Q3IA 1FU1A 2ZYGA 3D70A 3WFCC 5E79H 4BRYA 1Q82Q 2MJZA 3CWBG 5KAFH 2Z5IA 1B7VA 5H2FV 1N73A 3KYQA 2V7QH 2WSEH 3NFQA 2HODA 5GTHH 2C8SA 5KJ7A 2P67A 5GTIH 2XDJA 1YJNP 4IL6E 1YYCA 2Q1KA 4RESB 5TISE 1KB9E 2RMZA 3P8MC 5TISH 2RN0A 5B66E 1SQPJ 1BDCA 4IOIH 3Q3DA 4PJ0V 1OX3A 3W67A 3B8EB 1RE4A 3I55P 1PP9G 2GIWA 4HB1A 3H1IG 3MD0A 1YTZT 1FE6A 5AW5B 5AVYB 5DJQB 1JM0A 1KILE 1LFMA 5E79E 2BCCG 1BGYJ 4WQCA 1SQBE 3TGUJ 3C2CA 1S5LE 1H1OA 3L72G 2PFXA 3RK3B 4CPGA 1OIPA 1C52A 1RE3A 3UIAA 4I2LC 3WUTA 2A06G 3QH9A 1KV4A 4WQBA 2P2UA 3AE8C 1IZL0 2OZ1B 4KHXA 3II6A 2RH0A 2KS1B 2ZOOA 1FZCA 2ZVNB 4LGDE 5KAFE 5CHXA 2M0BA 4BRYB 1M1KQ 2IDBA 2QA4P 2A45H 1CHJA 5C0ZA 2FFDB 2J58A 1MZ4A 4PV1B 2H88C 5AURA 2H89C 1R5LA 3NBSA 1DD3A 1CORA 3RGUA 1LTSC 4O9BA 2C1UA 4U7JA 1FBMA 3OA8A 1FZGA 4OGQB 1Q2NA 2R32A 3PP5A 3IFMA 4KJMA 2GUSA 3CX5I 1SQBG 1AA0A 1W2BO 4P4QB 3GG2A 1M1JA 3P32A 5CCHC 4L1QA 3M9QA 2O3JA 1IFMA 3ZOXA 3E1RA 2P58A 1PZQA 4Y28J 1VQOP 1OW8A 4WVZA 1KYOW 2BCCD 2ZT9D 4LJIA 3KDPB 2OYHC 4U3FD 1E8EA 5KLVD 2B10B 1GW3A 4PWAA 1HTLC 2Q9IA 1LC2A 3VTPC 1X0TA 3CCUP 1FOSF 1VQ6P 4EIEA 1XTGB 4BWNA 2E74B 1K73Q 1EDJA 3CX5W 1GTWA 2WTYA 1HUCA 4OWFA 3IF4A 1X22A 1NTMG 1A56A 1H32B 1BE3E 1YCCA 3U59A 5EFWB 2V7QJ 5TISV 1A2SA 2FFDA 3GMAA 2KZIA 3TYIA 2V07A 4L76A 1NGMB 2FYNB 2P10A 5B6QA 1DW3A 2YKOA 3H1LJ 2ZZS1 4LLHA 1KYOI 2FYUJ 3D6ZA 2YO2A 3FXEA 3PH2B 4FA5A 3PH0A 3RMZA 4Q5PA 1JMBA 1NAFA 1QEXA 1CRYA 5CJ0A 1PPJD 2GA1A 3SXTA 3ZDMA 5E79V 3SJLA 1NTZE 4C46A 1AOQA 3SWFA 1J1EB 2KLVA 3A5TA 1DIPA 2LKMA 3H1HD 3RK2B 4ASVA 3H25A 1G1IA 3M9HA 3W68A 1VQMP 2WVRA 1U75B 1SQQD 1T3UA 3CXHW 1IJDB 1Y8AA 1AOFA 2V08A 2N18B 1L4AA 3V5BA 2OGUA 1SQVK 5AW7B 4WQAA 3CWBD 2QJPC 3GF3A 1COTA 1U74B 2K9JA 1WT6A 1FZCB 3TGUG 1OW7A 1SQXE 4GEDB 1BE3D 1SQXJ 3HTKB 2BH4X 1S2EA 2ZXEB 2QVAA 2E5TA 1MZ9A 3I56P 1MV8A 1EB7A 5BU8B 1OW6A 1AVYA 3JBTB 1SQQK 3B71A 3VN0A 2HR3A 1GL2D 1VDFA 3L73E 3CYTI 2OTJP 4IL6X 1S4XA 3ZOWA 2IYPA 1M1JB 3L71G 1W2EA 5KKZC 3L74D 3HE4B 1SQXD 1BE3J 1C6OA 3ITKA 1IFPA 2HV4A 3H1LD 3VNWA 4JF7A 4EOTA 4UB6H 1EDIA 1HROA 4I6MC 5APUA 2D2CB 5CIHB 1KX7A 1NIRA 2ZJSE 1GIWA 3BASA 3HD7C 4AUWA 1PGOA 3IR9A 3M0AA 1WEJF 3V4WA 3N7NA 1JY2N 5CCGC 1J1DB 1JDLA 1L4AB 1QL3A 2FXMA 3M91A 5AVQB 1BDDA 2A06D 2I8FA 2K9JB 1U7JA 3KZIE 5AW3B 3L74E 1KV9A 4AANA 1TU3F 4HH2A 1CRCA 3RL0C 1HH0A 3VMXA 1QGKB 1M60A 2GUVA 5DFSA 2HYNA 3ZOOA 1ZP0C 4I1LA 1YQ4C 3AE3C 1HJ4A 1HJ0A 3PXWA 3CCJP 3AE2C 2NZ2A 2KXPB 1KILC 1VF5D 5KJ7D 4GDOA 4M3LA 1VQ7P 1W2LA 1QVGO 1CYJA 2D2CD 2QJKB 1D7MA 3WFDC 3L72E 2N9JA 5B5EV 1VPCA 3I5CA 3HQ9A 1SQPG 3HE4A 1IZNB 2PRRA 4DOJA 1I8PA 1ZZHA 2WSFJ 2C1VA 4AQRD 2QM8A 1ZN5A 3DP5A 5DJUB 4H0JA 1HGZA 1OFCX 4QAOA 4JBZA 3L75J 1URQB 1Q86Q 3TSIA 2YKPA 2VRSA 1EC5A 1FOSE 1CYIA 1CRIA 5AW0B 1YEAA 2E75C 2C0WA 3G3ZA 3SWYA 1AV1A 1U7MA 4H13C 1RF0C 3MK7C 1CHIA 2LIRA 2OYIC 3CCEP 3AEFC 1S72P 1C6RA 3L75G 2WPSA 3LW5J 2R5BA 2YK3A 3OW2O 3HUSA 1JTHB 1LTGC 2ZFCA
chains in the Genus database with same CATH topology
1GKSA 1NTZD 2RMZA 1W5CT 3A9FA 2VHDA 1J3SA 3WUIA 2RN0A 1CIFA 4PJ0V 2N18C 3CP5A 2FWLA 1CIEA 1N9CA 4KMGA 1DIQC 4EIFA 1FJ0A 2QJPB 3NBTA 4PW9B 4FA9A 5KLIB 1M70A 2GIWA 4MU8A 1I5TA 2Y0DA 1LMSA 1SQVD 1N90A 3PLNA 5CIDB 2B4ZA 5DJQB 1LFMA 4WQ7A 1CRHA 4JCGA 4WQCA 2BGVX 4J20A 1I6DA 1H33A 3C2CA 1H1OA 5IY51 1HRCA 1R0QA 1C52A 1DIIC 2L91A 4UB6V 4WQBA 1C7MA 1CTYA 1SQPD 1IZL0 2OZ1B 1CNOA 1MG3D 3KZIV 1KIBA 1YNRA 1PP9D 3O20A 3O1YA 1I6EA 2ZOOA 1A8CA 3CU4A 1YIQA 5KKZB 3O5CA 5CICB 2MTAC 1HH7A 2CE1A 1CHJA 5C0ZA 5TJHA 2ORLA 1DVHA 1CXAA 1H9XA 1MZ4A 1GDVA 4XXLA 3ZIYA 5AURA 1P84D 3DR0A 4WQ8A 3NBSA 3SVWA 1FHBA 1CORA 1BGYD 2C1UA 3NWVA 3OA8A 4NFGB 3H1ID 2FRCA 4WQEA 1DW0A 1CHHA 3HQ8A 3X39A 4L3GA 1RAQA 1I55A 1OAEA 3RLMA 1WVEC 2D0SA 2GC4D 4V2KA 4P4QB 3GG2A 4L1QA 1H32A 2Q3EA 2ZONG 1HZVA 2O3JA 1C2RA 2PCBB 1HCMA 3ZOXA 1FI3A 1H31A 1EZVD 3CX5D 2JQRA 1CXCA 1N50A 1L0ND 1VYDA 3PXSA 1KYOW 2BCCD 4LJIA 4U3FD 1DW2A 1E8EA 1QL4A 5KLVD 2CE0A 2B10B 4PWAA 2GC7D 1LC2A 2C2CA 5CYTR 4AAOA 3L75D 1BCCD 4IL6V 1YICA 2LITA 4O1WA 1RZ5A 4EIEA 1CSXA 3WFBC 2YCCA 3L4OA 1S6VB 3CX5W 2D0WA 5DF5A 3H1JD 3PHLA 3L73D 1E29A 3WFEC 3TDKA 1A56A 1CIGA 1H32B 3BCCD 3ORVA 1YCCA 1HZUA 2PCCB 3RN1A 5TISV 1A2SA 1CSUA 2IBZD 1IO3A 3TYIA 3KHUA 2V07A 1CSVA 2MHMA 1H33B 4AAMA 2FYNB 5B6QA 1C2NA 1DW3A 1KX2A 1AYGA 5CIBB 2ZZS1 1I8OA 2JTIB 2N9IA 3ZOYA 4RSZA 2OZ1A 3PH2B 1CRJA 4FA5A 351CA 3RMZA 3TF5A 1S5LV 155CA 1RZ6A 4EIDA 4Q5PA 2ZBOA 2N3BA 2C9XB 3OCDA 3ZBMA 2KNCB 1CRYA 1I54A 1PPJD 3SXTA 1KYOD 5E79V 3SJLA 4K3IA 4WQDA 1AOQA 1KB0A 2B0ZB 1L0LD 1NMLA 3MK7B 4WQ9A 1CCHA 4AX3A 4EICA 1CIHA 1DVVA 4D6TD 3OA8B 3H1HD 3DMIA 1C75A 2GB8B 1CEDA 3HQ6A 1QKSA 3L71D 1CYCA 1U75B 1SQQD 3GW6A 1IRVA 3CXHW 1AOFA 2V08A 3M97X 1CCRA 2N18B 2PACA 1GQ1A 3WC8A 1ZRTD 4WQAA 3CWBD 4EDFA 1COTA 1U74B 2C1DB 4GYDA 1ETPA 2BPBB 2CA3B 1NTMD 2YQBA 1L9JC 4GEDB 1BE3D 4Y5RA 2AXTV 2BH4X 5DJQC 1NU1D 1CC5A 2ZXYA 2BH5X 1EB7A 1LS9A 1AKKA 3JBTB 3PTZA 2XTSB 2L4DA 4PD4D 4O1QA 3O0RC 4A7PA 1CTZA 2FYUD 5KAIV 5CIEB 2BLFB 3CYTI 4N0KA 3SLEA 3ZOWA 3PXTA 1N15A 5B66V 1K3HA 1YFCA 2AI5A 3L74D 1FI9A 1SQXD 1C6OA 3ITKA 1LC1A 1HJ5A 2N9YB 2HV4A 3H1LD 1F1FA 2CXBA 3VNWA 3RN0A 2EXVA 2QJYB 1CSWA 2DGEA 3L72D 4FAVA 3TGUD 1HROA 3VYMA 3VMAA 3SWSA 2Y0EA 5CIHB 3L70D 3ZCFA 1NIRA 1KX7A 1GIWA 3OCDB 1M6ZA 1C6SA 1WEJF 2B11B 1NTKD 4L3HA 1JDLA 4UB8V 1QL3A 4FA4A 1YTCA 2KS1A 3A0HV 2A06D 2YIUB 2I8FA 2K9JB 2C1DA 4AALA 1KV9A 4AANA 1CRCA 1E2RA 1IQCA 1M60A 1IRWA 1CRGA 3WU2V 1KB9D 5EXQA 2AIUA 1DT1A 5DFSA 1NNOA 5GTIV 3ZOOA 2N3YA 5GTHV 1L9BC 3A0BV 1HJ4A 1MG2D 1CO6A 3PXWA 4YE1A 4FB1A 2DVHA 5KAFV 4RJTA 4H0KA 5C9MA 1QYZA 2Y0CA 3CXHD 2JWAA 1DW1A 1W2LA 1FCDC 1CYJA 2CA4B 2QJKB 1GU2A 1QN2A 3WFDC 2N9JA 5B5EV 1H31B 2B12B 1F1CA 3FWLA 3HQ9A 1NMIA 2BCNB 1I8PA 1ZZHA 2C1VA 1OCDA 451CA 4FANA 3VRDA 3DP5A 1BL9A 4H0JA 2QG4A 4QAOA 3HQ7A 3L4MA 5CIGB 1FI7A 1SQBD 5CIFB 4XYDB 3WFCC 1FOCA 1CYIA 4DY9A 1CRIA 1YEAA 1RAPA 4FA1A 1K3GA 1B7VA 1GJQA 5H2FV 3H1KD 3MK7C 2C8SA 1CHIA 2LIRA 1YEBA 1H9YA 1C6RA 1CTJA 2YK3A 3PRJA 1HJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKS A;  1NTZ D;  2RMZ A;  1W5C T;  3A9F A;  2VHD A;  1J3S A;  3WUI A;  2RN0 A;  1CIF A;  4PJ0 V;  2N18 C;  3CP5 A;  2FWL A;  1CIE A;  1N9C A;  4KMG A;  1DIQ C;  4EIF A;  1FJ0 A;  2QJP B;  3NBT A;  4PW9 B;  4FA9 A;  5KLI B;  1M70 A;  2GIW A;  4MU8 A;  1I5T A;  2Y0D A;  1LMS A;  1SQV D;  1N90 A;  3PLN A;  5CID B;  2B4Z A;  5DJQ B;  1LFM A;  4WQ7 A;  1CRH A;  4JCG A;  4WQC A;  2BGV X;  4J20 A;  1I6D A;  1H33 A;  3C2C A;  1H1O A;  5IY5 1;  1HRC A;  1R0Q A;  1C52 A;  1DII C;  2L91 A;  4UB6 V;  4WQB A;  1C7M A;  1CTY A;  1SQP D;  1IZL 0;  2OZ1 B;  1CNO A;  1MG3 D;  3KZI V;  1KIB A;  1YNR A;  1PP9 D;  3O20 A;  3O1Y A;  1I6E A;  2ZOO A;  1A8C A;  3CU4 A;  1YIQ A;  5KKZ B;  3O5C A;  5CIC B;  2MTA C;  1HH7 A;  2CE1 A;  1CHJ A;  5C0Z A;  5TJH A;  2ORL A;  1DVH A;  1CXA A;  1H9X A;  1MZ4 A;  1GDV A;  4XXL A;  3ZIY A;  5AUR A;  1P84 D;  3DR0 A;  4WQ8 A;  3NBS A;  3SVW A;  1FHB A;  1COR A;  1BGY D;  2C1U A;  3NWV A;  3OA8 A;  4NFG B;  3H1I D;  2FRC A;  4WQE A;  1DW0 A;  1CHH A;  3HQ8 A;  3X39 A;  4L3G A;  1RAQ A;  1I55 A;  1OAE A;  3RLM A;  1WVE C;  2D0S A;  2GC4 D;  4V2K A;  4P4Q B;  3GG2 A;  4L1Q A;  1H32 A;  2Q3E A;  2ZON G;  1HZV A;  2O3J A;  1C2R A;  2PCB B;  1HCM A;  3ZOX A;  1FI3 A;  1H31 A;  1EZV D;  3CX5 D;  2JQR A;  1CXC A;  1N50 A;  1L0N D;  1VYD A;  3PXS A;  1KYO W;  2BCC D;  4LJI A;  4U3F D;  1DW2 A;  1E8E A;  1QL4 A;  5KLV D;  2CE0 A;  2B10 B;  4PWA A;  2GC7 D;  1LC2 A;  2C2C A;  5CYT R;  4AAO A;  3L75 D;  1BCC D;  4IL6 V;  1YIC A;  2LIT A;  4O1W A;  1RZ5 A;  4EIE A;  1CSX A;  3WFB C;  2YCC A;  3L4O A;  1S6V B;  3CX5 W;  2D0W A;  5DF5 A;  3H1J D;  3PHL A;  3L73 D;  1E29 A;  3WFE C;  3TDK A;  1A56 A;  1CIG A;  1H32 B;  3BCC D;  3ORV A;  1YCC A;  1HZU A;  2PCC B;  3RN1 A;  5TIS V;  1A2S A;  1CSU A;  2IBZ D;  1IO3 A;  3TYI A;  3KHU A;  2V07 A;  1CSV A;  2MHM A;  1H33 B;  4AAM A;  2FYN B;  5B6Q A;  1C2N A;  1DW3 A;  1KX2 A;  1AYG A;  5CIB B;  2ZZS 1;  1I8O A;  2JTI B;  2N9I A;  3ZOY A;  4RSZ A;  2OZ1 A;  3PH2 B;  1CRJ A;  4FA5 A;  351C A;  3RMZ A;  3TF5 A;  1S5L V;  155C A;  1RZ6 A;  4EID A;  4Q5P A;  2ZBO A;  2N3B A;  2C9X B;  3OCD A;  3ZBM A;  2KNC B;  1CRY A;  1I54 A;  1PPJ D;  3SXT A;  1KYO D;  5E79 V;  3SJL A;  4K3I A;  4WQD A;  1AOQ A;  1KB0 A;  2B0Z B;  1L0L D;  1NML A;  3MK7 B;  4WQ9 A;  1CCH A;  4AX3 A;  4EIC A;  1CIH A;  1DVV A;  4D6T D;  3OA8 B;  3H1H D;  3DMI A;  1C75 A;  2GB8 B;  1CED A;  3HQ6 A;  1QKS A;  3L71 D;  1CYC A;  1U75 B;  1SQQ D;  3GW6 A;  1IRV A;  3CXH W;  1AOF A;  2V08 A;  3M97 X;  1CCR A;  2N18 B;  2PAC A;  1GQ1 A;  3WC8 A;  1ZRT D;  4WQA A;  3CWB D;  4EDF A;  1COT A;  1U74 B;  2C1D B;  4GYD A;  1ETP A;  2BPB B;  2CA3 B;  1NTM D;  2YQB A;  1L9J C;  4GED B;  1BE3 D;  4Y5R A;  2AXT V;  2BH4 X;  5DJQ C;  1NU1 D;  1CC5 A;  2ZXY A;  2BH5 X;  1EB7 A;  1LS9 A;  1AKK A;  3JBT B;  3PTZ A;  2XTS B;  2L4D A;  4PD4 D;  4O1Q A;  3O0R C;  4A7P A;  1CTZ A;  2FYU D;  5KAI V;  5CIE B;  2BLF B;  3CYT I;  4N0K A;  3SLE A;  3ZOW A;  3PXT A;  1N15 A;  5B66 V;  1K3H A;  1YFC A;  2AI5 A;  3L74 D;  1FI9 A;  1SQX D;  1C6O A;  3ITK A;  1LC1 A;  1HJ5 A;  2N9Y B;  2HV4 A;  3H1L D;  1F1F A;  2CXB A;  3VNW A;  3RN0 A;  2EXV A;  2QJY B;  1CSW A;  2DGE A;  3L72 D;  4FAV A;  3TGU D;  1HRO A;  3VYM A;  3VMA A;  3SWS A;  2Y0E A;  5CIH B;  3L70 D;  3ZCF A;  1NIR A;  1KX7 A;  1GIW A;  3OCD B;  1M6Z A;  1C6S A;  1WEJ F;  2B11 B;  1NTK D;  4L3H A;  1JDL A;  4UB8 V;  1QL3 A;  4FA4 A;  1YTC A;  2KS1 A;  3A0H V;  2A06 D;  2YIU B;  2I8F A;  2K9J B;  2C1D A;  4AAL A;  1KV9 A;  4AAN A;  1CRC A;  1E2R A;  1IQC A;  1M60 A;  1IRW A;  1CRG A;  3WU2 V;  1KB9 D;  5EXQ A;  2AIU A;  1DT1 A;  5DFS A;  1NNO A;  5GTI V;  3ZOO A;  2N3Y A;  5GTH V;  1L9B C;  3A0B V;  1HJ4 A;  1MG2 D;  1CO6 A;  3PXW A;  4YE1 A;  4FB1 A;  2DVH A;  5KAF V;  4RJT A;  4H0K A;  5C9M A;  1QYZ A;  2Y0C A;  3CXH D;  2JWA A;  1DW1 A;  1W2L A;  1FCD C;  1CYJ A;  2CA4 B;  2QJK B;  1GU2 A;  1QN2 A;  3WFD C;  2N9J A;  5B5E V;  1H31 B;  2B12 B;  1F1C A;  3FWL A;  3HQ9 A;  1NMI A;  2BCN B;  1I8P A;  1ZZH A;  2C1V A;  1OCD A;  451C A;  4FAN A;  3VRD A;  3DP5 A;  1BL9 A;  4H0J A;  2QG4 A;  4QAO A;  3HQ7 A;  3L4M A;  5CIG B;  1FI7 A;  1SQB D;  5CIF B;  4XYD B;  3WFC C;  1FOC A;  1CYI A;  4DY9 A;  1CRI A;  1YEA A;  1RAP A;  4FA1 A;  1K3G A;  1B7V A;  1GJQ A;  5H2F V;  3H1K D;  3MK7 C;  2C8S A;  1CHI A;  2LIR A;  1YEB A;  1H9Y A;  1C6R A;  1CTJ A;  2YK3 A;  3PRJ A;  1HJ3 A; 
#chains in the Genus database with same CATH topology
 1KFM A;  1JUN A;  1GKS A;  1NTZ D;  1W5C T;  3A9F A;  2ZYD A;  1J3S A;  3WUI A;  1SQP E;  3KZI H;  2IFM A;  1T2K C;  4Y99 B;  1KZU B;  1N9C A;  4D6T E;  2DW3 A;  1FJ0 A;  3NBT A;  4U3F G;  1ZR4 A;  2FY8 A;  1I5T A;  2BAS A;  3KPE A;  2K88 A;  2B4Z A;  3KQG A;  3O6Q A;  4WQ7 A;  2H8P D;  1CRH A;  1BGY E;  2B88 A;  1L0N G;  1I6D A;  1H33 A;  1ZRT E;  1IK7 A;  2C0X A;  1NH4 A;  1DII C;  3L71 J;  1LP1 A;  1UII A;  1C7M A;  1CNO A;  1MG3 D;  3KZI V;  5C39 A;  4XA4 A;  3V2P A;  1S9K E;  2KYV A;  1YNR A;  2K1A A;  3H1I E;  4N3Y B;  1I6E A;  1A8C A;  3CME P;  3TNU A;  3O5C A;  2E76 D;  1HH7 A;  2C9L Y;  1DX7 A;  1DEE G;  1LTA C;  1GMJ A;  1H9X A;  1GDV A;  2POH A;  2WWW A;  4XXL A;  3ZIY A;  3M0D C;  1USE A;  1LTJ B;  1QX8 A;  1N7S B;  3BAT A;  4WQ8 A;  5KAI E;  3JC2 2;  3SVW A;  4JQ0 D;  1FHB A;  1USD A;  1SQQ E;  2KSJ A;  2QJY C;  3Q5P A;  2KZJ A;  2XNX A;  4I7Z C;  2ITA A;  1FJK A;  1OZH A;  1CHH A;  3HQ8 A;  2KI7 B;  3AEB C;  1Y9B A;  1EZV G;  4JYB A;  2KNC A;  1L0N E;  1RAQ A;  1I55 A;  2KIK A;  4HJG H;  3F89 A;  1N73 C;  2NPS A;  1HBW A;  1HZV A;  1C2R A;  2PCB B;  1NU1 K;  2WQY C;  1R8E A;  3WMM 0;  1GL2 C;  2JQR A;  3GHG C;  2Q7C A;  2O01 J;  2WZ7 A;  1VF5 B;  1N50 A;  2FXO A;  1L0N K;  2A45 I;  5AW4 B;  2R5D A;  4W7Y A;  2IYO A;  4L74 A;  5B66 H;  3L70 E;  5CCG D;  4PJ0 H;  1FDO A;  2YMK A;  3L75 D;  1LP1 B;  4IL6 V;  2LIT A;  3C1L A;  1BSN A;  1RZ5 A;  1JY3 P;  3H1H G;  3WFB C;  3L4O A;  4W7Z A;  1RF1 C;  3H1J D;  1AVO A;  3L73 D;  1CZQ A;  1OVU A;  1BE3 G;  3A0B E;  3B5N B;  2IPP A;  3RN1 A;  2IBZ D;  3WUU A;  1DH3 A;  2OYI A;  1CSV A;  1SFC B;  1C2N A;  2OYH A;  3H1H J;  1KX2 A;  4N6J A;  1JTH A;  1KB9 H;  1I8O A;  2I1K A;  1KN7 A;  2OZ1 A;  5AW9 B;  1S5L V;  4EID A;  2WPV B;  3MUD A;  2R44 A;  3OCD A;  1KOR A;  2KNC B;  3H1J G;  2NRG A;  1FZB A;  1FJP A;  5K5G B;  3L70 G;  4WQD A;  4EIJ A;  4N78 E;  4MN4 C;  4WQ9 A;  1R5S A;  3CCR P;  4EIC A;  1GL2 A;  3OA8 B;  1PPJ G;  1NTM K;  4WY4 D;  3DMI A;  2CPS A;  1CED A;  1ZXG A;  4GT1 A;  1KTM A;  3ABV C;  4WY4 A;  1CYC A;  1YJ9 P;  1IFJ A;  4YTP C;  1IRV A;  1X8Y A;  3BRT B;  1M56 D;  3CL3 D;  2PGD A;  1JEK A;  1AQT A;  1RH5 B;  2WPQ A;  2I1J A;  3CLQ A;  5APW A;  1GQ1 A;  3U1A A;  5CCH A;  3M06 A;  3RL0 g;  3CCM P;  5KLI C;  2C1D B;  1ETP A;  2CA3 B;  4H44 C;  5APX A;  1NTK E;  5AVX B;  5DJQ C;  1X79 B;  3LW5 H;  3B5N A;  3CPW O;  1CC5 A;  2ZXY A;  2BH5 X;  2HFE D;  1RQU A;  4UB8 H;  1SFC A;  3F5H A;  1SQB K;  1KQF B;  1T2K D;  3RK3 E;  4PD4 D;  4O1Q A;  1LWU C;  4PV1 D;  1N7S D;  4N0K A;  3PXT A;  1GK4 A;  2NPS B;  2YNY A;  3AE9 C;  1OVR A;  2FFD C;  1NTZ K;  2IBZ G;  5APY A;  3EFG A;  5B5E H;  2N1T B;  1LC1 A;  1HJ5 A;  2N9Y B;  1CI6 A;  4N78 D;  4YXW H;  1QVF O;  1VQN P;  3VYM A;  3VMA A;  2BCC J;  2Y0E A;  3L70 D;  3CCS P;  1NTK J;  1QLE D;  1YBK A;  3L72 J;  3V2R A;  1N8R Q;  4WY4 B;  2IBZ I;  1NWQ A;  2B11 B;  2E76 C;  2LR2 A;  3CCV P;  2W83 C;  5CBO A;  1RE4 C;  1NU1 E;  1LT9 B;  2C1D A;  2R3C A;  1E2R A;  4C7R A;  1GK6 A;  3AEC C;  1EXJ A;  3AE4 C;  2HLO A;  3FWN A;  1IRW A;  1CRG A;  4H0L B;  2AIU A;  1DT1 A;  4NPF X;  4UB6 E;  1NNO A;  2OYH B;  1L9B C;  3RL0 D;  2DVH A;  1YTZ I;  1LWU A;  3CD6 P;  1P84 I;  3CCQ P;  1URQ D;  5BVZ A;  4ZKU A;  1SLQ A;  2Y0C A;  1ZME C;  3B4S A;  2CA4 B;  3S1K A;  1VQK P;  1QN2 A;  4R4L A;  5AVR B;  3HTK A;  1PV3 A;  1H31 B;  3JCU H;  3GHG A;  1Q90 D;  5AW8 B;  5KJ7 C;  4IFF A;  1NMI A;  2BCN B;  4D6T J;  1NKN A;  1H8A A;  1U57 A;  1NU1 G;  2WSF H;  2W90 A;  451C A;  2E75 D;  4FAN A;  4U3F J;  4U3F E;  3HQ7 A;  5CIG B;  3A2A A;  1Q7Y Q;  4XYD B;  2LXB A;  1JY2 O;  3P8C E;  3WU2 H;  2HPC A;  1RAP A;  5CCG A;  4FA1 A;  1IFN A;  1K3G A;  4OVN F;  2FYU E;  3AED C;  2Y9Z A;  3L35 A;  4K35 A;  5AW2 B;  1J1E C;  1YEB A;  4DZO A;  1KC8 Q;  2AEF A;  1H9Y A;  4RKU J;  1CTJ A;  3RK2 C;  1J2J B;  3H1L G;  1HJ3 A;  2QIW A;  2OAR A;  1LT1 A;  2VHD A;  1CIF A;  1SVF A;  4LC1 A;  1MUU A;  2FBW C;  4KMG A;  1PP9 E;  1PP9 J;  3AEA C;  1SQQ J;  1DIQ C;  4EIF A;  2QJP B;  3RBX A;  4FA9 A;  2M5A B;  1FZC C;  2RKL A;  2JWD A;  1SQV D;  3PLN A;  3G71 P;  2BCC E;  1SQX K;  3A3Y B;  1K05 A;  5KLV E;  5KLV J;  3M9B A;  1HRC A;  2NPS D;  3CX5 H;  1NTM E;  1FZE A;  2JDI H;  1VL2 A;  1N86 A;  3EFF K;  3RBZ A;  2ZYA A;  1HJB A;  5APS A;  3BCC J;  1FAV A;  1PP9 D;  3O1Y A;  3CMA P;  3CU4 A;  5KKZ B;  4NPD A;  2CE1 A;  5TJH A;  2ORL A;  1CSB A;  4BXL A;  4ZMD A;  2KLU A;  3MTU E;  1P84 D;  2KK7 A;  4C7N B;  1H0T B;  1L0L J;  1ZW0 A;  5H2F H;  1VQ8 P;  1M90 Q;  4TT3 H;  2A06 E;  1DW0 A;  3CCL P;  2D2C C;  3L37 A;  1URQ A;  2AXT E;  3HUS C;  2ZT9 B;  4ZNC A;  1MFZ A;  2N9B A;  4L3G A;  2P7J A;  3G6E P;  2M3B A;  4HYT B;  1J1D C;  2D0S A;  2GC4 D;  4V2K A;  1NKZ B;  2W8Z A;  2M8R A;  1M57 D;  3AE6 C;  1H32 A;  2Q3E A;  2YIU C;  2P1J A;  2ZON G;  2M5A A;  1HCM A;  1FI3 A;  1H31 A;  2K3R A;  4PD4 H;  3M0D A;  1E5W A;  2IFN A;  1HVV A;  2WIT A;  1VYD A;  3PXS A;  1EQ7 A;  2G8Y A;  1DW2 A;  3P7K A;  1KD1 Q;  4Z1M H;  1CW5 A;  2CE0 A;  3L70 J;  1L0N J;  2IZ0 A;  5CYT R;  2K37 A;  3TK1 A;  3SFE C;  1BCC D;  3L73 J;  2QSI A;  1KIL B;  1OWA A;  1S6V B;  2K9Y A;  3SWK A;  2D0W A;  5DF5 A;  2HPC B;  3WFE C;  1CIG A;  2QJK C;  2O1J A;  4EI2 A;  2PCC B;  1CSU A;  2O01 N;  1IO3 A;  2V4H A;  1BCC E;  1H33 B;  1VQ9 P;  1SS1 A;  3L4F A;  5APV A;  4C7N A;  3L73 G;  1AYG A;  1IC2 A;  1RE3 C;  2JTI B;  1NHL A;  3LID A;  3ZOY A;  1S9K D;  4RSZ A;  1URQ C;  3MP7 B;  3A0H E;  3V2N A;  1RHZ B;  1CRJ A;  1S3J A;  2M3E A;  4WBA A;  1SQV G;  4GIF A;  5GTI E;  2C9X B;  3ZBM A;  2O01 H;  2IZ1 A;  3H1K J;  1KYO D;  2IX7 C;  4QMA A;  4K3I A;  1FS0 E;  4K3A A;  2J5U A;  2XU6 A;  1KQG B;  1L0L D;  1CCH A;  2ZVO B;  2YXR B;  3CC2 P;  4AX3 A;  2FYZ A;  1CIH A;  4D6T D;  2WSC H;  1Q81 Q;  1NO4 A;  3P8C D;  2QE7 H;  5CBN A;  1NOH A;  3CC4 P;  1C75 A;  1GZL A;  2GB8 B;  2XKM A;  4HKZ H;  2H43 A;  5CMZ A;  1QKS A;  3L71 D;  1BCC G;  1CCR A;  1NTZ J;  1A02 J;  1PFI A;  2Y9Y A;  5KAI H;  2PAC A;  4IFD K;  1KIL A;  3WC8 A;  1ZRT D;  1S5L H;  4EDF A;  5BU5 A;  2BPB B;  2W6A A;  1NYH A;  3Q1M A;  1JMM A;  1L9J C;  3L71 E;  1VQL P;  1IO4 A;  2W27 A;  2AXT V;  3A0B H;  4PD4 I;  1SQX G;  5L8R J;  3G9R A;  1NU1 D;  1HF9 A;  1H0T A;  1LS9 A;  1AKK A;  3AEG C;  3RK3 C;  3MGN A;  4H44 D;  1LGH B;  3PTZ A;  2B9B A;  1S5L X;  1MFT A;  2L4D A;  4DT0 A;  1CTZ A;  3OA7 A;  2FYU D;  1KQS O;  5KAI V;  1SQP K;  5CIE B;  1M8O B;  2BLF B;  1EXI A;  3VMY A;  5AVU B;  3AE7 C;  1SQB J;  3TGU E;  4ASW A;  1PGP A;  2UWJ E;  3NMD A;  2YXQ B;  1YFC A;  2AI5 A;  1PL5 A;  3QWO C;  4PV1 C;  5KTB A;  1LTJ C;  2Q6Q A;  1N7S C;  1F1F A;  2CXB A;  1CSW A;  4FAV A;  3TGU D;  2J59 M;  1YJW P;  4OGQ C;  1K8A Q;  4I7Z B;  3ZCF A;  4L73 A;  3MUD C;  3OCD B;  3V2Q A;  1Z56 A;  3S4R A;  5AVV B;  3VP8 A;  4DJG A;  1NTK D;  1T3J A;  4L3H A;  3E1I A;  4UB8 V;  1YHQ P;  2PAJ A;  2XND H;  2L5G B;  3L74 G;  3H32 B;  3AE1 C;  3H1K G;  1VQP P;  1LTT C;  1GL2 B;  1IQC A;  1PGJ A;  2QM7 A;  3WU2 V;  2ZXX A;  1KMI Z;  5EXQ A;  5GTI V;  5APQ A;  1K04 A;  2N3Y A;  5GTH V;  2CPB A;  3A0B V;  3HD7 A;  2FYU G;  2XZR A;  2G3A A;  2WSE J;  1CO6 A;  4YE1 A;  5KAF V;  3R2P A;  3VYI A;  5AVS B;  2E74 C;  1N7L A;  3AEE C;  1H88 A;  2YKQ A;  1JY3 N;  2Z5H A;  4H0K A;  5C9M A;  1QYZ A;  2MKV A;  3CXH D;  3VP9 A;  1FCD C;  4TLF A;  1GU2 A;  2B12 B;  1F1C A;  3FWL A;  3K5B A;  1L0L G;  1ZV8 A;  5AW6 B;  2FYN C;  1P84 H;  1SFC C;  5AW1 B;  1P84 E;  5CCH D;  2BEZ F;  1GW4 A;  1BL9 A;  2QG4 A;  2XV5 A;  3V4Q A;  1E79 H;  1AJY A;  3Q5S A;  1IK9 A;  1FI7 A;  2KUB A;  3C9I A;  1SQB D;  5CIF B;  1EZV I;  2WT7 A;  3OAK A;  1FOC A;  4DY9 A;  2CK3 H;  3CXH H;  1LNQ A;  3CWB E;  3R4Y A;  3JSV C;  1X9V A;  5KLV G;  1YI2 P;  1GJQ A;  1JY3 O;  2PP6 A;  3H1K D;  1L0L K;  2AXT H;  3H32 A;  2KOG A;  2JEE A;  4B86 A;  4ZKP A;  3NTN A;  1NU1 J;  2HG5 D;  3SSU A;  4JPZ B;  5CJ4 A;  1ZLL A;  2JR8 A;  3PRJ A;  1GDT A;  1BGY G;  2SPZ A;  3FXD A;  1MKM A;  4JYC A;  2N18 C;  3CP5 A;  2FWL A;  1OMI A;  1CIE A;  1KQL A;  4XE5 B;  3A7O A;  1LT9 A;  4GOD A;  4PW9 B;  5KLI B;  1M70 A;  4MU8 A;  2JO1 A;  3TNU B;  2Y0D A;  4H44 B;  1NJI Q;  4PD4 E;  5KLV K;  3A0H H;  3EWK A;  1LMS A;  1N90 A;  5CID B;  3VOP A;  1LJ2 A;  3H1L E;  3U1C A;  4JCG A;  2BGV X;  4J20 A;  2A45 G;  5IY5 1;  3MZW B;  3IN6 A;  2E74 D;  4UB8 E;  1R0Q A;  4EYY Q;  5AVW B;  2L91 A;  3HE5 A;  3T97 A;  1IFD A;  4GOE A;  2E43 A;  3CI9 A;  4UB6 V;  1LWU B;  1NAY A;  4D6T G;  1CTY A;  1SQP D;  3FX0 A;  5M1B A;  1G1J A;  1KIB A;  2WT7 B;  3BCC E;  1XTC C;  3O20 A;  1WMK A;  2WSC J;  3TYY A;  1M1J C;  3WU2 E;  1W5C E;  1YIQ A;  2NPS C;  5CIC B;  1KYO H;  2MTA C;  1DVH A;  4PJ0 E;  1KYO E;  1CXA A;  3O6Q B;  2N1T C;  2B89 A;  3DR0 A;  1HGV A;  1IFI A;  2WPR A;  1BGY D;  3O8Z A;  3CXH I;  4XFJ A;  2QEX P;  2FYU K;  3NWV A;  4NFG B;  3H1I D;  2FRC A;  4WQE A;  1S1C X;  3HRN A;  5APT A;  4NPE A;  2H7H A;  3HD7 B;  1EZV E;  3L36 A;  3CX5 E;  4WY4 C;  3PJS K;  3L75 E;  3B5N D;  1JY2 P;  1RY3 A;  3WUV A;  3X39 A;  2E76 B;  1BCC J;  1OAE A;  4H13 D;  1L4A C;  3RLM A;  1N2D C;  1WVE C;  2KSE A;  2WMM A;  3CC7 P;  3GLM A;  1LT9 C;  2KP8 A;  1LTI C;  1EZV D;  3C8V A;  1SQQ G;  3CX5 D;  1LTJ A;  1T6A A;  3RL0 B;  1N7S A;  1GU4 A;  1CXC A;  1KFN A;  1FZF A;  2W6J H;  1L0N D;  3USS A;  4H0L C;  3HD7 D;  3NXS A;  2AEM A;  1QL4 A;  1G2C A;  2GC7 D;  3IAO A;  3H1H E;  2C2C A;  4AAO A;  1PGQ A;  4YPC A;  1YIC A;  4O1W A;  3KXD A;  1JO5 A;  1CSX A;  2YCC A;  3Q2Y A;  1L2P A;  3PHL A;  1E29 A;  3TDK A;  2JP3 A;  2JKV A;  3BCC D;  3ORV A;  1HZU A;  1NTZ G;  3KHU A;  2MHM A;  2GM4 A;  4AAM A;  1FC2 C;  4GOF A;  1NTK K;  2AEJ A;  2BEQ D;  4IL6 H;  3CXH E;  3VMZ A;  5CIB B;  3LIE A;  1KIL D;  2N9I A;  3RK2 D;  3H6P A;  5B5E E;  3SFD C;  351C A;  3TF5 A;  2FXP A;  155C A;  1RZ6 A;  2OQQ A;  2ZBO A;  2N3B A;  1M7L A;  2IBZ E;  4DCK A;  1EDK A;  1QL2 A;  4GKG A;  1I54 A;  1RF1 A;  1KB9 I;  2E75 B;  1OVV A;  3L74 J;  3G4S P;  3H1J E;  1H89 A;  1PIX A;  1KB0 A;  2I8D A;  1T8Z A;  4H13 B;  2B0Z B;  3MK7 B;  1NML A;  1YIJ P;  1K9M Q;  2OYI B;  1DVV A;  1JCC A;  2QRX A;  5DJT B;  1JCD A;  3Q5R A;  3HQ6 A;  2FKW B;  1AQ5 A;  1SQV E;  1L4A D;  3HE5 B;  3T97 B;  2O1K A;  3H1K E;  3GW6 A;  2R3S A;  2YO3 A;  3M97 X;  4Y99 C;  5AVT B;  1WRG A;  3D6Y A;  4GYD A;  3RK3 D;  1NTM D;  2YQB A;  4OH8 B;  2HOD B;  3E7K A;  1GD2 E;  1GU5 A;  3OJA B;  4Y5R A;  1NTK G;  2OYO A;  4WWI A;  1Y47 A;  2N1T A;  4WB4 A;  4L75 A;  5H2F E;  3H1I J;  2LXC B;  3EQ2 A;  1UIX A;  3D71 A;  2XTS B;  3BRV B;  4IFM A;  1EDL A;  3MHV A;  4W80 A;  3O0R C;  4A7P A;  4KT0 J;  3CWB J;  1L0L E;  1NVO A;  2OTK E;  3SLE A;  3V6I A;  2E5Y A;  1SP4 A;  1N15 A;  5B66 V;  1SQV J;  1K3H A;  2KB7 P;  1NTM J;  5GTH E;  1FI9 A;  3S9O A;  1JOC A;  3RN0 A;  2EXV A;  2QJY B;  2DGE A;  3L72 D;  1LTB C;  1JNM A;  2B87 A;  3SWS A;  1JB0 J;  2ZAE B;  3AE5 C;  3BVH A;  3HUS B;  2ZT9 C;  2OTL P;  1G2C B;  1FDM A;  1VQ5 P;  1DEB A;  1M6Z A;  4RO0 A;  1PPJ E;  1C6S A;  1YQ3 C;  4FA4 A;  1YTC A;  3N4X A;  2KS1 A;  3A0H V;  1ZOY C;  4OGQ D;  1N73 B;  2W6B A;  2YIU B;  4AYC A;  4AAL A;  1ZR2 A;  3GHG B;  1CI6 B;  5AVZ B;  2AXC A;  1VF5 C;  1AFO A;  1KB9 D;  4YXD C;  2YMY A;  1QL1 A;  1RQV A;  1MG2 D;  4FB1 A;  2N1T D;  3H1J J;  1OXZ A;  2Q5U A;  2WSS H;  3JCU E;  4RJT A;  3MIW A;  1A02 F;  2JWA A;  1DD4 A;  1SFC D;  2C9N Y;  1YIT P;  1DW1 A;  3D0W A;  1RF1 B;  1BSH A;  1HWT C;  3B5N C;  4H0L D;  1FZA A;  1RF0 A;  2E42 A;  3FGA D;  1FDI A;  4R4M A;  1OCD A;  3BCC G;  3VRD A;  2B87 B;  2Z4E A;  3L4M A;  2JJL A;  3GF7 A;  1VQ4 P;  2Q3I A;  1FU1 A;  2ZYG A;  3D70 A;  3WFC C;  5E79 H;  4BRY A;  1Q82 Q;  2MJZ A;  3CWB G;  5KAF H;  2Z5I A;  1B7V A;  5H2F V;  1N73 A;  3KYQ A;  2V7Q H;  2WSE H;  3NFQ A;  2HOD A;  5GTH H;  2C8S A;  5KJ7 A;  2P67 A;  5GTI H;  2XDJ A;  1YJN P;  4IL6 E;  1YYC A;  2Q1K A;  4RES B;  5TIS E;  1KB9 E;  2RMZ A;  3P8M C;  5TIS H;  2RN0 A;  5B66 E;  1SQP J;  1BDC A;  4IOI H;  3Q3D A;  4PJ0 V;  1OX3 A;  3W67 A;  3B8E B;  1RE4 A;  3I55 P;  1PP9 G;  2GIW A;  4HB1 A;  3H1I G;  3MD0 A;  1YTZ T;  1FE6 A;  5AW5 B;  5AVY B;  5DJQ B;  1JM0 A;  1KIL E;  1LFM A;  5E79 E;  2BCC G;  1BGY J;  4WQC A;  1SQB E;  3TGU J;  3C2C A;  1S5L E;  1H1O A;  3L72 G;  2PFX A;  3RK3 B;  4CPG A;  1OIP A;  1C52 A;  1RE3 A;  3UIA A;  4I2L C;  3WUT A;  2A06 G;  3QH9 A;  1KV4 A;  4WQB A;  2P2U A;  3AE8 C;  1IZL 0;  2OZ1 B;  4KHX A;  3II6 A;  2RH0 A;  2KS1 B;  2ZOO A;  1FZC A;  2ZVN B;  4LGD E;  5KAF E;  5CHX A;  2M0B A;  4BRY B;  1M1K Q;  2IDB A;  2QA4 P;  2A45 H;  1CHJ A;  5C0Z A;  2FFD B;  2J58 A;  1MZ4 A;  4PV1 B;  2H88 C;  5AUR A;  2H89 C;  1R5L A;  3NBS A;  1DD3 A;  1COR A;  3RGU A;  1LTS C;  4O9B A;  2C1U A;  4U7J A;  1FBM A;  3OA8 A;  1FZG A;  4OGQ B;  1Q2N A;  2R32 A;  3PP5 A;  3IFM A;  4KJM A;  2GUS A;  3CX5 I;  1SQB G;  1AA0 A;  1W2B O;  4P4Q B;  3GG2 A;  1M1J A;  3P32 A;  5CCH C;  4L1Q A;  3M9Q A;  2O3J A;  1IFM A;  3ZOX A;  3E1R A;  2P58 A;  1PZQ A;  4Y28 J;  1VQO P;  1OW8 A;  4WVZ A;  1KYO W;  2BCC D;  2ZT9 D;  4LJI A;  3KDP B;  2OYH C;  4U3F D;  1E8E A;  5KLV D;  2B10 B;  1GW3 A;  4PWA A;  1HTL C;  2Q9I A;  1LC2 A;  3VTP C;  1X0T A;  3CCU P;  1FOS F;  1VQ6 P;  4EIE A;  1XTG B;  4BWN A;  2E74 B;  1K73 Q;  1EDJ A;  3CX5 W;  1GTW A;  2WTY A;  1HUC A;  4OWF A;  3IF4 A;  1X22 A;  1NTM G;  1A56 A;  1H32 B;  1BE3 E;  1YCC A;  3U59 A;  5EFW B;  2V7Q J;  5TIS V;  1A2S A;  2FFD A;  3GMA A;  2KZI A;  3TYI A;  2V07 A;  4L76 A;  1NGM B;  2FYN B;  2P10 A;  5B6Q A;  1DW3 A;  2YKO A;  3H1L J;  2ZZS 1;  4LLH A;  1KYO I;  2FYU J;  3D6Z A;  2YO2 A;  3FXE A;  3PH2 B;  4FA5 A;  3PH0 A;  3RMZ A;  4Q5P A;  1JMB A;  1NAF A;  1QEX A;  1CRY A;  5CJ0 A;  1PPJ D;  2GA1 A;  3SXT A;  3ZDM A;  5E79 V;  3SJL A;  1NTZ E;  4C46 A;  1AOQ A;  3SWF A;  1J1E B;  2KLV A;  3A5T A;  1DIP A;  2LKM A;  3H1H D;  3RK2 B;  4ASV A;  3H25 A;  1G1I A;  3M9H A;  3W68 A;  1VQM P;  2WVR A;  1U75 B;  1SQQ D;  1T3U A;  3CXH W;  1IJD B;  1Y8A A;  1AOF A;  2V08 A;  2N18 B;  1L4A A;  3V5B A;  2OGU A;  1SQV K;  5AW7 B;  4WQA A;  3CWB D;  2QJP C;  3GF3 A;  1COT A;  1U74 B;  2K9J A;  1WT6 A;  1FZC B;  3TGU G;  1OW7 A;  1SQX E;  4GED B;  1BE3 D;  1SQX J;  3HTK B;  2BH4 X;  1S2E A;  2ZXE B;  2QVA A;  2E5T A;  1MZ9 A;  3I56 P;  1MV8 A;  1EB7 A;  5BU8 B;  1OW6 A;  1AVY A;  3JBT B;  1SQQ K;  3B71 A;  3VN0 A;  2HR3 A;  1GL2 D;  1VDF A;  3L73 E;  3CYT I;  2OTJ P;  4IL6 X;  1S4X A;  3ZOW A;  2IYP A;  1M1J B;  3L71 G;  1W2E A;  5KKZ C;  3L74 D;  3HE4 B;  1SQX D;  1BE3 J;  1C6O A;  3ITK A;  1IFP A;  2HV4 A;  3H1L D;  3VNW A;  4JF7 A;  4EOT A;  4UB6 H;  1EDI A;  1HRO A;  4I6M C;  5APU A;  2D2C B;  5CIH B;  1KX7 A;  1NIR A;  2ZJS E;  1GIW A;  3BAS A;  3HD7 C;  4AUW A;  1PGO A;  3IR9 A;  3M0A A;  1WEJ F;  3V4W A;  3N7N A;  1JY2 N;  5CCG C;  1J1D B;  1JDL A;  1L4A B;  1QL3 A;  2FXM A;  3M91 A;  5AVQ B;  1BDD A;  2A06 D;  2I8F A;  2K9J B;  1U7J A;  3KZI E;  5AW3 B;  3L74 E;  1KV9 A;  4AAN A;  1TU3 F;  4HH2 A;  1CRC A;  3RL0 C;  1HH0 A;  3VMX A;  1QGK B;  1M60 A;  2GUV A;  5DFS A;  2HYN A;  3ZOO A;  1ZP0 C;  4I1L A;  1YQ4 C;  3AE3 C;  1HJ4 A;  1HJ0 A;  3PXW A;  3CCJ P;  3AE2 C;  2NZ2 A;  2KXP B;  1KIL C;  1VF5 D;  5KJ7 D;  4GDO A;  4M3L A;  1VQ7 P;  1W2L A;  1QVG O;  1CYJ A;  2D2C D;  2QJK B;  1D7M A;  3WFD C;  3L72 E;  2N9J A;  5B5E V;  1VPC A;  3I5C A;  3HQ9 A;  1SQP G;  3HE4 A;  1IZN B;  2PRR A;  4DOJ A;  1I8P A;  1ZZH A;  2WSF J;  2C1V A;  4AQR D;  2QM8 A;  1ZN5 A;  3DP5 A;  5DJU B;  4H0J A;  1HGZ A;  1OFC X;  4QAO A;  4JBZ A;  3L75 J;  1URQ B;  1Q86 Q;  3TSI A;  2YKP A;  2VRS A;  1EC5 A;  1FOS E;  1CYI A;  1CRI A;  5AW0 B;  1YEA A;  2E75 C;  2C0W A;  3G3Z A;  3SWY A;  1AV1 A;  1U7M A;  4H13 C;  1RF0 C;  3MK7 C;  1CHI A;  2LIR A;  2OYI C;  3CCE P;  3AEF C;  1S72 P;  1C6R A;  3L75 G;  2WPS A;  3LW5 J;  2R5B A;  2YK3 A;  3OW2 O;  3HUS A;  1JTH B;  1LTG C;  2ZFC A; 
#chains in the Genus database with same CATH homology
 1GKS A;  1NTZ D;  2RMZ A;  1W5C T;  3A9F A;  2VHD A;  1J3S A;  3WUI A;  2RN0 A;  1CIF A;  4PJ0 V;  2N18 C;  3CP5 A;  2FWL A;  1CIE A;  1N9C A;  4KMG A;  1DIQ C;  4EIF A;  1FJ0 A;  2QJP B;  3NBT A;  4PW9 B;  4FA9 A;  5KLI B;  1M70 A;  2GIW A;  4MU8 A;  1I5T A;  2Y0D A;  1LMS A;  1SQV D;  1N90 A;  3PLN A;  5CID B;  2B4Z A;  5DJQ B;  1LFM A;  4WQ7 A;  1CRH A;  4JCG A;  4WQC A;  2BGV X;  4J20 A;  1I6D A;  1H33 A;  3C2C A;  1H1O A;  5IY5 1;  1HRC A;  1R0Q A;  1C52 A;  1DII C;  2L91 A;  4UB6 V;  4WQB A;  1C7M A;  1CTY A;  1SQP D;  1IZL 0;  2OZ1 B;  1CNO A;  1MG3 D;  3KZI V;  1KIB A;  1YNR A;  1PP9 D;  3O20 A;  3O1Y A;  1I6E A;  2ZOO A;  1A8C A;  3CU4 A;  1YIQ A;  5KKZ B;  3O5C A;  5CIC B;  2MTA C;  1HH7 A;  2CE1 A;  1CHJ A;  5C0Z A;  5TJH A;  2ORL A;  1DVH A;  1CXA A;  1H9X A;  1MZ4 A;  1GDV A;  4XXL A;  3ZIY A;  5AUR A;  1P84 D;  3DR0 A;  4WQ8 A;  3NBS A;  3SVW A;  1FHB A;  1COR A;  1BGY D;  2C1U A;  3NWV A;  3OA8 A;  4NFG B;  3H1I D;  2FRC A;  4WQE A;  1DW0 A;  1CHH A;  3HQ8 A;  3X39 A;  4L3G A;  1RAQ A;  1I55 A;  1OAE A;  3RLM A;  1WVE C;  2D0S A;  2GC4 D;  4V2K A;  4P4Q B;  3GG2 A;  4L1Q A;  1H32 A;  2Q3E A;  2ZON G;  1HZV A;  2O3J A;  1C2R A;  2PCB B;  1HCM A;  3ZOX A;  1FI3 A;  1H31 A;  1EZV D;  3CX5 D;  2JQR A;  1CXC A;  1N50 A;  1L0N D;  1VYD A;  3PXS A;  1KYO W;  2BCC D;  4LJI A;  4U3F D;  1DW2 A;  1E8E A;  1QL4 A;  5KLV D;  2CE0 A;  2B10 B;  4PWA A;  2GC7 D;  1LC2 A;  2C2C A;  5CYT R;  4AAO A;  3L75 D;  1BCC D;  4IL6 V;  1YIC A;  2LIT A;  4O1W A;  1RZ5 A;  4EIE A;  1CSX A;  3WFB C;  2YCC A;  3L4O A;  1S6V B;  3CX5 W;  2D0W A;  5DF5 A;  3H1J D;  3PHL A;  3L73 D;  1E29 A;  3WFE C;  3TDK A;  1A56 A;  1CIG A;  1H32 B;  3BCC D;  3ORV A;  1YCC A;  1HZU A;  2PCC B;  3RN1 A;  5TIS V;  1A2S A;  1CSU A;  2IBZ D;  1IO3 A;  3TYI A;  3KHU A;  2V07 A;  1CSV A;  2MHM A;  1H33 B;  4AAM A;  2FYN B;  5B6Q A;  1C2N A;  1DW3 A;  1KX2 A;  1AYG A;  5CIB B;  2ZZS 1;  1I8O A;  2JTI B;  2N9I A;  3ZOY A;  4RSZ A;  2OZ1 A;  3PH2 B;  1CRJ A;  4FA5 A;  351C A;  3RMZ A;  3TF5 A;  1S5L V;  155C A;  1RZ6 A;  4EID A;  4Q5P A;  2ZBO A;  2N3B A;  2C9X B;  3OCD A;  3ZBM A;  2KNC B;  1CRY A;  1I54 A;  1PPJ D;  3SXT A;  1KYO D;  5E79 V;  3SJL A;  4K3I A;  4WQD A;  1AOQ A;  1KB0 A;  2B0Z B;  1L0L D;  1NML A;  3MK7 B;  4WQ9 A;  1CCH A;  4AX3 A;  4EIC A;  1CIH A;  1DVV A;  4D6T D;  3OA8 B;  3H1H D;  3DMI A;  1C75 A;  2GB8 B;  1CED A;  3HQ6 A;  1QKS A;  3L71 D;  1CYC A;  1U75 B;  1SQQ D;  3GW6 A;  1IRV A;  3CXH W;  1AOF A;  2V08 A;  3M97 X;  1CCR A;  2N18 B;  2PAC A;  1GQ1 A;  3WC8 A;  1ZRT D;  4WQA A;  3CWB D;  4EDF A;  1COT A;  1U74 B;  2C1D B;  4GYD A;  1ETP A;  2BPB B;  2CA3 B;  1NTM D;  2YQB A;  1L9J C;  4GED B;  1BE3 D;  4Y5R A;  2AXT V;  2BH4 X;  5DJQ C;  1NU1 D;  1CC5 A;  2ZXY A;  2BH5 X;  1EB7 A;  1LS9 A;  1AKK A;  3JBT B;  3PTZ A;  2XTS B;  2L4D A;  4PD4 D;  4O1Q A;  3O0R C;  4A7P A;  1CTZ A;  2FYU D;  5KAI V;  5CIE B;  2BLF B;  3CYT I;  4N0K A;  3SLE A;  3ZOW A;  3PXT A;  1N15 A;  5B66 V;  1K3H A;  1YFC A;  2AI5 A;  3L74 D;  1FI9 A;  1SQX D;  1C6O A;  3ITK A;  1LC1 A;  1HJ5 A;  2N9Y B;  2HV4 A;  3H1L D;  1F1F A;  2CXB A;  3VNW A;  3RN0 A;  2EXV A;  2QJY B;  1CSW A;  2DGE A;  3L72 D;  4FAV A;  3TGU D;  1HRO A;  3VYM A;  3VMA A;  3SWS A;  2Y0E A;  5CIH B;  3L70 D;  3ZCF A;  1NIR A;  1KX7 A;  1GIW A;  3OCD B;  1M6Z A;  1C6S A;  1WEJ F;  2B11 B;  1NTK D;  4L3H A;  1JDL A;  4UB8 V;  1QL3 A;  4FA4 A;  1YTC A;  2KS1 A;  3A0H V;  2A06 D;  2YIU B;  2I8F A;  2K9J B;  2C1D A;  4AAL A;  1KV9 A;  4AAN A;  1CRC A;  1E2R A;  1IQC A;  1M60 A;  1IRW A;  1CRG A;  3WU2 V;  1KB9 D;  5EXQ A;  2AIU A;  1DT1 A;  5DFS A;  1NNO A;  5GTI V;  3ZOO A;  2N3Y A;  5GTH V;  1L9B C;  3A0B V;  1HJ4 A;  1MG2 D;  1CO6 A;  3PXW A;  4YE1 A;  4FB1 A;  2DVH A;  5KAF V;  4RJT A;  4H0K A;  5C9M A;  1QYZ A;  2Y0C A;  3CXH D;  2JWA A;  1DW1 A;  1W2L A;  1FCD C;  1CYJ A;  2CA4 B;  2QJK B;  1GU2 A;  1QN2 A;  3WFD C;  2N9J A;  5B5E V;  1H31 B;  2B12 B;  1F1C A;  3FWL A;  3HQ9 A;  1NMI A;  2BCN B;  1I8P A;  1ZZH A;  2C1V A;  1OCD A;  451C A;  4FAN A;  3VRD A;  3DP5 A;  1BL9 A;  4H0J A;  2QG4 A;  4QAO A;  3HQ7 A;  3L4M A;  5CIG B;  1FI7 A;  1SQB D;  5CIF B;  4XYD B;  3WFC C;  1FOC A;  1CYI A;  4DY9 A;  1CRI A;  1YEA A;  1RAP A;  4FA1 A;  1K3G A;  1B7V A;  1GJQ A;  5H2F V;  3H1K D;  3MK7 C;  2C8S A;  1CHI A;  2LIR A;  1YEB A;  1H9Y A;  1C6R A;  1CTJ A;  2YK3 A;  3PRJ A;  1HJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...