1PP9D

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 76
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1pp9D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1pp9D01
4K3IA 5KLIB 3WC8A 1KX2A 1HZUA 1PP9D 1CRGA 1H1OA 1CEDA 1FCDC 4EIDA 4RJTA 2GC4D 2QG4A 351CA 1K3GA 3SVWA 1COTA 4LJIA 3HQ9A 1LMSA 3BCCD 1SQXD 2QJYB 1NNOA 3TF5A 1C75A 1DT1A 5CIGB 1KB9D 1M60A 4NFGB 3SWSA 1M70A 4AAMA 3WUIA 1CHIA 4H0KA 1H9YA 2Y0CA 2GIWA 4WQCA 1N90A 1E8EA 3RN1A 4PJ0V 1C6SA 1I8OA 1QYZA 4FA1A 1SQQD 1YNRA 1NTZD 1C7MA 5C9MA 4WQAA 1NIRA 2KS1A 1H33B 2PCBB 1YCCA 2C9XB 3WFEC 2B12B 4FA5A 5CIDB 1YEBA 1H32A 1CORA 3PXTA 2Y0DA 5CIBB 1AKKA 4AANA 3H1LD 1CHJA 3RN0A 1HCMA 5CYTR 4O1WA 2MTAC 2A06D 2CA3B 1L9JC 4XYDB 4MU8A 3PH2B 1H32B 1QKSA 1NTKD 2YCCA 5B6QA 1F1FA 5KLVD 1MG2D 2CXBA 4UB6V 3O0RC 1H33A 1OCDA 3L71D 1HROA 1CTZA 3FWLA 1DIIC 1H31A 2ZONG 1HJ5A 5C0ZA 3CP5A 1I6DA 1S5LV 3MK7B 3CX5D 1K3HA 3L72D 1C2RA 4AALA 3GG2A 4FA9A 2CE1A 1RZ6A 2QJPB 2B10B 1YIQA 1CYCA 1NU1D 5E79V 2JTIB 1CYJA 1AOQA 1E2RA 2LITA 5B5EV 3PTZA 1DW1A 3ITKA 2N18C 5KKZB 3ORVA 3MK7C 2KNCB 3A9FA 3ZBMA 3SLEA 2D0WA 5GTHV 2MHMA 2XTSB 1CCHA 2DGEA 4P4QB 2N9JA 2L4DA 3RMZA 1A56A 1QL4A 2B4ZA 1LFMA 1IO3A 1HJ3A 1WVEC 1GDVA 2YK3A 3RLMA 1F1CA 3X39A 4RSZA 3H1JD 451CA 1HRCA 1A8CA 2CA4B 2B0ZB 3KZIV 2C1UA 1R0QA 1FI7A 3PXSA 1C52A 1L9BC 4FAVA 1AYGA 4UB8V 1NMIA 5IY51 1I8PA 3TYIA 4U3FD 1HZVA 3ZCFA 2C1DA 2BH5X 3A0BV 2K9JB 1CCRA 3ZOWA 3DP5A 4GYDA 1CIGA 2N9YB 4WQ7A 1IRVA 1HJ4A 155CA 1L0LD 2ZZS1 2V08A 2ORLA 2AXTV 3WU2V 3L4OA 3TGUD 3CXHD 1CSWA 4D6TD 4PD4D 2JQRA 1C2NA 1FHBA 2YQBA 3HQ6A 1N15A 1GJQA 1GQ1A 1VYDA 4WQBA 4J20A 3HQ8A 1DIQC 2IBZD 1YEAA 1KYOW 1P84D 1N9CA 4PW9B 4EICA 1S6VB 3NWVA 2BH4X 3ZOXA 1CC5A 1RAQA 1MG3D 1MZ4A 2PACA 1JDLA 2C1DB 1FJ0A 3L75D 1SQBD 1SQPD 3L74D 4QAOA 3L4MA 1YTCA 1CSVA 2N3BA 5CIEB 5CICB 2LIRA 2YIUB 1HH7A 1SQVD 3GW6A 4V2KA 4IL6V 1J3SA 1CNOA 2B11B 1M6ZA 1ZZHA 1CIHA 4JCGA 3VRDA 1CTJA 4L1QA 4O1QA 4H0JA 1AOFA 3O1YA 4A7PA 5EXQA 3WFCC 1DW2A 2QJKB 1YFCA 3CYTI 3O20A 1GIWA 2AI5A 2V07A 1BE3D 1QN2A 1DVHA 2N9IA 4EIFA 1KIBA 2HV4A 2D0SA 1I6EA 3WFBC 3C2CA 1FOCA 1LC1A 4KMGA 4XXLA 3KHUA 1CSXA 2N3YA 2C2CA 3OA8B 1CIEA 4FB1A 1NTMD 1GKSA 1CIFA 4WQ8A 2O3JA 5DJQC 3NBTA 2BLFB 1DW3A 1E29A 2L91A 3ZOYA 2GB8B 3L73D 2ZXYA 2FWLA 4L3HA 1L0ND 3OCDB 4Q5PA 5KAFV 4WQDA 1CYIA 1EB7A 4EIEA 2I8FA 3CX5W 4WQ9A 2AIUA 1B7VA 1ZRTD 1CXCA 1I54A 5CIHB 1H31B 1CXAA 3PHLA 1BGYD 3PRJA 1KYOD 2PCCB 1EZVD 2EXVA 2CE0A 3SJLA 4YE1A 1H9XA 2ZBOA 2FYNB 3CU4A 2VHDA 3A0HV 5B66V 1CRIA 1DVVA 1PPJD 3NBSA 1KB0A 3HQ7A 2BCCD 3VNWA 4L3GA 4Y5RA 1RZ5A 2OZ1A 1DW0A 5TISV 3H1ID 1BL9A 1KV9A 5DFSA 2JWAA 3CXHW 2DVHA 3DMIA 4AAOA 1N50A 4FA4A 2BGVX 1KX7A 2FYUD 2C1VA 3PXWA 5TJHA 3JBTB 2RN0A 3VMAA 1IQCA 1NMLA 2BCNB 4EDFA 2FRCA 3CWBD 1LC2A 1I5TA 5KAIV 1W2LA 1QL3A 1U74B 3H1KD 1FI9A 4GEDB 2N18B 1CRCA 4N0KA 1RAPA 2GC7D 1GU2A 5AURA 4WQEA 3L70D 1W5CT 4FANA 1CTYA 3OCDA 1YICA 1C6OA 1U75B 3VYMA 5DF5A 5CIFB 2BPBB 1FI3A 3ZOOA 1IRWA 3WFDC 1CSUA 2C8SA 5GTIV 1I55A 1BCCD 1OAEA 3OA8A 2RMZA 3O5CA 2OZ1B 3PLNA 1CRHA 3H1HD 1IZL0 5DJQB 3DR0A 1C6RA 3SXTA 1LS9A 3ZIYA 2Q3EA 2Y0EA 1CO6A 1CHHA 3M97X 3TDKA 2ZOOA 4AX3A 1A2SA 1CRYA 1WEJF 1ETPA 5H2FV 4PWAA 1CRJA 4DY9A
chains in the Genus database with same CATH superfamily
1W5CE 5KLIB 3WC8A 2K1AA 1HTLC 2M0BA 4WWIA 3O6QB 1CEDA 1KILC 4EIDA 1Q7YQ 2GC4D 3BATA 1K3GA 3SVWA 1J2JB 1U7JA 1S72P 5KLVK 3GHGB 1GDTA 2Q6QA 3GF7A 1SP4A 1PPJE 1EZVG 1NAFA 3BCCD 3A0BH 3CWBE 3SWYA 1IFDA 3HE5B 1LWUC 4BXLA 4EYYQ 5CIGB 4NFGB 4H13C 1GL2D 4AAMA 1H89A 1UIXA 1SQXE 5APUA 4U3FE 3OAKA 1GW4A 2M8RA 2YKQA 2GIWA 2JR8A 1S5LH 1BDCA 5AW8B 2O01H 1EDIA 2H7HA 3V4WA 1PP9E 5AW0B 3B5ND 1LTSC 3BRVB 4I7ZB 2PCBB 2LR2A 1T3JA 2AEMA 1NWQA 5AVYB 1YEBA 4XA4A 1H32A 1Z56A 3CI9A 4H0LD 1USDA 2YO3A 2Y0DA 3EFFK 4IFMA 4NPDA 4C7NB 1OW7A 2I1KA 3RK2B 2A06D 4XYDB 4H13B 5B6QA 2IZ1A 2AXTE 1P84I 3O0RC 2MKVA 1HROA 4LC1A 3A0BE 3FWLA 1HF9A 5C0ZA 5DJUB 1I6DA 3CX5D 2OYIA 2CE1A 1LTJC 2FYZA 2QJPB 3C9IA 1YIQA 5EFWB 2P10A 1NU1D 1MUUA 2N1TC 1Q90D 3MGNA 1CYJA 1T8ZA 1AOQA 3CCRP 1KQLA 2D2CB 4D6TE 3ITKA 3CXHE 5KLVJ 1PP9G 3F89A 3EFGA 5GTHV 3AE4C 1Q2NA 2DGEA 4P4QB 2ZFCA 1FDOA 1GL2C 3IFMA 3RMZA 2RH0A 1A56A 1EDLA 3L72J 2V4HA 1HJ3A 1GDVA 1SQXG 2W6BA 2W83C 3L36A 5APTA 2XNDH 1F1CA 2HYNA 3L71G 1GU4A 3QH9A 1HRCA 3CXHH 1AV1A 2OYHC 3KZIV 1OW6A 3PP5A 3RL0B 2VRSA 3L73J 1IK9A 1GZLA 1VL2A 2IYOA 4FAVA 4UB8V 4OGQC 4ASVA 2OARA 3NFQA 1NU1G 1MZ9A 3L73E 4ZKUA 2E75D 1J1DC 1CIGA 1ZXGA 1NTMJ 155CA 2ORLA 2AXTV 2QM7A 3VN0A 1KZUB 2KLUA 1N73C 1PPJG 2JQRA 1VQ7P 1N7SA 1NTME 3P8CE 3HQ6A 1N15A 4KHXA 2XNXA 1YIJP 3RGUA 1DIQC 2ZXXA 4XFJA 1KB9E 2C9NY 1QVGO 1KV4A 3MTUE 1OWAA 1BE3J 1RAQA 5KLVE 3FXDA 1RQVA 1SQXK 2W6JH 2IPPA 1KILD 2HPCB 2R32A 4C7RA 1FZFA 2E75B 1SQPD 4PD4H 5CIEB 1CI6B 5CICB 2KIKA 1Q86Q 1SQVD 3H1KJ 3D6ZA 4I6MC 3OA7A 1X9VA 1CNOA 4EOTA 1EDJA 3C1LA 1CIHA 3CCVP 4JCGA 3VRDA 2E74D 1OVVA 3O1YA 5K5GB 4WY4A 5EXQA 3FX0A 3O20A 1XTGB 2QSIA 5APVA 2FBWC 2PRRA 3IAOA 2HV4A 1EXIA 2D0SA 3WFBC 1GW3A 1IFJA 4XXLA 4W7ZA 2K37A 2ZXEB 3AEBC 3CMAP 1KYOI 3AEAC 4FB1A 1ZW0A 1GKSA 1CIFA 5CCHA 4WQ8A 5DJQC 1NJIQ 3C8VA 2BLFB 1LT9C 1SQQK 2ZXYA 3L74G 3CMEP 2PP6A 1W2BO 3JCUE 1FZCB 3OCDB 4Q5PA 3GHGA 4H13D 1CYIA 3RK3B 4EIEA 2I8FA 1AQTA 2AIUA 1NTZJ 3HD7C 1I54A 5C39A 1OMIA 3H32A 3U59A 1KYOD 2W6AA 1EZVD 2EXVA 2E76D 4H0LB 2HLOA 1AVOA 2FYUE 1U7MA 1SQBJ 2N1TB 2Y9ZA 2VHDA 5B66V 1CRIA 1EZVE 3NBSA 1KB0A 4JPZB 3U1CA 2D2CD 3CCMP 1NTKE 3EQ2A 1VQPP 3VNWA 3H1HE 4N3YB 1JMMA 1HBWA 2OZ1A 4HYTB 5TISV 2GUVA 3L75E 5CBOA 2GUSA 2WPSA 2M3EA 1IO4A 3DMIA 3A0HE 1JY3N 3E1RA 2FYUD 1LTAC 2C1VA 5TJHA 1KQFB 1EZVI 2RN0A 2BCNB 3L75J 1KC8Q 2FRCA 1LNQA 4MN4C 1AFOA 1NU1E 1I5TA 2E74C 1W2LA 1U74B 3H1KD 1QX8A 1IC2A 1A02J 1J1DB 1FI9A 2YMYA 4IL6X 2FXMA 1AVYA 2HODB 1RAPA 1GU2A 1NU1J 5KJ7D 4WQEA 5CCHD 1RE3C 1NGMB 1JY3P 4I7ZC 1BGYG 3F5HA 1EQ7A 3L71E 3H1IJ 3G6EP 4WB4A 1NHLA 2H89C 1FI3A 2KXPB 1NTMK 2C8SA 4BRYA 2WQYC 1BCCD 4W7YA 3MIWA 2Y9YA 3O5CA 2OZ1B 1VQNP 1CRHA 1RE4C 3ZIYA 3TK1A 2Y0EA 2AEJA 1JCCA 1LWUB 4GOEA 1SQBE 4CPGA 3M97X 3TDKA 1YJ9P 2Q5UA 1YJNP 3HD7D 2PGDA 1S9KE 4WY4B 5CHXA 4PWAA 1NTZK 4DY9A 1NTKJ 4K3IA 1L0NG 1KX2A 4IFFA 1VF5B 1PP9D 1H1OA 3GHGC 3M0DC 2OYOA 2QG4A 4UB8H 4ZKPA 351CA 3VMZA 3ZDMA 1KILB 1EXJA 3Q1MA 4OH8B 3CCEP 2QJYB 2HPCA 4H44C 3RK3C 3RK2D 1H0TB 3GMAA 4N6JA 1DX7A 1G2CA 4H0KA 1ZMEC 2Y0CA 2HODA 1S3JA 1YQ3C 4GT1A 1I8OA 1QYZA 1K73Q 1LTBC 1C7MA 2WITA 3VMXA 3WMM0 5CCHC 3CWBG 3IN6A 2KS1A 3NTNA 2C9XB 3WFEC 2WT7A 1JB0J 1LTJB 2WMMA 5TISH 4AANA 3I55P 1YJWP 4HKZH 1CHJA 3RN0A 3V2RA 2QIWA 2MTAC 2KK7A 2XU6A 1GK4A 2CPBA 4MU8A 3TNUA 3PH2B 1LTJA 5AW1B 1H32B 1QKSA 5KLVD 4U3FJ 1SQQJ 1NTKK 2XDJA 1YHQP 1S5LV 3MK7B 3MHVA 1J1EC 5DJTB 2ZVNB 1N73A 1C2RA 3GF3A 4NPFX 3GG2A 3H1HG 4FA9A 1RZ6A 3LIEA 2B87A 3RBXA 3R4YA 5AVQB 1R5LA 1ZR2A 2JTIB 1PV3A 2OYHB 3CCJP 1RE3A 1YITP 2ZYGA 1KB9H 2M5AA 2OYIC 2MHMA 1LP1A 2WSCH 2A45H 4ASWA 2WSSH 1BGYJ 2B4ZA 1QL4A 1LFMA 3R2PA 4K35A 1VPCA 1WVEC 1JEKA 3RLMA 5AVZB 5B5EH 1XTCC 1RE4A 2O1KA 5KTBA 1S1CX 5E79E 3I5CA 2CA4B 2BCCJ 4OGQB 5AVUB 2POHA 2IBZI 2C1UA 1R0QA 1FI7A 1AYGA 2BEQD 1NMIA 1VDFA 3V2QA 4C7NA 1FZBA 2NZ2A 1PFIA 1I8PA 3TYIA 3V2PA 1HZVA 2C1DA 2M5AB 2BH5X 2WPVB 2O01N 3KQGA 4HJGH 1CCRA 3ZOWA 3DP5A 1SFCC 3S9OA 3BASA 1IRVA 1HJ4A 2KS1B 1L4AC 1L0LD 2CPSA 4W80A 4PD4D 1ZRTE 2QM8A 1JNMA 1LT9B 3L70J 2G8YA 3P8CD 2OYIB 4WY4D 1N73B 1VYDA 1LT9A 5M1BA 1T2KC 2IBZD 2JO1A 3S1KA 1WRGA 2W90A 5AW3B 4XE5B 5KLVG 2BH4X 3H1JG 2XV5A 1URQA 3ABVC 1MG3D 1MZ4A 2UWJE 2C1DB 1FJ0A 1R5SA 1RQUA 1YTCA 1CSVA 2N3BA 2FXOA 3H1LE 3GW6A 2ZT9C 1NAYA 2AXCA 2N1TD 4HB1A 4Y28J 2IYPA 1N86A 1J3SA 3G3ZA 4RO0A 2B11B 1S2EA 1M6ZA 4IFDK 1KQSO 2LXBA 1CTJA 2AXTH 1AOFA 2RKLA 2P67A 2WTYA 4A7PA 3WFCC 4GODA 1GIWA 2AI5A 1QN2A 1DVHA 1P84E 4EIFA 3T97B 5B66H 3D71A 2QEXP 1FOCA 2QA4P 3KHUA 1CSXA 1FDIA 2C2CA 2WZ7A 3HUSC 3SWFA 2E43A 1CIEA 1OW8A 4Y99C 4BRYB 1NTMD 4JQ0D 2KNCA 1SQPK 1IK7A 2H88C 3TGUJ 2FYUG 1SQPE 3NBTA 3G9RA 1BSHA 1DW3A 3ZOYA 2YNYA 4GDOA 2FWLA 1L0ND 1JUNA 1KILA 1AA0A 4JBZA 1EB7A 1L4AD 1URQD 2Q7CA 3L37A 4LGDE 3WUTA 4JYBA 3V5BA 1VQ4P 3AE8C 3CCQP 4IL6E 2WPQA 1H31B 3PHLA 1PZQA 3A7OA 3PRJA 2PCCB 2CE0A 2IX7C 2XZRA 4YE1A 3M91A 2ZBOA 5AVVB 1SLQA 4QMAA 3BCCE 3H1IE 1IZNB 5KAIH 3WU2H 1WMKA 2QJPC 1SQVE 1RZ5A 3P7KA 1DW0A 1GU5A 3H1ID 1BL9A 4IL6H 5DFSA 2NPSD 4PV1B 2FFDB 2DVHA 1LTIC 1N50A 5GTIE 1NTZG 1KYOH 1NYHA 5APWA 3JBTB 3VMAA 1IQCA 1VQ5P 4UB6H 2P2UA 1VQOP 3K5BA 1ZOYC 4H44B 4GEDB 4N0KA 1VQMP 1PGPA 3RBZA 1W5CT 2GA1A 5CCGD 1PIXA 5B66E 1PL5A 3VYMA 1M7LA 1KILE 3HE4B 1PP9J 3ZOOA 2I8DA 1CSUA 2KB7P 3M9BA 1RF1A 2FFDA 1NOHA 1HVVA 2A45G 3FXEA 2FFDC 1N7LA 3OA8A 4PD4I 1JTHB 1BCCE 4AUWA 3PLNA 1X8YA 5DJQB 3H6PA 3DR0A 3B5NA 1C6RA 1BDDA 2K3RA 3HUSA 1MFZA 2HR3A 2Q3EA 2C0XA 4OGQD 1K8AQ 3OW2O 4HH2A 4H44D 2FY8A 5AW2B 1A02F 2ZOOA 1A2SA 1CRYA 2E75C 3WUUA 3L73G 2KZJA 1FOSF 1N7SD 3H32B 1HZUA 1CRGA 1ZR4A 3L71J 1FCDC 2H8PD 1T2KD 1FAVA 1LGHB 4RJTA 3P32A 2AEFA 2B9BA 1NH4A 2J59M 1PGJA 4Z1MH 1WT6A 3MUDC 1LMSA 3H25A 4OVNF 1L4AB 5CCGA 1DH3A 1SQXD 4I2LC 2IZ0A 1C75A 1CW5A 1QL2A 1M60A 2OYHA 1CHIA 2ZT9D 5KAFH 5AW9B 1VQ9P 3V4QA 4L75A 1S5LX 1H9YA 3M0DA 3NXSA 3A5TA 4GIFA 1DEBA 4WQCA 3W68A 1N90A 3JSVC 4PJ0V 2W8ZA 3IF4A 3S4RA 1SQQD 1X0TA 1YNRA 3WU2E 1NTZD 5H2FE 1NIRA 4LLHA 1YCCA 1IFIA 2YMKA 1OVRA 5APSA 4FA5A 3Q5PA 3TGUG 2K9JA 1NVOA 3CX5H 2JEEA 1CORA 1YQ4C 1FDMA 1AKKA 1HCMA 3PH0A 2WSEH 1D7MA 3N7NA 3L4FA 1AQ5A 1SFCA 2WSFJ 1NTKD 1URQB 2YCCA 1GK6A 4OWFA 1F1FA 2WT7B 1MG2D 1KMIZ 1CTZA 3TYYA 2WSCJ 3QWOC 1H31A 2Z5IA 1HJ5A 1IFNA 3CP5A 3AE3C 2OGUA 1JCDA 2IFNA 3CC7P 5GTHE 2B10B 1SQQG 2YXRB 2K9YA 2V7QJ 5E79V 5AW7B 3AE7C 1E2RA 1L0LE 3CCUP 1LTTC 1FS0E 2LITA 5B5EV 1DW1A 3HTKB 2N18C 5KKZB 3ORVA 2KNCB 2BEZF 3ZBMA 2H43A 3SFDC 3L72E 2XTSB 1CCHA 1KB9I 1M8OB 2N9JA 1JY2P 1IFMA 4GKGA 2Z5HA 3T97A 1URQC 4L76A 1SFCD 4L74A 3H1KE 3CXHI 3X39A 3H1JD 3CC4P 451CA 1A8CA 1K9MQ 1DIPA 3AECC 1G1JA 5CJ0A 2WPRA 1JOCA 1SQPG 2QJKC 1LWUA 2FXPA 1BGYE 1EDKA 3LIDA 1JO5A 3CCLP 1K04A 4U3FD 1VQKP 3CLQA 4UB6E 1HJBA 2Q1KA 2ZZS1 3L4OA 2J58A 3TGUD 3AEGC 3CXHD 1ZP0C 2ZVOB 4YXWH 1FHBA 2J5UA 5CMZA 2E5TA 1GJQA 3CPWO 4IOIH 4WQBA 4J20A 2A06G 1YEAA 1KYOW 1P84D 1U57A 3E7KA 1RF0A 5CCGC 4EICA 3AEDC 1VF5C 1CC5A 2FYUJ 3PJSK 2ZJSE 1JDLA 3L75D 4WVZA 3H1KG 3L4MA 1ZN5A 2M3BA 3KDPB 1HH7A 4YPCA 1JY3O 1SVFA 3TSIA 2P7JA 4PJ0E 4IL6V 1KQGB 1ZZHA 5AVSB 4L1QA 4O1QA 4H0JA 5KAFE 3D0WA 3HRNA 2LXCB 1DW2A 3LW5H 2ZAEB 2V07A 1H8AA 1QEXA 3AEFC 1GD2E 2N9IA 3HUSB 1M1JB 1KIBA 4B86A 1FJKA 1I6EA 1JY2N 2R5BA 3C2CA 1LC1A 4KMGA 2B89A 2N3YA 3BCCJ 3KZIE 3OA8B 3RL0g 4ZNCA 5CJ4A 3UIAA 4DJGA 4EI2A 2ITAA 1KN7A 3D6YA 2MJZA 3AEEC 2L91A 2R5DA 3L73D 1L4AA 4RESB 2Q9IA 1NTZE 2A06E 2C0WA 1CSBA 3AE2C 3SSUA 2HFED 1FZAA 2OQQA 1B7VA 1YI2P 4TLFA 3L70G 5CIHB 3O6QA 3TGUE 1CXAA 1BGYD 2E42A 1BE3E 1H9XA 3D70A 3JC22 3L74J 2FYNB 3CU4A 3A0HV 2L5GB 2NRGA 3Q3DA 1OXZA 1GL2A 3B5NB 2W27A 2KLVA 2BCCD 4L3GA 3Q5RA 1QLED 1FZEA 1KD1Q 5BVZA 1KV9A 2IBZG 4YXDC 3VOPA 1HH0A 4FA4A 5CBNA 3CC2P 2BGVX 1IFPA 3PXWA 2YKOA 3JCUH 1KYOE 4EDFA 1HGZA 3P8MC 5KAIV 1SQVJ 1NU1K 1QL3A 2YXQB 3M9QA 4WBAA 2N18B 4N78E 5GTIH 5KKZC 1CRCA 2OTKE 2QE7H 1H88A 2Q3IA 1Q81Q 1X22A 3L70D 1YBKA 3EWKA 4N78D 1H0TA 2ZT9B 3CX5E 5E79H 1N7SC 1C6OA 2DW3A 1U75B 2O01J 3MZWB 2BPBB 3VTPC 1JMBA 2PFXA 3WFDC 1BE3G 5GTIV 3CWBJ 2V7QH 2LKMA 5KJ7C 4EIJA 3L72G 1Y9BA 3MP7B 4R4LA 3SXTA 1M1JA 4R4MA 1LS9A 3KPEA 1EC5A 1CHHA 1SQBK 5KJ7A 4AX3A 3LW5J 1WEJF 1ETPA 5H2FV 1M1JC 1SQQE 3Q2YA 2IDBA 2G3AA 3II6A 3U1AA 1JTHA 2JWDA 2WWWA 3KXDA 1GMJA 1COTA 3I56P 4LJIA 1FZCA 3HQ9A 1RF1B 1LP1B 4WY4C 3V6IA 2KSJA 1NNOA 3TF5A 1FOSE 1DT1A 3HTKA 1N8RQ 1KB9D 1OVUA 3SWSA 1M70A 3SWKA 3WUIA 3G4SP 3M06A 2ZYDA 3A0HH 3A2AA 1JM0A 3N4XA 4L73A 3MUDA 1YYCA 1E8EA 3RN1A 1C6SA 1E5WA 4FA1A 2QVAA 5C9MA 2JP3A 4WQAA 1H33B 3E1IA 2B12B 1SQXJ 5BU5A 5CIDB 3W67A 3KZIH 1L0LJ 1T3UA 3PXTA 5CIBB 4D6TJ 3H1LD 2E5YA 3VP8A 3USSA 4KJMA 5CYTR 4O1WA 2CA3B 1JY2O 2R3CA 1L9JC 2WSFH 2KSEA 2SPZA 3OJAB 4BWNA 2CXBA 5AW5B 4UB6V 1BSNA 1K05A 3B5NC 4Y99B 4AQRD 5BU8B 1H33A 1OCDA 3L71D 2QRXA 2CK3H 1DIIC 4U7JA 2ZONG 1LTGC 2WVRA 3L75G 2IBZE 4PJ0H 1BCCG 3FWNA 3AE1C 1K3HA 3SFEC 4TT3H 3L72D 1PGOA 5AW6B 4AALA 1M57D 2KOGA 1N7SB 5APQA 1CYCA 3RL0D 5KAIE 4YTPC 3BRTB 5B5EE 1HJ0A 3PTZA 3MK7C 3A9FA 3VYIA 4AYCA 3SLEA 2D0WA 1PGQA 1USEA 4JF7A 3BVHA 1RHZB 3KYQA 1MFTA 1RF0C 3FGAD 1Q82Q 2Z4EA 2E74B 2JKVA 3H1LG 2L4DA 2JJLA 1FC2C 3Q5SA 1IO3A 1SS1A 1VQLP 2BCCE 2PAJA 1NTKG 3MD0A 2YK3A 5AVXB 2NPSC 3B8EB 4RSZA 1CZQA 3RK3E 1S4XA 3AE9C 3A3YB 2B0ZB 2KYVA 1SFCB 5APXA 1RH5B 4PV1C 1HGVA 5AVWB 2N9BA 3PXSA 1C52A 1L9BC 2YO2A 1QVFO 1SQVG 1L0NJ 1QGKB 4C46A 5IY51 1CI6A 2YKPA 1MV8A 1J1EB 1P84H 3ZCFA 3A0BV 2K9JB 4ZMDA 3AE5C 2K88A 1L0NE 4GYDA 2N9YB 4WQ7A 1R8EA 2BASA 2XKMA 1FZGA 2V08A 4NPEA 3WU2V 4K3AA 2R44A 1CSWA 4D6TD 1QL1A 3V2NA 1C2NA 2YQBA 2B87B 1DEEG 2E76B 1GQ1A 4RKUJ 1FE6A 3H1IG 3HQ8A 1HUCA 1MKMA 3NMDA 1OIPA 3B71A 1N9CA 4PW9B 4I1LA 1YTZI 1ZV8A 1S6VB 3RK2C 3RK3D 3NWVA 5AVTB 3ZOXA 1IJDB 1SQVK 3IR9A 2PACA 4H0LC 5GTHH 2P1JA 3WUVA 2FKWB 3TNUB 1SQBD 4QAOA 3L74D 2KUBA 1LT1A 2LIRA 2YIUB 4DZOA 5L8RJ 1LJ2A 4V2KA 4O9BA 3O8ZA 1DD3A 4U3FG 1X79B 2WSEJ 3CCSP 1GL2B 1FJPA 2P58A 2QJKB 1YFCA 1KTMA 3CYTI 1TU3F 1BE3D 4UB8E 1OX3A 2IFMA 3CD6P 1SQPJ 1L2PA 1M1KQ 3M0AA 2I1JA 1N2DC 1G2CB 4JYCA 1NKZB 3H1HJ 2FYNC 5H2FH 2O3JA 2NPSA 1M90Q 4DOJA 2HG5D 1E29A 2GB8B 3B4SA 3L70E 4KT0J 4L3HA 1Y47A 1M56D 3VMYA 5KAFV 1KFMA 4WQDA 1YTZT 3CX5W 4WQ9A 2A45I 4GOFA 1ZLLA 4PD4E 1ZRTD 1CXCA 1KORA 2YIUC 1BCCJ 3L35A 4DT0A 5AVRB 2OTLP 3H1JE 2B88A 3SJLA 5KLIC 1L0LG 1RF1C 3CX5I 4D6TG 1E79H 1DVVA 1PPJD 1AJYA 2QJYC 3H1JJ 1T6AA 3H1LJ 3HQ7A 3M9HA 3GLMA 4Y5RA 1S5LE 1OFCX 4M3LA 1L0LK 1FZCC 1Y8AA 2O1JA 2FYUK 3HD7A 2JWAA 3CXHW 4AAOA 1VF5D 3L74E 1KX7A 1NMLA 3HE4A 2N1TA 3CWBD 1W2EA 1LC2A 1DD4A 1SQBG 2E76C 1HWTC 3CL3D 1RY3A 1GTWA 2KZIA 2GC7D 1G1IA 5APYA 5AURA 1FU1A 5TISE 2D2CC 2KP8A 4FANA 1L0NK 2KI7B 1UIIA 1CTYA 3OCDA 2ZYAA 2JDIH 1VQ6P 1YICA 3BCCG 3HE5A 3AE6C 3RL0C 5AW4B 5DF5A 2C9LY 5CIFB 1OZHA 1FBMA 1IRWA 2NPSB 4PV1D 2GM4A 1I55A 3HD7B 2BCCG 2OTJP 1OAEA 4DCKA 3VP9A 2RMZA 3H1HD 1IZL0 1KFNA 1VQ8P 1NTMG 1NKNA 2R3SA 1CO6A 1S9KD 3G71P 1NO4A 1CRJA
chains in the Genus database with same CATH topology
4K3IA 5KLIB 3WC8A 1KX2A 1HZUA 1PP9D 1CRGA 1H1OA 1CEDA 1FCDC 4EIDA 4RJTA 2GC4D 2QG4A 351CA 1K3GA 3SVWA 1COTA 4LJIA 3HQ9A 1LMSA 3BCCD 1SQXD 2QJYB 1NNOA 3TF5A 1C75A 1DT1A 5CIGB 1KB9D 1M60A 4NFGB 3SWSA 1M70A 4AAMA 3WUIA 1CHIA 4H0KA 1H9YA 2Y0CA 2GIWA 4WQCA 1N90A 1E8EA 3RN1A 4PJ0V 1C6SA 1I8OA 1QYZA 4FA1A 1SQQD 1YNRA 1NTZD 1C7MA 5C9MA 4WQAA 1NIRA 2KS1A 1H33B 2PCBB 1YCCA 2C9XB 3WFEC 2B12B 4FA5A 5CIDB 1YEBA 1H32A 1CORA 3PXTA 2Y0DA 5CIBB 1AKKA 4AANA 3H1LD 1CHJA 3RN0A 1HCMA 5CYTR 4O1WA 2MTAC 2A06D 2CA3B 1L9JC 4XYDB 4MU8A 3PH2B 1H32B 1QKSA 1NTKD 2YCCA 5B6QA 1F1FA 5KLVD 1MG2D 2CXBA 4UB6V 3O0RC 1H33A 1OCDA 3L71D 1HROA 1CTZA 3FWLA 1DIIC 1H31A 2ZONG 1HJ5A 5C0ZA 3CP5A 1I6DA 1S5LV 3MK7B 3CX5D 1K3HA 3L72D 1C2RA 4AALA 3GG2A 4FA9A 2CE1A 1RZ6A 2QJPB 2B10B 1YIQA 1CYCA 1NU1D 5E79V 2JTIB 1CYJA 1AOQA 1E2RA 2LITA 5B5EV 3PTZA 1DW1A 3ITKA 2N18C 5KKZB 3ORVA 3MK7C 2KNCB 3A9FA 3ZBMA 3SLEA 2D0WA 5GTHV 2MHMA 2XTSB 1CCHA 2DGEA 4P4QB 2N9JA 2L4DA 3RMZA 1A56A 1QL4A 2B4ZA 1LFMA 1IO3A 1HJ3A 1WVEC 1GDVA 2YK3A 3RLMA 1F1CA 3X39A 4RSZA 3H1JD 451CA 1HRCA 1A8CA 2CA4B 2B0ZB 3KZIV 2C1UA 1R0QA 1FI7A 3PXSA 1C52A 1L9BC 4FAVA 1AYGA 4UB8V 1NMIA 5IY51 1I8PA 3TYIA 4U3FD 1HZVA 3ZCFA 2C1DA 2BH5X 3A0BV 2K9JB 1CCRA 3ZOWA 3DP5A 4GYDA 1CIGA 2N9YB 4WQ7A 1IRVA 1HJ4A 155CA 1L0LD 2ZZS1 2V08A 2ORLA 2AXTV 3WU2V 3L4OA 3TGUD 3CXHD 1CSWA 4D6TD 4PD4D 2JQRA 1C2NA 1FHBA 2YQBA 3HQ6A 1N15A 1GJQA 1GQ1A 1VYDA 4WQBA 4J20A 3HQ8A 1DIQC 2IBZD 1YEAA 1KYOW 1P84D 1N9CA 4PW9B 4EICA 1S6VB 3NWVA 2BH4X 3ZOXA 1CC5A 1RAQA 1MG3D 1MZ4A 2PACA 1JDLA 2C1DB 1FJ0A 3L75D 1SQBD 1SQPD 3L74D 4QAOA 3L4MA 1YTCA 1CSVA 2N3BA 5CIEB 5CICB 2LIRA 2YIUB 1HH7A 1SQVD 3GW6A 4V2KA 4IL6V 1J3SA 1CNOA 2B11B 1M6ZA 1ZZHA 1CIHA 4JCGA 3VRDA 1CTJA 4L1QA 4O1QA 4H0JA 1AOFA 3O1YA 4A7PA 5EXQA 3WFCC 1DW2A 2QJKB 1YFCA 3CYTI 3O20A 1GIWA 2AI5A 2V07A 1BE3D 1QN2A 1DVHA 2N9IA 4EIFA 1KIBA 2HV4A 2D0SA 1I6EA 3WFBC 3C2CA 1FOCA 1LC1A 4KMGA 4XXLA 3KHUA 1CSXA 2N3YA 2C2CA 3OA8B 1CIEA 4FB1A 1NTMD 1GKSA 1CIFA 4WQ8A 2O3JA 5DJQC 3NBTA 2BLFB 1DW3A 1E29A 2L91A 3ZOYA 2GB8B 3L73D 2ZXYA 2FWLA 4L3HA 1L0ND 3OCDB 4Q5PA 5KAFV 4WQDA 1CYIA 1EB7A 4EIEA 2I8FA 3CX5W 4WQ9A 2AIUA 1B7VA 1ZRTD 1CXCA 1I54A 5CIHB 1H31B 1CXAA 3PHLA 1BGYD 3PRJA 1KYOD 2PCCB 1EZVD 2EXVA 2CE0A 3SJLA 4YE1A 1H9XA 2ZBOA 2FYNB 3CU4A 2VHDA 3A0HV 5B66V 1CRIA 1DVVA 1PPJD 3NBSA 1KB0A 3HQ7A 2BCCD 3VNWA 4L3GA 4Y5RA 1RZ5A 2OZ1A 1DW0A 5TISV 3H1ID 1BL9A 1KV9A 5DFSA 2JWAA 3CXHW 2DVHA 3DMIA 4AAOA 1N50A 4FA4A 2BGVX 1KX7A 2FYUD 2C1VA 3PXWA 5TJHA 3JBTB 2RN0A 3VMAA 1IQCA 1NMLA 2BCNB 4EDFA 2FRCA 3CWBD 1LC2A 1I5TA 5KAIV 1W2LA 1QL3A 1U74B 3H1KD 1FI9A 4GEDB 2N18B 1CRCA 4N0KA 1RAPA 2GC7D 1GU2A 5AURA 4WQEA 3L70D 1W5CT 4FANA 1CTYA 3OCDA 1YICA 1C6OA 1U75B 3VYMA 5DF5A 5CIFB 2BPBB 1FI3A 3ZOOA 1IRWA 3WFDC 1CSUA 2C8SA 5GTIV 1I55A 1BCCD 1OAEA 3OA8A 2RMZA 3O5CA 2OZ1B 3PLNA 1CRHA 3H1HD 1IZL0 5DJQB 3DR0A 1C6RA 3SXTA 1LS9A 3ZIYA 2Q3EA 2Y0EA 1CO6A 1CHHA 3M97X 3TDKA 2ZOOA 4AX3A 1A2SA 1CRYA 1WEJF 1ETPA 5H2FV 4PWAA 1CRJA 4DY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3I A;  5KLI B;  3WC8 A;  1KX2 A;  1HZU A;  1PP9 D;  1CRG A;  1H1O A;  1CED A;  1FCD C;  4EID A;  4RJT A;  2GC4 D;  2QG4 A;  351C A;  1K3G A;  3SVW A;  1COT A;  4LJI A;  3HQ9 A;  1LMS A;  3BCC D;  1SQX D;  2QJY B;  1NNO A;  3TF5 A;  1C75 A;  1DT1 A;  5CIG B;  1KB9 D;  1M60 A;  4NFG B;  3SWS A;  1M70 A;  4AAM A;  3WUI A;  1CHI A;  4H0K A;  1H9Y A;  2Y0C A;  2GIW A;  4WQC A;  1N90 A;  1E8E A;  3RN1 A;  4PJ0 V;  1C6S A;  1I8O A;  1QYZ A;  4FA1 A;  1SQQ D;  1YNR A;  1NTZ D;  1C7M A;  5C9M A;  4WQA A;  1NIR A;  2KS1 A;  1H33 B;  2PCB B;  1YCC A;  2C9X B;  3WFE C;  2B12 B;  4FA5 A;  5CID B;  1YEB A;  1H32 A;  1COR A;  3PXT A;  2Y0D A;  5CIB B;  1AKK A;  4AAN A;  3H1L D;  1CHJ A;  3RN0 A;  1HCM A;  5CYT R;  4O1W A;  2MTA C;  2A06 D;  2CA3 B;  1L9J C;  4XYD B;  4MU8 A;  3PH2 B;  1H32 B;  1QKS A;  1NTK D;  2YCC A;  5B6Q A;  1F1F A;  5KLV D;  1MG2 D;  2CXB A;  4UB6 V;  3O0R C;  1H33 A;  1OCD A;  3L71 D;  1HRO A;  1CTZ A;  3FWL A;  1DII C;  1H31 A;  2ZON G;  1HJ5 A;  5C0Z A;  3CP5 A;  1I6D A;  1S5L V;  3MK7 B;  3CX5 D;  1K3H A;  3L72 D;  1C2R A;  4AAL A;  3GG2 A;  4FA9 A;  2CE1 A;  1RZ6 A;  2QJP B;  2B10 B;  1YIQ A;  1CYC A;  1NU1 D;  5E79 V;  2JTI B;  1CYJ A;  1AOQ A;  1E2R A;  2LIT A;  5B5E V;  3PTZ A;  1DW1 A;  3ITK A;  2N18 C;  5KKZ B;  3ORV A;  3MK7 C;  2KNC B;  3A9F A;  3ZBM A;  3SLE A;  2D0W A;  5GTH V;  2MHM A;  2XTS B;  1CCH A;  2DGE A;  4P4Q B;  2N9J A;  2L4D A;  3RMZ A;  1A56 A;  1QL4 A;  2B4Z A;  1LFM A;  1IO3 A;  1HJ3 A;  1WVE C;  1GDV A;  2YK3 A;  3RLM A;  1F1C A;  3X39 A;  4RSZ A;  3H1J D;  451C A;  1HRC A;  1A8C A;  2CA4 B;  2B0Z B;  3KZI V;  2C1U A;  1R0Q A;  1FI7 A;  3PXS A;  1C52 A;  1L9B C;  4FAV A;  1AYG A;  4UB8 V;  1NMI A;  5IY5 1;  1I8P A;  3TYI A;  4U3F D;  1HZV A;  3ZCF A;  2C1D A;  2BH5 X;  3A0B V;  2K9J B;  1CCR A;  3ZOW A;  3DP5 A;  4GYD A;  1CIG A;  2N9Y B;  4WQ7 A;  1IRV A;  1HJ4 A;  155C A;  1L0L D;  2ZZS 1;  2V08 A;  2ORL A;  2AXT V;  3WU2 V;  3L4O A;  3TGU D;  3CXH D;  1CSW A;  4D6T D;  4PD4 D;  2JQR A;  1C2N A;  1FHB A;  2YQB A;  3HQ6 A;  1N15 A;  1GJQ A;  1GQ1 A;  1VYD A;  4WQB A;  4J20 A;  3HQ8 A;  1DIQ C;  2IBZ D;  1YEA A;  1KYO W;  1P84 D;  1N9C A;  4PW9 B;  4EIC A;  1S6V B;  3NWV A;  2BH4 X;  3ZOX A;  1CC5 A;  1RAQ A;  1MG3 D;  1MZ4 A;  2PAC A;  1JDL A;  2C1D B;  1FJ0 A;  3L75 D;  1SQB D;  1SQP D;  3L74 D;  4QAO A;  3L4M A;  1YTC A;  1CSV A;  2N3B A;  5CIE B;  5CIC B;  2LIR A;  2YIU B;  1HH7 A;  1SQV D;  3GW6 A;  4V2K A;  4IL6 V;  1J3S A;  1CNO A;  2B11 B;  1M6Z A;  1ZZH A;  1CIH A;  4JCG A;  3VRD A;  1CTJ A;  4L1Q A;  4O1Q A;  4H0J A;  1AOF A;  3O1Y A;  4A7P A;  5EXQ A;  3WFC C;  1DW2 A;  2QJK B;  1YFC A;  3CYT I;  3O20 A;  1GIW A;  2AI5 A;  2V07 A;  1BE3 D;  1QN2 A;  1DVH A;  2N9I A;  4EIF A;  1KIB A;  2HV4 A;  2D0S A;  1I6E A;  3WFB C;  3C2C A;  1FOC A;  1LC1 A;  4KMG A;  4XXL A;  3KHU A;  1CSX A;  2N3Y A;  2C2C A;  3OA8 B;  1CIE A;  4FB1 A;  1NTM D;  1GKS A;  1CIF A;  4WQ8 A;  2O3J A;  5DJQ C;  3NBT A;  2BLF B;  1DW3 A;  1E29 A;  2L91 A;  3ZOY A;  2GB8 B;  3L73 D;  2ZXY A;  2FWL A;  4L3H A;  1L0N D;  3OCD B;  4Q5P A;  5KAF V;  4WQD A;  1CYI A;  1EB7 A;  4EIE A;  2I8F A;  3CX5 W;  4WQ9 A;  2AIU A;  1B7V A;  1ZRT D;  1CXC A;  1I54 A;  5CIH B;  1H31 B;  1CXA A;  3PHL A;  1BGY D;  3PRJ A;  1KYO D;  2PCC B;  1EZV D;  2EXV A;  2CE0 A;  3SJL A;  4YE1 A;  1H9X A;  2ZBO A;  2FYN B;  3CU4 A;  2VHD A;  3A0H V;  5B66 V;  1CRI A;  1DVV A;  1PPJ D;  3NBS A;  1KB0 A;  3HQ7 A;  2BCC D;  3VNW A;  4L3G A;  4Y5R A;  1RZ5 A;  2OZ1 A;  1DW0 A;  5TIS V;  3H1I D;  1BL9 A;  1KV9 A;  5DFS A;  2JWA A;  3CXH W;  2DVH A;  3DMI A;  4AAO A;  1N50 A;  4FA4 A;  2BGV X;  1KX7 A;  2FYU D;  2C1V A;  3PXW A;  5TJH A;  3JBT B;  2RN0 A;  3VMA A;  1IQC A;  1NML A;  2BCN B;  4EDF A;  2FRC A;  3CWB D;  1LC2 A;  1I5T A;  5KAI V;  1W2L A;  1QL3 A;  1U74 B;  3H1K D;  1FI9 A;  4GED B;  2N18 B;  1CRC A;  4N0K A;  1RAP A;  2GC7 D;  1GU2 A;  5AUR A;  4WQE A;  3L70 D;  1W5C T;  4FAN A;  1CTY A;  3OCD A;  1YIC A;  1C6O A;  1U75 B;  3VYM A;  5DF5 A;  5CIF B;  2BPB B;  1FI3 A;  3ZOO A;  1IRW A;  3WFD C;  1CSU A;  2C8S A;  5GTI V;  1I55 A;  1BCC D;  1OAE A;  3OA8 A;  2RMZ A;  3O5C A;  2OZ1 B;  3PLN A;  1CRH A;  3H1H D;  1IZL 0;  5DJQ B;  3DR0 A;  1C6R A;  3SXT A;  1LS9 A;  3ZIY A;  2Q3E A;  2Y0E A;  1CO6 A;  1CHH A;  3M97 X;  3TDK A;  2ZOO A;  4AX3 A;  1A2S A;  1CRY A;  1WEJ F;  1ETP A;  5H2F V;  4PWA A;  1CRJ A;  4DY9 A; 
#chains in the Genus database with same CATH topology
 1W5C E;  5KLI B;  3WC8 A;  2K1A A;  1HTL C;  2M0B A;  4WWI A;  3O6Q B;  1CED A;  1KIL C;  4EID A;  1Q7Y Q;  2GC4 D;  3BAT A;  1K3G A;  3SVW A;  1J2J B;  1U7J A;  1S72 P;  5KLV K;  3GHG B;  1GDT A;  2Q6Q A;  3GF7 A;  1SP4 A;  1PPJ E;  1EZV G;  1NAF A;  3BCC D;  3A0B H;  3CWB E;  3SWY A;  1IFD A;  3HE5 B;  1LWU C;  4BXL A;  4EYY Q;  5CIG B;  4NFG B;  4H13 C;  1GL2 D;  4AAM A;  1H89 A;  1UIX A;  1SQX E;  5APU A;  4U3F E;  3OAK A;  1GW4 A;  2M8R A;  2YKQ A;  2GIW A;  2JR8 A;  1S5L H;  1BDC A;  5AW8 B;  2O01 H;  1EDI A;  2H7H A;  3V4W A;  1PP9 E;  5AW0 B;  3B5N D;  1LTS C;  3BRV B;  4I7Z B;  2PCB B;  2LR2 A;  1T3J A;  2AEM A;  1NWQ A;  5AVY B;  1YEB A;  4XA4 A;  1H32 A;  1Z56 A;  3CI9 A;  4H0L D;  1USD A;  2YO3 A;  2Y0D A;  3EFF K;  4IFM A;  4NPD A;  4C7N B;  1OW7 A;  2I1K A;  3RK2 B;  2A06 D;  4XYD B;  4H13 B;  5B6Q A;  2IZ1 A;  2AXT E;  1P84 I;  3O0R C;  2MKV A;  1HRO A;  4LC1 A;  3A0B E;  3FWL A;  1HF9 A;  5C0Z A;  5DJU B;  1I6D A;  3CX5 D;  2OYI A;  2CE1 A;  1LTJ C;  2FYZ A;  2QJP B;  3C9I A;  1YIQ A;  5EFW B;  2P10 A;  1NU1 D;  1MUU A;  2N1T C;  1Q90 D;  3MGN A;  1CYJ A;  1T8Z A;  1AOQ A;  3CCR P;  1KQL A;  2D2C B;  4D6T E;  3ITK A;  3CXH E;  5KLV J;  1PP9 G;  3F89 A;  3EFG A;  5GTH V;  3AE4 C;  1Q2N A;  2DGE A;  4P4Q B;  2ZFC A;  1FDO A;  1GL2 C;  3IFM A;  3RMZ A;  2RH0 A;  1A56 A;  1EDL A;  3L72 J;  2V4H A;  1HJ3 A;  1GDV A;  1SQX G;  2W6B A;  2W83 C;  3L36 A;  5APT A;  2XND H;  1F1C A;  2HYN A;  3L71 G;  1GU4 A;  3QH9 A;  1HRC A;  3CXH H;  1AV1 A;  2OYH C;  3KZI V;  1OW6 A;  3PP5 A;  3RL0 B;  2VRS A;  3L73 J;  1IK9 A;  1GZL A;  1VL2 A;  2IYO A;  4FAV A;  4UB8 V;  4OGQ C;  4ASV A;  2OAR A;  3NFQ A;  1NU1 G;  1MZ9 A;  3L73 E;  4ZKU A;  2E75 D;  1J1D C;  1CIG A;  1ZXG A;  1NTM J;  155C A;  2ORL A;  2AXT V;  2QM7 A;  3VN0 A;  1KZU B;  2KLU A;  1N73 C;  1PPJ G;  2JQR A;  1VQ7 P;  1N7S A;  1NTM E;  3P8C E;  3HQ6 A;  1N15 A;  4KHX A;  2XNX A;  1YIJ P;  3RGU A;  1DIQ C;  2ZXX A;  4XFJ A;  1KB9 E;  2C9N Y;  1QVG O;  1KV4 A;  3MTU E;  1OWA A;  1BE3 J;  1RAQ A;  5KLV E;  3FXD A;  1RQV A;  1SQX K;  2W6J H;  2IPP A;  1KIL D;  2HPC B;  2R32 A;  4C7R A;  1FZF A;  2E75 B;  1SQP D;  4PD4 H;  5CIE B;  1CI6 B;  5CIC B;  2KIK A;  1Q86 Q;  1SQV D;  3H1K J;  3D6Z A;  4I6M C;  3OA7 A;  1X9V A;  1CNO A;  4EOT A;  1EDJ A;  3C1L A;  1CIH A;  3CCV P;  4JCG A;  3VRD A;  2E74 D;  1OVV A;  3O1Y A;  5K5G B;  4WY4 A;  5EXQ A;  3FX0 A;  3O20 A;  1XTG B;  2QSI A;  5APV A;  2FBW C;  2PRR A;  3IAO A;  2HV4 A;  1EXI A;  2D0S A;  3WFB C;  1GW3 A;  1IFJ A;  4XXL A;  4W7Z A;  2K37 A;  2ZXE B;  3AEB C;  3CMA P;  1KYO I;  3AEA C;  4FB1 A;  1ZW0 A;  1GKS A;  1CIF A;  5CCH A;  4WQ8 A;  5DJQ C;  1NJI Q;  3C8V A;  2BLF B;  1LT9 C;  1SQQ K;  2ZXY A;  3L74 G;  3CME P;  2PP6 A;  1W2B O;  3JCU E;  1FZC B;  3OCD B;  4Q5P A;  3GHG A;  4H13 D;  1CYI A;  3RK3 B;  4EIE A;  2I8F A;  1AQT A;  2AIU A;  1NTZ J;  3HD7 C;  1I54 A;  5C39 A;  1OMI A;  3H32 A;  3U59 A;  1KYO D;  2W6A A;  1EZV D;  2EXV A;  2E76 D;  4H0L B;  2HLO A;  1AVO A;  2FYU E;  1U7M A;  1SQB J;  2N1T B;  2Y9Z A;  2VHD A;  5B66 V;  1CRI A;  1EZV E;  3NBS A;  1KB0 A;  4JPZ B;  3U1C A;  2D2C D;  3CCM P;  1NTK E;  3EQ2 A;  1VQP P;  3VNW A;  3H1H E;  4N3Y B;  1JMM A;  1HBW A;  2OZ1 A;  4HYT B;  5TIS V;  2GUV A;  3L75 E;  5CBO A;  2GUS A;  2WPS A;  2M3E A;  1IO4 A;  3DMI A;  3A0H E;  1JY3 N;  3E1R A;  2FYU D;  1LTA C;  2C1V A;  5TJH A;  1KQF B;  1EZV I;  2RN0 A;  2BCN B;  3L75 J;  1KC8 Q;  2FRC A;  1LNQ A;  4MN4 C;  1AFO A;  1NU1 E;  1I5T A;  2E74 C;  1W2L A;  1U74 B;  3H1K D;  1QX8 A;  1IC2 A;  1A02 J;  1J1D B;  1FI9 A;  2YMY A;  4IL6 X;  2FXM A;  1AVY A;  2HOD B;  1RAP A;  1GU2 A;  1NU1 J;  5KJ7 D;  4WQE A;  5CCH D;  1RE3 C;  1NGM B;  1JY3 P;  4I7Z C;  1BGY G;  3F5H A;  1EQ7 A;  3L71 E;  3H1I J;  3G6E P;  4WB4 A;  1NHL A;  2H89 C;  1FI3 A;  2KXP B;  1NTM K;  2C8S A;  4BRY A;  2WQY C;  1BCC D;  4W7Y A;  3MIW A;  2Y9Y A;  3O5C A;  2OZ1 B;  1VQN P;  1CRH A;  1RE4 C;  3ZIY A;  3TK1 A;  2Y0E A;  2AEJ A;  1JCC A;  1LWU B;  4GOE A;  1SQB E;  4CPG A;  3M97 X;  3TDK A;  1YJ9 P;  2Q5U A;  1YJN P;  3HD7 D;  2PGD A;  1S9K E;  4WY4 B;  5CHX A;  4PWA A;  1NTZ K;  4DY9 A;  1NTK J;  4K3I A;  1L0N G;  1KX2 A;  4IFF A;  1VF5 B;  1PP9 D;  1H1O A;  3GHG C;  3M0D C;  2OYO A;  2QG4 A;  4UB8 H;  4ZKP A;  351C A;  3VMZ A;  3ZDM A;  1KIL B;  1EXJ A;  3Q1M A;  4OH8 B;  3CCE P;  2QJY B;  2HPC A;  4H44 C;  3RK3 C;  3RK2 D;  1H0T B;  3GMA A;  4N6J A;  1DX7 A;  1G2C A;  4H0K A;  1ZME C;  2Y0C A;  2HOD A;  1S3J A;  1YQ3 C;  4GT1 A;  1I8O A;  1QYZ A;  1K73 Q;  1LTB C;  1C7M A;  2WIT A;  3VMX A;  3WMM 0;  5CCH C;  3CWB G;  3IN6 A;  2KS1 A;  3NTN A;  2C9X B;  3WFE C;  2WT7 A;  1JB0 J;  1LTJ B;  2WMM A;  5TIS H;  4AAN A;  3I55 P;  1YJW P;  4HKZ H;  1CHJ A;  3RN0 A;  3V2R A;  2QIW A;  2MTA C;  2KK7 A;  2XU6 A;  1GK4 A;  2CPB A;  4MU8 A;  3TNU A;  3PH2 B;  1LTJ A;  5AW1 B;  1H32 B;  1QKS A;  5KLV D;  4U3F J;  1SQQ J;  1NTK K;  2XDJ A;  1YHQ P;  1S5L V;  3MK7 B;  3MHV A;  1J1E C;  5DJT B;  2ZVN B;  1N73 A;  1C2R A;  3GF3 A;  4NPF X;  3GG2 A;  3H1H G;  4FA9 A;  1RZ6 A;  3LIE A;  2B87 A;  3RBX A;  3R4Y A;  5AVQ B;  1R5L A;  1ZR2 A;  2JTI B;  1PV3 A;  2OYH B;  3CCJ P;  1RE3 A;  1YIT P;  2ZYG A;  1KB9 H;  2M5A A;  2OYI C;  2MHM A;  1LP1 A;  2WSC H;  2A45 H;  4ASW A;  2WSS H;  1BGY J;  2B4Z A;  1QL4 A;  1LFM A;  3R2P A;  4K35 A;  1VPC A;  1WVE C;  1JEK A;  3RLM A;  5AVZ B;  5B5E H;  1XTC C;  1RE4 A;  2O1K A;  5KTB A;  1S1C X;  5E79 E;  3I5C A;  2CA4 B;  2BCC J;  4OGQ B;  5AVU B;  2POH A;  2IBZ I;  2C1U A;  1R0Q A;  1FI7 A;  1AYG A;  2BEQ D;  1NMI A;  1VDF A;  3V2Q A;  4C7N A;  1FZB A;  2NZ2 A;  1PFI A;  1I8P A;  3TYI A;  3V2P A;  1HZV A;  2C1D A;  2M5A B;  2BH5 X;  2WPV B;  2O01 N;  3KQG A;  4HJG H;  1CCR A;  3ZOW A;  3DP5 A;  1SFC C;  3S9O A;  3BAS A;  1IRV A;  1HJ4 A;  2KS1 B;  1L4A C;  1L0L D;  2CPS A;  4W80 A;  4PD4 D;  1ZRT E;  2QM8 A;  1JNM A;  1LT9 B;  3L70 J;  2G8Y A;  3P8C D;  2OYI B;  4WY4 D;  1N73 B;  1VYD A;  1LT9 A;  5M1B A;  1T2K C;  2IBZ D;  2JO1 A;  3S1K A;  1WRG A;  2W90 A;  5AW3 B;  4XE5 B;  5KLV G;  2BH4 X;  3H1J G;  2XV5 A;  1URQ A;  3ABV C;  1MG3 D;  1MZ4 A;  2UWJ E;  2C1D B;  1FJ0 A;  1R5S A;  1RQU A;  1YTC A;  1CSV A;  2N3B A;  2FXO A;  3H1L E;  3GW6 A;  2ZT9 C;  1NAY A;  2AXC A;  2N1T D;  4HB1 A;  4Y28 J;  2IYP A;  1N86 A;  1J3S A;  3G3Z A;  4RO0 A;  2B11 B;  1S2E A;  1M6Z A;  4IFD K;  1KQS O;  2LXB A;  1CTJ A;  2AXT H;  1AOF A;  2RKL A;  2P67 A;  2WTY A;  4A7P A;  3WFC C;  4GOD A;  1GIW A;  2AI5 A;  1QN2 A;  1DVH A;  1P84 E;  4EIF A;  3T97 B;  5B66 H;  3D71 A;  2QEX P;  1FOC A;  2QA4 P;  3KHU A;  1CSX A;  1FDI A;  2C2C A;  2WZ7 A;  3HUS C;  3SWF A;  2E43 A;  1CIE A;  1OW8 A;  4Y99 C;  4BRY B;  1NTM D;  4JQ0 D;  2KNC A;  1SQP K;  1IK7 A;  2H88 C;  3TGU J;  2FYU G;  1SQP E;  3NBT A;  3G9R A;  1BSH A;  1DW3 A;  3ZOY A;  2YNY A;  4GDO A;  2FWL A;  1L0N D;  1JUN A;  1KIL A;  1AA0 A;  4JBZ A;  1EB7 A;  1L4A D;  1URQ D;  2Q7C A;  3L37 A;  4LGD E;  3WUT A;  4JYB A;  3V5B A;  1VQ4 P;  3AE8 C;  3CCQ P;  4IL6 E;  2WPQ A;  1H31 B;  3PHL A;  1PZQ A;  3A7O A;  3PRJ A;  2PCC B;  2CE0 A;  2IX7 C;  2XZR A;  4YE1 A;  3M91 A;  2ZBO A;  5AVV B;  1SLQ A;  4QMA A;  3BCC E;  3H1I E;  1IZN B;  5KAI H;  3WU2 H;  1WMK A;  2QJP C;  1SQV E;  1RZ5 A;  3P7K A;  1DW0 A;  1GU5 A;  3H1I D;  1BL9 A;  4IL6 H;  5DFS A;  2NPS D;  4PV1 B;  2FFD B;  2DVH A;  1LTI C;  1N50 A;  5GTI E;  1NTZ G;  1KYO H;  1NYH A;  5APW A;  3JBT B;  3VMA A;  1IQC A;  1VQ5 P;  4UB6 H;  2P2U A;  1VQO P;  3K5B A;  1ZOY C;  4H44 B;  4GED B;  4N0K A;  1VQM P;  1PGP A;  3RBZ A;  1W5C T;  2GA1 A;  5CCG D;  1PIX A;  5B66 E;  1PL5 A;  3VYM A;  1M7L A;  1KIL E;  3HE4 B;  1PP9 J;  3ZOO A;  2I8D A;  1CSU A;  2KB7 P;  3M9B A;  1RF1 A;  2FFD A;  1NOH A;  1HVV A;  2A45 G;  3FXE A;  2FFD C;  1N7L A;  3OA8 A;  4PD4 I;  1JTH B;  1BCC E;  4AUW A;  3PLN A;  1X8Y A;  5DJQ B;  3H6P A;  3DR0 A;  3B5N A;  1C6R A;  1BDD A;  2K3R A;  3HUS A;  1MFZ A;  2HR3 A;  2Q3E A;  2C0X A;  4OGQ D;  1K8A Q;  3OW2 O;  4HH2 A;  4H44 D;  2FY8 A;  5AW2 B;  1A02 F;  2ZOO A;  1A2S A;  1CRY A;  2E75 C;  3WUU A;  3L73 G;  2KZJ A;  1FOS F;  1N7S D;  3H32 B;  1HZU A;  1CRG A;  1ZR4 A;  3L71 J;  1FCD C;  2H8P D;  1T2K D;  1FAV A;  1LGH B;  4RJT A;  3P32 A;  2AEF A;  2B9B A;  1NH4 A;  2J59 M;  1PGJ A;  4Z1M H;  1WT6 A;  3MUD C;  1LMS A;  3H25 A;  4OVN F;  1L4A B;  5CCG A;  1DH3 A;  1SQX D;  4I2L C;  2IZ0 A;  1C75 A;  1CW5 A;  1QL2 A;  1M60 A;  2OYH A;  1CHI A;  2ZT9 D;  5KAF H;  5AW9 B;  1VQ9 P;  3V4Q A;  4L75 A;  1S5L X;  1H9Y A;  3M0D A;  3NXS A;  3A5T A;  4GIF A;  1DEB A;  4WQC A;  3W68 A;  1N90 A;  3JSV C;  4PJ0 V;  2W8Z A;  3IF4 A;  3S4R A;  1SQQ D;  1X0T A;  1YNR A;  3WU2 E;  1NTZ D;  5H2F E;  1NIR A;  4LLH A;  1YCC A;  1IFI A;  2YMK A;  1OVR A;  5APS A;  4FA5 A;  3Q5P A;  3TGU G;  2K9J A;  1NVO A;  3CX5 H;  2JEE A;  1COR A;  1YQ4 C;  1FDM A;  1AKK A;  1HCM A;  3PH0 A;  2WSE H;  1D7M A;  3N7N A;  3L4F A;  1AQ5 A;  1SFC A;  2WSF J;  1NTK D;  1URQ B;  2YCC A;  1GK6 A;  4OWF A;  1F1F A;  2WT7 B;  1MG2 D;  1KMI Z;  1CTZ A;  3TYY A;  2WSC J;  3QWO C;  1H31 A;  2Z5I A;  1HJ5 A;  1IFN A;  3CP5 A;  3AE3 C;  2OGU A;  1JCD A;  2IFN A;  3CC7 P;  5GTH E;  2B10 B;  1SQQ G;  2YXR B;  2K9Y A;  2V7Q J;  5E79 V;  5AW7 B;  3AE7 C;  1E2R A;  1L0L E;  3CCU P;  1LTT C;  1FS0 E;  2LIT A;  5B5E V;  1DW1 A;  3HTK B;  2N18 C;  5KKZ B;  3ORV A;  2KNC B;  2BEZ F;  3ZBM A;  2H43 A;  3SFD C;  3L72 E;  2XTS B;  1CCH A;  1KB9 I;  1M8O B;  2N9J A;  1JY2 P;  1IFM A;  4GKG A;  2Z5H A;  3T97 A;  1URQ C;  4L76 A;  1SFC D;  4L74 A;  3H1K E;  3CXH I;  3X39 A;  3H1J D;  3CC4 P;  451C A;  1A8C A;  1K9M Q;  1DIP A;  3AEC C;  1G1J A;  5CJ0 A;  2WPR A;  1JOC A;  1SQP G;  2QJK C;  1LWU A;  2FXP A;  1BGY E;  1EDK A;  3LID A;  1JO5 A;  3CCL P;  1K04 A;  4U3F D;  1VQK P;  3CLQ A;  4UB6 E;  1HJB A;  2Q1K A;  2ZZS 1;  3L4O A;  2J58 A;  3TGU D;  3AEG C;  3CXH D;  1ZP0 C;  2ZVO B;  4YXW H;  1FHB A;  2J5U A;  5CMZ A;  2E5T A;  1GJQ A;  3CPW O;  4IOI H;  4WQB A;  4J20 A;  2A06 G;  1YEA A;  1KYO W;  1P84 D;  1U57 A;  3E7K A;  1RF0 A;  5CCG C;  4EIC A;  3AED C;  1VF5 C;  1CC5 A;  2FYU J;  3PJS K;  2ZJS E;  1JDL A;  3L75 D;  4WVZ A;  3H1K G;  3L4M A;  1ZN5 A;  2M3B A;  3KDP B;  1HH7 A;  4YPC A;  1JY3 O;  1SVF A;  3TSI A;  2P7J A;  4PJ0 E;  4IL6 V;  1KQG B;  1ZZH A;  5AVS B;  4L1Q A;  4O1Q A;  4H0J A;  5KAF E;  3D0W A;  3HRN A;  2LXC B;  1DW2 A;  3LW5 H;  2ZAE B;  2V07 A;  1H8A A;  1QEX A;  3AEF C;  1GD2 E;  2N9I A;  3HUS B;  1M1J B;  1KIB A;  4B86 A;  1FJK A;  1I6E A;  1JY2 N;  2R5B A;  3C2C A;  1LC1 A;  4KMG A;  2B89 A;  2N3Y A;  3BCC J;  3KZI E;  3OA8 B;  3RL0 g;  4ZNC A;  5CJ4 A;  3UIA A;  4DJG A;  4EI2 A;  2ITA A;  1KN7 A;  3D6Y A;  2MJZ A;  3AEE C;  2L91 A;  2R5D A;  3L73 D;  1L4A A;  4RES B;  2Q9I A;  1NTZ E;  2A06 E;  2C0W A;  1CSB A;  3AE2 C;  3SSU A;  2HFE D;  1FZA A;  2OQQ A;  1B7V A;  1YI2 P;  4TLF A;  3L70 G;  5CIH B;  3O6Q A;  3TGU E;  1CXA A;  1BGY D;  2E42 A;  1BE3 E;  1H9X A;  3D70 A;  3JC2 2;  3L74 J;  2FYN B;  3CU4 A;  3A0H V;  2L5G B;  2NRG A;  3Q3D A;  1OXZ A;  1GL2 A;  3B5N B;  2W27 A;  2KLV A;  2BCC D;  4L3G A;  3Q5R A;  1QLE D;  1FZE A;  1KD1 Q;  5BVZ A;  1KV9 A;  2IBZ G;  4YXD C;  3VOP A;  1HH0 A;  4FA4 A;  5CBN A;  3CC2 P;  2BGV X;  1IFP A;  3PXW A;  2YKO A;  3JCU H;  1KYO E;  4EDF A;  1HGZ A;  3P8M C;  5KAI V;  1SQV J;  1NU1 K;  1QL3 A;  2YXQ B;  3M9Q A;  4WBA A;  2N18 B;  4N78 E;  5GTI H;  5KKZ C;  1CRC A;  2OTK E;  2QE7 H;  1H88 A;  2Q3I A;  1Q81 Q;  1X22 A;  3L70 D;  1YBK A;  3EWK A;  4N78 D;  1H0T A;  2ZT9 B;  3CX5 E;  5E79 H;  1N7S C;  1C6O A;  2DW3 A;  1U75 B;  2O01 J;  3MZW B;  2BPB B;  3VTP C;  1JMB A;  2PFX A;  3WFD C;  1BE3 G;  5GTI V;  3CWB J;  2V7Q H;  2LKM A;  5KJ7 C;  4EIJ A;  3L72 G;  1Y9B A;  3MP7 B;  4R4L A;  3SXT A;  1M1J A;  4R4M A;  1LS9 A;  3KPE A;  1EC5 A;  1CHH A;  1SQB K;  5KJ7 A;  4AX3 A;  3LW5 J;  1WEJ F;  1ETP A;  5H2F V;  1M1J C;  1SQQ E;  3Q2Y A;  2IDB A;  2G3A A;  3II6 A;  3U1A A;  1JTH A;  2JWD A;  2WWW A;  3KXD A;  1GMJ A;  1COT A;  3I56 P;  4LJI A;  1FZC A;  3HQ9 A;  1RF1 B;  1LP1 B;  4WY4 C;  3V6I A;  2KSJ A;  1NNO A;  3TF5 A;  1FOS E;  1DT1 A;  3HTK A;  1N8R Q;  1KB9 D;  1OVU A;  3SWS A;  1M70 A;  3SWK A;  3WUI A;  3G4S P;  3M06 A;  2ZYD A;  3A0H H;  3A2A A;  1JM0 A;  3N4X A;  4L73 A;  3MUD A;  1YYC A;  1E8E A;  3RN1 A;  1C6S A;  1E5W A;  4FA1 A;  2QVA A;  5C9M A;  2JP3 A;  4WQA A;  1H33 B;  3E1I A;  2B12 B;  1SQX J;  5BU5 A;  5CID B;  3W67 A;  3KZI H;  1L0L J;  1T3U A;  3PXT A;  5CIB B;  4D6T J;  3H1L D;  2E5Y A;  3VP8 A;  3USS A;  4KJM A;  5CYT R;  4O1W A;  2CA3 B;  1JY2 O;  2R3C A;  1L9J C;  2WSF H;  2KSE A;  2SPZ A;  3OJA B;  4BWN A;  2CXB A;  5AW5 B;  4UB6 V;  1BSN A;  1K05 A;  3B5N C;  4Y99 B;  4AQR D;  5BU8 B;  1H33 A;  1OCD A;  3L71 D;  2QRX A;  2CK3 H;  1DII C;  4U7J A;  2ZON G;  1LTG C;  2WVR A;  3L75 G;  2IBZ E;  4PJ0 H;  1BCC G;  3FWN A;  3AE1 C;  1K3H A;  3SFE C;  4TT3 H;  3L72 D;  1PGO A;  5AW6 B;  4AAL A;  1M57 D;  2KOG A;  1N7S B;  5APQ A;  1CYC A;  3RL0 D;  5KAI E;  4YTP C;  3BRT B;  5B5E E;  1HJ0 A;  3PTZ A;  3MK7 C;  3A9F A;  3VYI A;  4AYC A;  3SLE A;  2D0W A;  1PGQ A;  1USE A;  4JF7 A;  3BVH A;  1RHZ B;  3KYQ A;  1MFT A;  1RF0 C;  3FGA D;  1Q82 Q;  2Z4E A;  2E74 B;  2JKV A;  3H1L G;  2L4D A;  2JJL A;  1FC2 C;  3Q5S A;  1IO3 A;  1SS1 A;  1VQL P;  2BCC E;  2PAJ A;  1NTK G;  3MD0 A;  2YK3 A;  5AVX B;  2NPS C;  3B8E B;  4RSZ A;  1CZQ A;  3RK3 E;  1S4X A;  3AE9 C;  3A3Y B;  2B0Z B;  2KYV A;  1SFC B;  5APX A;  1RH5 B;  4PV1 C;  1HGV A;  5AVW B;  2N9B A;  3PXS A;  1C52 A;  1L9B C;  2YO2 A;  1QVF O;  1SQV G;  1L0N J;  1QGK B;  4C46 A;  5IY5 1;  1CI6 A;  2YKP A;  1MV8 A;  1J1E B;  1P84 H;  3ZCF A;  3A0B V;  2K9J B;  4ZMD A;  3AE5 C;  2K88 A;  1L0N E;  4GYD A;  2N9Y B;  4WQ7 A;  1R8E A;  2BAS A;  2XKM A;  1FZG A;  2V08 A;  4NPE A;  3WU2 V;  4K3A A;  2R44 A;  1CSW A;  4D6T D;  1QL1 A;  3V2N A;  1C2N A;  2YQB A;  2B87 B;  1DEE G;  2E76 B;  1GQ1 A;  4RKU J;  1FE6 A;  3H1I G;  3HQ8 A;  1HUC A;  1MKM A;  3NMD A;  1OIP A;  3B71 A;  1N9C A;  4PW9 B;  4I1L A;  1YTZ I;  1ZV8 A;  1S6V B;  3RK2 C;  3RK3 D;  3NWV A;  5AVT B;  3ZOX A;  1IJD B;  1SQV K;  3IR9 A;  2PAC A;  4H0L C;  5GTH H;  2P1J A;  3WUV A;  2FKW B;  3TNU B;  1SQB D;  4QAO A;  3L74 D;  2KUB A;  1LT1 A;  2LIR A;  2YIU B;  4DZO A;  5L8R J;  1LJ2 A;  4V2K A;  4O9B A;  3O8Z A;  1DD3 A;  4U3F G;  1X79 B;  2WSE J;  3CCS P;  1GL2 B;  1FJP A;  2P58 A;  2QJK B;  1YFC A;  1KTM A;  3CYT I;  1TU3 F;  1BE3 D;  4UB8 E;  1OX3 A;  2IFM A;  3CD6 P;  1SQP J;  1L2P A;  1M1K Q;  3M0A A;  2I1J A;  1N2D C;  1G2C B;  4JYC A;  1NKZ B;  3H1H J;  2FYN C;  5H2F H;  2O3J A;  2NPS A;  1M90 Q;  4DOJ A;  2HG5 D;  1E29 A;  2GB8 B;  3B4S A;  3L70 E;  4KT0 J;  4L3H A;  1Y47 A;  1M56 D;  3VMY A;  5KAF V;  1KFM A;  4WQD A;  1YTZ T;  3CX5 W;  4WQ9 A;  2A45 I;  4GOF A;  1ZLL A;  4PD4 E;  1ZRT D;  1CXC A;  1KOR A;  2YIU C;  1BCC J;  3L35 A;  4DT0 A;  5AVR B;  2OTL P;  3H1J E;  2B88 A;  3SJL A;  5KLI C;  1L0L G;  1RF1 C;  3CX5 I;  4D6T G;  1E79 H;  1DVV A;  1PPJ D;  1AJY A;  2QJY C;  3H1J J;  1T6A A;  3H1L J;  3HQ7 A;  3M9H A;  3GLM A;  4Y5R A;  1S5L E;  1OFC X;  4M3L A;  1L0L K;  1FZC C;  1Y8A A;  2O1J A;  2FYU K;  3HD7 A;  2JWA A;  3CXH W;  4AAO A;  1VF5 D;  3L74 E;  1KX7 A;  1NML A;  3HE4 A;  2N1T A;  3CWB D;  1W2E A;  1LC2 A;  1DD4 A;  1SQB G;  2E76 C;  1HWT C;  3CL3 D;  1RY3 A;  1GTW A;  2KZI A;  2GC7 D;  1G1I A;  5APY A;  5AUR A;  1FU1 A;  5TIS E;  2D2C C;  2KP8 A;  4FAN A;  1L0N K;  2KI7 B;  1UII A;  1CTY A;  3OCD A;  2ZYA A;  2JDI H;  1VQ6 P;  1YIC A;  3BCC G;  3HE5 A;  3AE6 C;  3RL0 C;  5AW4 B;  5DF5 A;  2C9L Y;  5CIF B;  1OZH A;  1FBM A;  1IRW A;  2NPS B;  4PV1 D;  2GM4 A;  1I55 A;  3HD7 B;  2BCC G;  2OTJ P;  1OAE A;  4DCK A;  3VP9 A;  2RMZ A;  3H1H D;  1IZL 0;  1KFN A;  1VQ8 P;  1NTM G;  1NKN A;  2R3S A;  1CO6 A;  1S9K D;  3G71 P;  1NO4 A;  1CRJ A; 
#chains in the Genus database with same CATH homology
 4K3I A;  5KLI B;  3WC8 A;  1KX2 A;  1HZU A;  1PP9 D;  1CRG A;  1H1O A;  1CED A;  1FCD C;  4EID A;  4RJT A;  2GC4 D;  2QG4 A;  351C A;  1K3G A;  3SVW A;  1COT A;  4LJI A;  3HQ9 A;  1LMS A;  3BCC D;  1SQX D;  2QJY B;  1NNO A;  3TF5 A;  1C75 A;  1DT1 A;  5CIG B;  1KB9 D;  1M60 A;  4NFG B;  3SWS A;  1M70 A;  4AAM A;  3WUI A;  1CHI A;  4H0K A;  1H9Y A;  2Y0C A;  2GIW A;  4WQC A;  1N90 A;  1E8E A;  3RN1 A;  4PJ0 V;  1C6S A;  1I8O A;  1QYZ A;  4FA1 A;  1SQQ D;  1YNR A;  1NTZ D;  1C7M A;  5C9M A;  4WQA A;  1NIR A;  2KS1 A;  1H33 B;  2PCB B;  1YCC A;  2C9X B;  3WFE C;  2B12 B;  4FA5 A;  5CID B;  1YEB A;  1H32 A;  1COR A;  3PXT A;  2Y0D A;  5CIB B;  1AKK A;  4AAN A;  3H1L D;  1CHJ A;  3RN0 A;  1HCM A;  5CYT R;  4O1W A;  2MTA C;  2A06 D;  2CA3 B;  1L9J C;  4XYD B;  4MU8 A;  3PH2 B;  1H32 B;  1QKS A;  1NTK D;  2YCC A;  5B6Q A;  1F1F A;  5KLV D;  1MG2 D;  2CXB A;  4UB6 V;  3O0R C;  1H33 A;  1OCD A;  3L71 D;  1HRO A;  1CTZ A;  3FWL A;  1DII C;  1H31 A;  2ZON G;  1HJ5 A;  5C0Z A;  3CP5 A;  1I6D A;  1S5L V;  3MK7 B;  3CX5 D;  1K3H A;  3L72 D;  1C2R A;  4AAL A;  3GG2 A;  4FA9 A;  2CE1 A;  1RZ6 A;  2QJP B;  2B10 B;  1YIQ A;  1CYC A;  1NU1 D;  5E79 V;  2JTI B;  1CYJ A;  1AOQ A;  1E2R A;  2LIT A;  5B5E V;  3PTZ A;  1DW1 A;  3ITK A;  2N18 C;  5KKZ B;  3ORV A;  3MK7 C;  2KNC B;  3A9F A;  3ZBM A;  3SLE A;  2D0W A;  5GTH V;  2MHM A;  2XTS B;  1CCH A;  2DGE A;  4P4Q B;  2N9J A;  2L4D A;  3RMZ A;  1A56 A;  1QL4 A;  2B4Z A;  1LFM A;  1IO3 A;  1HJ3 A;  1WVE C;  1GDV A;  2YK3 A;  3RLM A;  1F1C A;  3X39 A;  4RSZ A;  3H1J D;  451C A;  1HRC A;  1A8C A;  2CA4 B;  2B0Z B;  3KZI V;  2C1U A;  1R0Q A;  1FI7 A;  3PXS A;  1C52 A;  1L9B C;  4FAV A;  1AYG A;  4UB8 V;  1NMI A;  5IY5 1;  1I8P A;  3TYI A;  4U3F D;  1HZV A;  3ZCF A;  2C1D A;  2BH5 X;  3A0B V;  2K9J B;  1CCR A;  3ZOW A;  3DP5 A;  4GYD A;  1CIG A;  2N9Y B;  4WQ7 A;  1IRV A;  1HJ4 A;  155C A;  1L0L D;  2ZZS 1;  2V08 A;  2ORL A;  2AXT V;  3WU2 V;  3L4O A;  3TGU D;  3CXH D;  1CSW A;  4D6T D;  4PD4 D;  2JQR A;  1C2N A;  1FHB A;  2YQB A;  3HQ6 A;  1N15 A;  1GJQ A;  1GQ1 A;  1VYD A;  4WQB A;  4J20 A;  3HQ8 A;  1DIQ C;  2IBZ D;  1YEA A;  1KYO W;  1P84 D;  1N9C A;  4PW9 B;  4EIC A;  1S6V B;  3NWV A;  2BH4 X;  3ZOX A;  1CC5 A;  1RAQ A;  1MG3 D;  1MZ4 A;  2PAC A;  1JDL A;  2C1D B;  1FJ0 A;  3L75 D;  1SQB D;  1SQP D;  3L74 D;  4QAO A;  3L4M A;  1YTC A;  1CSV A;  2N3B A;  5CIE B;  5CIC B;  2LIR A;  2YIU B;  1HH7 A;  1SQV D;  3GW6 A;  4V2K A;  4IL6 V;  1J3S A;  1CNO A;  2B11 B;  1M6Z A;  1ZZH A;  1CIH A;  4JCG A;  3VRD A;  1CTJ A;  4L1Q A;  4O1Q A;  4H0J A;  1AOF A;  3O1Y A;  4A7P A;  5EXQ A;  3WFC C;  1DW2 A;  2QJK B;  1YFC A;  3CYT I;  3O20 A;  1GIW A;  2AI5 A;  2V07 A;  1BE3 D;  1QN2 A;  1DVH A;  2N9I A;  4EIF A;  1KIB A;  2HV4 A;  2D0S A;  1I6E A;  3WFB C;  3C2C A;  1FOC A;  1LC1 A;  4KMG A;  4XXL A;  3KHU A;  1CSX A;  2N3Y A;  2C2C A;  3OA8 B;  1CIE A;  4FB1 A;  1NTM D;  1GKS A;  1CIF A;  4WQ8 A;  2O3J A;  5DJQ C;  3NBT A;  2BLF B;  1DW3 A;  1E29 A;  2L91 A;  3ZOY A;  2GB8 B;  3L73 D;  2ZXY A;  2FWL A;  4L3H A;  1L0N D;  3OCD B;  4Q5P A;  5KAF V;  4WQD A;  1CYI A;  1EB7 A;  4EIE A;  2I8F A;  3CX5 W;  4WQ9 A;  2AIU A;  1B7V A;  1ZRT D;  1CXC A;  1I54 A;  5CIH B;  1H31 B;  1CXA A;  3PHL A;  1BGY D;  3PRJ A;  1KYO D;  2PCC B;  1EZV D;  2EXV A;  2CE0 A;  3SJL A;  4YE1 A;  1H9X A;  2ZBO A;  2FYN B;  3CU4 A;  2VHD A;  3A0H V;  5B66 V;  1CRI A;  1DVV A;  1PPJ D;  3NBS A;  1KB0 A;  3HQ7 A;  2BCC D;  3VNW A;  4L3G A;  4Y5R A;  1RZ5 A;  2OZ1 A;  1DW0 A;  5TIS V;  3H1I D;  1BL9 A;  1KV9 A;  5DFS A;  2JWA A;  3CXH W;  2DVH A;  3DMI A;  4AAO A;  1N50 A;  4FA4 A;  2BGV X;  1KX7 A;  2FYU D;  2C1V A;  3PXW A;  5TJH A;  3JBT B;  2RN0 A;  3VMA A;  1IQC A;  1NML A;  2BCN B;  4EDF A;  2FRC A;  3CWB D;  1LC2 A;  1I5T A;  5KAI V;  1W2L A;  1QL3 A;  1U74 B;  3H1K D;  1FI9 A;  4GED B;  2N18 B;  1CRC A;  4N0K A;  1RAP A;  2GC7 D;  1GU2 A;  5AUR A;  4WQE A;  3L70 D;  1W5C T;  4FAN A;  1CTY A;  3OCD A;  1YIC A;  1C6O A;  1U75 B;  3VYM A;  5DF5 A;  5CIF B;  2BPB B;  1FI3 A;  3ZOO A;  1IRW A;  3WFD C;  1CSU A;  2C8S A;  5GTI V;  1I55 A;  1BCC D;  1OAE A;  3OA8 A;  2RMZ A;  3O5C A;  2OZ1 B;  3PLN A;  1CRH A;  3H1H D;  1IZL 0;  5DJQ B;  3DR0 A;  1C6R A;  3SXT A;  1LS9 A;  3ZIY A;  2Q3E A;  2Y0E A;  1CO6 A;  1CHH A;  3M97 X;  3TDK A;  2ZOO A;  4AX3 A;  1A2S A;  1CRY A;  1WEJ F;  1ETP A;  5H2F V;  4PWA A;  1CRJ A;  4DY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...