1PP9J

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 24
structure length 62
sequence length 62
chains with identical sequence W
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1pp9J00
1PP9J 3L74J 3CX5I 1BCCJ 3L70J 1P84I 3TGUJ 3H1LJ 3H1KJ 3L75J 2FYUJ 3CXHI 1NTZJ 1NU1J 1KB9I 1L0NJ 3L71J 1L0LJ 3CWBJ 5KLVJ 2IBZI 1SQXJ 1BGYJ 1NTMJ 1EZVI 3H1JJ 3BCCJ 4PD4I 3L73J 3H1IJ 2BCCJ 1SQPJ 4D6TJ 1NTKJ 4U3FJ 3L72J 1SQBJ 1SQQJ 3H1HJ 1BE3J 1SQVJ 1KYOI
chains in the Genus database with same CATH superfamily
1NAFA 1X79B 2IYOA 4LGDE 1EC5A 1J1EC 2V7QJ 1NTMD 1J1DC 1LP1B 2FYUE 2QE7H 5AW1B 1L0NJ 3G4SP 1PFIA 4PD4D 2I8DA 3KZIE 3TSIA 3U59A 4EYYQ 1BDCA 3ABVC 1SQPD 2PAJA 1NTKD 4PJ0H 1SQXK 1NOHA 1X9VA 1ZN5A 3JC22 2KZIA 3CCQP 5B5EE 1OWAA 5H2FH 1OX3A 3H6PA 1SQVG 2W8ZA 2O1JA 3JCUH 1XTCC 1KB9H 5AW5B 1BSNA 4JF7A 1VF5D 2W6AA 1NU1J 1JNMA 1JEKA 2KXPB 3EQ2A 5GTIH 1YTZI 2FFDC 1U7MA 1X0TA 4L75A 1S4XA 3VP8A 2MJZA 1AV1A 2M8RA 1YQ4C 4K3AA 2V4HA 3V6IA 3BCCJ 1GTWA 1P84H 3HE5B 1UIXA 2IPPA 1SQVE 3SFDC 3MHVA 5AVYB 1OXZA 3T97A 3B5NC 1KB9I 4OH8B 1KN7A 3AE1C 2KZJA 3D71A 2IYPA 2N1TA 2E43A 3RL0D 2LXBA 1FZCC 3AEGC 2OYHC 2BEQD 1NTZK 2NPSA 1HVVA 1OW7A 2G3AA 5KLVG 3M9QA 1NTMJ 3H1LG 2JJLA 1EQ7A 1PGPA 1YTZT 1N73B 3FX0A 3R4YA 1QL1A 3F5HA 2OARA 2HODA 1FZBA 3GW6A 3M9HA 3D6YA 3H1JE 2NPSD 3AEAC 2BCCE 2B9BA 1G2CA 3PP5A 2WSFJ 1SQBK 3CMAP 2WSCH 3B71A 1KB9D 1GW3A 2WWWA 5KLVJ 1DD3A 2D2CD 2Z4EA 2QJPC 2KNCB 3GF3A 2WQYC 2ZVNB 1BE3J 3KHUA 3H1LE 1JMBA 2OYIB 5KJ7A 2KB7P 1SQXD 3PLNA 1S5LX 2H7HA 1KMIZ 3H1IG 4NPEA 1OMIA 1SQQG 2QA4P 4PV1B 1JTHB 3VMAA 3SWFA 3TF5A 3H32A 3M0AA 2N1TB 2H89C 4OVNF 3V4QA 2CK3H 2W90A 4UB6E 1NH4A 4ZNCA 3CXHE 1VPCA 3W68A 2R44A 3KDPB 4N6JA 3TGUG 4NPFX 2FYUK 1R5LA 3WU2E 1KZUB 3L74D 2KUBA 1ZRTE 5AW4B 3H1IE 1KFNA 1SQQJ 2FYNB 3V2RA 1KILB 4H44D 2E75D 5CCGC 1RY3A 1HUCA 2XKMA 4C46A 2J58A 2N9BA 1FOSE 3AECC 4OWFA 1OVUA 3NFQA 5APYA 1VQ4P 4RKUJ 1DEEG 3RK3E 1NTZD 5DJTB 3KZIH 4H0LC 2LXCB 2FFDA 3RGUA 2RH0A 2J5UA 3TGUJ 1LTJB 5E79E 1S9KD 3HD7A 1T6AA 3H25A 1EXIA 3L73G 1PIXA 1RF0A 1NGMB 2ZYGA 5B5EH 1OW8A 2C9NY 2P1JA 5AW6B 1RF1A 2C0XA 2Q5UA 1RE4A 4YXWH 1SQBD 1AVYA 1P84E 3PTZA 3BATA 3HD7D 1H88A 3L72G 2I1KA 1XTGB 1SQVK 2YKQA 1GU4A 1DD4A 2ZXEB 1QVFO 2W6JH 1JUNA 3CCEP 2WPVB 4W80A 3CWBG 1JCCA 1IFIA 2K88A 3L73J 3CCUP 3CI9A 1FC2C 1NKNA 1HWTC 3B5ND 4ZKPA 3IF4A 4I7ZB 1M56D 2E76D 2I1JA 2NRGA 3L72E 3L72J 2M3EA 3RK2B 1PPJD 2E5TA 2MKVA 1ZR2A 4PV1C 1CI6A 2OQQA 4H13B 2Z5HA 2KS1B 1BCCE 2K9JB 3P32A 4GOFA 1Q90D 4YTPC 2QRXA 3OJAB 3MGNA 2N1TC 2AXCA 3CWBJ 3CCSP 2FYUD 1URQB 4EI2A 4UB8E 3L70G 1RQUA 4JQ0D 1L0LG 1GDTA 1BGYJ 1R8EA 2YKOA 3P7KA 2JKVA 4IFMA 4QMAA 1N7LA 3V2PA 1JM0A 3L37A 3W67A 3L75D 3H1HG 1PP9G 2G8YA 1VQMP 1KILC 2KK7A 4GT1A 3HE4B 1A02F 2WVRA 1JY3O 2A06G 2KOGA 5KTBA 4U3FD 4RJTA 1NWQA 3IR9A 2CPBA 2Q7CA 1H0TB 3M91A 1OW6A 3U1AA 1CZQA 2QJKB 4R4LA 4DOJA 1AVOA 4I6MC 3S9OA 1KYOI 3HUSB 5M1BA 3L70J 1M7LA 1T2KC 1KFMA 2B89A 2OTJP 1L0NG 1L0LE 2YKPA 3MZWB 5KJ7C 3RL0g 3Q3DA 2ZT9B 5AVSB 1L4AA 3H1HE 1PP9J 1H89A 3Q5SA 1QEXA 3HE5A 2QEXP 2XU6A 5CCGA 3BRVB 2A06E 1SQVD 2XDJA 1VQNP 1YI2P 4CPGA 3N4XA 1LTBC 4UB6H 1GW4A 3C1LA 1YJ9P 1Q2NA 2XNDH 1G1JA 3CXHH 3S1KA 1DX7A 2YNYA 2A45H 1YYCA 3AEEC 4H44C 2E75C 1EDLA 1NU1G 2LR2A 1L0NE 4Y99B 2Z5IA 2YIUB 3WU2H 5CCGD 1KYOD 1EZVG 3I55P 4U7JA 1EXJA 2KYVA 1N73A 2AEMA 2P7JA 1N86A 2KIKA 1VQ8P 3BCCG 3CL3D 4GDOA 3TDKA 1ZW0A 4H0LD 5AVRB 3CD6P 2RKLA 3L36A 4H13C 1LT9A 3H1JD 4YPCA 3L75J 2PRRA 3CXHI 1T8ZA 2BCCD 4ASVA 2A45I 1NU1E 5E79H 4KJMA 4BRYB 3AEFC 3B4SA 1HJBA 5CCHC 2O01H 1Y47A 2M5AB 4U3FJ 2Q6QA 3P8MC 4IFFA 1URQC 1EZVE 4JYBA 3HD7C 1FE6A 2KNCA 3S4RA 1DIPA 2R5DA 3LW5H 2OYIA 3G6EP 1RF0C 2YMKA 1NTMG 1L4AB 3BCCE 2GUSA 4YXDC 5AVVB 1RF1C 2W83C 1RE4C 1JY2O 1JTHA 1E5WA 1FZAA 3BVHA 4LLHA 5KKZB 1SQPG 3KQGA 1M57D 2E76C 3HUSC 1JY3N 3A5TA 3CXHD 3MUDA 1J2JB 2Y0CA 3AE9C 2QVAA 2JWDA 1D7MA 3NMDA 1NTME 2OTKE 1KTMA 4PV1D 3I56P 1BE3G 1HBWA 2IFMA 2Y9YA 1K9MQ 1P84I 4I1LA 2N1TD 1ZRTD 2K1AA 3CX5E 1N7SA 1KILA 1MFTA 1SQPJ 1FZFA 1VQ9P 1NTKJ 1PL5A 5KLIB 1LT9B 1TU3F 2SPZA 1VQ5P 1K05A 3BASA 3FXDA 4A7PA 1FOSF 3B8EB 3CLQA 1OVRA 4UB8H 4DJGA 2UWJE 2C9LY 1OIPA 2AEFA 3R2PA 3NTNA 1LTJA 5KLVE 3G71P 4L73A 2YIUC 2WSEJ 2HLOA 1KILD 1UIIA 2XNXA 1VQ6P 1IZNB 1VDFA 3GG2A 1BE3E 1M1KQ 3VMZA 3USSA 1NO4A 3C9IA 5APTA 2WTYA 1KORA 2JDIH 1MV8A 1L0LK 3AE3C 1MKMA 5AW7B 1JY2P 1VL2A 3H1KD 4KHXA 2IBZG 1T2KD 2QJYB 2KLVA 3AE7C 1P84D 2B87B 1PGQA 1X22A 1BDDA 4XFJA 1SLQA 4Z1MH 5KJ7D 3GLMA 1NKZB 2W27A 1HGZA 1ZMEC 1IK7A 1FS0E 2R3CA 3L71D 2FXOA 1SP4A 1LTSC 2GUVA 3AEBC 4RESB 2QG4A 5GTHE 1YHQP 1LTTC 1L0NK 3ZDMA 4WY4B 1L4AC 1N2DC 3RK3B 3GMAA 3TYYA 1SQQE 2IBZE 1OFCX 1N7SB 5C39A 1GL2B 2R32A 4N3YB 2POHA 2KP8A 2FY8A 1JOCA 4D6TD 4ZMDA 3AE2C 2KS1A 2V7QH 1SQXG 2K9JA 3V4WA 2R3SA 1BCCD 1S3JA 2E74B 2KSEA 3CC4P 1T3UA 1NHLA 2WZ7A 2WT7B 1JY2N 3KPEA 4IOIH 5CCHA 3L35A 3TGUE 1URQA 3C8VA 2ZAEB 1SS1A 3PJSK 1NU1K 1S1CX 4ASWA 1PZQA 3CCRP 4H13D 2IDBA 3A0BE 2J59M 1N73C 5AVWB 1YQ3C 5CCHD 2HG5D 1SQXJ 3HE4A 3D70A 1URQD 1Q7YQ 4N78D 3TNUB 1LTIC 3GHGB 3VN0A 2K37A 1LT9C 2CPSA 1H0TA 2HYNA 3L74G 5CHXA 5APWA 5CJ4A 2H8PD 3H1KJ 1FDMA 3HUSA 1ZP0C 1LWUA 5APVA 1QGKB 1EDKA 3PHLA 3L73E 4IL6E 3K5BA 3RBZA 5DJUB 4HH2A 2OYIC 1L0LD 1J1EB 1J1DB 1NTZG 1OVVA 2VRSA 3L71J 3H1HD 1BGYG 1NTMK 1RHZB 2ITAA 2QJYC 3L74J 5L8RJ 2QSIA 1FZGA 3O8ZA 5BU8B 1RE3A 1WRGA 3WUVA 1HF9A 3CWBE 2L5GB 2ZT9D 3VMYA 4D6TJ 1SQBG 2P58A 2QIWA 1LTGC 4OGQB 2K9YA 4I2LC 5K5GB 1N8RQ 3MUDC 1HH0A 1WT6A 1GK6A 1KQFB 3AE4C 2ZYDA 1NTZJ 3A2AA 4WY4C 5KLVK 5AVXB 4B86A 3CX5H 4GODA 1BGYE 2E5YA 3RK3C 2JP3A 1GMJA 2WSCJ 2FYNC 1N7SC 2WSFH 3CMEP 3Q5RA 4KT0J 4DCKA 2E42A 3AE8C 5TJHA 4WWIA 2E74C 3LIEA 1SQBJ 4BRYA 3E1RA 4JBZA 2IFNA 1NU1D 2M5AA 1LWUB 1M8OB 3L70E 2WITA 3I5CA 1LTJC 1FAVA 2PP6A 3HTKB 1PPJG 1HGVA 2ZFCA 2WMMA 4IL6X 1VQPP 3FXEA 1W5CE 1E79H 1FZCB 3CX5I 1MFZA 2OYHB 1PP9E 1M1JA 3BCCD 1GK4A 2YXQB 3Q1MA 1IJDB 3VTPC 5B66H 1SFCB 3QWOC 3U1CA 1FJKA 1SQQK 1WMKA 3VMXA 1RH5B 1IFDA 1LTAC 2R5BA 1Y8AA 3G3ZA 3L75G 4O9BA 1L4AD 1M90Q 1JCDA 3O6QB 5GTHH 3MTUE 4U3FG 1ZV8A 2WPQA 3MD0A 5KAIE 4ZKUA 2LKMA 4TT3H 2WSSH 2FYUJ 2O3JA 2P2UA 3F89A 1AJYA 1AQ5A 4I7ZC 2QJPB 4K35A 1FZEA 3CX5D 1JY3P 3PH0A 5EFWB 2HPCB 1YJNP 3RK2C 3V2QA 3V5BA 1YIJP 1VQ7P 3MP7B 3WMM0 3WUTA 3L75E 3A0HE 2HFED 1IK9A 3AEDC 1A02J 3VP9A 1L2PA 5CMZA 5CBNA 4U3FE 1USEA 4GIFA 1Q82Q 2JWAA 4OGQC 3EWKA 5KLVD 4C7NB 2IZ1A 3FWNA 3A0BH 2Q1KA 2RN0A 3JSVC 1BE3D 2AXTE 3H1LD 2IBZI 1QL2A 1Y9BA 2NZ2A 3N7NA 1M1JB 2PGDA 3IAOA 2JO1A 1LNQA 4Y28J 2K3RA 3G9RA 3P8CE 1S5LE 4AUWA 2ZXXA 2B87A 1U7JA 1YJWP 2L91A 2QJKC 1NTKG 2ZVOB 2WPSA 5APXA 3IFMA 3CCLP 1OZHA 1SQVJ 4IL6H 3EFGA 1USDA 1LWUC 5TISE 3V2NA 5KAFE 2O01N 1EDIA 2YO3A 3H1JG 2YO2A 4WB4A 4C7RA 2BCCG 3M0DA 1NYHA 4WY4A 4H0LB 2ZT9C 2QM7A 4PD4E 1KQLA 1R5SA 5APQA 1ZXGA 3TK1A 2JEEA 1KYOE 3H1ID 1KQGB 1SQQD 1GL2A 2IBZD 2Y0EA 1DH3A 5CBOA 1ZLLA 1VF5B 4L74A 1SFCC 1SQPE 1NTKE 4IFDK 1G1IA 4JYCA 2BEZF 1IFMA 2O1KA 1JMMA 1RE3C 1W2BO 4WBAA 4WY4D 1IC2A 2WT7A 1ZOYC 3SWKA 5AW8B 3RK3D 4DZOA 3H1JJ 1VQLP 4Y99C 4RO0A 2XZRA 2BCCJ 3TGUD 1N7SD 4EDFA 5AVUB 1GL2D 2YMYA 4JPZB 4BXLA 3AE6C 2WPRA 2Q3IA 4AYCA 1KQSO 1GD2E 1KV4A 4R4MA 3BRTB 2H43A 5AVZB 2E74D 2Y9ZA 2B88A 2A45G 1SVFA 3SFEC 3H1LJ 5APUA 1NJIQ 5APSA 1FDIA 3TNUA 3RL0B 3GHGA 2IX7C 3A3YB 2IZ0A 5B66E 1AA0A 2N9YB 3M9BA 4M3LA 3T97B 1X8YA 3OAKA 5BU5A 5AW3B 3ITKA 4NPDA 3L73D 1CSBA 3VOPA 1K04A 2OGUA 4L76A 2KI7B 1M1JC 2NPSB 1IFPA 5AW2B 2M3BA 3GF7A 3L72D 1NVOA 4BWNA 5KKZC 3H1IJ 3WUUA 2D2CB 1QVGO 2P10A 3CWBD 2HODB 2RMZA 4PJ0E 3SWYA 3H1KG 1Q86Q 5KAIH 1K73Q 1G2CB 5H2FE 2W6BA 3JCUE 3RK2D 3FWLA 1HTLC 1KB9E 4XA4A 1AQTA 1FDOA 2JR8A 1HJ0A 1BGYD 1KILE 1MZ9A 1RQVA 3UIAA 3CCMP 5GTIE 2O01J 3L71G 1S2EA 1KC8Q 1SQXE 3IN6A 1VF5C 3A0HH 2Y0DA 3MIWA 4OGQD 5KLIC 5AW0B 2GA1A 3LW5J 4W7ZA 3HRNA 2ZYAA 3SSUA 3Q5PA 3H1KE 1Z56A 3PRJA 3CCJP 1T3JA 1JO5A 3B5NA 3HTKA 2AXTH 1PGJA 3L70D 4D6TG 3CC2P 1ZR4A 2FYZA 1BCCG 3CCVP 3H32B 4HKZH 1FZCA 2FBWC 4H44B 2E75B 4GKGA 2OYHA 3L71E 5AVQB 1PP9D 1PGOA 1S5LH 3NXSA 2P67A 3E1IA 1LJ2A 2GM4A 1DEBA 1SFCA 2FKWB 2A06D 3L74E 3RL0C 1LT1A 1W2EA 4HJGH 3CPWO 1FU1A 3VYIA 5TISH 4MN4C 5KAFH 1EZVI 1MUUA 3CC7P 1SQPK 1NTKK 4D6TE 4W7YA 3O6QA 1BCCJ 4TLFA 1L0ND 1GZLA 1BSHA 4PD4H 1SFCD 1NTZE 2FXMA 3M0DC 1KYOH 1LP1A 3OW2O 1EDJA 2FFDB 1KD1Q 1VQOP 1S9KE 3D6ZA 4XE5B 3HD7B 3RBXA 2Q9IA 2NPSC 2DW3A 3AE5C 5CJ0A 1GL2C 2HPCA 3EFFK 3QH9A 2BASA 3KXDA 4LC1A 1FJPA 2QM8A 1JB0J 5AW9B 1SQBE 2Q3EA 2D2CC 1RF1B 2WSEH 1S72P 4EIJA 4HB1A 1IO4A 4N78E 2H88C 1IFJA 2HR3A 3FGAD 1FBMA 3B5NB 4EOTA 1GU5A 2PFXA 4C7NA 1EZVD 3E7KA 4PD4I 2M0BA 4HYTB 1QLED 2E76B 2OYOA 3L4FA 2C0WA 3M06A 2XV5A 1YITP 1YBKA 2FYUG 3OA7A 2OTLP 3II6A 3LIDA 1LGHB 1NAYA 1L0LJ 2FXPA 4WVZA 2YXRB 1CW5A 2KSJA 1AFOA 5AVTB 3GHGC 3H1HJ 3P8CD 1H8AA 3Q2YA 5BVZA 2KLUA 2ZJSE 1K8AQ 3A7OA 1VQKP 4DT0A 3KYQA 4GOEA 1PPJE 1IFNA 1U57A 1PV3A 1CI6B 1QX8A 4AQRD 2AEJA 1Q81Q
chains in the Genus database with same CATH topology
1PP9J 3L74J 3CX5I 1BCCJ 3L70J 1P84I 3TGUJ 3H1LJ 3H1KJ 3L75J 2FYUJ 3CXHI 1NTZJ 1NU1J 1KB9I 1L0NJ 3L71J 1L0LJ 3CWBJ 5KLVJ 2IBZI 1SQXJ 1BGYJ 1NTMJ 1EZVI 3H1JJ 3BCCJ 4PD4I 3L73J 3H1IJ 2BCCJ 1SQPJ 4D6TJ 1NTKJ 4U3FJ 3L72J 1SQBJ 1SQQJ 3H1HJ 1BE3J 1SQVJ 1KYOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 J;  3L74 J;  3CX5 I;  1BCC J;  3L70 J;  1P84 I;  3TGU J;  3H1L J;  3H1K J;  3L75 J;  2FYU J;  3CXH I;  1NTZ J;  1NU1 J;  1KB9 I;  1L0N J;  3L71 J;  1L0L J;  3CWB J;  5KLV J;  2IBZ I;  1SQX J;  1BGY J;  1NTM J;  1EZV I;  3H1J J;  3BCC J;  4PD4 I;  3L73 J;  3H1I J;  2BCC J;  1SQP J;  4D6T J;  1NTK J;  4U3F J;  3L72 J;  1SQB J;  1SQQ J;  3H1H J;  1BE3 J;  1SQV J;  1KYO I; 
#chains in the Genus database with same CATH topology
 1NAF A;  1X79 B;  2IYO A;  4LGD E;  1EC5 A;  1J1E C;  2V7Q J;  1NTM D;  1J1D C;  1LP1 B;  2FYU E;  2QE7 H;  5AW1 B;  1L0N J;  3G4S P;  1PFI A;  4PD4 D;  2I8D A;  3KZI E;  3TSI A;  3U59 A;  4EYY Q;  1BDC A;  3ABV C;  1SQP D;  2PAJ A;  1NTK D;  4PJ0 H;  1SQX K;  1NOH A;  1X9V A;  1ZN5 A;  3JC2 2;  2KZI A;  3CCQ P;  5B5E E;  1OWA A;  5H2F H;  1OX3 A;  3H6P A;  1SQV G;  2W8Z A;  2O1J A;  3JCU H;  1XTC C;  1KB9 H;  5AW5 B;  1BSN A;  4JF7 A;  1VF5 D;  2W6A A;  1NU1 J;  1JNM A;  1JEK A;  2KXP B;  3EQ2 A;  5GTI H;  1YTZ I;  2FFD C;  1U7M A;  1X0T A;  4L75 A;  1S4X A;  3VP8 A;  2MJZ A;  1AV1 A;  2M8R A;  1YQ4 C;  4K3A A;  2V4H A;  3V6I A;  3BCC J;  1GTW A;  1P84 H;  3HE5 B;  1UIX A;  2IPP A;  1SQV E;  3SFD C;  3MHV A;  5AVY B;  1OXZ A;  3T97 A;  3B5N C;  1KB9 I;  4OH8 B;  1KN7 A;  3AE1 C;  2KZJ A;  3D71 A;  2IYP A;  2N1T A;  2E43 A;  3RL0 D;  2LXB A;  1FZC C;  3AEG C;  2OYH C;  2BEQ D;  1NTZ K;  2NPS A;  1HVV A;  1OW7 A;  2G3A A;  5KLV G;  3M9Q A;  1NTM J;  3H1L G;  2JJL A;  1EQ7 A;  1PGP A;  1YTZ T;  1N73 B;  3FX0 A;  3R4Y A;  1QL1 A;  3F5H A;  2OAR A;  2HOD A;  1FZB A;  3GW6 A;  3M9H A;  3D6Y A;  3H1J E;  2NPS D;  3AEA C;  2BCC E;  2B9B A;  1G2C A;  3PP5 A;  2WSF J;  1SQB K;  3CMA P;  2WSC H;  3B71 A;  1KB9 D;  1GW3 A;  2WWW A;  5KLV J;  1DD3 A;  2D2C D;  2Z4E A;  2QJP C;  2KNC B;  3GF3 A;  2WQY C;  2ZVN B;  1BE3 J;  3KHU A;  3H1L E;  1JMB A;  2OYI B;  5KJ7 A;  2KB7 P;  1SQX D;  3PLN A;  1S5L X;  2H7H A;  1KMI Z;  3H1I G;  4NPE A;  1OMI A;  1SQQ G;  2QA4 P;  4PV1 B;  1JTH B;  3VMA A;  3SWF A;  3TF5 A;  3H32 A;  3M0A A;  2N1T B;  2H89 C;  4OVN F;  3V4Q A;  2CK3 H;  2W90 A;  4UB6 E;  1NH4 A;  4ZNC A;  3CXH E;  1VPC A;  3W68 A;  2R44 A;  3KDP B;  4N6J A;  3TGU G;  4NPF X;  2FYU K;  1R5L A;  3WU2 E;  1KZU B;  3L74 D;  2KUB A;  1ZRT E;  5AW4 B;  3H1I E;  1KFN A;  1SQQ J;  2FYN B;  3V2R A;  1KIL B;  4H44 D;  2E75 D;  5CCG C;  1RY3 A;  1HUC A;  2XKM A;  4C46 A;  2J58 A;  2N9B A;  1FOS E;  3AEC C;  4OWF A;  1OVU A;  3NFQ A;  5APY A;  1VQ4 P;  4RKU J;  1DEE G;  3RK3 E;  1NTZ D;  5DJT B;  3KZI H;  4H0L C;  2LXC B;  2FFD A;  3RGU A;  2RH0 A;  2J5U A;  3TGU J;  1LTJ B;  5E79 E;  1S9K D;  3HD7 A;  1T6A A;  3H25 A;  1EXI A;  3L73 G;  1PIX A;  1RF0 A;  1NGM B;  2ZYG A;  5B5E H;  1OW8 A;  2C9N Y;  2P1J A;  5AW6 B;  1RF1 A;  2C0X A;  2Q5U A;  1RE4 A;  4YXW H;  1SQB D;  1AVY A;  1P84 E;  3PTZ A;  3BAT A;  3HD7 D;  1H88 A;  3L72 G;  2I1K A;  1XTG B;  1SQV K;  2YKQ A;  1GU4 A;  1DD4 A;  2ZXE B;  1QVF O;  2W6J H;  1JUN A;  3CCE P;  2WPV B;  4W80 A;  3CWB G;  1JCC A;  1IFI A;  2K88 A;  3L73 J;  3CCU P;  3CI9 A;  1FC2 C;  1NKN A;  1HWT C;  3B5N D;  4ZKP A;  3IF4 A;  4I7Z B;  1M56 D;  2E76 D;  2I1J A;  2NRG A;  3L72 E;  3L72 J;  2M3E A;  3RK2 B;  1PPJ D;  2E5T A;  2MKV A;  1ZR2 A;  4PV1 C;  1CI6 A;  2OQQ A;  4H13 B;  2Z5H A;  2KS1 B;  1BCC E;  2K9J B;  3P32 A;  4GOF A;  1Q90 D;  4YTP C;  2QRX A;  3OJA B;  3MGN A;  2N1T C;  2AXC A;  3CWB J;  3CCS P;  2FYU D;  1URQ B;  4EI2 A;  4UB8 E;  3L70 G;  1RQU A;  4JQ0 D;  1L0L G;  1GDT A;  1BGY J;  1R8E A;  2YKO A;  3P7K A;  2JKV A;  4IFM A;  4QMA A;  1N7L A;  3V2P A;  1JM0 A;  3L37 A;  3W67 A;  3L75 D;  3H1H G;  1PP9 G;  2G8Y A;  1VQM P;  1KIL C;  2KK7 A;  4GT1 A;  3HE4 B;  1A02 F;  2WVR A;  1JY3 O;  2A06 G;  2KOG A;  5KTB A;  4U3F D;  4RJT A;  1NWQ A;  3IR9 A;  2CPB A;  2Q7C A;  1H0T B;  3M91 A;  1OW6 A;  3U1A A;  1CZQ A;  2QJK B;  4R4L A;  4DOJ A;  1AVO A;  4I6M C;  3S9O A;  1KYO I;  3HUS B;  5M1B A;  3L70 J;  1M7L A;  1T2K C;  1KFM A;  2B89 A;  2OTJ P;  1L0N G;  1L0L E;  2YKP A;  3MZW B;  5KJ7 C;  3RL0 g;  3Q3D A;  2ZT9 B;  5AVS B;  1L4A A;  3H1H E;  1PP9 J;  1H89 A;  3Q5S A;  1QEX A;  3HE5 A;  2QEX P;  2XU6 A;  5CCG A;  3BRV B;  2A06 E;  1SQV D;  2XDJ A;  1VQN P;  1YI2 P;  4CPG A;  3N4X A;  1LTB C;  4UB6 H;  1GW4 A;  3C1L A;  1YJ9 P;  1Q2N A;  2XND H;  1G1J A;  3CXH H;  3S1K A;  1DX7 A;  2YNY A;  2A45 H;  1YYC A;  3AEE C;  4H44 C;  2E75 C;  1EDL A;  1NU1 G;  2LR2 A;  1L0N E;  4Y99 B;  2Z5I A;  2YIU B;  3WU2 H;  5CCG D;  1KYO D;  1EZV G;  3I55 P;  4U7J A;  1EXJ A;  2KYV A;  1N73 A;  2AEM A;  2P7J A;  1N86 A;  2KIK A;  1VQ8 P;  3BCC G;  3CL3 D;  4GDO A;  3TDK A;  1ZW0 A;  4H0L D;  5AVR B;  3CD6 P;  2RKL A;  3L36 A;  4H13 C;  1LT9 A;  3H1J D;  4YPC A;  3L75 J;  2PRR A;  3CXH I;  1T8Z A;  2BCC D;  4ASV A;  2A45 I;  1NU1 E;  5E79 H;  4KJM A;  4BRY B;  3AEF C;  3B4S A;  1HJB A;  5CCH C;  2O01 H;  1Y47 A;  2M5A B;  4U3F J;  2Q6Q A;  3P8M C;  4IFF A;  1URQ C;  1EZV E;  4JYB A;  3HD7 C;  1FE6 A;  2KNC A;  3S4R A;  1DIP A;  2R5D A;  3LW5 H;  2OYI A;  3G6E P;  1RF0 C;  2YMK A;  1NTM G;  1L4A B;  3BCC E;  2GUS A;  4YXD C;  5AVV B;  1RF1 C;  2W83 C;  1RE4 C;  1JY2 O;  1JTH A;  1E5W A;  1FZA A;  3BVH A;  4LLH A;  5KKZ B;  1SQP G;  3KQG A;  1M57 D;  2E76 C;  3HUS C;  1JY3 N;  3A5T A;  3CXH D;  3MUD A;  1J2J B;  2Y0C A;  3AE9 C;  2QVA A;  2JWD A;  1D7M A;  3NMD A;  1NTM E;  2OTK E;  1KTM A;  4PV1 D;  3I56 P;  1BE3 G;  1HBW A;  2IFM A;  2Y9Y A;  1K9M Q;  1P84 I;  4I1L A;  2N1T D;  1ZRT D;  2K1A A;  3CX5 E;  1N7S A;  1KIL A;  1MFT A;  1SQP J;  1FZF A;  1VQ9 P;  1NTK J;  1PL5 A;  5KLI B;  1LT9 B;  1TU3 F;  2SPZ A;  1VQ5 P;  1K05 A;  3BAS A;  3FXD A;  4A7P A;  1FOS F;  3B8E B;  3CLQ A;  1OVR A;  4UB8 H;  4DJG A;  2UWJ E;  2C9L Y;  1OIP A;  2AEF A;  3R2P A;  3NTN A;  1LTJ A;  5KLV E;  3G71 P;  4L73 A;  2YIU C;  2WSE J;  2HLO A;  1KIL D;  1UII A;  2XNX A;  1VQ6 P;  1IZN B;  1VDF A;  3GG2 A;  1BE3 E;  1M1K Q;  3VMZ A;  3USS A;  1NO4 A;  3C9I A;  5APT A;  2WTY A;  1KOR A;  2JDI H;  1MV8 A;  1L0L K;  3AE3 C;  1MKM A;  5AW7 B;  1JY2 P;  1VL2 A;  3H1K D;  4KHX A;  2IBZ G;  1T2K D;  2QJY B;  2KLV A;  3AE7 C;  1P84 D;  2B87 B;  1PGQ A;  1X22 A;  1BDD A;  4XFJ A;  1SLQ A;  4Z1M H;  5KJ7 D;  3GLM A;  1NKZ B;  2W27 A;  1HGZ A;  1ZME C;  1IK7 A;  1FS0 E;  2R3C A;  3L71 D;  2FXO A;  1SP4 A;  1LTS C;  2GUV A;  3AEB C;  4RES B;  2QG4 A;  5GTH E;  1YHQ P;  1LTT C;  1L0N K;  3ZDM A;  4WY4 B;  1L4A C;  1N2D C;  3RK3 B;  3GMA A;  3TYY A;  1SQQ E;  2IBZ E;  1OFC X;  1N7S B;  5C39 A;  1GL2 B;  2R32 A;  4N3Y B;  2POH A;  2KP8 A;  2FY8 A;  1JOC A;  4D6T D;  4ZMD A;  3AE2 C;  2KS1 A;  2V7Q H;  1SQX G;  2K9J A;  3V4W A;  2R3S A;  1BCC D;  1S3J A;  2E74 B;  2KSE A;  3CC4 P;  1T3U A;  1NHL A;  2WZ7 A;  2WT7 B;  1JY2 N;  3KPE A;  4IOI H;  5CCH A;  3L35 A;  3TGU E;  1URQ A;  3C8V A;  2ZAE B;  1SS1 A;  3PJS K;  1NU1 K;  1S1C X;  4ASW A;  1PZQ A;  3CCR P;  4H13 D;  2IDB A;  3A0B E;  2J59 M;  1N73 C;  5AVW B;  1YQ3 C;  5CCH D;  2HG5 D;  1SQX J;  3HE4 A;  3D70 A;  1URQ D;  1Q7Y Q;  4N78 D;  3TNU B;  1LTI C;  3GHG B;  3VN0 A;  2K37 A;  1LT9 C;  2CPS A;  1H0T A;  2HYN A;  3L74 G;  5CHX A;  5APW A;  5CJ4 A;  2H8P D;  3H1K J;  1FDM A;  3HUS A;  1ZP0 C;  1LWU A;  5APV A;  1QGK B;  1EDK A;  3PHL A;  3L73 E;  4IL6 E;  3K5B A;  3RBZ A;  5DJU B;  4HH2 A;  2OYI C;  1L0L D;  1J1E B;  1J1D B;  1NTZ G;  1OVV A;  2VRS A;  3L71 J;  3H1H D;  1BGY G;  1NTM K;  1RHZ B;  2ITA A;  2QJY C;  3L74 J;  5L8R J;  2QSI A;  1FZG A;  3O8Z A;  5BU8 B;  1RE3 A;  1WRG A;  3WUV A;  1HF9 A;  3CWB E;  2L5G B;  2ZT9 D;  3VMY A;  4D6T J;  1SQB G;  2P58 A;  2QIW A;  1LTG C;  4OGQ B;  2K9Y A;  4I2L C;  5K5G B;  1N8R Q;  3MUD C;  1HH0 A;  1WT6 A;  1GK6 A;  1KQF B;  3AE4 C;  2ZYD A;  1NTZ J;  3A2A A;  4WY4 C;  5KLV K;  5AVX B;  4B86 A;  3CX5 H;  4GOD A;  1BGY E;  2E5Y A;  3RK3 C;  2JP3 A;  1GMJ A;  2WSC J;  2FYN C;  1N7S C;  2WSF H;  3CME P;  3Q5R A;  4KT0 J;  4DCK A;  2E42 A;  3AE8 C;  5TJH A;  4WWI A;  2E74 C;  3LIE A;  1SQB J;  4BRY A;  3E1R A;  4JBZ A;  2IFN A;  1NU1 D;  2M5A A;  1LWU B;  1M8O B;  3L70 E;  2WIT A;  3I5C A;  1LTJ C;  1FAV A;  2PP6 A;  3HTK B;  1PPJ G;  1HGV A;  2ZFC A;  2WMM A;  4IL6 X;  1VQP P;  3FXE A;  1W5C E;  1E79 H;  1FZC B;  3CX5 I;  1MFZ A;  2OYH B;  1PP9 E;  1M1J A;  3BCC D;  1GK4 A;  2YXQ B;  3Q1M A;  1IJD B;  3VTP C;  5B66 H;  1SFC B;  3QWO C;  3U1C A;  1FJK A;  1SQQ K;  1WMK A;  3VMX A;  1RH5 B;  1IFD A;  1LTA C;  2R5B A;  1Y8A A;  3G3Z A;  3L75 G;  4O9B A;  1L4A D;  1M90 Q;  1JCD A;  3O6Q B;  5GTH H;  3MTU E;  4U3F G;  1ZV8 A;  2WPQ A;  3MD0 A;  5KAI E;  4ZKU A;  2LKM A;  4TT3 H;  2WSS H;  2FYU J;  2O3J A;  2P2U A;  3F89 A;  1AJY A;  1AQ5 A;  4I7Z C;  2QJP B;  4K35 A;  1FZE A;  3CX5 D;  1JY3 P;  3PH0 A;  5EFW B;  2HPC B;  1YJN P;  3RK2 C;  3V2Q A;  3V5B A;  1YIJ P;  1VQ7 P;  3MP7 B;  3WMM 0;  3WUT A;  3L75 E;  3A0H E;  2HFE D;  1IK9 A;  3AED C;  1A02 J;  3VP9 A;  1L2P A;  5CMZ A;  5CBN A;  4U3F E;  1USE A;  4GIF A;  1Q82 Q;  2JWA A;  4OGQ C;  3EWK A;  5KLV D;  4C7N B;  2IZ1 A;  3FWN A;  3A0B H;  2Q1K A;  2RN0 A;  3JSV C;  1BE3 D;  2AXT E;  3H1L D;  2IBZ I;  1QL2 A;  1Y9B A;  2NZ2 A;  3N7N A;  1M1J B;  2PGD A;  3IAO A;  2JO1 A;  1LNQ A;  4Y28 J;  2K3R A;  3G9R A;  3P8C E;  1S5L E;  4AUW A;  2ZXX A;  2B87 A;  1U7J A;  1YJW P;  2L91 A;  2QJK C;  1NTK G;  2ZVO B;  2WPS A;  5APX A;  3IFM A;  3CCL P;  1OZH A;  1SQV J;  4IL6 H;  3EFG A;  1USD A;  1LWU C;  5TIS E;  3V2N A;  5KAF E;  2O01 N;  1EDI A;  2YO3 A;  3H1J G;  2YO2 A;  4WB4 A;  4C7R A;  2BCC G;  3M0D A;  1NYH A;  4WY4 A;  4H0L B;  2ZT9 C;  2QM7 A;  4PD4 E;  1KQL A;  1R5S A;  5APQ A;  1ZXG A;  3TK1 A;  2JEE A;  1KYO E;  3H1I D;  1KQG B;  1SQQ D;  1GL2 A;  2IBZ D;  2Y0E A;  1DH3 A;  5CBO A;  1ZLL A;  1VF5 B;  4L74 A;  1SFC C;  1SQP E;  1NTK E;  4IFD K;  1G1I A;  4JYC A;  2BEZ F;  1IFM A;  2O1K A;  1JMM A;  1RE3 C;  1W2B O;  4WBA A;  4WY4 D;  1IC2 A;  2WT7 A;  1ZOY C;  3SWK A;  5AW8 B;  3RK3 D;  4DZO A;  3H1J J;  1VQL P;  4Y99 C;  4RO0 A;  2XZR A;  2BCC J;  3TGU D;  1N7S D;  4EDF A;  5AVU B;  1GL2 D;  2YMY A;  4JPZ B;  4BXL A;  3AE6 C;  2WPR A;  2Q3I A;  4AYC A;  1KQS O;  1GD2 E;  1KV4 A;  4R4M A;  3BRT B;  2H43 A;  5AVZ B;  2E74 D;  2Y9Z A;  2B88 A;  2A45 G;  1SVF A;  3SFE C;  3H1L J;  5APU A;  1NJI Q;  5APS A;  1FDI A;  3TNU A;  3RL0 B;  3GHG A;  2IX7 C;  3A3Y B;  2IZ0 A;  5B66 E;  1AA0 A;  2N9Y B;  3M9B A;  4M3L A;  3T97 B;  1X8Y A;  3OAK A;  5BU5 A;  5AW3 B;  3ITK A;  4NPD A;  3L73 D;  1CSB A;  3VOP A;  1K04 A;  2OGU A;  4L76 A;  2KI7 B;  1M1J C;  2NPS B;  1IFP A;  5AW2 B;  2M3B A;  3GF7 A;  3L72 D;  1NVO A;  4BWN A;  5KKZ C;  3H1I J;  3WUU A;  2D2C B;  1QVG O;  2P10 A;  3CWB D;  2HOD B;  2RMZ A;  4PJ0 E;  3SWY A;  3H1K G;  1Q86 Q;  5KAI H;  1K73 Q;  1G2C B;  5H2F E;  2W6B A;  3JCU E;  3RK2 D;  3FWL A;  1HTL C;  1KB9 E;  4XA4 A;  1AQT A;  1FDO A;  2JR8 A;  1HJ0 A;  1BGY D;  1KIL E;  1MZ9 A;  1RQV A;  3UIA A;  3CCM P;  5GTI E;  2O01 J;  3L71 G;  1S2E A;  1KC8 Q;  1SQX E;  3IN6 A;  1VF5 C;  3A0H H;  2Y0D A;  3MIW A;  4OGQ D;  5KLI C;  5AW0 B;  2GA1 A;  3LW5 J;  4W7Z A;  3HRN A;  2ZYA A;  3SSU A;  3Q5P A;  3H1K E;  1Z56 A;  3PRJ A;  3CCJ P;  1T3J A;  1JO5 A;  3B5N A;  3HTK A;  2AXT H;  1PGJ A;  3L70 D;  4D6T G;  3CC2 P;  1ZR4 A;  2FYZ A;  1BCC G;  3CCV P;  3H32 B;  4HKZ H;  1FZC A;  2FBW C;  4H44 B;  2E75 B;  4GKG A;  2OYH A;  3L71 E;  5AVQ B;  1PP9 D;  1PGO A;  1S5L H;  3NXS A;  2P67 A;  3E1I A;  1LJ2 A;  2GM4 A;  1DEB A;  1SFC A;  2FKW B;  2A06 D;  3L74 E;  3RL0 C;  1LT1 A;  1W2E A;  4HJG H;  3CPW O;  1FU1 A;  3VYI A;  5TIS H;  4MN4 C;  5KAF H;  1EZV I;  1MUU A;  3CC7 P;  1SQP K;  1NTK K;  4D6T E;  4W7Y A;  3O6Q A;  1BCC J;  4TLF A;  1L0N D;  1GZL A;  1BSH A;  4PD4 H;  1SFC D;  1NTZ E;  2FXM A;  3M0D C;  1KYO H;  1LP1 A;  3OW2 O;  1EDJ A;  2FFD B;  1KD1 Q;  1VQO P;  1S9K E;  3D6Z A;  4XE5 B;  3HD7 B;  3RBX A;  2Q9I A;  2NPS C;  2DW3 A;  3AE5 C;  5CJ0 A;  1GL2 C;  2HPC A;  3EFF K;  3QH9 A;  2BAS A;  3KXD A;  4LC1 A;  1FJP A;  2QM8 A;  1JB0 J;  5AW9 B;  1SQB E;  2Q3E A;  2D2C C;  1RF1 B;  2WSE H;  1S72 P;  4EIJ A;  4HB1 A;  1IO4 A;  4N78 E;  2H88 C;  1IFJ A;  2HR3 A;  3FGA D;  1FBM A;  3B5N B;  4EOT A;  1GU5 A;  2PFX A;  4C7N A;  1EZV D;  3E7K A;  4PD4 I;  2M0B A;  4HYT B;  1QLE D;  2E76 B;  2OYO A;  3L4F A;  2C0W A;  3M06 A;  2XV5 A;  1YIT P;  1YBK A;  2FYU G;  3OA7 A;  2OTL P;  3II6 A;  3LID A;  1LGH B;  1NAY A;  1L0L J;  2FXP A;  4WVZ A;  2YXR B;  1CW5 A;  2KSJ A;  1AFO A;  5AVT B;  3GHG C;  3H1H J;  3P8C D;  1H8A A;  3Q2Y A;  5BVZ A;  2KLU A;  2ZJS E;  1K8A Q;  3A7O A;  1VQK P;  4DT0 A;  3KYQ A;  4GOE A;  1PPJ E;  1IFN A;  1U57 A;  1PV3 A;  1CI6 B;  1QX8 A;  4AQR D;  2AEJ A;  1Q81 Q; 
#chains in the Genus database with same CATH homology
 1PP9 J;  3L74 J;  3CX5 I;  1BCC J;  3L70 J;  1P84 I;  3TGU J;  3H1L J;  3H1K J;  3L75 J;  2FYU J;  3CXH I;  1NTZ J;  1NU1 J;  1KB9 I;  1L0N J;  3L71 J;  1L0L J;  3CWB J;  5KLV J;  2IBZ I;  1SQX J;  1BGY J;  1NTM J;  1EZV I;  3H1J J;  3BCC J;  4PD4 I;  3L73 J;  3H1I J;  2BCC J;  1SQP J;  4D6T J;  1NTK J;  4U3F J;  3L72 J;  1SQB J;  1SQQ J;  3H1H J;  1BE3 J;  1SQV J;  1KYO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...