1PP9J

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
molecule tags Oxidoreductase
total genus 24
structure length 62
sequence length 62
chains with identical sequence W
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1pp9J00
4D6TJ 2BCCJ 4PD4I 5KLVJ 1SQBJ 3L73J 1NTMJ 3CX5I 1SQVJ 3CXHI 1SQPJ 3CWBJ 3L70J 3L74J 3H1LJ 3BCCJ 4U3FJ 3TGUJ 2FYUJ 2IBZI 1L0NJ 1BE3J 1NU1J 1KYOI 3L75J 3L72J 1EZVI 1SQXJ 3H1KJ 1BCCJ 1PP9J 1NTKJ 1BGYJ 3H1HJ 1SQQJ 3L71J 1P84I 1NTZJ 3H1JJ 1L0LJ 1KB9I 3H1IJ
chains in the Genus database with same CATH superfamily
2BCCJ 3VP9A 1DEBA 2YMYA 4UB8H 1SQBJ 3VP8A 1SQVJ 1RE4A 3CPWO 2E74C 1PZQA 1M1JA 3L75D 1PP9E 1Q90D 4Y99B 1NTZG 2B9BA 1HUCA 1M1JB 1KMIZ 3Q5PA 3Q5RA 1FJPA 4NPDA 4Y28J 1OVRA 1CW5A 3Q2YA 3CL3D 5AW3B 3CWBJ 2RN0A 1J1DB 3CCSP 3CXHH 1SQQG 3KDPB 3L71E 3RK3E 1T6AA 1T8ZA 4XA4A 2QE7H 3GHGA 3FXEA 1KB9I 1VF5D 3LW5H 2KUBA 4D6TE 3MTUE 2O01N 4GODA 2E75C 1RHZB 3GHGB 2QM8A 3OA7A 1OW8A 3RK2C 5KAIH 3RL0C 4B86A 1PP9D 2HG5D 1DD3A 4OH8B 5KJ7A 2WPRA 1NTZJ 3RBZA 5CJ4A 1RF1C 2FYNC 5KLVE 2E74B 2A06G 2POHA 3AE2C 4N78E 1S9KD 1KTMA 2Q3IA 3H1KG 2UWJE 5AVTB 1FZCC 5BVZA 2HFED 2ZYGA 2ITAA 2QJYC 2M3BA 3L71D 3RK3D 1SQQJ 3LIEA 2XV5A 1SQPD 5AVUB 3RL0g 1AV1A 3MIWA 3LIDA 3R4YA 1GMJA 1CSBA 2ZXXA 2WSEH 1T3UA 1FZAA 1HH0A 4RKUJ 4DT0A 5KLVD 2RKLA 1BE3G 4N78D 2NRGA 4AYCA 3L36A 3B5ND 1NU1K 1BCCG 1SQXK 1T2KC 2OTJP 4WBAA 2L91A 3AEBC 3OAKA 2QJKC 1VDFA 5KKZC 3E1RA 1EDJA 2ZYDA 3CXHI 1AQTA 3JCUE 2QJYB 4U7JA 2KI7B 2FXPA 1JB0J 2K3RA 2KZIA 1DH3A 3AE4C 2E5TA 2CPSA 3II6A 1K73Q 2N1TD 2E43A 1GL2D 4H0LC 3A0BE 2IBZD 2Y0DA 1BE3J 1T3JA 2W83C 2JDIH 1BCCJ 4IOIH 3IF4A 3LW5J 1NTMK 3B71A 2AEFA 5E79H 3L73J 3G71P 4BRYA 2FYUG 1ZV8A 4BRYB 4IL6H 2XNDH 3SFEC 3ABVC 2P7JA 1PPJG 1SFCD 2QJKB 5KKZB 3IAOA 1AVYA 3H1IE 4H13C 3MUDC 1RE3A 3L74G 2GM4A 5AW4B 3CLQA 1CZQA 3GG2A 2Q5UA 3H1LE 4EDFA 2FFDC 3L70J 1LT1A 1X8YA 5AVWB 2ZJSE 3L72E 1NU1J 1SQXJ 2ZXEB 2XZRA 3A5TA 1BSNA 3EQ2A 2H7HA 2CPBA 3P8CD 1SQVD 4H0LB 1WRGA 3U59A 4I2LC 1L0NK 4WY4D 2KSJA 2FYUJ 1KQLA 3TDKA 2YXRB 1A02J 2WSEJ 1L2PA 1P84E 5CMZA 1KB9E 2GA1A 5BU5A 3AE6C 3CWBD 2K1AA 5APYA 3G6EP 3H1LD 3CX5E 5AW2B 3MUDA 1GW4A 2B87A 1EZVG 1M56D 3L72D 4YTPC 1IFDA 2HODA 1HWTC 3OJAB 2HODB 3AE1C 4KJMA 3AEGC 1FDOA 2A45H 1VQ7P 1NTMJ 3GF3A 3PTZA 4PD4H 1S5LH 3O6QA 5AW6B 3S9OA 3O6QB 1IC2A 2M5AA 3QWOC 1PGJA 2IFNA 1P84D 1KB9D 1AQ5A 2Y9YA 1IK7A 2M5AB 3VMZA 4LC1A 1OIPA 4DCKA 3EFGA 3V2RA 2B89A 1YHQP 1KILC 5GTIH 2Q6QA 3N7NA 1FU1A 2MJZA 1ZN5A 4D6TG 4UB8E 3JC22 1SLQA 4EIJA 3VN0A 3PJSK 2O1KA 2OYOA 3CCEP 4L76A 2XNXA 3AE5C 1GZLA 1K9MQ 2Q1KA 3M0DA 3NTNA 1GTWA 2W27A 5EFWB 1L0LE 3EWKA 1KQGB 1RQVA 1BSHA 2P58A 2Q9IA 2ZT9C 5H2FH 2Z4EA 3TNUA 1JTHA 2K37A 2LR2A 3TNUB 4I6MC 1G2CA 4K35A 1DD4A 1JTHB 3NXSA 3CCJP 1G2CB 2A45G 4O9BA 1YIJP 1NWQA 3U1AA 1GK6A 1KILA 4D6TJ 2Y0CA 3B4SA 1KILB 3A2AA 3KXDA 3HD7D 2O1JA 2HPCA 1HJ0A 1EXIA 1KYOE 5KLIC 3D70A 2HPCB 4YXWH 2A45I 2E76C 1LTIC 3KQGA 3G9RA 3KZIH 1AA0A 3ITKA 1N73C 1SQBK 3R2PA 3CC2P 2AXTH 1WT6A 1EDKA 2K9YA 4PV1B 2ZVNB 1Q81Q 1N7SC 5KJ7D 4PJ0E 1ZR4A 3L73D 2C9NY 2OTKE 1J1EC 1E5WA 1VQ4P 1JY2O 1Z56A 3P32A 4ASVA 3U1CA 1S1CX 2AEMA 1KYOD 2JP3A 1JM0A 3M0AA 2OYIC 3FWLA 4WB4A 1U57A 1W2BO 1VQPP 5KLIB 2D2CC 2E76B 1SQXD 1YBKA 3WUVA 1BGYE 3NFQA 1H0TA 3M9QA 1NOHA 1NTZK 2G3AA 3F5HA 1H0TB 3RGUA 1A02F 1EQ7A 3CI9A 2KB7P 2M0BA 3MD0A 4GT1A 2K88A 1N7SB 1QVFO 1K05A 1GK4A 3H1HE 1KQSO 1W5CE 1SQQK 3H1IG 1FZEA 1J1EB 2QIWA 1JCCA 3H1JJ 2LXCB 1NKNA 4JF7A 1RH5B 2WQYC 1PGPA 2OYIA 2OYIB 2H43A 1BGYD 1L4AA 3CCMP 1GU5A 4UB6E 1X0TA 2J59M 2N9BA 1L4AB 1XTCC 1NTMD 2IYPA 2D2CB 4IL6E 3Q3DA 4XFJA 1S9KE 5TISH 1L0NE 4HH2A 1FJKA 4JPZB 1R5SA 4KT0J 1VQMP 4GKGA 3H1HD 1KC8Q 1FOSE 1AFOA 2V7QH 1JMMA 3H1IJ 4N3YB 5B66H 1SQPE 1FS0E 2FBWC 3PLNA 3AE8C 4EOTA 2QJPC 1YYCA 1LP1A 1J2JB 1YQ4C 5KTBA 3HUSC 1KFMA 1LP1B 1FOSF 3BCCE 3H25A 1UIXA 4JYCA 4WVZA 1L0ND 5KAFH 1URQD 2PAJA 3MGNA 2W6BA 2OGUA 3AECC 1VQOP 1H88A 2KP8A 2KLUA 2OYHC 2LKMA 4TT3H 2E42A 1EDLA 2WSSH 2AXCA 5K5GB 1MV8A 1HF9A 3BVHA 2I1JA 1MFZA 5CJ0A 1KZUB 3VMAA 2E75B 2XDJA 1HTLC 2OARA 3SWFA 3USSA 1FDIA 1VQ5P 3BRVB 3RK2B 2XKMA 4PD4E 1X9VA 3RL0B 3BCCD 3HUSA 1RF1A 1Y47A 2IBZE 2KYVA 3HUSB 3WMM0 1L0LG 1RF1B 2FYNB 3H1KJ 1XTGB 1S72P 1LNQA 3I5CA 1KQFB 2J5UA 1FZCA 1ZMEC 4U3FE 2OTLP 5CCHD 2KOGA 1FZCB 2FYUK 2OYHA 1VF5C 1H8AA 2OYHB 2BEQD 2RMZA 3PRJA 4TLFA 4HKZH 4PD4D 1E79H 3V6IA 2B88A 5APUA 5GTHH 1RF0C 3VMYA 1YITP 3CCVP 2V7QJ 2GUSA 2JKVA 3SWKA 3W67A 2BCCE 2HLOA 3E7KA 3P8CE 1SQBE 2IPPA 1SQVE 4IL6X 3L4FA 2IZ1A 2WWWA 3TGUG 3RK3C 4U3FD 1Q7YQ 1ZOYC 1VQ9P 2NPSC 2E5YA 3AEFC 2WTYA 1X79B 4C7RA 3CCUP 1NAFA 2QM7A 3CWBE 3AE3C 1MFTA 3A0HE 3CMAP 1IFIA 2G8YA 1NTKG 3IFMA 1JY2N 2KSEA 2H88C 3KZIE 1M1KQ 2H89C 4OGQD 3CCLP 1RF0A 2BCCD 1MUUA 3D71A 1SQBD 3HTKA 3PH0A 3H6PA 1DX7A 5APQA 1Q2NA 3L75G 3HTKB 3TGUJ 4JQ0D 1ZXGA 1NTZE 1JMBA 1SVFA 2NPSA 1EDIA 2KNCA 2NPSB 3L74J 1N7LA 4PV1D 2KNCB 3H1HG 1OW6A 4H13B 3M06A 1SQQE 2FFDA 1AVOA 1NTKJ 3AEAC 2JO1A 1GL2C 2I1KA 5AW1B 2FFDB 5CHXA 1RY3A 2YXQB 1S5LX 1QX8A 3OW2O 1PP9G 1PIXA 3L75J 1EZVI 2NZ2A 3F89A 1NTZD 5BU8B 1NHLA 1NO4A 3NMDA 2R5BA 2A06E 3SSUA 1VL2A 1LGHB 3VMXA 4H44D 3WUUA 1FC2C 3L71G 3KHUA 4R4LA 1SQQD 3ZDMA 2R44A 5B5EH 1FDMA 2AEJA 1FBMA 4IFMA 5APTA 1SQPG 2YO3A 1GL2A 2Q7CA 1GL2B 2O3JA 1IFNA 2Z5IA 3V2QA 3JCUH 1FZFA 4JBZA 1PP9J 3CCRP 2WPQA 1LWUC 5AVYB 4W7YA 4YXDC 5KLVG 1QGKB 2C0WA 1M90Q 2I8DA 3K5BA 2A06D 3CXHE 4AQRD 3FWNA 2KLVA 1BE3E 5AW8B 3H1KD 1BCCE 2WPVB 1JY2P 1L4AD 2M3EA 5L8RJ 3L71J 3CC4P 2IZ0A 4HB1A 3L73E 1HVVA 5KAIE 1SQPJ 5DJTB 2WVRA 1KORA 4CPGA 2GUVA 3V4WA 1S2EA 1NAYA 3TSIA 3HE4A 1ZW0A 1M8OB 3L70E 1H89A 5KAFE 3HE4B 5KLVJ 1PFIA 1BDCA 3CXHD 1N2DC 2IBZG 1NU1E 1BE3D 4BXLA 5C39A 2W6AA 1SQXE 1LWUB 1BCCD 1N8RQ 1YJWP 2E74D 2ZT9B 4ZKPA 1LJ2A 3V2NA 4U3FG 5APSA 4XE5B 3CC7P 1FE6A 4QMAA 1U7JA 1VQ8P 2WSCH 1YTZI 2ZVOB 4IFDK 4I7ZC 3L37A 1GD2E 4W80A 1N86A 1OXZA 5APWA 2QEXP 4WWIA 2OQQA 3SFDC 1EC5A 4L73A 2BEZF 4BWNA 2BASA 3L70D 1P84H 5M1BA 4AUWA 2IX7C 3BASA 3M9HA 3VYIA 1NU1D 1N73A 3CX5H 2E75D 1ZRTE 1N73B 1RE4C 3RK2D 1SQVG 1PL5A 4R4MA 3RL0D 2KXPB 1NTME 1JY3N 2FKWB 2YKQA 1N7SA 3CMEP 2FXMA 2FYUD 2LXBA 3MHVA 1Q82Q 3D6YA 3P8MC 3V5BA 2Y0EA 1GU4A 2FY8A 3HD7C 3CWBG 4DZOA 2P1JA 3H1LG 1YJ9P 1Y9BA 5CCGC 4I7ZB 2O01H 3L72G 2Y9ZA 1NVOA 1K8AQ 1EZVE 3I55P 1ZRTD 2WSFJ 5E79E 4N6JA 3KYQA 5CBNA 1VQKP 3T97A 3IR9A 5KJ7C 1KD1Q 3T97B 3C1LA 3S1KA 1JNMA 3UIAA 5AVZB 1IK9A 2QA4P 1T2KD 3A3YB 1JUNA 4GOFA 5DJUB 3H1LJ 3HD7A 3SWYA 2P2UA 3HD7B 3L72J 5CCGA 1EZVD 3AEEC 1HJBA 1P84I 1GW3A 3CX5I 2WSCJ 1TU3F 2M8RA 2WITA 2MKVA 1L0LK 1FZGA 1KYOH 2C9LY 4H0LD 4KHXA 1JO5A 4RESB 1PGOA 4A7PA 1G1JA 3I56P 5AW5B 1S4XA 3MZWB 5AW9B 1EXJA 1IFPA 1USDA 4C46A 4W7ZA 2WPSA 3VOPA 5APXA 4D6TD 3KPEA 2NPSD 1ZP0C 4PJ0H 1S5LE 3WU2H 1JY3P 2QRXA 2QJPB 2P10A 4H13D 3HRNA 2R32A 3M9BA 1MKMA 5AVVB 1VPCA 1NH4A 2O01J 2PGDA 1JEKA 5GTIE 4K3AA 4HYTB 5B5EE 1S3JA 2QVAA 1FZBA 1K04A 3L73G 1OW7A 2ZAEB 3HE5A 3P7KA 5AVQB 2KIKA 1QEXA 3C9IA 3HE5B 1LTJC 2WZ7A 1VQNP 1RE3C 1QL2A 2K9JA 1NTKK 2V4HA 3H1JE 4ZNCA 3M91A 2IDBA 2P67A 1YI2P 1JY3O 2K9JB 3FX0A 1L0LJ 5H2FE 3L70G 1URQC 1LTSC 1KILE 1PGQA 1NU1G 1SQXG 4LGDE 1D7MA 2YMKA 4YPCA 2JJLA 1KYOI 3N4XA 3CCQP 1DIPA 2YO2A 1Y8AA 4IFFA 3G3ZA 4UB6H 1M7LA 3FXDA 1VF5B 2QG4A 1HGVA 4DJGA 1LTJA 2KS1A 3GW6A 1AJYA 4OWFA 3H1JD 3C8VA 2AXTE 1OX3A 1LTJB 2KS1B 3B5NC 1KILD 3E1IA 3D6ZA 1URQA 2QSIA 2JWDA 1VQ6P 1BGYG 2HYNA 1ZR2A 1URQB 5CCHC 3PP5A 3WUTA 1NTMG 4LLHA 3GMAA 4NPFX 4M3LA 3RK3B 3W68A 3FGAD 2W6JH 1YJNP 1UIIA 1KFNA 2ZFCA 2CK3H 1LTBC 2ZT9D 2N1TC 3H1ID 1JOCA 1R5LA 1SQPK 4ASWA 3B5NA 3BRTB 1NJIQ 3S4RA 1Q86Q 1QVGO 3B5NB 3JSVC 1CI6A 3A7OA 2B87B 3V2PA 1BGYJ 1HBWA 3B8EB 3Q5SA 1CI6B 1BDDA 1YTZT 3M0DC 5KLVK 4RO0A 1R8EA 5CCHA 1SFCC 4GIFA 1L0NG 2E76D 1OVVA 4I1LA 2ZYAA 3H1KE 3MP7B 1PV3A 2YIUC 3AEDC 3H1HJ 3L35A 1IO4A 1LTAC 4OVNF 1LTGC 4EYYQ 5APVA 1RQUA 2N1TA 3CX5D 1N7SD 4GOEA 4OGQC 2WT7A 3CD6P 4L75A 3BATA 2N1TB 1OVUA 2WT7B 2L5GB 3QH9A 2R3CA 2FYZA 4WY4C 2HR3A 2YKPA 5TISE 3BCCG 4C7NA 3IN6A 1OFCX 1NYHA 1SP4A 2FXOA 2W8ZA 2PRRA 3VTPC 4C7NB 1X22A 2YNYA 1YQ3C 1L0NJ 3AE9C 2YKOA 4RJTA 1ZLLA 1SFCA 2R3SA 2H8PD 1JCDA 3A0BH 2W90A 5B66E 4PV1C 1SFCB 3AE7C 2D2CD 2WSFH 1IFMA 2YIUB 3V4QA 3Q1MA 4NPEA 1G1IA 2PFXA 1KV4A 4Z1MH 5AW7B 5AW0B 4EI2A 4OGQB 1NKZB 1W2EA 5AVXB 2WMMA 3BCCJ 1LWUA 4WY4A 3PHLA 3A0HH 1OZHA 2RH0A 1OWAA 3TK1A 4WY4B 5CCGD 1L0LD 1IJDB 4ZMDA 4H44C 1U7MA 2KZJA 1SQVK 3TYYA 3EFFK 4PD4I 3TGUE 2JEEA 2FYUE 2IBZI 2J58A 1WMKA 1PPJE 2JWAA 3WU2E 2JR8A 4MN4C 2C0XA 1IFJA 3L74E 2N9YB 1KB9H 4GDOA 1OMIA 1LT9C 1HGZA 2PP6A 1QLED 1NTKE 3H1JG 2VRSA 2XU6A 5TJHA 2IYOA 2BCCG 4HJGH 1M57D 1SQBG 4Y99C 2SPZA 1QL1A 1M1JC 4DOJA 1IZNB 1FAVA 1NGMB 1L4AC 1KN7A 2Q3EA 2DW3A 3TGUD 4U3FJ 3L75E 1SS1A 4L74A 2IFMA 4H44B 2KK7A 1LTTC 1GDTA 1MZ9A 5AVRB 1J1DC 1PPJD 3RBXA 3G4SP 3O8ZA 3TF5A 1VQLP 5GTHE 3L74D 5AVSB 3H32A 1USEA 1DEEG 3GHGC 3GF7A 3H32B 4JYBA 1NTKD 2Z5HA 1LT9A 3GLMA 4ZKUA 2R5DA 1LT9B 5CBOA
chains in the Genus database with same CATH topology
4D6TJ 2BCCJ 4PD4I 5KLVJ 1SQBJ 3L73J 1NTMJ 3CX5I 1SQVJ 3CXHI 1SQPJ 3CWBJ 3L70J 3L74J 3H1LJ 3BCCJ 4U3FJ 3TGUJ 2FYUJ 2IBZI 1L0NJ 1BE3J 1NU1J 1KYOI 3L75J 3L72J 1EZVI 1SQXJ 3H1KJ 1BCCJ 1PP9J 1NTKJ 1BGYJ 3H1HJ 1SQQJ 3L71J 1P84I 1NTZJ 3H1JJ 1L0LJ 1KB9I 3H1IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T J;  2BCC J;  4PD4 I;  5KLV J;  1SQB J;  3L73 J;  1NTM J;  3CX5 I;  1SQV J;  3CXH I;  1SQP J;  3CWB J;  3L70 J;  3L74 J;  3H1L J;  3BCC J;  4U3F J;  3TGU J;  2FYU J;  2IBZ I;  1L0N J;  1BE3 J;  1NU1 J;  1KYO I;  3L75 J;  3L72 J;  1EZV I;  1SQX J;  3H1K J;  1BCC J;  1PP9 J;  1NTK J;  1BGY J;  3H1H J;  1SQQ J;  3L71 J;  1P84 I;  1NTZ J;  3H1J J;  1L0L J;  1KB9 I;  3H1I J; 
#chains in the Genus database with same CATH topology
 2BCC J;  3VP9 A;  1DEB A;  2YMY A;  4UB8 H;  1SQB J;  3VP8 A;  1SQV J;  1RE4 A;  3CPW O;  2E74 C;  1PZQ A;  1M1J A;  3L75 D;  1PP9 E;  1Q90 D;  4Y99 B;  1NTZ G;  2B9B A;  1HUC A;  1M1J B;  1KMI Z;  3Q5P A;  3Q5R A;  1FJP A;  4NPD A;  4Y28 J;  1OVR A;  1CW5 A;  3Q2Y A;  3CL3 D;  5AW3 B;  3CWB J;  2RN0 A;  1J1D B;  3CCS P;  3CXH H;  1SQQ G;  3KDP B;  3L71 E;  3RK3 E;  1T6A A;  1T8Z A;  4XA4 A;  2QE7 H;  3GHG A;  3FXE A;  1KB9 I;  1VF5 D;  3LW5 H;  2KUB A;  4D6T E;  3MTU E;  2O01 N;  4GOD A;  2E75 C;  1RHZ B;  3GHG B;  2QM8 A;  3OA7 A;  1OW8 A;  3RK2 C;  5KAI H;  3RL0 C;  4B86 A;  1PP9 D;  2HG5 D;  1DD3 A;  4OH8 B;  5KJ7 A;  2WPR A;  1NTZ J;  3RBZ A;  5CJ4 A;  1RF1 C;  2FYN C;  5KLV E;  2E74 B;  2A06 G;  2POH A;  3AE2 C;  4N78 E;  1S9K D;  1KTM A;  2Q3I A;  3H1K G;  2UWJ E;  5AVT B;  1FZC C;  5BVZ A;  2HFE D;  2ZYG A;  2ITA A;  2QJY C;  2M3B A;  3L71 D;  3RK3 D;  1SQQ J;  3LIE A;  2XV5 A;  1SQP D;  5AVU B;  3RL0 g;  1AV1 A;  3MIW A;  3LID A;  3R4Y A;  1GMJ A;  1CSB A;  2ZXX A;  2WSE H;  1T3U A;  1FZA A;  1HH0 A;  4RKU J;  4DT0 A;  5KLV D;  2RKL A;  1BE3 G;  4N78 D;  2NRG A;  4AYC A;  3L36 A;  3B5N D;  1NU1 K;  1BCC G;  1SQX K;  1T2K C;  2OTJ P;  4WBA A;  2L91 A;  3AEB C;  3OAK A;  2QJK C;  1VDF A;  5KKZ C;  3E1R A;  1EDJ A;  2ZYD A;  3CXH I;  1AQT A;  3JCU E;  2QJY B;  4U7J A;  2KI7 B;  2FXP A;  1JB0 J;  2K3R A;  2KZI A;  1DH3 A;  3AE4 C;  2E5T A;  2CPS A;  3II6 A;  1K73 Q;  2N1T D;  2E43 A;  1GL2 D;  4H0L C;  3A0B E;  2IBZ D;  2Y0D A;  1BE3 J;  1T3J A;  2W83 C;  2JDI H;  1BCC J;  4IOI H;  3IF4 A;  3LW5 J;  1NTM K;  3B71 A;  2AEF A;  5E79 H;  3L73 J;  3G71 P;  4BRY A;  2FYU G;  1ZV8 A;  4BRY B;  4IL6 H;  2XND H;  3SFE C;  3ABV C;  2P7J A;  1PPJ G;  1SFC D;  2QJK B;  5KKZ B;  3IAO A;  1AVY A;  3H1I E;  4H13 C;  3MUD C;  1RE3 A;  3L74 G;  2GM4 A;  5AW4 B;  3CLQ A;  1CZQ A;  3GG2 A;  2Q5U A;  3H1L E;  4EDF A;  2FFD C;  3L70 J;  1LT1 A;  1X8Y A;  5AVW B;  2ZJS E;  3L72 E;  1NU1 J;  1SQX J;  2ZXE B;  2XZR A;  3A5T A;  1BSN A;  3EQ2 A;  2H7H A;  2CPB A;  3P8C D;  1SQV D;  4H0L B;  1WRG A;  3U59 A;  4I2L C;  1L0N K;  4WY4 D;  2KSJ A;  2FYU J;  1KQL A;  3TDK A;  2YXR B;  1A02 J;  2WSE J;  1L2P A;  1P84 E;  5CMZ A;  1KB9 E;  2GA1 A;  5BU5 A;  3AE6 C;  3CWB D;  2K1A A;  5APY A;  3G6E P;  3H1L D;  3CX5 E;  5AW2 B;  3MUD A;  1GW4 A;  2B87 A;  1EZV G;  1M56 D;  3L72 D;  4YTP C;  1IFD A;  2HOD A;  1HWT C;  3OJA B;  2HOD B;  3AE1 C;  4KJM A;  3AEG C;  1FDO A;  2A45 H;  1VQ7 P;  1NTM J;  3GF3 A;  3PTZ A;  4PD4 H;  1S5L H;  3O6Q A;  5AW6 B;  3S9O A;  3O6Q B;  1IC2 A;  2M5A A;  3QWO C;  1PGJ A;  2IFN A;  1P84 D;  1KB9 D;  1AQ5 A;  2Y9Y A;  1IK7 A;  2M5A B;  3VMZ A;  4LC1 A;  1OIP A;  4DCK A;  3EFG A;  3V2R A;  2B89 A;  1YHQ P;  1KIL C;  5GTI H;  2Q6Q A;  3N7N A;  1FU1 A;  2MJZ A;  1ZN5 A;  4D6T G;  4UB8 E;  3JC2 2;  1SLQ A;  4EIJ A;  3VN0 A;  3PJS K;  2O1K A;  2OYO A;  3CCE P;  4L76 A;  2XNX A;  3AE5 C;  1GZL A;  1K9M Q;  2Q1K A;  3M0D A;  3NTN A;  1GTW A;  2W27 A;  5EFW B;  1L0L E;  3EWK A;  1KQG B;  1RQV A;  1BSH A;  2P58 A;  2Q9I A;  2ZT9 C;  5H2F H;  2Z4E A;  3TNU A;  1JTH A;  2K37 A;  2LR2 A;  3TNU B;  4I6M C;  1G2C A;  4K35 A;  1DD4 A;  1JTH B;  3NXS A;  3CCJ P;  1G2C B;  2A45 G;  4O9B A;  1YIJ P;  1NWQ A;  3U1A A;  1GK6 A;  1KIL A;  4D6T J;  2Y0C A;  3B4S A;  1KIL B;  3A2A A;  3KXD A;  3HD7 D;  2O1J A;  2HPC A;  1HJ0 A;  1EXI A;  1KYO E;  5KLI C;  3D70 A;  2HPC B;  4YXW H;  2A45 I;  2E76 C;  1LTI C;  3KQG A;  3G9R A;  3KZI H;  1AA0 A;  3ITK A;  1N73 C;  1SQB K;  3R2P A;  3CC2 P;  2AXT H;  1WT6 A;  1EDK A;  2K9Y A;  4PV1 B;  2ZVN B;  1Q81 Q;  1N7S C;  5KJ7 D;  4PJ0 E;  1ZR4 A;  3L73 D;  2C9N Y;  2OTK E;  1J1E C;  1E5W A;  1VQ4 P;  1JY2 O;  1Z56 A;  3P32 A;  4ASV A;  3U1C A;  1S1C X;  2AEM A;  1KYO D;  2JP3 A;  1JM0 A;  3M0A A;  2OYI C;  3FWL A;  4WB4 A;  1U57 A;  1W2B O;  1VQP P;  5KLI B;  2D2C C;  2E76 B;  1SQX D;  1YBK A;  3WUV A;  1BGY E;  3NFQ A;  1H0T A;  3M9Q A;  1NOH A;  1NTZ K;  2G3A A;  3F5H A;  1H0T B;  3RGU A;  1A02 F;  1EQ7 A;  3CI9 A;  2KB7 P;  2M0B A;  3MD0 A;  4GT1 A;  2K88 A;  1N7S B;  1QVF O;  1K05 A;  1GK4 A;  3H1H E;  1KQS O;  1W5C E;  1SQQ K;  3H1I G;  1FZE A;  1J1E B;  2QIW A;  1JCC A;  3H1J J;  2LXC B;  1NKN A;  4JF7 A;  1RH5 B;  2WQY C;  1PGP A;  2OYI A;  2OYI B;  2H43 A;  1BGY D;  1L4A A;  3CCM P;  1GU5 A;  4UB6 E;  1X0T A;  2J59 M;  2N9B A;  1L4A B;  1XTC C;  1NTM D;  2IYP A;  2D2C B;  4IL6 E;  3Q3D A;  4XFJ A;  1S9K E;  5TIS H;  1L0N E;  4HH2 A;  1FJK A;  4JPZ B;  1R5S A;  4KT0 J;  1VQM P;  4GKG A;  3H1H D;  1KC8 Q;  1FOS E;  1AFO A;  2V7Q H;  1JMM A;  3H1I J;  4N3Y B;  5B66 H;  1SQP E;  1FS0 E;  2FBW C;  3PLN A;  3AE8 C;  4EOT A;  2QJP C;  1YYC A;  1LP1 A;  1J2J B;  1YQ4 C;  5KTB A;  3HUS C;  1KFM A;  1LP1 B;  1FOS F;  3BCC E;  3H25 A;  1UIX A;  4JYC A;  4WVZ A;  1L0N D;  5KAF H;  1URQ D;  2PAJ A;  3MGN A;  2W6B A;  2OGU A;  3AEC C;  1VQO P;  1H88 A;  2KP8 A;  2KLU A;  2OYH C;  2LKM A;  4TT3 H;  2E42 A;  1EDL A;  2WSS H;  2AXC A;  5K5G B;  1MV8 A;  1HF9 A;  3BVH A;  2I1J A;  1MFZ A;  5CJ0 A;  1KZU B;  3VMA A;  2E75 B;  2XDJ A;  1HTL C;  2OAR A;  3SWF A;  3USS A;  1FDI A;  1VQ5 P;  3BRV B;  3RK2 B;  2XKM A;  4PD4 E;  1X9V A;  3RL0 B;  3BCC D;  3HUS A;  1RF1 A;  1Y47 A;  2IBZ E;  2KYV A;  3HUS B;  3WMM 0;  1L0L G;  1RF1 B;  2FYN B;  3H1K J;  1XTG B;  1S72 P;  1LNQ A;  3I5C A;  1KQF B;  2J5U A;  1FZC A;  1ZME C;  4U3F E;  2OTL P;  5CCH D;  2KOG A;  1FZC B;  2FYU K;  2OYH A;  1VF5 C;  1H8A A;  2OYH B;  2BEQ D;  2RMZ A;  3PRJ A;  4TLF A;  4HKZ H;  4PD4 D;  1E79 H;  3V6I A;  2B88 A;  5APU A;  5GTH H;  1RF0 C;  3VMY A;  1YIT P;  3CCV P;  2V7Q J;  2GUS A;  2JKV A;  3SWK A;  3W67 A;  2BCC E;  2HLO A;  3E7K A;  3P8C E;  1SQB E;  2IPP A;  1SQV E;  4IL6 X;  3L4F A;  2IZ1 A;  2WWW A;  3TGU G;  3RK3 C;  4U3F D;  1Q7Y Q;  1ZOY C;  1VQ9 P;  2NPS C;  2E5Y A;  3AEF C;  2WTY A;  1X79 B;  4C7R A;  3CCU P;  1NAF A;  2QM7 A;  3CWB E;  3AE3 C;  1MFT A;  3A0H E;  3CMA P;  1IFI A;  2G8Y A;  1NTK G;  3IFM A;  1JY2 N;  2KSE A;  2H88 C;  3KZI E;  1M1K Q;  2H89 C;  4OGQ D;  3CCL P;  1RF0 A;  2BCC D;  1MUU A;  3D71 A;  1SQB D;  3HTK A;  3PH0 A;  3H6P A;  1DX7 A;  5APQ A;  1Q2N A;  3L75 G;  3HTK B;  3TGU J;  4JQ0 D;  1ZXG A;  1NTZ E;  1JMB A;  1SVF A;  2NPS A;  1EDI A;  2KNC A;  2NPS B;  3L74 J;  1N7L A;  4PV1 D;  2KNC B;  3H1H G;  1OW6 A;  4H13 B;  3M06 A;  1SQQ E;  2FFD A;  1AVO A;  1NTK J;  3AEA C;  2JO1 A;  1GL2 C;  2I1K A;  5AW1 B;  2FFD B;  5CHX A;  1RY3 A;  2YXQ B;  1S5L X;  1QX8 A;  3OW2 O;  1PP9 G;  1PIX A;  3L75 J;  1EZV I;  2NZ2 A;  3F89 A;  1NTZ D;  5BU8 B;  1NHL A;  1NO4 A;  3NMD A;  2R5B A;  2A06 E;  3SSU A;  1VL2 A;  1LGH B;  3VMX A;  4H44 D;  3WUU A;  1FC2 C;  3L71 G;  3KHU A;  4R4L A;  1SQQ D;  3ZDM A;  2R44 A;  5B5E H;  1FDM A;  2AEJ A;  1FBM A;  4IFM A;  5APT A;  1SQP G;  2YO3 A;  1GL2 A;  2Q7C A;  1GL2 B;  2O3J A;  1IFN A;  2Z5I A;  3V2Q A;  3JCU H;  1FZF A;  4JBZ A;  1PP9 J;  3CCR P;  2WPQ A;  1LWU C;  5AVY B;  4W7Y A;  4YXD C;  5KLV G;  1QGK B;  2C0W A;  1M90 Q;  2I8D A;  3K5B A;  2A06 D;  3CXH E;  4AQR D;  3FWN A;  2KLV A;  1BE3 E;  5AW8 B;  3H1K D;  1BCC E;  2WPV B;  1JY2 P;  1L4A D;  2M3E A;  5L8R J;  3L71 J;  3CC4 P;  2IZ0 A;  4HB1 A;  3L73 E;  1HVV A;  5KAI E;  1SQP J;  5DJT B;  2WVR A;  1KOR A;  4CPG A;  2GUV A;  3V4W A;  1S2E A;  1NAY A;  3TSI A;  3HE4 A;  1ZW0 A;  1M8O B;  3L70 E;  1H89 A;  5KAF E;  3HE4 B;  5KLV J;  1PFI A;  1BDC A;  3CXH D;  1N2D C;  2IBZ G;  1NU1 E;  1BE3 D;  4BXL A;  5C39 A;  2W6A A;  1SQX E;  1LWU B;  1BCC D;  1N8R Q;  1YJW P;  2E74 D;  2ZT9 B;  4ZKP A;  1LJ2 A;  3V2N A;  4U3F G;  5APS A;  4XE5 B;  3CC7 P;  1FE6 A;  4QMA A;  1U7J A;  1VQ8 P;  2WSC H;  1YTZ I;  2ZVO B;  4IFD K;  4I7Z C;  3L37 A;  1GD2 E;  4W80 A;  1N86 A;  1OXZ A;  5APW A;  2QEX P;  4WWI A;  2OQQ A;  3SFD C;  1EC5 A;  4L73 A;  2BEZ F;  4BWN A;  2BAS A;  3L70 D;  1P84 H;  5M1B A;  4AUW A;  2IX7 C;  3BAS A;  3M9H A;  3VYI A;  1NU1 D;  1N73 A;  3CX5 H;  2E75 D;  1ZRT E;  1N73 B;  1RE4 C;  3RK2 D;  1SQV G;  1PL5 A;  4R4M A;  3RL0 D;  2KXP B;  1NTM E;  1JY3 N;  2FKW B;  2YKQ A;  1N7S A;  3CME P;  2FXM A;  2FYU D;  2LXB A;  3MHV A;  1Q82 Q;  3D6Y A;  3P8M C;  3V5B A;  2Y0E A;  1GU4 A;  2FY8 A;  3HD7 C;  3CWB G;  4DZO A;  2P1J A;  3H1L G;  1YJ9 P;  1Y9B A;  5CCG C;  4I7Z B;  2O01 H;  3L72 G;  2Y9Z A;  1NVO A;  1K8A Q;  1EZV E;  3I55 P;  1ZRT D;  2WSF J;  5E79 E;  4N6J A;  3KYQ A;  5CBN A;  1VQK P;  3T97 A;  3IR9 A;  5KJ7 C;  1KD1 Q;  3T97 B;  3C1L A;  3S1K A;  1JNM A;  3UIA A;  5AVZ B;  1IK9 A;  2QA4 P;  1T2K D;  3A3Y B;  1JUN A;  4GOF A;  5DJU B;  3H1L J;  3HD7 A;  3SWY A;  2P2U A;  3HD7 B;  3L72 J;  5CCG A;  1EZV D;  3AEE C;  1HJB A;  1P84 I;  1GW3 A;  3CX5 I;  2WSC J;  1TU3 F;  2M8R A;  2WIT A;  2MKV A;  1L0L K;  1FZG A;  1KYO H;  2C9L Y;  4H0L D;  4KHX A;  1JO5 A;  4RES B;  1PGO A;  4A7P A;  1G1J A;  3I56 P;  5AW5 B;  1S4X A;  3MZW B;  5AW9 B;  1EXJ A;  1IFP A;  1USD A;  4C46 A;  4W7Z A;  2WPS A;  3VOP A;  5APX A;  4D6T D;  3KPE A;  2NPS D;  1ZP0 C;  4PJ0 H;  1S5L E;  3WU2 H;  1JY3 P;  2QRX A;  2QJP B;  2P10 A;  4H13 D;  3HRN A;  2R32 A;  3M9B A;  1MKM A;  5AVV B;  1VPC A;  1NH4 A;  2O01 J;  2PGD A;  1JEK A;  5GTI E;  4K3A A;  4HYT B;  5B5E E;  1S3J A;  2QVA A;  1FZB A;  1K04 A;  3L73 G;  1OW7 A;  2ZAE B;  3HE5 A;  3P7K A;  5AVQ B;  2KIK A;  1QEX A;  3C9I A;  3HE5 B;  1LTJ C;  2WZ7 A;  1VQN P;  1RE3 C;  1QL2 A;  2K9J A;  1NTK K;  2V4H A;  3H1J E;  4ZNC A;  3M91 A;  2IDB A;  2P67 A;  1YI2 P;  1JY3 O;  2K9J B;  3FX0 A;  1L0L J;  5H2F E;  3L70 G;  1URQ C;  1LTS C;  1KIL E;  1PGQ A;  1NU1 G;  1SQX G;  4LGD E;  1D7M A;  2YMK A;  4YPC A;  2JJL A;  1KYO I;  3N4X A;  3CCQ P;  1DIP A;  2YO2 A;  1Y8A A;  4IFF A;  3G3Z A;  4UB6 H;  1M7L A;  3FXD A;  1VF5 B;  2QG4 A;  1HGV A;  4DJG A;  1LTJ A;  2KS1 A;  3GW6 A;  1AJY A;  4OWF A;  3H1J D;  3C8V A;  2AXT E;  1OX3 A;  1LTJ B;  2KS1 B;  3B5N C;  1KIL D;  3E1I A;  3D6Z A;  1URQ A;  2QSI A;  2JWD A;  1VQ6 P;  1BGY G;  2HYN A;  1ZR2 A;  1URQ B;  5CCH C;  3PP5 A;  3WUT A;  1NTM G;  4LLH A;  3GMA A;  4NPF X;  4M3L A;  3RK3 B;  3W68 A;  3FGA D;  2W6J H;  1YJN P;  1UII A;  1KFN A;  2ZFC A;  2CK3 H;  1LTB C;  2ZT9 D;  2N1T C;  3H1I D;  1JOC A;  1R5L A;  1SQP K;  4ASW A;  3B5N A;  3BRT B;  1NJI Q;  3S4R A;  1Q86 Q;  1QVG O;  3B5N B;  3JSV C;  1CI6 A;  3A7O A;  2B87 B;  3V2P A;  1BGY J;  1HBW A;  3B8E B;  3Q5S A;  1CI6 B;  1BDD A;  1YTZ T;  3M0D C;  5KLV K;  4RO0 A;  1R8E A;  5CCH A;  1SFC C;  4GIF A;  1L0N G;  2E76 D;  1OVV A;  4I1L A;  2ZYA A;  3H1K E;  3MP7 B;  1PV3 A;  2YIU C;  3AED C;  3H1H J;  3L35 A;  1IO4 A;  1LTA C;  4OVN F;  1LTG C;  4EYY Q;  5APV A;  1RQU A;  2N1T A;  3CX5 D;  1N7S D;  4GOE A;  4OGQ C;  2WT7 A;  3CD6 P;  4L75 A;  3BAT A;  2N1T B;  1OVU A;  2WT7 B;  2L5G B;  3QH9 A;  2R3C A;  2FYZ A;  4WY4 C;  2HR3 A;  2YKP A;  5TIS E;  3BCC G;  4C7N A;  3IN6 A;  1OFC X;  1NYH A;  1SP4 A;  2FXO A;  2W8Z A;  2PRR A;  3VTP C;  4C7N B;  1X22 A;  2YNY A;  1YQ3 C;  1L0N J;  3AE9 C;  2YKO A;  4RJT A;  1ZLL A;  1SFC A;  2R3S A;  2H8P D;  1JCD A;  3A0B H;  2W90 A;  5B66 E;  4PV1 C;  1SFC B;  3AE7 C;  2D2C D;  2WSF H;  1IFM A;  2YIU B;  3V4Q A;  3Q1M A;  4NPE A;  1G1I A;  2PFX A;  1KV4 A;  4Z1M H;  5AW7 B;  5AW0 B;  4EI2 A;  4OGQ B;  1NKZ B;  1W2E A;  5AVX B;  2WMM A;  3BCC J;  1LWU A;  4WY4 A;  3PHL A;  3A0H H;  1OZH A;  2RH0 A;  1OWA A;  3TK1 A;  4WY4 B;  5CCG D;  1L0L D;  1IJD B;  4ZMD A;  4H44 C;  1U7M A;  2KZJ A;  1SQV K;  3TYY A;  3EFF K;  4PD4 I;  3TGU E;  2JEE A;  2FYU E;  2IBZ I;  2J58 A;  1WMK A;  1PPJ E;  2JWA A;  3WU2 E;  2JR8 A;  4MN4 C;  2C0X A;  1IFJ A;  3L74 E;  2N9Y B;  1KB9 H;  4GDO A;  1OMI A;  1LT9 C;  1HGZ A;  2PP6 A;  1QLE D;  1NTK E;  3H1J G;  2VRS A;  2XU6 A;  5TJH A;  2IYO A;  2BCC G;  4HJG H;  1M57 D;  1SQB G;  4Y99 C;  2SPZ A;  1QL1 A;  1M1J C;  4DOJ A;  1IZN B;  1FAV A;  1NGM B;  1L4A C;  1KN7 A;  2Q3E A;  2DW3 A;  3TGU D;  4U3F J;  3L75 E;  1SS1 A;  4L74 A;  2IFM A;  4H44 B;  2KK7 A;  1LTT C;  1GDT A;  1MZ9 A;  5AVR B;  1J1D C;  1PPJ D;  3RBX A;  3G4S P;  3O8Z A;  3TF5 A;  1VQL P;  5GTH E;  3L74 D;  5AVS B;  3H32 A;  1USE A;  1DEE G;  3GHG C;  3GF7 A;  3H32 B;  4JYB A;  1NTK D;  2Z5H A;  1LT9 A;  3GLM A;  4ZKU A;  2R5D A;  1LT9 B;  5CBO A; 
#chains in the Genus database with same CATH homology
 4D6T J;  2BCC J;  4PD4 I;  5KLV J;  1SQB J;  3L73 J;  1NTM J;  3CX5 I;  1SQV J;  3CXH I;  1SQP J;  3CWB J;  3L70 J;  3L74 J;  3H1L J;  3BCC J;  4U3F J;  3TGU J;  2FYU J;  2IBZ I;  1L0N J;  1BE3 J;  1NU1 J;  1KYO I;  3L75 J;  3L72 J;  1EZV I;  1SQX J;  3H1K J;  1BCC J;  1PP9 J;  1NTK J;  1BGY J;  3H1H J;  1SQQ J;  3L71 J;  1P84 I;  1NTZ J;  3H1J J;  1L0L J;  1KB9 I;  3H1I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...