1PP9D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1pp9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1pp9D01
1NTZD 2PCBB 4EIDA 1P84D 1CRHA 1ETPA 1FHBA 1I54A 1SQPD 4L3GA 1LS9A 2Y0EA 3WFBC 4WQ9A 2JQRA 3A0HV 1CYJA 3O20A 4XYDB 2ZOOA 1FI3A 3OA8B 3DR0A 5B6QA 1H33A 1N50A 4Y5RA 5B5EV 4MU8A 3PHLA 1HJ3A 2VHDA 4LJIA 2L91A 3H1JD 1CHIA 5CIDB 1FOCA 4U3FD 2CE0A 4XXLA 3CU4A 1SQBD 3WU2V 3ZBMA 451CA 5KLIB 3TDKA 2ORLA 1CIFA 1FI9A 1IZL0 5KAFV 3MK7B 1KB9D 1CORA 1RAQA 3CYTI 2PACA 1WVEC 1M6ZA 1EZVD 4NFGB 1QYZA 1N90A 2FRCA 2N9YB 1CSUA 3L72D 5AURA 3M97X 3DMIA 1A56A 5KLVD 1RZ5A 1QL4A 3A9FA 1GJQA 1L0ND 3WFDC 1W5CT 1C52A 1KB0A 1I6EA 2B4ZA 1CNOA 5C9MA 1C6SA 3ZOXA 1A2SA 3DP5A 4UB8V 1H9XA 2BPBB 1H32A 3HQ8A 2DGEA 3H1ID 2XTSB 1L9JC 2D0SA 3KHUA 2Y0DA 1KYOD 1LFMA 4EIFA 3L74D 5DJQC 1KX7A 5C0ZA 1F1FA 4AANA 1CHJA 1CYIA 4UB6V 5GTHV 3L70D 3OCDB 3ZOOA 1F1CA 2YK3A 4DY9A 4FA1A 1CXAA 5DF5A 2BH4X 3O1YA 3ZOYA 3VRDA 2GB8B 1NTMD 1DIIC 2AIUA 4FANA 2CXBA 3WUIA 1NNOA 2YIUB 4QAOA 4PWAA 1SQQD 1RZ6A 1YNRA 2FYUD 3FWLA 2RN0A 1LMSA 1AOQA 5B66V 1CO6A 5CIHB 1CRYA 2BCCD 1FJ0A 1HZUA 5CYTR 5KAIV 3L4MA 3HQ9A 1HROA 2GC4D 1LC1A 1CIEA 1IRVA 2C1DA 4GYDA 5TISV 1VYDA 3GW6A 3MK7C 3L73D 1C7MA 1HJ4A 1IRWA 4N0KA 5CIBB 1CC5A 1CSVA 1E29A 3L4OA 1CCHA 2YCCA 1HJ5A 2OZ1A 3A0BV 1K3HA 4V2KA 4WQBA 2YQBA 1H1OA 5CIEB 1H31B 3L75D 3VNWA 1PPJD 1EB7A 1W2LA 3L71D 3ZOWA 1QL3A 2MHMA 2V07A 1COTA 1A8CA 1PP9D 2C8SA 3H1KD 2GIWA 1WEJF 3C2CA 2B0ZB 1KX2A 2QJYB 4O1WA 4L1QA 3JBTB 3SXTA 3RLMA 4EICA 4KMGA 3WFCC 3X39A 2N9IA 4IL6V 1SQXD 1MG3D 2BCNB 1NMIA 1GKSA 2QJPB 3TGUD 1CEDA 3PH2B 1YEBA 2Y0CA 351CA 5DFSA 1YFCA 4WQCA 1BE3D 3CP5A 3NBTA 1MZ4A 1KV9A 3CWBD 2C1VA 5KKZB 2QG4A 4YE1A 1HH7A 5CICB 1H9YA 1H33B 3OA8A 4EDFA 2B10B 1K3GA 3CXHD 1C6OA 1IQCA 3O5CA 1CIGA 1CIHA 1DW2A 4WQAA 3HQ6A 2IBZD 1S5LV 1YIQA 1CTZA 1BGYD 2PCCB 2B12B 4AAOA 1M60A 1R0QA 4RSZA 1YTCA 5IY51 4AAMA 3CX5D 1KYOW 2Q3EA 4FA5A 1QKSA 4WQ8A 2JTIB 2MTAC 2QJKB 3H1LD 3NBSA 4H0KA 2O3JA 4FB1A 1RAPA 3BCCD 4P4QB 1FI7A 2ZXYA 3ZIYA 1M70A 4J20A 3SWSA 1HRCA 4EIEA 1C75A 3SVWA 4WQDA 1E8EA 1GU2A 4FA4A 1C2NA 4GEDB 3WC8A 3RN0A 2AXTV 2N3BA 1KIBA 1AKKA 1CYCA 4K3IA 1NU1D 3GG2A 1E2RA 3PXWA 1H32B 1DVVA 3ZCFA 2ZONG 3PXSA 1HCMA 1CRCA 1I8PA 1BL9A 2N18B 3SLEA 3RMZA 1DVHA 2BH5X 5CIFB 2JWAA 1AOFA 1NIRA 2AI5A 2C1UA 4D6TD 3OCDA 2CE1A 2K9JB 2HV4A 1I8OA 4PW9B 3KZIV 1OCDA 4L3HA 1N15A 5E79V 1CSWA 2GC7D 3ITKA 5H2FV 2C9XB 1YICA 2CA4B 2V08A 1GDVA 3TF5A 1SQVD 1CHHA 3HQ7A 1NMLA 1YCCA 2FWLA 1GIWA 1DT1A 1B7VA 2D0WA 1CCRA 1CRGA 3NWVA 3PTZA 2KNCB 1I6DA 1DW1A 4O1QA 2FYNB 3PRJA 1CTYA 1L9BC 1CTJA 2L4DA 1IO3A 2C1DB 1FCDC 4PD4D 1ZZHA 1QN2A 3SJLA 4AALA 1DW3A 155CA 3VYMA 4Q5PA 2LIRA 2N3YA 3H1HD 1U74B 1N9CA 2BGVX 2C2CA 5CIGB 1HZVA 5TJHA 4JCGA 4FAVA 1I55A 2OZ1B 3VMAA 1BCCD 1NTKD 2ZBOA 3ORVA 1J3SA 2BLFB 3O0RC 5GTIV 4A7PA 1H31A 1DW0A 1S6VB 1U75B 2N9JA 3RN1A 2EXVA 4FA9A 2RMZA 1CSXA 1OAEA 3TYIA 1C6RA 1CRJA 4AX3A 1LC2A 5EXQA 3CXHW 2N18C 2LITA 4WQEA 3PXTA 1MG2D 5DJQB 2KS1A 2CA3B 1CXCA 3WFEC 1C2RA 2DVHA 1GQ1A 4H0JA 1JDLA 1AYGA 1I5TA 4WQ7A 1YEAA 2A06D 2ZZS1 2I8FA 3PLNA 1DIQC 1ZRTD 1CRIA 2B11B 3CX5W 4RJTA 1L0LD 4PJ0V
chains in the Genus database with same CATH superfamily
1NTZD 3HUSC 1N8RQ 1NTZE 2KI7B 1URQA 4OVNF 1FHBA 1I54A 1LGHB 2Y0EA 3TYYA 4WQ9A 2KYVA 2JQRA 3AEGC 2W6JH 1HUCA 2J59M 3VOPA 3VP9A 3DR0A 1CZQA 5AVSB 1N50A 3OJAB 2FYUK 2P1JA 5BVZA 4MU8A 1GMJA 4IL6E 4LJIA 5B66H 3H1JD 2QJPC 4K3AA 1IFJA 1T3UA 2CE0A 3CU4A 1SQBD 1RHZB 3WU2V 2N1TD 5KLIB 4L76A 3TDKA 3GMAA 2YXRB 1SQBE 3L37A 3PP5A 3CYTI 2PACA 1WVEC 5GTHE 4NFGB 2WSEJ 1Y9BA 2V4HA 3BCCG 3L72D 3M97X 1JY3O 1OXZA 1FZCC 2KS1B 2HG5D 3L72E 4C46A 1MUUA 5KLVD 1RZ5A 1FDIA 1NAFA 4GODA 1L0ND 3GLMA 3RK2B 5KLVE 3GHGC 1L0NE 3KPEA 1VPCA 3CD6P 2E76C 3RBZA 2BPBB 1IC2A 2V7QH 3HQ8A 2DGEA 3H1ID 2XTSB 1SQXE 1L9JC 1HGVA 3KZIH 2Y0DA 3L74D 1FOSF 1M1JA 2XV5A 1F1FA 4AANA 3L74E 1FZBA 1CHJA 4AYCA 4IFFA 1CYIA 4Y99C 3ZOOA 2M3EA 1JCCA 4FA1A 2OYHC 1CXAA 1S4XA 2UWJE 1LTAC 3IF4A 3IR9A 2WSFH 1DIIC 1PP9G 1PZQA 4FANA 2IBZI 1NNOA 2YIUB 1BCCJ 4TLFA 1ZW0A 1SQVG 1J1DB 3Q5RA 1FAVA 2IFNA 1N7SC 3JC22 3VN0A 2E42A 2BCCD 3V2NA 1H89A 1NTMK 1Y47A 1SQQJ 1OZHA 5CCGD 1GU5A 1LTJA 4GYDA 2E43A 5TISV 3D6YA 3MK7C 3H25A 3SWKA 1IRWA 4BXLA 2KP8A 5GTIH 1FZGA 2Y9ZA 1IZNB 3L4OA 1CCHA 1N7SD 2FYNC 4H44C 1S9KD 1T2KC 3GF7A 1K3HA 1EDLA 4V2KA 4IFDK 1S9KE 2AXTH 2IYOA 2YQBA 2OTJP 1H31B 1AA0A 1EQ7A 1M57D 2XNDH 3AE7C 3L71D 3ZOWA 5CJ4A 1K73Q 2MHMA 3L71E 3AE5C 1J1EB 1G1JA 1XTCC 1ZMEC 2IYPA 2B0ZB 1KX2A 4L1QA 3JBTB 3D70A 2NPSC 2N9IA 4IL6V 1L0LG 4H44D 1D7MA 1T2KD 1YHQP 2BCNB 1GKSA 3L72J 3PH2B 2Y0CA 351CA 1URQB 1YFCA 3H1KJ 2FXOA 5KLVJ 1J2JB 3L35A 1MZ4A 2CK3H 3CWBD 3CPWO 2PGDA 2C1VA 3WU2H 5C39A 4YE1A 3CWBE 3M0DA 3M0AA 2WMMA 1SQXJ 3AEEC 3G3ZA 1C6OA 1QL1A 3VMYA 3QH9A 2Z5IA 4PJ0E 2QA4P 3HQ6A 2IBZD 2ZYDA 2NPSD 2YKPA 1CTZA 2B12B 1PGJA 4U3FG 2IBZE 1YTCA 5IY51 1JNMA 2QJKB 3A0HE 3KDPB 3ABVC 2KXPB 1YJWP 2Q7CA 3NMDA 2YO3A 4FB1A 1QGKB 5B5EE 1IFPA 1G1IA 1M90Q 2WSEH 2H89C 1YTZI 1C75A 2H7HA 3L36A 3SVWA 2E75B 2W6AA 4WQDA 5BU5A 3N7NA 1QVGO 2AEJA 4GEDB 3VTPC 3WC8A 2N3BA 1RQUA 4DT0A 1AKKA 2A06E 1OW7A 1EXJA 3G6EP 3NXSA 1KB9H 2HFED 1RE4C 1GU4A 5AVRB 3HD7C 1P84E 2N18B 1RF1A 1M1JB 2FKWB 1DVHA 2BH5X 2WVRA 1NIRA 1ZV8A 3VMZA 1YTZT 4H13C 1YITP 3OCDA 4NPEA 2YKQA 3OA7A 5L8RJ 1ZR4A 2YMKA 2ZXEB 5KJ7A 5E79V 4OGQC 1EDJA 2CA4B 3B5NB 2JEEA 2Q6QA 5KKZC 1RF0C 3HD7D 1KFMA 3O8ZA 4JYCA 5TISH 1PIXA 2FYUG 1EDKA 1GIWA 3RL0C 3NWVA 3L71J 1FU1A 4KT0J 4N6JA 2W90A 4H13D 1EZVI 1DW1A 4O1QA 1BDDA 2Q1KA 2IDBA 2JO1A 1DD4A 3FWNA 2L4DA 1LTJB 1NAYA 4OGQD 1SQVK 2WWWA 2K88A 3LW5J 155CA 1YIJP 1DX7A 3C8VA 3LIDA 3H1HD 1AVOA 1IK7A 2P67A 5CIGB 3KQGA 3CCRP 1SFCD 3CWBJ 1RE3A 1I55A 1KYOI 1YJNP 1NTKD 4DOJA 4GDOA 3F5HA 1VF5B 1NTKE 2WPQA 3L75G 1DW0A 1U75B 2WPRA 3U1CA 1M7LA 4XA4A 2N1TA 4W80A 4IL6H 1OAEA 4ASVA 5CCHA 1LWUC 5EXQA 3CXHW 3PXTA 5DJQB 2KS1A 2CA3B 1C2RA 3RL0g 2XNXA 1DIQC 2KLVA 1WMKA 3CX5W 2PFXA 5AW7B 5GTHH 4PJ0V 2B88A 1S2EA 2W27A 4N78D 4EIDA 1NO4A 2A45I 1Q82Q 4N78E 1ZXGA 1ETPA 1BE3G 2D2CB 3CCVP 3WFBC 3A0HV 2QJYC 4H0LB 3D6ZA 1CYJA 4XYDB 2KOGA 4WBAA 1FI3A 2W83C 1WT6A 2GUSA 5B5EV 2HR3A 1HJ3A 2L91A 3MUDA 1FOCA 1GTWA 1JEKA 3M9QA 3V5BA 4XXLA 1EDIA 1NTMG 4WY4C 1NHLA 2I8DA 2R3CA 3S9OA 1SQPK 3V4QA 1VL2A 3AE3C 5APTA 3H1LG 1KB9D 5BU8B 1GL2D 2YKOA 1EZVD 1QYZA 2WSSH 2E5TA 1CSUA 5AURA 1FOSE 4YTPC 2M0BA 1R8EA 1L4AC 3DMIA 4IOIH 3BVHA 2ZXXA 1JY2P 3CLQA 3A9FA 1GJQA 3WUTA 3WFDC 3TSIA 1FE6A 3SFDC 2XU6A 1NU1G 3UIAA 1JY2O 1H9XA 4HKZH 3RK3B 5CCGA 2D0SA 3KHUA 1KYOD 1RF1B 1LFMA 1CI6A 1KX7A 5C0ZA 1K9MQ 4TT3H 1KYOE 1K8AQ 1L4AD 2FBWC 2PRRA 3OCDB 3MHVA 2K9JA 4WVZA 3AECC 2YK3A 1LTGC 3B71A 1L2PA 1JB0J 2ZYGA 2OYIB 1VQ7P 3PJSK 2FYZA 3E1RA 3RGUA 3IAOA 3CCEP 1NTKJ 4HB1A 1SQQD 1Y8AA 3U1AA 1RZ6A 1YNRA 2GA1A 5AW1B 5APQA 1A02J 1Q7YQ 3BRVB 1CO6A 4ASWA 1N86A 3BCCE 1CRYA 3A5TA 1FJ0A 1IJDB 3TK1A 1HZUA 2QIWA 3BATA 5CYTR 5CBNA 1A02F 5KAIV 4YXWH 4ZMDA 5H2FE 5APXA 5KLIC 1HROA 1CIEA 1KZUB 1IRVA 5M1BA 1S5LX 3L73D 1U7JA 3L73E 1CSVA 1NKZB 3LW5H 1E29A 2YCCA 2BEZF 4RO0A 1GW4A 2HODB 3RK2C 2OTKE 1FDMA 1Q81Q 1JY3P 1X9VA 1EB7A 2N1TB 4PJ0H 3SWFA 2V07A 1PP9D 1W2BO 1OVUA 2C8SA 2WQYC 4HYTB 5EFWB 3H1KD 2GIWA 1WEJF 1PP9E 4PV1B 3H1KE 3A0HH 1VDFA 1HTLC 5APWA 4EYYQ 3RBXA 1SQXD 1NTZG 3RK2D 5B5EH 1MG3D 1NMIA 2QJPB 1YEBA 3P8CD 4W7YA 4WQCA 3P8CE 1H0TA 2YIUC 3OAKA 3AEFC 1OMIA 1J1DC 1H9YA 2O01N 2B10B 4L75A 3Q1MA 1U57A 1K3GA 4D6TG 2KB7P 3WMM0 1DW2A 4WQAA 4PD4I 3H1JG 1YIQA 1P84H 1BGYD 1M60A 4LGDE 2E76D 1SQBG 1BGYE 1SP4A 3B5NA 2K3RA 4WQ8A 1N73A 3NBSA 3FXEA 1NGMB 1YQ4C 1KD1Q 1RAPA 1FI7A 2ZXYA 3AEAC 4J20A 3SWSA 2POHA 2AEFA 4EIEA 5AVTB 3B8EB 5KLVG 5E79E 2ZT9B 1E8EA 4FA4A 2KK7A 1L0NG 1OVRA 3II6A 3JCUE 3MZWB 1KILA 1Q2NA 3KYQA 4K3IA 2JWDA 5KAFE 3PXWA 3BCCJ 1DVVA 1X22A 3H1IG 1L0LE 3ZCFA 3PXSA 1BL9A 1CI6B 3L74G 3FXDA 1J1EC 3RMZA 1P84I 1QVFO 3L73J 3ZDMA 3V2RA 2C1UA 2FXMA 1KFNA 2K9JB 1DEEG 2RH0A 1NU1K 1HWTC 1SFCA 4Z1MH 1PL5A 1OCDA 3QWOC 4L3HA 1URQC 4DCKA 5H2FV 4U7JA 2J5UA 4U3FE 5CHXA 4YXDC 4I7ZB 3TF5A 5AVWB 3N4XA 2ZVNB 1YCCA 4UB6E 3P7KA 1CRGA 2Q5UA 3PTZA 1USEA 1PP9J 2FY8A 2BCCG 4JPZB 2IX7C 5APYA 3C9IA 2MKVA 2FYNB 1SQPG 1L9BC 1GK4A 1IO3A 1NYHA 1SQVJ 3W68A 1URQD 1PGQA 2QJKC 1IFNA 1GDTA 1AV1A 4PD4D 2G3AA 3VP8A 3OW2O 1OX3A 3G71P 1DW3A 4PD4E 1NVOA 3WUVA 1U74B 1N9CA 2BGVX 2NRGA 1HJ0A 2E75C 5TJHA 3AE6C 4FAVA 1MFZA 3VMAA 2WSCJ 2ZBOA 4WWIA 1J3SA 2BLFB 4R4LA 3I5CA 4W7ZA 4A7PA 3TNUA 3RN1A 2ZYAA 2RMZA 1BGYJ 1ZR2A 4AX3A 4K35A 2N18C 2LITA 3CL3D 3W67A 1M1JC 1GL2A 2ZFCA 2DVHA 4H0JA 2A06D 2ZZS1 2I8FA 1PFIA 1LT9A 2B11B 1AVYA 4RJTA 2E75D 3NFQA 3G4SP 1IO4A 1JUNA 5DJUB 2FYUE 2AEMA 1P84D 1JO5A 1NJIQ 3MTUE 2IPPA 4L3GA 4BWNA 1H0TB 5APVA 3AEBC 4WB4A 2P10A 1S3JA 2CPSA 4KJMA 4ZKUA 1SVFA 3Q5SA 1L0LJ 3HE4A 3L70G 3V2PA 3R2PA 1JMBA 2GUVA 3PHLA 4I1LA 5AW6B 1NTZK 2M3BA 2R5DA 3SWYA 1KYOH 2OYIA 3M9BA 4OWFA 451CA 2ORLA 1LTJC 1UIIA 1FI9A 1N73B 5KAFV 1RAQA 1KORA 4YPCA 3V4WA 3L75E 2OTLP 2FRCA 5AW9B 1LP1A 4GOEA 4U3FJ 2FXPA 3H32A 1S5LE 1OWAA 2P2UA 3BASA 1QL4A 1SQBK 1PGPA 2K37A 1R5LA 1KB0A 3MD0A 1KILB 2IZ1A 1CNOA 1VF5C 3ZOXA 2QM7A 3DP5A 1CW5A 1H32A 2A45H 5AVUB 2E74C 1AJYA 4EIFA 5DJQC 4N3YB 1VQNP 3RL0D 5H2FH 5KLVK 2HODA 5KAIE 1L0NK 4UB6V 5CJ0A 2K1AA 3F89A 2QVAA 3HUSA 1F1CA 1SFCB 1PPJG 2BH4X 2QE7H 3ZOYA 3CXHI 1NTMD 2AIUA 3CCSP 2CXBA 2E74D 4QAOA 2YMYA 1NTME 2KZJA 1KC8Q 4PWAA 4H0LC 2KIKA 2C0WA 3M0DC 3CX5I 2FFDB 1JCDA 1LMSA 1AOQA 5B66V 2P7JA 3V2QA 4DZOA 1GD2E 3VMXA 5CIHB 2XDJA 1KN7A 3TGUG 3CCQP 3B4SA 3Q2YA 3VYIA 2PAJA 3H6PA 1DIPA 2GC4D 2N9BA 2FYUJ 4L73A 2XKMA 1VYDA 1VQ6P 1C7MA 2R44A 5CIBB 5AVXB 3SSUA 4GT1A 1NU1E 3CI9A 3AE4C 1X8YA 3H1HG 1SLQA 1FZCA 1DD3A 1FJPA 3KXDA 2KSEA 2OZ1A 1MKMA 1LTBC 2HPCA 1NTKG 3GHGA 3O6QA 3EQ2A 1DH3A 3A2AA 5CIEB 1H1OA 2WSCH 3CCLP 1ZLLA 3TNUB 3VNWA 1AQ5A 3T97A 1X0TA 3RK3C 1QL3A 1QEXA 1RF1C 2R32A 4EIJA 3USSA 1GL2B 3C2CA 2QJYB 5AVVB 1LT9B 1KTMA 4C7RA 3L75J 1LTSC 1VQLP 2YNYA 3WFCC 4WY4D 3X39A 3K5BA 3P8MC 3M06A 1KQLA 5KJ7C 1YQ3C 3AE2C 2OYHA 2KZIA 5DFSA 1KQGB 3CP5A 1OVVA 1SS1A 5E79H 1KV9A 1JY2N 3JCUH 1HH7A 3RK3E 1VQOP 5CICB 1AFOA 3OA8A 4EDFA 2Z4EA 3HE4B 1N7LA 5KAFH 3D71A 2QEXP 3CXHD 3O5CA 1IQCA 1N7SA 1CIGA 3LIEA 1S5LV 1BE3J 1L4AB 3CXHE 3HE5A 2PCCB 3L4FA 4AAOA 3A7OA 1T3JA 4C7NA 4AAMA 2YXQB 3CX5D 1JM0A 4FA5A 3CX5E 2JTIB 2MTAC 4RESB 2HLOA 4H0KA 1EZVG 2QRXA 2O3JA 3BCCD 2P58A 4P4QB 1LP1B 2M5AA 3IFMA 3H32B 3ZIYA 1NTMJ 1M70A 1HRCA 3E7KA 1RE3C 1C2NA 4BRYA 3RN0A 2AXTV 1HGZA 3H1LJ 2XZRA 4UB6H 1H32B 2N1TC 3NTNA 5CCHC 2ZONG 1OIPA 1CRCA 3SLEA 2G8YA 1OW8A 2JKVA 2WZ7A 4PV1C 1HVVA 1AOFA 1QX8A 4QMAA 1BCCG 1NU1J 1S1CX 2BEQD 2NPSA 2AI5A 4I6MC 4OH8B 4D6TD 3HUSB 2HV4A 4PD4H 1I8OA 1NWQA 4PW9B 4D6TE 4UB8E 4AUWA 2L5GB 1N15A 1GK6A 2O1KA 3H1JE 3ITKA 1YICA 2V08A 4IFMA 5CCHD 1SQQG 2Y9YA 1SQVD 1YJ9P 1FZFA 1JY3N 2A45G 1SQVE 1DT1A 4ZNCA 1B7VA 4PV1D 1CCRA 2PP6A 1JOCA 3MUDC 1I6DA 2LKMA 1T8ZA 1CTYA 1IFMA 1CTJA 2E5YA 3V6IA 3CMEP 1G2CA 1FCDC 5CMZA 1Z56A 2JR8A 4RKUJ 3L73G 4GOFA 2H8PD 1ZZHA 1QN2A 3SJLA 1LNQA 1K04A 2QSIA 3JSVC 3VYMA 3MGNA 2LIRA 3H1IE 1FZCB 3U59A 3AEDC 3AE1C 2C2CA 2O01J 1OW6A 2ZT9C 2OZ1B 1U7MA 2HPCB 3GHGB 1EXIA 3O6QB 1RY3A 1VQ9P 3O0RC 1ZOYC 2E76B 2R5BA 3T97B 2EXVA 4FA9A 1RE4A 5CCGC 1CSXA 3MP7B 3TYIA 4EI2A 3L72G 2LR2A 5AVQB 3HD7A 4WQEA 1LJ2A 1WRGA 3I56P 3WFEC 3H1KG 1AYGA 1JDLA 3E1IA 1I5TA 1YEAA 1KQSO 1CRIA 1VQPP 1NTKK 3A0BE 2ZT9D 4Y99B 5DJTB 2QM8A 1L0LD 4RSZA 2PCBB 1SQXG 4ZKPA 2JJLA 2OYHB 5CBOA 1CRHA 2B87A 1S5LH 1MV8A 2RKLA 1SQPD 1LS9A 2BCCE 2DW3A 1JTHA 4I7ZC 4GIFA 1SQPE 1RF0A 2IFMA 3O20A 2ZOOA 4NPFX 3OA8B 5B6QA 1H33A 1QLED 4I2LC 2J58A 1NTZJ 4Y5RA 1IFIA 1N7SB 3HTKA 1NKNA 2VHDA 4EOTA 1VQKP 1CHIA 5CIDB 3HE5B 3EWKA 4JYBA 1BGYG 3A3YB 4U3FD 4C7NB 3ZBMA 3EFGA 5K5GB 5KAIH 2Q9IA 1CIFA 4XE5B 4LLHA 1IZL0 3MK7B 1FJKA 2R3SA 3CMAP 3BRTB 4D6TJ 1CORA 4LC1A 1RH5B 4AQRD 4L74A 2FFDA 1M6ZA 3H1JJ 1N90A 3SFEC 2N9YB 2M5AB 1LT1A 1A56A 1SQBJ 1GW3A 1S72P 1W2EA 2B89A 1HBWA 1ZN5A 1LTIC 4BRYB 2ITAA 4H44B 1W5CT 1C52A 1I6EA 2B4ZA 1R5SA 5C9MA 2GM4A 1C6SA 1A2SA 4UB8V 1N2DC 5B66E 1LWUA 2W8ZA 2IZ0A 2O1JA 3AE8C 1VQ5P 1L0NJ 1XTGB 5KTBA 3EFFK 4JQ0D 5GTHV 2AXCA 2NPSB 3L70D 1IFDA 1CSBA 3H1IJ 3G9RA 3L70E 4DY9A 1FZEA 2JDIH 5DF5A 2WPSA 3L71G 5APSA 3L74J 4JF7A 3O1YA 3M9HA 3VRDA 2GB8B 2NZ2A 1LTTC 2K9YA 1BDCA 3WUIA 2OQQA 1Q90D 4IL6X 4GKGA 2I1KA 3C1LA 3HRNA 2FYUD 3FWLA 2RN0A 3MIWA 4HH2A 4DJGA 2LXCB 1USDA 3CC4P 2KNCA 1JMMA 3KZIE 1T6AA 1H8AA 4WY4A 3L4MA 3HQ9A 1NOHA 3B5NC 3P32A 1LC1A 1G2CB 3CWBG 4JBZA 2C1DA 1FZAA 1SQQK 1N73C 1YYCA 3D0WA 3GW6A 4N0KA 1CC5A 1W5CE 5AW4B 4NPDA 3CCMP 2BASA 2BCCJ 1HJBA 2IBZG 2M8RA 2WITA 1L4AA 4O9BA 2ZVOB 1SQPJ 3CCUP 1HJ5A 3A0BV 2O01H 5AW0B 1KILC 4WQBA 3IN6A 3L75D 1AQTA 1PPJD 3B5ND 4R4MA 3FGAD 1W2LA 5AVYB 3GF3A 3CXHH 1PPJE 2B9BA 1NH4A 3HD7B 1COTA 1A8CA 2MJZA 2WT7A 3PH0A 2Q3IA 4O1WA 2H88C 2A06G 4B86A 2JP3A 3SXTA 3CX5H 3RLMA 4EICA 1K05A 4H13B 4KMGA 4Y28J 3CC2P 5GTIE 1SFCC 1KB9I 3TGUD 1CEDA 1KILD 3CCJP 1VQ8P 2B87B 4OGQB 1M1KQ 1BE3D 3TGUE 1KILE 2WPVB 3NBTA 1JTHB 1BE3E 5AW3B 5KKZB 2KSJA 2QG4A 1H33B 3WUUA 2AXTE 2FFDC 1BSHA 1GZLA 2ZJSE 3RL0B 3HTKB 1E5WA 3CC7P 1CIHA 1DEBA 1X79B 1SQXK 2OGUA 1VF5D 1M8OB 1R0QA 3H1HE 2D2CC 1KYOW 1YBKA 1TU3F 2Q3EA 1RQVA 1QKSA 2SPZA 3L70J 3H1LD 1KQFB 2H43A 1MZ9A 3H1LE 2E74B 2Z5HA 4UB8H 1KMIZ 1FC2C 1YI2P 1FDOA 1GU2A 1KV4A 5AVZB 1BSNA 3WU2E 1KIBA 3I55P 1QL2A 1CYCA 2V7QJ 1NU1D 3GG2A 3Q5PA 1E2RA 2D2CD 3S4RA 2C9NY 1HF9A 1HH0A 5AW5B 2HYNA 4H0LD 1FS0E 1HCMA 1I8PA 1LWUB 1OFCX 1PV3A 1GL2C 2LXBA 5CIFB 2JWAA 1LT9C 3S1KA 2C9LY 1EC5A 2CE1A 2YO2A 1L0LK 1VQ4P 3R4YA 2CPBA 3KZIV 2WSFJ 1IK9A 1CSWA 3AE9C 2GC7D 4M3LA 2C9XB 1E79H 2KLUA 1GDVA 1CHHA 3HQ7A 1M56D 1NMLA 2FWLA 2D0WA 1KB9E 2VRSA 1EZVE 2KNCB 2OARA 2C0XA 4WY4B 3PRJA 2OYIC 3RK3D 4KHXA 2C1DB 3A0BH 4MN4C 1UIXA 3FX0A 3Q3DA 1Q86Q 4AALA 3TGUJ 4XFJA 4Q5PA 2N3YA 1HZVA 1PGOA 4JCGA 5KJ7D 1BCCD 3ORVA 5GTIV 1BCCE 5TISE 1H31A 5APUA 1S6VB 2N9JA 2ZAEB 3H1HJ 2KUBA 2W6BA 1C6RA 1CRJA 1LC2A 2OYOA 5AW8B 4CPGA 1MG2D 3M91A 2WT7B 1CXCA 1FBMA 1GQ1A 4WQ7A 5AW2B 2WTYA 2I1JA 3PLNA 1ZRTD 1SQQE 1VQMP 1MFTA 1ZP0C 4HJGH 1H88A 1HJ4A 1ZRTE
chains in the Genus database with same CATH topology
1NTZD 2PCBB 4EIDA 1P84D 1CRHA 1ETPA 1FHBA 1I54A 1SQPD 4L3GA 1LS9A 2Y0EA 3WFBC 4WQ9A 2JQRA 3A0HV 1CYJA 3O20A 4XYDB 2ZOOA 1FI3A 3OA8B 3DR0A 5B6QA 1H33A 1N50A 4Y5RA 5B5EV 4MU8A 3PHLA 1HJ3A 2VHDA 4LJIA 2L91A 3H1JD 1CHIA 5CIDB 1FOCA 4U3FD 2CE0A 4XXLA 3CU4A 1SQBD 3WU2V 3ZBMA 451CA 5KLIB 3TDKA 2ORLA 1CIFA 1FI9A 1IZL0 5KAFV 3MK7B 1KB9D 1CORA 1RAQA 3CYTI 2PACA 1WVEC 1M6ZA 1EZVD 4NFGB 1QYZA 1N90A 2FRCA 2N9YB 1CSUA 3L72D 5AURA 3M97X 3DMIA 1A56A 5KLVD 1RZ5A 1QL4A 3A9FA 1GJQA 1L0ND 3WFDC 1W5CT 1C52A 1KB0A 1I6EA 2B4ZA 1CNOA 5C9MA 1C6SA 3ZOXA 1A2SA 3DP5A 4UB8V 1H9XA 2BPBB 1H32A 3HQ8A 2DGEA 3H1ID 2XTSB 1L9JC 2D0SA 3KHUA 2Y0DA 1KYOD 1LFMA 4EIFA 3L74D 5DJQC 1KX7A 5C0ZA 1F1FA 4AANA 1CHJA 1CYIA 4UB6V 5GTHV 3L70D 3OCDB 3ZOOA 1F1CA 2YK3A 4DY9A 4FA1A 1CXAA 5DF5A 2BH4X 3O1YA 3ZOYA 3VRDA 2GB8B 1NTMD 1DIIC 2AIUA 4FANA 2CXBA 3WUIA 1NNOA 2YIUB 4QAOA 4PWAA 1SQQD 1RZ6A 1YNRA 2FYUD 3FWLA 2RN0A 1LMSA 1AOQA 5B66V 1CO6A 5CIHB 1CRYA 2BCCD 1FJ0A 1HZUA 5CYTR 5KAIV 3L4MA 3HQ9A 1HROA 2GC4D 1LC1A 1CIEA 1IRVA 2C1DA 4GYDA 5TISV 1VYDA 3GW6A 3MK7C 3L73D 1C7MA 1HJ4A 1IRWA 4N0KA 5CIBB 1CC5A 1CSVA 1E29A 3L4OA 1CCHA 2YCCA 1HJ5A 2OZ1A 3A0BV 1K3HA 4V2KA 4WQBA 2YQBA 1H1OA 5CIEB 1H31B 3L75D 3VNWA 1PPJD 1EB7A 1W2LA 3L71D 3ZOWA 1QL3A 2MHMA 2V07A 1COTA 1A8CA 1PP9D 2C8SA 3H1KD 2GIWA 1WEJF 3C2CA 2B0ZB 1KX2A 2QJYB 4O1WA 4L1QA 3JBTB 3SXTA 3RLMA 4EICA 4KMGA 3WFCC 3X39A 2N9IA 4IL6V 1SQXD 1MG3D 2BCNB 1NMIA 1GKSA 2QJPB 3TGUD 1CEDA 3PH2B 1YEBA 2Y0CA 351CA 5DFSA 1YFCA 4WQCA 1BE3D 3CP5A 3NBTA 1MZ4A 1KV9A 3CWBD 2C1VA 5KKZB 2QG4A 4YE1A 1HH7A 5CICB 1H9YA 1H33B 3OA8A 4EDFA 2B10B 1K3GA 3CXHD 1C6OA 1IQCA 3O5CA 1CIGA 1CIHA 1DW2A 4WQAA 3HQ6A 2IBZD 1S5LV 1YIQA 1CTZA 1BGYD 2PCCB 2B12B 4AAOA 1M60A 1R0QA 4RSZA 1YTCA 5IY51 4AAMA 3CX5D 1KYOW 2Q3EA 4FA5A 1QKSA 4WQ8A 2JTIB 2MTAC 2QJKB 3H1LD 3NBSA 4H0KA 2O3JA 4FB1A 1RAPA 3BCCD 4P4QB 1FI7A 2ZXYA 3ZIYA 1M70A 4J20A 3SWSA 1HRCA 4EIEA 1C75A 3SVWA 4WQDA 1E8EA 1GU2A 4FA4A 1C2NA 4GEDB 3WC8A 3RN0A 2AXTV 2N3BA 1KIBA 1AKKA 1CYCA 4K3IA 1NU1D 3GG2A 1E2RA 3PXWA 1H32B 1DVVA 3ZCFA 2ZONG 3PXSA 1HCMA 1CRCA 1I8PA 1BL9A 2N18B 3SLEA 3RMZA 1DVHA 2BH5X 5CIFB 2JWAA 1AOFA 1NIRA 2AI5A 2C1UA 4D6TD 3OCDA 2CE1A 2K9JB 2HV4A 1I8OA 4PW9B 3KZIV 1OCDA 4L3HA 1N15A 5E79V 1CSWA 2GC7D 3ITKA 5H2FV 2C9XB 1YICA 2CA4B 2V08A 1GDVA 3TF5A 1SQVD 1CHHA 3HQ7A 1NMLA 1YCCA 2FWLA 1GIWA 1DT1A 1B7VA 2D0WA 1CCRA 1CRGA 3NWVA 3PTZA 2KNCB 1I6DA 1DW1A 4O1QA 2FYNB 3PRJA 1CTYA 1L9BC 1CTJA 2L4DA 1IO3A 2C1DB 1FCDC 4PD4D 1ZZHA 1QN2A 3SJLA 4AALA 1DW3A 155CA 3VYMA 4Q5PA 2LIRA 2N3YA 3H1HD 1U74B 1N9CA 2BGVX 2C2CA 5CIGB 1HZVA 5TJHA 4JCGA 4FAVA 1I55A 2OZ1B 3VMAA 1BCCD 1NTKD 2ZBOA 3ORVA 1J3SA 2BLFB 3O0RC 5GTIV 4A7PA 1H31A 1DW0A 1S6VB 1U75B 2N9JA 3RN1A 2EXVA 4FA9A 2RMZA 1CSXA 1OAEA 3TYIA 1C6RA 1CRJA 4AX3A 1LC2A 5EXQA 3CXHW 2N18C 2LITA 4WQEA 3PXTA 1MG2D 5DJQB 2KS1A 2CA3B 1CXCA 3WFEC 1C2RA 2DVHA 1GQ1A 4H0JA 1JDLA 1AYGA 1I5TA 4WQ7A 1YEAA 2A06D 2ZZS1 2I8FA 3PLNA 1DIQC 1ZRTD 1CRIA 2B11B 3CX5W 4RJTA 1L0LD 4PJ0V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ D;  2PCB B;  4EID A;  1P84 D;  1CRH A;  1ETP A;  1FHB A;  1I54 A;  1SQP D;  4L3G A;  1LS9 A;  2Y0E A;  3WFB C;  4WQ9 A;  2JQR A;  3A0H V;  1CYJ A;  3O20 A;  4XYD B;  2ZOO A;  1FI3 A;  3OA8 B;  3DR0 A;  5B6Q A;  1H33 A;  1N50 A;  4Y5R A;  5B5E V;  4MU8 A;  3PHL A;  1HJ3 A;  2VHD A;  4LJI A;  2L91 A;  3H1J D;  1CHI A;  5CID B;  1FOC A;  4U3F D;  2CE0 A;  4XXL A;  3CU4 A;  1SQB D;  3WU2 V;  3ZBM A;  451C A;  5KLI B;  3TDK A;  2ORL A;  1CIF A;  1FI9 A;  1IZL 0;  5KAF V;  3MK7 B;  1KB9 D;  1COR A;  1RAQ A;  3CYT I;  2PAC A;  1WVE C;  1M6Z A;  1EZV D;  4NFG B;  1QYZ A;  1N90 A;  2FRC A;  2N9Y B;  1CSU A;  3L72 D;  5AUR A;  3M97 X;  3DMI A;  1A56 A;  5KLV D;  1RZ5 A;  1QL4 A;  3A9F A;  1GJQ A;  1L0N D;  3WFD C;  1W5C T;  1C52 A;  1KB0 A;  1I6E A;  2B4Z A;  1CNO A;  5C9M A;  1C6S A;  3ZOX A;  1A2S A;  3DP5 A;  4UB8 V;  1H9X A;  2BPB B;  1H32 A;  3HQ8 A;  2DGE A;  3H1I D;  2XTS B;  1L9J C;  2D0S A;  3KHU A;  2Y0D A;  1KYO D;  1LFM A;  4EIF A;  3L74 D;  5DJQ C;  1KX7 A;  5C0Z A;  1F1F A;  4AAN A;  1CHJ A;  1CYI A;  4UB6 V;  5GTH V;  3L70 D;  3OCD B;  3ZOO A;  1F1C A;  2YK3 A;  4DY9 A;  4FA1 A;  1CXA A;  5DF5 A;  2BH4 X;  3O1Y A;  3ZOY A;  3VRD A;  2GB8 B;  1NTM D;  1DII C;  2AIU A;  4FAN A;  2CXB A;  3WUI A;  1NNO A;  2YIU B;  4QAO A;  4PWA A;  1SQQ D;  1RZ6 A;  1YNR A;  2FYU D;  3FWL A;  2RN0 A;  1LMS A;  1AOQ A;  5B66 V;  1CO6 A;  5CIH B;  1CRY A;  2BCC D;  1FJ0 A;  1HZU A;  5CYT R;  5KAI V;  3L4M A;  3HQ9 A;  1HRO A;  2GC4 D;  1LC1 A;  1CIE A;  1IRV A;  2C1D A;  4GYD A;  5TIS V;  1VYD A;  3GW6 A;  3MK7 C;  3L73 D;  1C7M A;  1HJ4 A;  1IRW A;  4N0K A;  5CIB B;  1CC5 A;  1CSV A;  1E29 A;  3L4O A;  1CCH A;  2YCC A;  1HJ5 A;  2OZ1 A;  3A0B V;  1K3H A;  4V2K A;  4WQB A;  2YQB A;  1H1O A;  5CIE B;  1H31 B;  3L75 D;  3VNW A;  1PPJ D;  1EB7 A;  1W2L A;  3L71 D;  3ZOW A;  1QL3 A;  2MHM A;  2V07 A;  1COT A;  1A8C A;  1PP9 D;  2C8S A;  3H1K D;  2GIW A;  1WEJ F;  3C2C A;  2B0Z B;  1KX2 A;  2QJY B;  4O1W A;  4L1Q A;  3JBT B;  3SXT A;  3RLM A;  4EIC A;  4KMG A;  3WFC C;  3X39 A;  2N9I A;  4IL6 V;  1SQX D;  1MG3 D;  2BCN B;  1NMI A;  1GKS A;  2QJP B;  3TGU D;  1CED A;  3PH2 B;  1YEB A;  2Y0C A;  351C A;  5DFS A;  1YFC A;  4WQC A;  1BE3 D;  3CP5 A;  3NBT A;  1MZ4 A;  1KV9 A;  3CWB D;  2C1V A;  5KKZ B;  2QG4 A;  4YE1 A;  1HH7 A;  5CIC B;  1H9Y A;  1H33 B;  3OA8 A;  4EDF A;  2B10 B;  1K3G A;  3CXH D;  1C6O A;  1IQC A;  3O5C A;  1CIG A;  1CIH A;  1DW2 A;  4WQA A;  3HQ6 A;  2IBZ D;  1S5L V;  1YIQ A;  1CTZ A;  1BGY D;  2PCC B;  2B12 B;  4AAO A;  1M60 A;  1R0Q A;  4RSZ A;  1YTC A;  5IY5 1;  4AAM A;  3CX5 D;  1KYO W;  2Q3E A;  4FA5 A;  1QKS A;  4WQ8 A;  2JTI B;  2MTA C;  2QJK B;  3H1L D;  3NBS A;  4H0K A;  2O3J A;  4FB1 A;  1RAP A;  3BCC D;  4P4Q B;  1FI7 A;  2ZXY A;  3ZIY A;  1M70 A;  4J20 A;  3SWS A;  1HRC A;  4EIE A;  1C75 A;  3SVW A;  4WQD A;  1E8E A;  1GU2 A;  4FA4 A;  1C2N A;  4GED B;  3WC8 A;  3RN0 A;  2AXT V;  2N3B A;  1KIB A;  1AKK A;  1CYC A;  4K3I A;  1NU1 D;  3GG2 A;  1E2R A;  3PXW A;  1H32 B;  1DVV A;  3ZCF A;  2ZON G;  3PXS A;  1HCM A;  1CRC A;  1I8P A;  1BL9 A;  2N18 B;  3SLE A;  3RMZ A;  1DVH A;  2BH5 X;  5CIF B;  2JWA A;  1AOF A;  1NIR A;  2AI5 A;  2C1U A;  4D6T D;  3OCD A;  2CE1 A;  2K9J B;  2HV4 A;  1I8O A;  4PW9 B;  3KZI V;  1OCD A;  4L3H A;  1N15 A;  5E79 V;  1CSW A;  2GC7 D;  3ITK A;  5H2F V;  2C9X B;  1YIC A;  2CA4 B;  2V08 A;  1GDV A;  3TF5 A;  1SQV D;  1CHH A;  3HQ7 A;  1NML A;  1YCC A;  2FWL A;  1GIW A;  1DT1 A;  1B7V A;  2D0W A;  1CCR A;  1CRG A;  3NWV A;  3PTZ A;  2KNC B;  1I6D A;  1DW1 A;  4O1Q A;  2FYN B;  3PRJ A;  1CTY A;  1L9B C;  1CTJ A;  2L4D A;  1IO3 A;  2C1D B;  1FCD C;  4PD4 D;  1ZZH A;  1QN2 A;  3SJL A;  4AAL A;  1DW3 A;  155C A;  3VYM A;  4Q5P A;  2LIR A;  2N3Y A;  3H1H D;  1U74 B;  1N9C A;  2BGV X;  2C2C A;  5CIG B;  1HZV A;  5TJH A;  4JCG A;  4FAV A;  1I55 A;  2OZ1 B;  3VMA A;  1BCC D;  1NTK D;  2ZBO A;  3ORV A;  1J3S A;  2BLF B;  3O0R C;  5GTI V;  4A7P A;  1H31 A;  1DW0 A;  1S6V B;  1U75 B;  2N9J A;  3RN1 A;  2EXV A;  4FA9 A;  2RMZ A;  1CSX A;  1OAE A;  3TYI A;  1C6R A;  1CRJ A;  4AX3 A;  1LC2 A;  5EXQ A;  3CXH W;  2N18 C;  2LIT A;  4WQE A;  3PXT A;  1MG2 D;  5DJQ B;  2KS1 A;  2CA3 B;  1CXC A;  3WFE C;  1C2R A;  2DVH A;  1GQ1 A;  4H0J A;  1JDL A;  1AYG A;  1I5T A;  4WQ7 A;  1YEA A;  2A06 D;  2ZZS 1;  2I8F A;  3PLN A;  1DIQ C;  1ZRT D;  1CRI A;  2B11 B;  3CX5 W;  4RJT A;  1L0L D;  4PJ0 V; 
#chains in the Genus database with same CATH topology
 1NTZ D;  3HUS C;  1N8R Q;  1NTZ E;  2KI7 B;  1URQ A;  4OVN F;  1FHB A;  1I54 A;  1LGH B;  2Y0E A;  3TYY A;  4WQ9 A;  2KYV A;  2JQR A;  3AEG C;  2W6J H;  1HUC A;  2J59 M;  3VOP A;  3VP9 A;  3DR0 A;  1CZQ A;  5AVS B;  1N50 A;  3OJA B;  2FYU K;  2P1J A;  5BVZ A;  4MU8 A;  1GMJ A;  4IL6 E;  4LJI A;  5B66 H;  3H1J D;  2QJP C;  4K3A A;  1IFJ A;  1T3U A;  2CE0 A;  3CU4 A;  1SQB D;  1RHZ B;  3WU2 V;  2N1T D;  5KLI B;  4L76 A;  3TDK A;  3GMA A;  2YXR B;  1SQB E;  3L37 A;  3PP5 A;  3CYT I;  2PAC A;  1WVE C;  5GTH E;  4NFG B;  2WSE J;  1Y9B A;  2V4H A;  3BCC G;  3L72 D;  3M97 X;  1JY3 O;  1OXZ A;  1FZC C;  2KS1 B;  2HG5 D;  3L72 E;  4C46 A;  1MUU A;  5KLV D;  1RZ5 A;  1FDI A;  1NAF A;  4GOD A;  1L0N D;  3GLM A;  3RK2 B;  5KLV E;  3GHG C;  1L0N E;  3KPE A;  1VPC A;  3CD6 P;  2E76 C;  3RBZ A;  2BPB B;  1IC2 A;  2V7Q H;  3HQ8 A;  2DGE A;  3H1I D;  2XTS B;  1SQX E;  1L9J C;  1HGV A;  3KZI H;  2Y0D A;  3L74 D;  1FOS F;  1M1J A;  2XV5 A;  1F1F A;  4AAN A;  3L74 E;  1FZB A;  1CHJ A;  4AYC A;  4IFF A;  1CYI A;  4Y99 C;  3ZOO A;  2M3E A;  1JCC A;  4FA1 A;  2OYH C;  1CXA A;  1S4X A;  2UWJ E;  1LTA C;  3IF4 A;  3IR9 A;  2WSF H;  1DII C;  1PP9 G;  1PZQ A;  4FAN A;  2IBZ I;  1NNO A;  2YIU B;  1BCC J;  4TLF A;  1ZW0 A;  1SQV G;  1J1D B;  3Q5R A;  1FAV A;  2IFN A;  1N7S C;  3JC2 2;  3VN0 A;  2E42 A;  2BCC D;  3V2N A;  1H89 A;  1NTM K;  1Y47 A;  1SQQ J;  1OZH A;  5CCG D;  1GU5 A;  1LTJ A;  4GYD A;  2E43 A;  5TIS V;  3D6Y A;  3MK7 C;  3H25 A;  3SWK A;  1IRW A;  4BXL A;  2KP8 A;  5GTI H;  1FZG A;  2Y9Z A;  1IZN B;  3L4O A;  1CCH A;  1N7S D;  2FYN C;  4H44 C;  1S9K D;  1T2K C;  3GF7 A;  1K3H A;  1EDL A;  4V2K A;  4IFD K;  1S9K E;  2AXT H;  2IYO A;  2YQB A;  2OTJ P;  1H31 B;  1AA0 A;  1EQ7 A;  1M57 D;  2XND H;  3AE7 C;  3L71 D;  3ZOW A;  5CJ4 A;  1K73 Q;  2MHM A;  3L71 E;  3AE5 C;  1J1E B;  1G1J A;  1XTC C;  1ZME C;  2IYP A;  2B0Z B;  1KX2 A;  4L1Q A;  3JBT B;  3D70 A;  2NPS C;  2N9I A;  4IL6 V;  1L0L G;  4H44 D;  1D7M A;  1T2K D;  1YHQ P;  2BCN B;  1GKS A;  3L72 J;  3PH2 B;  2Y0C A;  351C A;  1URQ B;  1YFC A;  3H1K J;  2FXO A;  5KLV J;  1J2J B;  3L35 A;  1MZ4 A;  2CK3 H;  3CWB D;  3CPW O;  2PGD A;  2C1V A;  3WU2 H;  5C39 A;  4YE1 A;  3CWB E;  3M0D A;  3M0A A;  2WMM A;  1SQX J;  3AEE C;  3G3Z A;  1C6O A;  1QL1 A;  3VMY A;  3QH9 A;  2Z5I A;  4PJ0 E;  2QA4 P;  3HQ6 A;  2IBZ D;  2ZYD A;  2NPS D;  2YKP A;  1CTZ A;  2B12 B;  1PGJ A;  4U3F G;  2IBZ E;  1YTC A;  5IY5 1;  1JNM A;  2QJK B;  3A0H E;  3KDP B;  3ABV C;  2KXP B;  1YJW P;  2Q7C A;  3NMD A;  2YO3 A;  4FB1 A;  1QGK B;  5B5E E;  1IFP A;  1G1I A;  1M90 Q;  2WSE H;  2H89 C;  1YTZ I;  1C75 A;  2H7H A;  3L36 A;  3SVW A;  2E75 B;  2W6A A;  4WQD A;  5BU5 A;  3N7N A;  1QVG O;  2AEJ A;  4GED B;  3VTP C;  3WC8 A;  2N3B A;  1RQU A;  4DT0 A;  1AKK A;  2A06 E;  1OW7 A;  1EXJ A;  3G6E P;  3NXS A;  1KB9 H;  2HFE D;  1RE4 C;  1GU4 A;  5AVR B;  3HD7 C;  1P84 E;  2N18 B;  1RF1 A;  1M1J B;  2FKW B;  1DVH A;  2BH5 X;  2WVR A;  1NIR A;  1ZV8 A;  3VMZ A;  1YTZ T;  4H13 C;  1YIT P;  3OCD A;  4NPE A;  2YKQ A;  3OA7 A;  5L8R J;  1ZR4 A;  2YMK A;  2ZXE B;  5KJ7 A;  5E79 V;  4OGQ C;  1EDJ A;  2CA4 B;  3B5N B;  2JEE A;  2Q6Q A;  5KKZ C;  1RF0 C;  3HD7 D;  1KFM A;  3O8Z A;  4JYC A;  5TIS H;  1PIX A;  2FYU G;  1EDK A;  1GIW A;  3RL0 C;  3NWV A;  3L71 J;  1FU1 A;  4KT0 J;  4N6J A;  2W90 A;  4H13 D;  1EZV I;  1DW1 A;  4O1Q A;  1BDD A;  2Q1K A;  2IDB A;  2JO1 A;  1DD4 A;  3FWN A;  2L4D A;  1LTJ B;  1NAY A;  4OGQ D;  1SQV K;  2WWW A;  2K88 A;  3LW5 J;  155C A;  1YIJ P;  1DX7 A;  3C8V A;  3LID A;  3H1H D;  1AVO A;  1IK7 A;  2P67 A;  5CIG B;  3KQG A;  3CCR P;  1SFC D;  3CWB J;  1RE3 A;  1I55 A;  1KYO I;  1YJN P;  1NTK D;  4DOJ A;  4GDO A;  3F5H A;  1VF5 B;  1NTK E;  2WPQ A;  3L75 G;  1DW0 A;  1U75 B;  2WPR A;  3U1C A;  1M7L A;  4XA4 A;  2N1T A;  4W80 A;  4IL6 H;  1OAE A;  4ASV A;  5CCH A;  1LWU C;  5EXQ A;  3CXH W;  3PXT A;  5DJQ B;  2KS1 A;  2CA3 B;  1C2R A;  3RL0 g;  2XNX A;  1DIQ C;  2KLV A;  1WMK A;  3CX5 W;  2PFX A;  5AW7 B;  5GTH H;  4PJ0 V;  2B88 A;  1S2E A;  2W27 A;  4N78 D;  4EID A;  1NO4 A;  2A45 I;  1Q82 Q;  4N78 E;  1ZXG A;  1ETP A;  1BE3 G;  2D2C B;  3CCV P;  3WFB C;  3A0H V;  2QJY C;  4H0L B;  3D6Z A;  1CYJ A;  4XYD B;  2KOG A;  4WBA A;  1FI3 A;  2W83 C;  1WT6 A;  2GUS A;  5B5E V;  2HR3 A;  1HJ3 A;  2L91 A;  3MUD A;  1FOC A;  1GTW A;  1JEK A;  3M9Q A;  3V5B A;  4XXL A;  1EDI A;  1NTM G;  4WY4 C;  1NHL A;  2I8D A;  2R3C A;  3S9O A;  1SQP K;  3V4Q A;  1VL2 A;  3AE3 C;  5APT A;  3H1L G;  1KB9 D;  5BU8 B;  1GL2 D;  2YKO A;  1EZV D;  1QYZ A;  2WSS H;  2E5T A;  1CSU A;  5AUR A;  1FOS E;  4YTP C;  2M0B A;  1R8E A;  1L4A C;  3DMI A;  4IOI H;  3BVH A;  2ZXX A;  1JY2 P;  3CLQ A;  3A9F A;  1GJQ A;  3WUT A;  3WFD C;  3TSI A;  1FE6 A;  3SFD C;  2XU6 A;  1NU1 G;  3UIA A;  1JY2 O;  1H9X A;  4HKZ H;  3RK3 B;  5CCG A;  2D0S A;  3KHU A;  1KYO D;  1RF1 B;  1LFM A;  1CI6 A;  1KX7 A;  5C0Z A;  1K9M Q;  4TT3 H;  1KYO E;  1K8A Q;  1L4A D;  2FBW C;  2PRR A;  3OCD B;  3MHV A;  2K9J A;  4WVZ A;  3AEC C;  2YK3 A;  1LTG C;  3B71 A;  1L2P A;  1JB0 J;  2ZYG A;  2OYI B;  1VQ7 P;  3PJS K;  2FYZ A;  3E1R A;  3RGU A;  3IAO A;  3CCE P;  1NTK J;  4HB1 A;  1SQQ D;  1Y8A A;  3U1A A;  1RZ6 A;  1YNR A;  2GA1 A;  5AW1 B;  5APQ A;  1A02 J;  1Q7Y Q;  3BRV B;  1CO6 A;  4ASW A;  1N86 A;  3BCC E;  1CRY A;  3A5T A;  1FJ0 A;  1IJD B;  3TK1 A;  1HZU A;  2QIW A;  3BAT A;  5CYT R;  5CBN A;  1A02 F;  5KAI V;  4YXW H;  4ZMD A;  5H2F E;  5APX A;  5KLI C;  1HRO A;  1CIE A;  1KZU B;  1IRV A;  5M1B A;  1S5L X;  3L73 D;  1U7J A;  3L73 E;  1CSV A;  1NKZ B;  3LW5 H;  1E29 A;  2YCC A;  2BEZ F;  4RO0 A;  1GW4 A;  2HOD B;  3RK2 C;  2OTK E;  1FDM A;  1Q81 Q;  1JY3 P;  1X9V A;  1EB7 A;  2N1T B;  4PJ0 H;  3SWF A;  2V07 A;  1PP9 D;  1W2B O;  1OVU A;  2C8S A;  2WQY C;  4HYT B;  5EFW B;  3H1K D;  2GIW A;  1WEJ F;  1PP9 E;  4PV1 B;  3H1K E;  3A0H H;  1VDF A;  1HTL C;  5APW A;  4EYY Q;  3RBX A;  1SQX D;  1NTZ G;  3RK2 D;  5B5E H;  1MG3 D;  1NMI A;  2QJP B;  1YEB A;  3P8C D;  4W7Y A;  4WQC A;  3P8C E;  1H0T A;  2YIU C;  3OAK A;  3AEF C;  1OMI A;  1J1D C;  1H9Y A;  2O01 N;  2B10 B;  4L75 A;  3Q1M A;  1U57 A;  1K3G A;  4D6T G;  2KB7 P;  3WMM 0;  1DW2 A;  4WQA A;  4PD4 I;  3H1J G;  1YIQ A;  1P84 H;  1BGY D;  1M60 A;  4LGD E;  2E76 D;  1SQB G;  1BGY E;  1SP4 A;  3B5N A;  2K3R A;  4WQ8 A;  1N73 A;  3NBS A;  3FXE A;  1NGM B;  1YQ4 C;  1KD1 Q;  1RAP A;  1FI7 A;  2ZXY A;  3AEA C;  4J20 A;  3SWS A;  2POH A;  2AEF A;  4EIE A;  5AVT B;  3B8E B;  5KLV G;  5E79 E;  2ZT9 B;  1E8E A;  4FA4 A;  2KK7 A;  1L0N G;  1OVR A;  3II6 A;  3JCU E;  3MZW B;  1KIL A;  1Q2N A;  3KYQ A;  4K3I A;  2JWD A;  5KAF E;  3PXW A;  3BCC J;  1DVV A;  1X22 A;  3H1I G;  1L0L E;  3ZCF A;  3PXS A;  1BL9 A;  1CI6 B;  3L74 G;  3FXD A;  1J1E C;  3RMZ A;  1P84 I;  1QVF O;  3L73 J;  3ZDM A;  3V2R A;  2C1U A;  2FXM A;  1KFN A;  2K9J B;  1DEE G;  2RH0 A;  1NU1 K;  1HWT C;  1SFC A;  4Z1M H;  1PL5 A;  1OCD A;  3QWO C;  4L3H A;  1URQ C;  4DCK A;  5H2F V;  4U7J A;  2J5U A;  4U3F E;  5CHX A;  4YXD C;  4I7Z B;  3TF5 A;  5AVW B;  3N4X A;  2ZVN B;  1YCC A;  4UB6 E;  3P7K A;  1CRG A;  2Q5U A;  3PTZ A;  1USE A;  1PP9 J;  2FY8 A;  2BCC G;  4JPZ B;  2IX7 C;  5APY A;  3C9I A;  2MKV A;  2FYN B;  1SQP G;  1L9B C;  1GK4 A;  1IO3 A;  1NYH A;  1SQV J;  3W68 A;  1URQ D;  1PGQ A;  2QJK C;  1IFN A;  1GDT A;  1AV1 A;  4PD4 D;  2G3A A;  3VP8 A;  3OW2 O;  1OX3 A;  3G71 P;  1DW3 A;  4PD4 E;  1NVO A;  3WUV A;  1U74 B;  1N9C A;  2BGV X;  2NRG A;  1HJ0 A;  2E75 C;  5TJH A;  3AE6 C;  4FAV A;  1MFZ A;  3VMA A;  2WSC J;  2ZBO A;  4WWI A;  1J3S A;  2BLF B;  4R4L A;  3I5C A;  4W7Z A;  4A7P A;  3TNU A;  3RN1 A;  2ZYA A;  2RMZ A;  1BGY J;  1ZR2 A;  4AX3 A;  4K35 A;  2N18 C;  2LIT A;  3CL3 D;  3W67 A;  1M1J C;  1GL2 A;  2ZFC A;  2DVH A;  4H0J A;  2A06 D;  2ZZS 1;  2I8F A;  1PFI A;  1LT9 A;  2B11 B;  1AVY A;  4RJT A;  2E75 D;  3NFQ A;  3G4S P;  1IO4 A;  1JUN A;  5DJU B;  2FYU E;  2AEM A;  1P84 D;  1JO5 A;  1NJI Q;  3MTU E;  2IPP A;  4L3G A;  4BWN A;  1H0T B;  5APV A;  3AEB C;  4WB4 A;  2P10 A;  1S3J A;  2CPS A;  4KJM A;  4ZKU A;  1SVF A;  3Q5S A;  1L0L J;  3HE4 A;  3L70 G;  3V2P A;  3R2P A;  1JMB A;  2GUV A;  3PHL A;  4I1L A;  5AW6 B;  1NTZ K;  2M3B A;  2R5D A;  3SWY A;  1KYO H;  2OYI A;  3M9B A;  4OWF A;  451C A;  2ORL A;  1LTJ C;  1UII A;  1FI9 A;  1N73 B;  5KAF V;  1RAQ A;  1KOR A;  4YPC A;  3V4W A;  3L75 E;  2OTL P;  2FRC A;  5AW9 B;  1LP1 A;  4GOE A;  4U3F J;  2FXP A;  3H32 A;  1S5L E;  1OWA A;  2P2U A;  3BAS A;  1QL4 A;  1SQB K;  1PGP A;  2K37 A;  1R5L A;  1KB0 A;  3MD0 A;  1KIL B;  2IZ1 A;  1CNO A;  1VF5 C;  3ZOX A;  2QM7 A;  3DP5 A;  1CW5 A;  1H32 A;  2A45 H;  5AVU B;  2E74 C;  1AJY A;  4EIF A;  5DJQ C;  4N3Y B;  1VQN P;  3RL0 D;  5H2F H;  5KLV K;  2HOD A;  5KAI E;  1L0N K;  4UB6 V;  5CJ0 A;  2K1A A;  3F89 A;  2QVA A;  3HUS A;  1F1C A;  1SFC B;  1PPJ G;  2BH4 X;  2QE7 H;  3ZOY A;  3CXH I;  1NTM D;  2AIU A;  3CCS P;  2CXB A;  2E74 D;  4QAO A;  2YMY A;  1NTM E;  2KZJ A;  1KC8 Q;  4PWA A;  4H0L C;  2KIK A;  2C0W A;  3M0D C;  3CX5 I;  2FFD B;  1JCD A;  1LMS A;  1AOQ A;  5B66 V;  2P7J A;  3V2Q A;  4DZO A;  1GD2 E;  3VMX A;  5CIH B;  2XDJ A;  1KN7 A;  3TGU G;  3CCQ P;  3B4S A;  3Q2Y A;  3VYI A;  2PAJ A;  3H6P A;  1DIP A;  2GC4 D;  2N9B A;  2FYU J;  4L73 A;  2XKM A;  1VYD A;  1VQ6 P;  1C7M A;  2R44 A;  5CIB B;  5AVX B;  3SSU A;  4GT1 A;  1NU1 E;  3CI9 A;  3AE4 C;  1X8Y A;  3H1H G;  1SLQ A;  1FZC A;  1DD3 A;  1FJP A;  3KXD A;  2KSE A;  2OZ1 A;  1MKM A;  1LTB C;  2HPC A;  1NTK G;  3GHG A;  3O6Q A;  3EQ2 A;  1DH3 A;  3A2A A;  5CIE B;  1H1O A;  2WSC H;  3CCL P;  1ZLL A;  3TNU B;  3VNW A;  1AQ5 A;  3T97 A;  1X0T A;  3RK3 C;  1QL3 A;  1QEX A;  1RF1 C;  2R32 A;  4EIJ A;  3USS A;  1GL2 B;  3C2C A;  2QJY B;  5AVV B;  1LT9 B;  1KTM A;  4C7R A;  3L75 J;  1LTS C;  1VQL P;  2YNY A;  3WFC C;  4WY4 D;  3X39 A;  3K5B A;  3P8M C;  3M06 A;  1KQL A;  5KJ7 C;  1YQ3 C;  3AE2 C;  2OYH A;  2KZI A;  5DFS A;  1KQG B;  3CP5 A;  1OVV A;  1SS1 A;  5E79 H;  1KV9 A;  1JY2 N;  3JCU H;  1HH7 A;  3RK3 E;  1VQO P;  5CIC B;  1AFO A;  3OA8 A;  4EDF A;  2Z4E A;  3HE4 B;  1N7L A;  5KAF H;  3D71 A;  2QEX P;  3CXH D;  3O5C A;  1IQC A;  1N7S A;  1CIG A;  3LIE A;  1S5L V;  1BE3 J;  1L4A B;  3CXH E;  3HE5 A;  2PCC B;  3L4F A;  4AAO A;  3A7O A;  1T3J A;  4C7N A;  4AAM A;  2YXQ B;  3CX5 D;  1JM0 A;  4FA5 A;  3CX5 E;  2JTI B;  2MTA C;  4RES B;  2HLO A;  4H0K A;  1EZV G;  2QRX A;  2O3J A;  3BCC D;  2P58 A;  4P4Q B;  1LP1 B;  2M5A A;  3IFM A;  3H32 B;  3ZIY A;  1NTM J;  1M70 A;  1HRC A;  3E7K A;  1RE3 C;  1C2N A;  4BRY A;  3RN0 A;  2AXT V;  1HGZ A;  3H1L J;  2XZR A;  4UB6 H;  1H32 B;  2N1T C;  3NTN A;  5CCH C;  2ZON G;  1OIP A;  1CRC A;  3SLE A;  2G8Y A;  1OW8 A;  2JKV A;  2WZ7 A;  4PV1 C;  1HVV A;  1AOF A;  1QX8 A;  4QMA A;  1BCC G;  1NU1 J;  1S1C X;  2BEQ D;  2NPS A;  2AI5 A;  4I6M C;  4OH8 B;  4D6T D;  3HUS B;  2HV4 A;  4PD4 H;  1I8O A;  1NWQ A;  4PW9 B;  4D6T E;  4UB8 E;  4AUW A;  2L5G B;  1N15 A;  1GK6 A;  2O1K A;  3H1J E;  3ITK A;  1YIC A;  2V08 A;  4IFM A;  5CCH D;  1SQQ G;  2Y9Y A;  1SQV D;  1YJ9 P;  1FZF A;  1JY3 N;  2A45 G;  1SQV E;  1DT1 A;  4ZNC A;  1B7V A;  4PV1 D;  1CCR A;  2PP6 A;  1JOC A;  3MUD C;  1I6D A;  2LKM A;  1T8Z A;  1CTY A;  1IFM A;  1CTJ A;  2E5Y A;  3V6I A;  3CME P;  1G2C A;  1FCD C;  5CMZ A;  1Z56 A;  2JR8 A;  4RKU J;  3L73 G;  4GOF A;  2H8P D;  1ZZH A;  1QN2 A;  3SJL A;  1LNQ A;  1K04 A;  2QSI A;  3JSV C;  3VYM A;  3MGN A;  2LIR A;  3H1I E;  1FZC B;  3U59 A;  3AED C;  3AE1 C;  2C2C A;  2O01 J;  1OW6 A;  2ZT9 C;  2OZ1 B;  1U7M A;  2HPC B;  3GHG B;  1EXI A;  3O6Q B;  1RY3 A;  1VQ9 P;  3O0R C;  1ZOY C;  2E76 B;  2R5B A;  3T97 B;  2EXV A;  4FA9 A;  1RE4 A;  5CCG C;  1CSX A;  3MP7 B;  3TYI A;  4EI2 A;  3L72 G;  2LR2 A;  5AVQ B;  3HD7 A;  4WQE A;  1LJ2 A;  1WRG A;  3I56 P;  3WFE C;  3H1K G;  1AYG A;  1JDL A;  3E1I A;  1I5T A;  1YEA A;  1KQS O;  1CRI A;  1VQP P;  1NTK K;  3A0B E;  2ZT9 D;  4Y99 B;  5DJT B;  2QM8 A;  1L0L D;  4RSZ A;  2PCB B;  1SQX G;  4ZKP A;  2JJL A;  2OYH B;  5CBO A;  1CRH A;  2B87 A;  1S5L H;  1MV8 A;  2RKL A;  1SQP D;  1LS9 A;  2BCC E;  2DW3 A;  1JTH A;  4I7Z C;  4GIF A;  1SQP E;  1RF0 A;  2IFM A;  3O20 A;  2ZOO A;  4NPF X;  3OA8 B;  5B6Q A;  1H33 A;  1QLE D;  4I2L C;  2J58 A;  1NTZ J;  4Y5R A;  1IFI A;  1N7S B;  3HTK A;  1NKN A;  2VHD A;  4EOT A;  1VQK P;  1CHI A;  5CID B;  3HE5 B;  3EWK A;  4JYB A;  1BGY G;  3A3Y B;  4U3F D;  4C7N B;  3ZBM A;  3EFG A;  5K5G B;  5KAI H;  2Q9I A;  1CIF A;  4XE5 B;  4LLH A;  1IZL 0;  3MK7 B;  1FJK A;  2R3S A;  3CMA P;  3BRT B;  4D6T J;  1COR A;  4LC1 A;  1RH5 B;  4AQR D;  4L74 A;  2FFD A;  1M6Z A;  3H1J J;  1N90 A;  3SFE C;  2N9Y B;  2M5A B;  1LT1 A;  1A56 A;  1SQB J;  1GW3 A;  1S72 P;  1W2E A;  2B89 A;  1HBW A;  1ZN5 A;  1LTI C;  4BRY B;  2ITA A;  4H44 B;  1W5C T;  1C52 A;  1I6E A;  2B4Z A;  1R5S A;  5C9M A;  2GM4 A;  1C6S A;  1A2S A;  4UB8 V;  1N2D C;  5B66 E;  1LWU A;  2W8Z A;  2IZ0 A;  2O1J A;  3AE8 C;  1VQ5 P;  1L0N J;  1XTG B;  5KTB A;  3EFF K;  4JQ0 D;  5GTH V;  2AXC A;  2NPS B;  3L70 D;  1IFD A;  1CSB A;  3H1I J;  3G9R A;  3L70 E;  4DY9 A;  1FZE A;  2JDI H;  5DF5 A;  2WPS A;  3L71 G;  5APS A;  3L74 J;  4JF7 A;  3O1Y A;  3M9H A;  3VRD A;  2GB8 B;  2NZ2 A;  1LTT C;  2K9Y A;  1BDC A;  3WUI A;  2OQQ A;  1Q90 D;  4IL6 X;  4GKG A;  2I1K A;  3C1L A;  3HRN A;  2FYU D;  3FWL A;  2RN0 A;  3MIW A;  4HH2 A;  4DJG A;  2LXC B;  1USD A;  3CC4 P;  2KNC A;  1JMM A;  3KZI E;  1T6A A;  1H8A A;  4WY4 A;  3L4M A;  3HQ9 A;  1NOH A;  3B5N C;  3P32 A;  1LC1 A;  1G2C B;  3CWB G;  4JBZ A;  2C1D A;  1FZA A;  1SQQ K;  1N73 C;  1YYC A;  3D0W A;  3GW6 A;  4N0K A;  1CC5 A;  1W5C E;  5AW4 B;  4NPD A;  3CCM P;  2BAS A;  2BCC J;  1HJB A;  2IBZ G;  2M8R A;  2WIT A;  1L4A A;  4O9B A;  2ZVO B;  1SQP J;  3CCU P;  1HJ5 A;  3A0B V;  2O01 H;  5AW0 B;  1KIL C;  4WQB A;  3IN6 A;  3L75 D;  1AQT A;  1PPJ D;  3B5N D;  4R4M A;  3FGA D;  1W2L A;  5AVY B;  3GF3 A;  3CXH H;  1PPJ E;  2B9B A;  1NH4 A;  3HD7 B;  1COT A;  1A8C A;  2MJZ A;  2WT7 A;  3PH0 A;  2Q3I A;  4O1W A;  2H88 C;  2A06 G;  4B86 A;  2JP3 A;  3SXT A;  3CX5 H;  3RLM A;  4EIC A;  1K05 A;  4H13 B;  4KMG A;  4Y28 J;  3CC2 P;  5GTI E;  1SFC C;  1KB9 I;  3TGU D;  1CED A;  1KIL D;  3CCJ P;  1VQ8 P;  2B87 B;  4OGQ B;  1M1K Q;  1BE3 D;  3TGU E;  1KIL E;  2WPV B;  3NBT A;  1JTH B;  1BE3 E;  5AW3 B;  5KKZ B;  2KSJ A;  2QG4 A;  1H33 B;  3WUU A;  2AXT E;  2FFD C;  1BSH A;  1GZL A;  2ZJS E;  3RL0 B;  3HTK B;  1E5W A;  3CC7 P;  1CIH A;  1DEB A;  1X79 B;  1SQX K;  2OGU A;  1VF5 D;  1M8O B;  1R0Q A;  3H1H E;  2D2C C;  1KYO W;  1YBK A;  1TU3 F;  2Q3E A;  1RQV A;  1QKS A;  2SPZ A;  3L70 J;  3H1L D;  1KQF B;  2H43 A;  1MZ9 A;  3H1L E;  2E74 B;  2Z5H A;  4UB8 H;  1KMI Z;  1FC2 C;  1YI2 P;  1FDO A;  1GU2 A;  1KV4 A;  5AVZ B;  1BSN A;  3WU2 E;  1KIB A;  3I55 P;  1QL2 A;  1CYC A;  2V7Q J;  1NU1 D;  3GG2 A;  3Q5P A;  1E2R A;  2D2C D;  3S4R A;  2C9N Y;  1HF9 A;  1HH0 A;  5AW5 B;  2HYN A;  4H0L D;  1FS0 E;  1HCM A;  1I8P A;  1LWU B;  1OFC X;  1PV3 A;  1GL2 C;  2LXB A;  5CIF B;  2JWA A;  1LT9 C;  3S1K A;  2C9L Y;  1EC5 A;  2CE1 A;  2YO2 A;  1L0L K;  1VQ4 P;  3R4Y A;  2CPB A;  3KZI V;  2WSF J;  1IK9 A;  1CSW A;  3AE9 C;  2GC7 D;  4M3L A;  2C9X B;  1E79 H;  2KLU A;  1GDV A;  1CHH A;  3HQ7 A;  1M56 D;  1NML A;  2FWL A;  2D0W A;  1KB9 E;  2VRS A;  1EZV E;  2KNC B;  2OAR A;  2C0X A;  4WY4 B;  3PRJ A;  2OYI C;  3RK3 D;  4KHX A;  2C1D B;  3A0B H;  4MN4 C;  1UIX A;  3FX0 A;  3Q3D A;  1Q86 Q;  4AAL A;  3TGU J;  4XFJ A;  4Q5P A;  2N3Y A;  1HZV A;  1PGO A;  4JCG A;  5KJ7 D;  1BCC D;  3ORV A;  5GTI V;  1BCC E;  5TIS E;  1H31 A;  5APU A;  1S6V B;  2N9J A;  2ZAE B;  3H1H J;  2KUB A;  2W6B A;  1C6R A;  1CRJ A;  1LC2 A;  2OYO A;  5AW8 B;  4CPG A;  1MG2 D;  3M91 A;  2WT7 B;  1CXC A;  1FBM A;  1GQ1 A;  4WQ7 A;  5AW2 B;  2WTY A;  2I1J A;  3PLN A;  1ZRT D;  1SQQ E;  1VQM P;  1MFT A;  1ZP0 C;  4HJG H;  1H88 A;  1HJ4 A;  1ZRT E; 
#chains in the Genus database with same CATH homology
 1NTZ D;  2PCB B;  4EID A;  1P84 D;  1CRH A;  1ETP A;  1FHB A;  1I54 A;  1SQP D;  4L3G A;  1LS9 A;  2Y0E A;  3WFB C;  4WQ9 A;  2JQR A;  3A0H V;  1CYJ A;  3O20 A;  4XYD B;  2ZOO A;  1FI3 A;  3OA8 B;  3DR0 A;  5B6Q A;  1H33 A;  1N50 A;  4Y5R A;  5B5E V;  4MU8 A;  3PHL A;  1HJ3 A;  2VHD A;  4LJI A;  2L91 A;  3H1J D;  1CHI A;  5CID B;  1FOC A;  4U3F D;  2CE0 A;  4XXL A;  3CU4 A;  1SQB D;  3WU2 V;  3ZBM A;  451C A;  5KLI B;  3TDK A;  2ORL A;  1CIF A;  1FI9 A;  1IZL 0;  5KAF V;  3MK7 B;  1KB9 D;  1COR A;  1RAQ A;  3CYT I;  2PAC A;  1WVE C;  1M6Z A;  1EZV D;  4NFG B;  1QYZ A;  1N90 A;  2FRC A;  2N9Y B;  1CSU A;  3L72 D;  5AUR A;  3M97 X;  3DMI A;  1A56 A;  5KLV D;  1RZ5 A;  1QL4 A;  3A9F A;  1GJQ A;  1L0N D;  3WFD C;  1W5C T;  1C52 A;  1KB0 A;  1I6E A;  2B4Z A;  1CNO A;  5C9M A;  1C6S A;  3ZOX A;  1A2S A;  3DP5 A;  4UB8 V;  1H9X A;  2BPB B;  1H32 A;  3HQ8 A;  2DGE A;  3H1I D;  2XTS B;  1L9J C;  2D0S A;  3KHU A;  2Y0D A;  1KYO D;  1LFM A;  4EIF A;  3L74 D;  5DJQ C;  1KX7 A;  5C0Z A;  1F1F A;  4AAN A;  1CHJ A;  1CYI A;  4UB6 V;  5GTH V;  3L70 D;  3OCD B;  3ZOO A;  1F1C A;  2YK3 A;  4DY9 A;  4FA1 A;  1CXA A;  5DF5 A;  2BH4 X;  3O1Y A;  3ZOY A;  3VRD A;  2GB8 B;  1NTM D;  1DII C;  2AIU A;  4FAN A;  2CXB A;  3WUI A;  1NNO A;  2YIU B;  4QAO A;  4PWA A;  1SQQ D;  1RZ6 A;  1YNR A;  2FYU D;  3FWL A;  2RN0 A;  1LMS A;  1AOQ A;  5B66 V;  1CO6 A;  5CIH B;  1CRY A;  2BCC D;  1FJ0 A;  1HZU A;  5CYT R;  5KAI V;  3L4M A;  3HQ9 A;  1HRO A;  2GC4 D;  1LC1 A;  1CIE A;  1IRV A;  2C1D A;  4GYD A;  5TIS V;  1VYD A;  3GW6 A;  3MK7 C;  3L73 D;  1C7M A;  1HJ4 A;  1IRW A;  4N0K A;  5CIB B;  1CC5 A;  1CSV A;  1E29 A;  3L4O A;  1CCH A;  2YCC A;  1HJ5 A;  2OZ1 A;  3A0B V;  1K3H A;  4V2K A;  4WQB A;  2YQB A;  1H1O A;  5CIE B;  1H31 B;  3L75 D;  3VNW A;  1PPJ D;  1EB7 A;  1W2L A;  3L71 D;  3ZOW A;  1QL3 A;  2MHM A;  2V07 A;  1COT A;  1A8C A;  1PP9 D;  2C8S A;  3H1K D;  2GIW A;  1WEJ F;  3C2C A;  2B0Z B;  1KX2 A;  2QJY B;  4O1W A;  4L1Q A;  3JBT B;  3SXT A;  3RLM A;  4EIC A;  4KMG A;  3WFC C;  3X39 A;  2N9I A;  4IL6 V;  1SQX D;  1MG3 D;  2BCN B;  1NMI A;  1GKS A;  2QJP B;  3TGU D;  1CED A;  3PH2 B;  1YEB A;  2Y0C A;  351C A;  5DFS A;  1YFC A;  4WQC A;  1BE3 D;  3CP5 A;  3NBT A;  1MZ4 A;  1KV9 A;  3CWB D;  2C1V A;  5KKZ B;  2QG4 A;  4YE1 A;  1HH7 A;  5CIC B;  1H9Y A;  1H33 B;  3OA8 A;  4EDF A;  2B10 B;  1K3G A;  3CXH D;  1C6O A;  1IQC A;  3O5C A;  1CIG A;  1CIH A;  1DW2 A;  4WQA A;  3HQ6 A;  2IBZ D;  1S5L V;  1YIQ A;  1CTZ A;  1BGY D;  2PCC B;  2B12 B;  4AAO A;  1M60 A;  1R0Q A;  4RSZ A;  1YTC A;  5IY5 1;  4AAM A;  3CX5 D;  1KYO W;  2Q3E A;  4FA5 A;  1QKS A;  4WQ8 A;  2JTI B;  2MTA C;  2QJK B;  3H1L D;  3NBS A;  4H0K A;  2O3J A;  4FB1 A;  1RAP A;  3BCC D;  4P4Q B;  1FI7 A;  2ZXY A;  3ZIY A;  1M70 A;  4J20 A;  3SWS A;  1HRC A;  4EIE A;  1C75 A;  3SVW A;  4WQD A;  1E8E A;  1GU2 A;  4FA4 A;  1C2N A;  4GED B;  3WC8 A;  3RN0 A;  2AXT V;  2N3B A;  1KIB A;  1AKK A;  1CYC A;  4K3I A;  1NU1 D;  3GG2 A;  1E2R A;  3PXW A;  1H32 B;  1DVV A;  3ZCF A;  2ZON G;  3PXS A;  1HCM A;  1CRC A;  1I8P A;  1BL9 A;  2N18 B;  3SLE A;  3RMZ A;  1DVH A;  2BH5 X;  5CIF B;  2JWA A;  1AOF A;  1NIR A;  2AI5 A;  2C1U A;  4D6T D;  3OCD A;  2CE1 A;  2K9J B;  2HV4 A;  1I8O A;  4PW9 B;  3KZI V;  1OCD A;  4L3H A;  1N15 A;  5E79 V;  1CSW A;  2GC7 D;  3ITK A;  5H2F V;  2C9X B;  1YIC A;  2CA4 B;  2V08 A;  1GDV A;  3TF5 A;  1SQV D;  1CHH A;  3HQ7 A;  1NML A;  1YCC A;  2FWL A;  1GIW A;  1DT1 A;  1B7V A;  2D0W A;  1CCR A;  1CRG A;  3NWV A;  3PTZ A;  2KNC B;  1I6D A;  1DW1 A;  4O1Q A;  2FYN B;  3PRJ A;  1CTY A;  1L9B C;  1CTJ A;  2L4D A;  1IO3 A;  2C1D B;  1FCD C;  4PD4 D;  1ZZH A;  1QN2 A;  3SJL A;  4AAL A;  1DW3 A;  155C A;  3VYM A;  4Q5P A;  2LIR A;  2N3Y A;  3H1H D;  1U74 B;  1N9C A;  2BGV X;  2C2C A;  5CIG B;  1HZV A;  5TJH A;  4JCG A;  4FAV A;  1I55 A;  2OZ1 B;  3VMA A;  1BCC D;  1NTK D;  2ZBO A;  3ORV A;  1J3S A;  2BLF B;  3O0R C;  5GTI V;  4A7P A;  1H31 A;  1DW0 A;  1S6V B;  1U75 B;  2N9J A;  3RN1 A;  2EXV A;  4FA9 A;  2RMZ A;  1CSX A;  1OAE A;  3TYI A;  1C6R A;  1CRJ A;  4AX3 A;  1LC2 A;  5EXQ A;  3CXH W;  2N18 C;  2LIT A;  4WQE A;  3PXT A;  1MG2 D;  5DJQ B;  2KS1 A;  2CA3 B;  1CXC A;  3WFE C;  1C2R A;  2DVH A;  1GQ1 A;  4H0J A;  1JDL A;  1AYG A;  1I5T A;  4WQ7 A;  1YEA A;  2A06 D;  2ZZS 1;  2I8F A;  3PLN A;  1DIQ C;  1ZRT D;  1CRI A;  2B11 B;  3CX5 W;  4RJT A;  1L0L D;  4PJ0 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...