1PPCE

Geometry of binding of the benzamidine-and arginine-based inhibitors n-alpha-(2-naphthyl-sulphonyl-glycyl)-dl-p-amidinophenylalanyl-piperidine (napap) and (2r,4r)-4-methyl-1-[n-alpha-(3-methyl-1,2,3,4-tetrahydro-8-quinolinesulphonyl)-l-arginyl]-2-piperidine carboxylic acid (mqpa) to human alpha-thrombin: x-ray crystallographic determination of the
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Geometry of binding of the benzamidine- and arginine-based inhibitors N alpha-(2-naphthyl-sulphonyl-glycyl)-DL-p-amidinophenylalanyl-pipe ridine (NAPAP) and (2R,4R)-4-methyl-1-[N alpha-(3-methyl-1,2,3,4-tetrahydr quinolinesulphonyl)-L-arginyl]-2-piperidine carboxylic acid (MQPA) to human alpha-thrombin.X-ray crystallographic determination of the NA
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1991-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppcE02
1BTWA 2H2ZA 5IYTA 1O2LA 2JKHA 5L2ZH 1NFYA 2J38A 1UTKA 2ODQA 1DICA 6GCHF 5J4QA 5L2YH 1DUAA 3ZZBA 2FOGA 2A2QH 2GD4B 4Y76A 3B9FH 1UVSH 5E2PA 1SLVB 1WCZA 3SJOA 5F8XA 1G9IE 2ZZUH 5EPYA 1GJ8B 3TK5A 1W7GH 1CA8B 2BY8X 1MU6B 1S6FA 2XBVA 2AGGX 1JWTA 1E38B 1ELAA 1J8AA 3A7TA 1C1PA 3VFEA 1BB0B 1B0FA 1HIAB 3MU1A 2P95A 4JZ1A 1O2HA 1UTLM 4GHTA 1K2I1 3E6PH 1GBDA 5C3NA 4UFDH 1RXPA 1ZPZA 3SGBE 5ABWA 2BVRH 1EXFA 2G4UA 1TFXA 3UY9A 4RN6A 2A1DB 1INCA 2EI6A 4GCHF 2B8OH 2Q6GA 4IN2A 2VB0A 1FJSA 5A0BA 1ESBA 3SJ9A 3BEUA 1GG6C 5TJXA 3MI4A 3LU9B 1MZDA 3EA9A 1Z6EA 1B0EA 1GBMA 4MNVA 1O2MA 2H9EH 3A7XA 3TJVA 2FXRA 1P3CA 1UK4A 3QWCH 3UQOA 1A5IA 4NG9H 2C93B 3SU1A 4HGCA 7GCHF 5EU8A 4R8TB 3ZVCA 3GICB 3O8CA 1QURH 3PMHB 4DY7B 1NRQH 3DA9B 5JBAS 3S69A 1TB6H 2JH6D 1W13U 1PQ8A 2A2XH 4XBBA 1KDQB 8GCHG 1ETRH 1YC0A 1VGCC 4NFEA 5H4IB 2STBE 4JZDH 3RUOA 2QAAA 1ZR0A 2BX3A 1C5QA 1RTLA 3I77A 2Z9JA 2TGPZ 2J2UA 1FN8A 2W5EA 2A0QB 2FP7B 3DFLA 3KQEA 1AIXH 3VGCB 1QJ7B 3W94A 2VU8E 3GY2A 2PWXA 4U2WA 1C5VA 1YLCA 1G30B 1EASA 3PTNA 1QJ1B 4UONA 2XRCA 4AB8A 1HFDA 1QR3E 2IOTA 2BOKA 2BM2A 4LZ4B 3E8LA 5HGGA 1N6XA 1GCDA 4NA7A 5A0AE 4UFGH 3A89A 3C1KA 3MO9A 2CHAB 5T3HA 4CBNA 1A5HA 1LHEH 3ZZ3A 1ELDE 4UE7H 1HAPH 2ZU4A 1K1LA 1O31A 1LKAA 1C9TA 1SPJA 2QA9E 1BJVA 4NWKA 1SGRE 4ESTE 1C1SA 1O30A 3ITIA 1MMJN 2ZA5A 1FY4A 2FS9A 3SN8A 5EXMA 2K1QA 1M9UA 2A5IA 3GDUA 1ESTA 2Y82A 1RIWB 1A3BH 2FOEA 3M7QA 1QA7A 5EW2H 5F6MA 3QX5H 1NROH 1JMOH 1RIWC 2Z3CA 1MD7A 3PWBA 1SGYE 2ALVA 2F9PA 1QRZA 2ZF0H 5A09A 3K9XB 3NPSA 3F68H 2GGVB 2GDDA 1GVZA 3A87A 1O2PA 1WU1A 4X8SH 3S0NA 1H4WA 1MKWH 3ZV9A 1BBRH 2QXJA 4OS2A 5I25A 3TK9A 2VH0A 1V2TT 1DY8A 2R0KA 2ODPA 3GCOA 2VIWA 1TX7A 2GDEH 1MAXA 1VR1H 2FEQH 1JXPA 1AB9B 4X6NA 1A4WH 3OTJE 4Y8YA 1QL7A 3A81A 1EPTA 3RXIA 5JB9S 1BRBE 1S6HA 4AG1A 1FI8A 3QDZB 1F5LA 3ZYEA 3M37A 1DVAH 1K28D 1Z8GA 2THFB 3T26A 1GHXH 5JB8S 1CGJE 1BA8B 4X0WU 5GIBA 4NZQA 1EQ9A 1ID5H 3KN2A 1P3EA 1BIOA 1YGCH 2I6SA 1ZPCA 1G37A 2G81E 2A5KA 2CN0H 2J95A 1UHBA 2FOHA 2ULLA 3VGCC 1KYNA 1V2PT 3GCTG 1Z8JB 5EQQA 2BDGA 3G01A 4ZROA 2ZC9H 2AMQA 3BEFB 3K6ZA 5JPMH 2FS8A 1GBEA 2F9OA 2ZWLH 3UOUA 1O32A 1GDUA 3LGVA 2FTMA 2BDIA 1KXAA 2Z9IA 2P8OB 1AFQB 4CREA 1OP0A 1EAWA 1KTSB 1S0RA 4J1YA 3PWCA 3MU5A 1F0TA 5K7RA 2BMGB 3ZVFA 1D3TB 1FNIA 1YPEH 4AFUA 3FANA 4LZ1H 2Z3EA 7LPRA 2ZPQA 4Y8XA 1SGIB 1AWFH 1XUKA 4TPIZ 3U98H 4IC6A 1G32B 1V2MT 1HJAB 1ZSJA 1SGEE 1MBQA 3ZZ6A 1C5SA 1VJAU 1CO7E 3A86A 2O9QA 2A4OA 2M5TA 1G36A 3MTYA 2BXUH 2GKVE 1A0HB 1XKBC 5EODA 1F2SE 1HYLA 3QK1A 1O2XA 1DXWA 3GY7A 1BZXE 1AD8H 1F0UA 5DP3A 1XUJA 2ZFQH 2OCVB 3M5NA 3GY8A 1J16A 2STAE 1C4U2 1ZRKA 3D49H 2ZPSA 1O3MA 3HGPA 3S9CA 1WQSA 1TIOA 1Y5BT 1BBRE 2PR3A 1TGNA 1V2OT 1YM0A 4D76A 3TNTA 2ZHEH 3M61U 2ODYB 4M7GA 3RXOA 1YKTA 5EW1H 2H5DA 4SGBE 4ZXYH 3KQBA 3STIA 2V0BA 3RXFA 3UTUH 3F9HA 1TBQH 2SGEE 1P10A 1O2GH 3MHWU 3T29A 1BUIA 1CHGA 1SLXB 5FHTA 4B76A 3RXCA 1P57B 1C1OA 1ZGVA 3SNCA 4FUFA 4HI3A 1C5UA 1G3EA 1SL3A 1W8BH 2V35A 4ABFA 1OP8A 2Z7FE 1O5AB 2HLCA 3E91A 2LNCA 1EOLA 5E8EH 3A85A 1C1TA 1K22H 2GV6A 5HYOA 1YPKH 1B5GH 1TAWA 1O3FA 4CRDA 2ZPRA 2QXHA 1EB1H 3EYDA 1GMHF 3FFGA 3RXTA 3LGUA 1SLUB 2ZDAH 2OC0A 1AB9C 1ANBA 1QCPA 1G2LA 2TGAA 5DPAA 4X2VA 1IQLA 3PLKA 3E16B 2PUXB 8LPRA 1O3CA 2ZKSA 2UUKB 4O97A 4OS5A 3SI4H 1O5DH 4PROA 6LPRA 1TX6A 3CS0A 1HAOH 4CRGA 1FPCH 4OGYA 3K65B 4BOHA 1S5SA 1GBHA 2Z3DA 1MTNB 4MLFB 2QXIA 1RJXB 2FOAA 2J4IA 5F8ZA 1ESAA 1SR5C 2ZI2H 2ZQ1A 4NSVA 2EI7A 3MMGA 4MVNA 2VH6A 3A88A 2FLBH 2PSXA 1AUJA 4GLYA 3VPKA 2AIPA 4UFEH 5A8XA 1HRTH 4HTCH 3QZRA 4FUIA 3RXMA 4Z6AH 1GMDF 1O34A 3F9FA 1KLJH 2J94A 1CE5A 1YPGH 4X1RU 3E90B 1OWEA 2ZECA 1EOJA 3K2UA 1YCPK 1UTPA 5AFYH 1PPEE 1MAYA 1MKXH 3R3GB 1XUHA 1GDNA 1NT1A 3UUZA 2GCHG 2WPJS 5FXLA 3RU4E 1ELCA 2PGBB 1VITG 2BVSH 3M3SA 1AKSB 1E0FD 2ZHFH 1EB2A 1BOQA 4KTCA 4MG3A 4Y0ZE 1QBOA 3ATIA 2XBXA 3RU4T 3VB3A 3KHVA 1J14A 1ELVA 1X7AC 1EKBB 4OS7A 1SC8U 2FWWA 4LXBH 1YCPH 1GBBA 1DITH 4NIXA 2BTCE 3B8JA 4Y7BA 4A1XA 1TRNA 2D1JA 1MTUA 4ISIH 4NIYA 1WSSH 1ZZZA 5FX6A 3SU6A 4ISOA 3EAJA 4JK5A 1T7CA 1HJ9A 3HKJB 1IQNA 1MTVA 2ZFTA 1ANCA 3U1JB 3DFJA 2FOBA 1DY9A 1TNGA 1AHTH 1MUEB 3SHAH 2RG3A 2LPRA 3BTEE 2ZFFH 1TX8A 2VIQA 1P01A 3QTVH 1TALA 3CP7A 2CF8H 5DP6A 1SVPA 1WV7H 5FPTA 1GHWH 1V3XA 1AQ7A 1GHBF 2O8LA 1XUGA 4O9VA 1DSTA 1GI2A 4YLUA 5GPIB 3OSYA 2BVXH 1PPCE 2UUFB 1KY9A 1GMCF 1MZAA 1FONA 2O8TA 1LVYA 2G55A 1O37A 2ZCKP 3TNSA 1G2MA 4H6TA 4OS4A 1PQ5A 5G4BA 4OGXA 3PMAB 3VEQB 3MH7A 4A5TS 1P2JA 1THPB 1TPAE 1O2QA 2BQ7B 2IPHA 1HAGE 1O3AA 4GCHG 1GPZA 2ALPA 4MPVA 1L1GA 3OYPA 1LQEA 3BTGE 4YLQH 1AGJA 1E35B 1FDPA 3C27B 1G3DA 4WXVA 1TYNA 1YYY1 2FPZA 3URDA 1XUIA 1MQ6A 3Q00A 1S0QA 5A2MH 4DGJA 2H6MA 2VINA 2D8WA 1UVUH 3BTKE 3H7OA 3EGKH 2BLVA 2C3SA 1NESE 2ZCHP 3F9GA 3SNBA 1GGDC 3GCHB 2ZO3H 1UJ1A 1O2UA 2C8ZB 1P06A 4K1EA 1AMHA 3IWMA 5CMXH 2C4FH 1V2WT 4KKDA 4ASHA 2XYAA 3KQCA 1O5BB 1SQAA 1D3DB 2GTBA 5FX5A 1CHOF 1ZPBA 4ABAA 1XXDA 1U6QA 1P9UA 3M5OA 1Z1JA 3BG8A 1GBAA 3LPRA 2YNBA 3ZZ4A 2F9NA 3PLPA 3UWIA 4CR5A 1O33A 3URCA 1TRMA 1PPFE 1N1LA 2BHGA 1O2VA 4TY7A 1CU1A 2ZU3A 1ORFA 3PO1C 3Q3YA 4I8JA 3SUEA 2QGRA 4MPWA 1UK3A 4K60A 4WF8A 1RTFB 1BMMH 5PTPA 1AE8H 5CE1A 1DS2E 2HALA 1BBRK 3BTFE 1TE0A 2G4TA 1JRTA 4AYYB 1PPBH 1TOMH 2ZGXH 2FYQA 2JH0D 3L3TA 1QQ4A 4WH8A 3SI3H 4TPYA 2UWLA 3T25A 4IMQA 2XC4A 3QGJA 4KELA 3RXVA 1FZZA 1Y5AT 4DJZB 2BY9X 3HK6B 1P2KA 1OYTH 1ZTKA 2FI5E 2AS9A 4AG2A 1A46H 1HLTH 1NO9H 3M7UA 3STJA 1D3PB 1NY22 4MNYA 3ATLA 1BMLA 1EZSC 3O8DA 3VXFH 1VITF 1QGFA 4X8TH 1JBUH 2D26C 2DE9A 3UNRA 5DJ7A 1RS0A 2A5AA 3ZVBA 3NK8A 1ZHMA 1GJBB 5EPNA 1TBZH 2ZGCA 2VIPA 3NUMA 5A8ZA 4JZIA 1NFWA 2V3OH 1TQ7B 1A61H 2RA0A 2ZNKH 1P03A 3M36A 1LTOA 2OC8A 4NIWA 2OBOA 5DO4H 1K1JA 2ZHWH 1CBWB 4I33A 1WTHD 4Y8ZA 3KNXA 1HXEH 5E0HA 2QV1A 2QF3A 3UQVA 1FAKH 3RM2H 2WPLS 1HAZB 1XXFA 2ZGHA 4FUJA 1XMNB 1P0SH 1N8OC 4THNH 1XVOA 3P8FA 3GISB 3FZDA 3P17H 2P3FH 1IAUA 1Y8TA 1CT0E 3TVJB 4E7NA 1TA2A 5C67A 3SNEA 1AN1E 1OXGA 3GDVA 2BXTH 3QN7A 4FUGA 1Y3UA 3M5MA 1F5KU 2BY7X 1HBTH 4U32A 4NCYA 2NWNA 2HRVA 3A7YA 3KQDA 4WY3A 1SGDE 3H5CB 3F6UH 1QA0A 1W14U 1E36B 1SFQB 1EPTC 1UMAH 2PHBA 4MNXA 5GXPA 2GX4A 2BD5A 1S81A 1ZRBA 4UFFH 4ZKOU 1UTNA 1A0LA 3VB5A 1BRCE 2W7UA 5K0HA 3Q3XA 3JZ1B 3SGAE 4Q80A 1S85A 4BTIB 1PYTC 1THRH 4JMYA 4RKOB 5ETXA 4F49A 1O2NA 1GL0E 2GT7A 1BQYA 3MNSA 1O2OA 1K1IA 1O3NA 4AYVB 2ZG0H 3VXEH 1EJAA 1IQFA 1NPMA 4FUEA 3L6PA 7GCHG 1GDQA 1C1WH 2QXGA 3BTTE 3P92A 4B71A 2FO9A 3A80A 1AVXA 2DUCA 2F3CE 1CGHA 4I8GA 2AFQB 1FAXA 2VIOA 1TLDA 3MWIU 1L0ZA 1O3PB 2R2WU 1DLEA 4X8VH 4YM9A 3BF6H 1LVMA 2HNTF 1QBVH 1NRRH 4UDWH 1KSNA 1FMGA 1SGPE 3EA8A 2GVFA 2QCYA 1LPZB 1UCYH 1AZ8A 4B74A 2BY5X 4Q2KA 1P9SA 4ABDA 1BMNH 1ZTLA 1EZXC 1DWCH 1LO6A 4AFSA 1O36A 2SNWA 2P94A 1Y3XA 2C8XB 1KTTB 4Y7AA 1TWXB 2OC7A 1ELFA 5LPRA 4K1SA 2PTCE 1NRSH 2GZ9A 1WOFA 3ZZAA 3SV7A 3LC5A 8ESTE 4FXGH 5C1UA 1HDTH 4B2CA 1CA0B 2WPHS 1GJ4H 1BTPA 3LJJA 1L2EA 3MFJA 3SU0A 1CGIE 2J9NA 3FVFB 5FPYA 1GHZA 1GMDG 3RXEA 2UUJB 1L1NA 4TYDA 2JH5D 3PMJA 1O2SA 5AHGH 2CJIA 1QHRB 1UCYE 2FX6A 1FV9A 1QIXB 3CENA 1OWKA 2TRMA 3IITA 1P8VC 1SGFG 4JK6A 2H9TH 2A7JA 2UWPA 1DDJA 4JYTA 2R0LA 4WMFA 1HJAC 1ANDA 4B1TA 4ZHLU 2PV9B 1UTJA 1BRAA 4BANB 2H5CA 3HATH 5J4SA 3T28A 2GCTB 2XXLA 1KDQA 4U30A 1Y3VA 5TCAA 3P8GA 4BNRA 2NU0E 1DOJA 3LOXA 1J9CH 1OOKB 3SOSA 1B7XB 4IGDA 1NM6A 1O5CB 2VVUA 1CHOG 3DUXH 2GMTC 4D9RA 4J2YB 4BAQB 1AVGH 2EC9H 4OS1A 1C1MA 4A92A 1LPGB 1NZQH 4WH6A 1A5GH 5C2ZA 1AY6H 3SU2A 3LGIA 1W0YH 3P95A 2FTLE 1EPTB 1YLDA 1JOUB 2TGDA 2GT8A 2P59A 3DHKH 1FLEE 3SU4A 3HGNA 1P12E 3RMNH 3SBKA 1MU8B 1SI5H 1T8MA 4ZH8A 3NXPA 4FVBA 1K1MA 1ELBA 3GCHC 1ETTH 1EX3A 1O2ZA 1ZHPA 4A7IB 2ZDLA 4WVPE 3ZVEA 3JZ2B 2CXVA 4FU8A 1K1NA 1MH0A 1N8OB 3T2NA 2BQWB 3RXJA 2BLQA 4WMEA 1OS8A 5DK1A 2SGAA 3RXUA 3SUGA 5E2OA 5C5NA 2GZ7A 3ENSB 3TJUA 2P93A 4K2YA 1NTPA 1VJ9U 1TNIA 3QUMP 1C5WB 4X1NU 1HGTH 1OPHB 3ATMA 4ABEA 1AKSA 3QZQA 1AU8A 1K1PA 2SGQE 3SQHE 4DOQA 2FODA 3UWJH 1GG6B 4ZHMU 2QYIA 1MCTA 1ZSKA 1TMUH 1GHAG 2C90B 3AAUA 2BLWA 2R2MB 3HKIB 1DX5M 2Z9LA 3M3TA 2C8YB 1JIMA 1W10U 3LKWA 2R9PA 4AZ2B 3BTWE 1SQOA 4BXSA 1ACBE 1D6WA 4BTUB 2Y7ZA 4AFQA 4CR9A 3A84A 1AE5A 2JETC 3LDXH 4KP0A 2CHAC 3MYWA 1L4ZA 1ABJH 1E37B 2YOLA 2QIQA 4E05H 3LC3A 3A82A 5FCKA 2OXSA 1V6DA 1XKAC 1EJNA 1QBNA 3BG4C 5EGMA 2FI3E 2F91A 3SJIA 2XNIA 3PM3A 4ISNA 1V2UT 3PB1E 3TH2H 1O3KA 2AERH 1GBLA 1GHBG 3M35A 2WINI 3A8AA 1TBRH 2ZDKA 3U8RH 3S9BA 1YCPM 2KAIB 2ZGJA 3ZVDA 5F03A 3GDSA 3KGPA 1EATA 4JYVH 2BD7A 3TU7H 3U8TH 1MKWK 1XM1A 3SNAA 1IQKA 4K1TA 2AH4X 4INLA 1C5ZB 2A32A 2OQUA 3TJOA 1FY1A 3RXSA 1O38A 1GHYH 1DANH 1Y5UT 3TJNA 3RXQA 1T8LA 2D2DA 2ZTYA 3BIVH 3FZZA 2BDBA 4FU7A 1DT2A 2ANYA 3U9AH 3RXGA 1DUEA 1QL9A 1H9HE 2B9LA 5DGJA 3BTDE 3Q76A 2ZDMA 4IW4E 1TPPA 3WY8A 1GJ6A 3ATKA 1GGDB 5JBBS 1QJ6B 1T8OA 4NWLA 1TMBH 3NWUA 1SBWA 1GJCB 3MOCA 1O5EH 1HJ8A 3L33A 2ANKH 5ESBA 1V2QT 2A7HA 2BD8A 2VNTA 1XUFA 2Z94A 3MU0A 1IQIA 3ODDA 4QT8C 2VGCB 4IBLH 3BSQA 2A7CA 2ASUB 2IJOB 1SFIA 1OWHA 2O8WA 4IN1A 1UTQA 2I6QA 2SGFE 3UREA 1ZSLA 4CHAB 1HIAA 2VJ1A 2FM2A 1AO5A 1L4DA 1TGSZ 3RLYH 3UIRA 2NU4E 1P11E 3VB6A 1GJ5H 1PPGE 1C1UH 1MTNC 1G3BA 2FZZA 4ZKRU 1K21H 3RC5A 2FESH 2VWLA 1O3EA 1YPMH 5JBCS 4GHQA 1SHHB 5L30H 1AVWA 7KMEH 1PPZA 1Q3XA 3ZVGA 1GI3A 3IG6B 1O3BA 1YPJH 2XWBI 3E3TA 1O3IA 1TMTH 2O8UA 3AASA 4GSOA 1D3QB 1QY6A 1PQAA 1A7SA 3SQEE 1FUJA 4F4OC 2VGCC 2BZAA 2H1UA 1LKBA 4BAMB 6CHAB 1O5FH 3E0NB 3ZZCA 1KXCA 3UR9A 1WQVH 2BLOA 1LDTT 3GY5A 3ZZDA 1SOTA 3RXDA 1GHVH 1GL1A 2DE8A 3KEEA 2Q6FA 1H8IH 4I8LA 1LCYA 4AN7A 1VITH 2Y80A 4A6LA 2PKSB 4ZKNU 2AGIX 1GCTC 1SB1H 2TBSA 1P2OA 5C1XA 3LGTA 5HM2A 3UPEA 4ZMAH 1BITA 2GP9B 1PJPA 4KTSA 2ZEBA 1VCWA 1IOEA 3SV6A 4ZKSU 3BEIB 2W3KA 1RRKA 4DW2U 1QRXA 4TY6A 1HCGA 1GI6A 1SQTA 5DG6A 2SGPE 2ZQ2A 3RMLH 4MPUA 1C1VH 3LH1A 1O3GA 3GCTF 3GOVB 3SGQE 1JRSA 1ELGA 1WUNH 3RXRA 2BY6X 2YNAA 3BG4B 3SUFA 4BAKB 2XBWA 1IHSH 1P2NA 1HUTH 1A0JA 1GBFA 1V2RT 3SNDA 5C5OA 2FOCA 2A45B 1Q31A 2EEKA 1HAXB 4FUHA 1SLWB 3UNQA 2PFEA 1ANEA 4RSPA 3TK6A 1SGCA 1UO6A 2FYRA 3SORA 1IQMA 1Z71A 1YBWA 4XDEA 4BTTB 3A8DA 1O5GH 1C4Y2 1NU7B 4INHA 1HV7A 2WYGA 3PO1B 2WV5A 3V13A 4RKJB 2G52A 1IQJA 5LPEA 2WUBA 1S84A 1O0DH 1AZZA 5TCCA 1QL8A 3K6YA 2KAIA 1PQ7A 1OYQA 4KTUA 2Y5HA 4IMZA 1UVPA 3HK3B 2Q6DA 2GZ8A 3LGWA 3V0XA 4TWYA 1GJ7B 2F9UA 2AMDA 4WXIA 1H9IE 1RFNA 2WPMS 1JIRA 3SV9A 1D6RA 1AWHB 1C2MA 3LT3A 2QY0B 4MQAA 3SO3A 1YPHE 3A7WA 3TIUA 3AW1A 1F7ZA 5AFZH 1EAIA 3U69H 1RD3B 7ESTE 4IC5A 1ZMLA 1GCTB 1LPKB 4GAWA 4YESB 1DLKB 2A4GA 1QB1A 1UHBB 4H4FA 1J15A 2PKAB 5DP4A 8GCHF 1KXFA 4H6SB 3TPIZ 1N6YA 2W26A 4DG4A 2PTNA 1W2KH 2Y5GA 4ZAEA 3MU4A 1DWBH 1CBWC 5B6OA 1J17T 6CHAC 1OSSA 2Q1JA 1LHCH 1Z6JH 1Z1IA 1C2LA 5C20A 1F92A 1OP2A 2VIDA 4FUBA 4FUCA 2ZDVH 1DM4B 2GMTB 4WJG2 1QFKH 4X6OA 9ESTA 4CRCA 1W12U 1WBGB 1BTXA 1AI8H 3P70B 5DP9A 1BCUH 4U01A 3N7OA 2G5NA 2G5VA 4XE4A 1LVOA 4XOJA 1UK2A 2HWLB 3RMOH 2WV4A 3RXAA 4ABIA 2B7DH 4CRFA 1F5RA 1CT4E 4AB9A 1H9LB 1GI4A 2BOHB 5FBIA 2ZU5A 8KME2 1IQHA 3EDXB 2TIOA 2XCFA 1TA6A 4JZEH 1HAVA 3TGKE 1KXDA 2AIQA 3SU5A 4CRAA 4NIVA 5DKMA 3NCLA 4AGJA 1SGFA 3U8OH 1GBCA 3D65E 5A8YA 1DWDH 4X2WA 1LVBA 3TGIE 3SJ8A 2BDYA 1DPOA 2BZ6H 4AOQA 3FP6E 4NGAH 6GCHG 3GYLB 3A8BA 3TLOA 1QB9A 4DCDA 1C9PA 2OINA 5LPFA 2IN2A 1TNJA 4I7YH 1YF4A 5I46H 1C1NA 5A0CA 1IQEA 5ESTE 3KCGH 4ISHH 2BDHA 3RU4D 1P2IA 5FPSA 3GY6A 1IQGA 1F0SA 1V2LT 1CSOE 4Y79A 4AORA 4MNWA 1O3HA 1NRNH 1ZJDA 3RXPA 3ZZ8A 3BIUH 3PTBA 3SZNA 1HAIH 2XC0A 2BD9A 1LHDH 2OUAA 1AFQC 2BB4A 2RA3A 1C2GA 1TRYA 3B23B 3FP8E 1C5LH 1P02A 5HM9A 1O3OA 3EA7A 2ANWA 4X6PA 1GHAF 3VB4A 1YP9A 4FUDA 1PPHE 4FVDA 3ELAH 4D8NA 4NSYA 4CRBA 1VZQH 4AFZA 5AVDA 4K8YA 1Y59T 4I31A 3KIDU 4NZLA 2PKSC 3Q77A 5JDUB 3M7TA 2ILNA 1ARBA 2PLXA 3EQ0H 1KIGH 2J92A 1YPHC 2EI8A 4ABHA 1QB6A 2FI4E 1HNEE 2G00A 2FOFA 4YO9A 1ETSH 4X1SU 2EA3A 3E0PB 1DWEH 1BMAA 1DE7H 2ZTXA 1FQ3A 3KL6A 1TGTA 1WTGH 3RXKA 2ZU2A 2FOMB 1GMCG 3PV4A 4K5ZA 5BPEA 1GVLA 1FY8E 2BQ6B 2VIVA 3A7VA 4X2YA 1F0RA 1MTWA 3RC4A 1QTFA 2ZU1A 1BHXF 1S82A 4UEHH 2ZIQH 3AAVA 4FU9A 3UNSA 3T62A 4AX9H 3GY4A 3BV9B 1C1QA 3NZIA 4AGKA 1NS3A 3S7KB 1TNHA 5GCHG 3ZV8A 4JZFH 5GJ4B 3ODFA 2P3UB 4WMDA 5LGOA 5AF9H 2ZCLP 3MH4A 1ABIH 1L1JA 3MNXA 1C2JA 3SV2H 1O2JA 1FIZA 2A4QA 4Y0YE 2SFAA 5C1YA 2XBYA 1BHXB 3AW0A 1ZMJA 3I78A 4SGAE 3P6ZB 3A83A 1Z8RA 1D9IA 2AYWA 4HZHA 4YOIA 2HPQH 4YZUA 2TGTA 4OS6A 3M3VA 1P2QA 4O03A 4GVUA 1Y3WA 1CT2E 3FP7E 4XFQA 2B0FA 1FXYA 2OC1A 1T4UH 1LQDB 1BDAA 2UUYA 4LOYH 1GJAB 1MD8A 4BAOB 3GY3A 3TH4H 1QNJA 2W3IA 1O2KA 3RM0H 1FN6A 3MO6A 3KF2A 4O3UA 1GI7B 1CA0C 1ZMNA 5T6GA 1C2IA 2P16A 1UTOA 4X1PU 3ZYDA 3D62A 4IS5A 2WUCA 1HAYB 1GMHG 4ABJA 2ANMH 2PKAA 1TGBA 2HNTC 2AMPA 3V7TA 1GVKB 1BTZA 3S7HB 4XSKU 4JCNA 4E7RG 4Y11E 1T32A 1NN6A 1KXEA 3AVZA 3RXHA 4B73A 1A2CH 2CGAA 4A1TA 1TPOA 1P2MA 2RDLA 1OKXA 2ZHQH 2Z9KA 1MBMA 5EQSA 2HNTE 3BTME 1VGCB 3OU0A 4D9QA 4XBCA 3S9AA 3PROA 1XX9A 1UTMA 4YOJA 4MTBA 1Y3YA 1TNLA 1LHGH 4WWYA 1NC6A 4KGAA 2F83A 1V2ST 1O3JA 2J34A 5DP5A 2A31A 1C2EA 4Y6DA 3Q3KA 3T27A 1VCQA 2ZFPH 3LONA 2V3HH 1QRWA 4UD9H 2NU2E 1C5XB 1NFUA 4BAHB 3PMBB 2ZFSA 2FIRH 1ZJKA 3PLBA 1MQ5A 1O39A 2H9HA 2QC2A 4D7GA 4XBDA 1AFEH 1LHFH 1QQUA 2WPIS 4X8UH 1BTUA 1WAYB 1SMFE 4E06H 2JETB 1O2WA 4R0IA 1YPLH 1TABE 3RP2A 4BXWA 4A1VA 2O8MA 2Y6TA 4B2BA 1O3LA 3LGYA 1ZGIA 3VB7A 2ZDNA 5EG4A 2PSYA 2PUQH 2VVVA 3UOPA 2GCHF 4O3TA 1E34B 1NRPH 5F8TA 4CBOA 3BTHE 3SU3A 5JYIA 3BN9A 1HAHH 4NA8A 1V2NT 1GI8B 2ZGBH 4ABGA 4YTAA 5T6FA 4CH2B 1SGTA 1EP5A 2HOBA 4JYUH 2OTVA 4MPXA 3SV8A 1SSXA 4I32A 1DFPA 1NFXA 3SJKA 3W95A 2B5TB 1C2KA 2BD3A 2AEIH 1GBKA 2NU3E 1IHTH 1NU9A 1GBIA 1Q2WA 3FAOA 1D4PB 3ATWA 1KLIH 2ZTZA 1W3CA 2ZP0H 1EZQA 5EOKA 2OP9A 1HAVB 3NKKA 1BTYA 3MH6A 2F9BH 4YT7H 1LMWB 4LK4A 1OX1A 4DVAU 4ISLA 5GWZA 4K8BA 5FCRA 4K69A 5BRRE 2FX4A 3ZZ9A 1DSUA 5CHAC 3RXBA 5E0GA 4Z0KA 5DP8A 1MTSA 4INKA 3RMMH 3PYHA 3O8RA 2SGDE 1UVOA 1GJDB 3V3MA 1C1RA 3ZVAA 1RGQA 2AGEX 3P8NA 4NFFA 2VWOA 1OWJA 4GUXA 1KXBA 4DIHH 3I29A 2FLRH 1ZHRA 1EZUC 1BT7A 3MO3A 4Y10E 1UVTH 2Y5FA 1RTKA 1O2RA 2BDAA 3TH3H 2VWNA 1A3EH 1O2YA 2XTTB 2QN5T 1GBTA 3RC6A 1C5NH 2XW9A 3F9EA 1C5TA 3LJOA 4B75A 1GI0A 5CHAB 4DT7B 2R3UA 1ZLRA 2GCTC 4Q7XA 4TWWA 2ESTE 1DXPA 1O2TA 3SW2B 1KLTA 1TOCB 1TNKA 1CQQA 3OX7U 1OWIA 3OY6U 4X2XA 1SOZA 1W11U 1SHYA 2ZFRH 4Q7ZA 3QGNB 5IDKA 1FY3A 3ZZ7A 1OWDA 1PFXC 1T31A 2UWOA 5EXLA 4CH8B 5HXFA 4ZUHA 4I8HA 3QTOH 5JBTA 3R0FA 3GCNA 3LIWA 1EAUA 1C5YB 2GV7A 3U1IB 5FBEA 4I8KA 2BX4A 2PW8H 4B2AA 4VGCC 3OY5U 2WYJA 2G51A 1HXFH 2G8TA 5EQRA 4ZHAA 3SUDA 1S83A 3O8BA 3UR6A 1WYKA 1UCYK 1A1RA 2Y7XA 1HPGA 2SNVA 3MU8A 4VGCB 1AUTC 3D23A 3BTQE 3LH3A 1FY5A 2CMYA 1O2IA 5E0JA 3M5LA 5SGAE 3A7ZA 2RCEA 5L6NH 4Q7YA 5GDSH 1Z8IB 2W7SA 1EAXA 4DIIH 3MH5A 3QLPH 4X6MA 1Z7KA 2FMJA 1ELTA 4ABBA 2QF0A 3A8CA 4YT6H 3P8OA 4ZXXH 3TGJE 4HFPB 5LH8A 1CVWH 2Z9GA 2PGQB 2XWAA 1K9OE 2NU1E 2V6NA 1P09A 1SGQE 1ZOMA 4H42U 1BRUP 1W0ZU 2P3TB 3RXLA 3F1SB 1BTHH 2TPIZ 1TPSA 3DT0H 2CV3A 4Y71A 3RLWH 1T8NA 2VVCA 4GPGA 3RDZA 3EE0B 2HVXA 1TONA 1BJUA 2FDAA 1GJ9B 2F9VA 1O3DA 2Y81A 3E1XB 3SHCH 1C2HA 3ZZ5A 2P8OC 3MNBA 4CHAC 3ESTA 2BYAX 1K1OA 1HB0B 1C4V2 3HPTB 4YOGA 1ZTJA 1VCPA 2ZHDA 1FPHH 1THSH 1P05A 4MDSA 2BD2A 2A4RA 3UFAA 1ELEE 1MCVA 4DURA 3GYMA 2BDCA 1V2JT 1C2FA 2HGTH 1O35A 1SG8B 1XVMA 5EXNA 9LPRA 1FIWA 4NA9H 2OD3B 5FAHA 5T6DA 1C5OH 4K3JA 2R3YA 1W7XH 1GI5A 1C5RA 1T4VH 2OLGA 4D7FA 1EP6A 1EJMA 3V12A 3MNCA 2VWMA 1ARCA 1PYTD 1SGNE 1GBJA 5DP7A 3CS7A 1MKXK 3TITA 5HMAA 3DD2H 1GI1A 1TGCA 5GCHF 1H8DH 2OQ5A 2C8WB 1G3CA 1C5MD 1EUFA 1V2VT 2WPKS 2CF9H 1ZYOA 1C5PA 2Z6BD 3T5FH 1P04A 1GI9B 2OBQA 4X1QU 1C2DA 2BD4A 3QO6A 1H1BA 3H7TA 1V2KT 2HPPH 2XCNA 2XC5A 1GWAA 1TQ0B 6ESTA
chains in the Genus database with same CATH superfamily
1BTWA 2H2ZA 5IYTA 1O2LA 2JKHA 5L2ZH 1NFYA 2J38A 1UTKA 2ODQA 1DICA 6GCHF 5J4QA 5L2YH 1DUAA 3ZZBA 2FOGA 2A2QH 2GD4B 4Y76A 3B9FH 1UVSH 2KCAA 3AK5A 5E2PA 1SLVB 1WCZA 3SJOA 5F8XA 1G9IE 2ZZUH 5EPYA 3PV5A 1GJ8B 3TK5A 1W7GH 1CA8B 2BY8X 1MU6B 1S6FA 2XBVA 2AGGX 1JWTA 1E38B 1ELAA 1J8AA 3A7TA 1C1PA 3VFEA 1BB0B 1B0FA 1HIAB 3MU1A 2P95A 4JZ1A 1O2HA 1UTLM 4GHTA 1K2I1 3E6PH 1GBDA 5C3NA 4UFDH 1RXPA 1ZPZA 5FL7D 3SGBE 5ABWA 2BVRH 1EXFA 2G4UA 1TFXA 3UY9A 4RN6A 2A1DB 1INCA 2EI6A 4GCHF 2B8OH 2Q6GA 4IN2A 2VB0A 1FJSA 5A0BA 1ESBA 3SJ9A 3BEUA 1GG6C 5TJXA 3H09A 3LU9B 3MI4A 1MZDA 3EA9A 1Z6EA 1B0EA 1GBMA 4MNVA 1O2MA 2H9EH 3A7XA 3TJVA 2FXRA 1P3CA 1UK4A 3QWCH 1BMFD 3UQOA 1A5IA 4NG9H 2C93B 3SU1A 4HGCA 7GCHF 5EU8A 4R8TB 3ZVCA 3GICB 3O8CA 1QURH 3PMHB 4DY7B 3ZIAD 1NRQH 1OHHD 3DA9B 5JBAS 3S69A 1TB6H 2JH6D 1W13U 1PQ8A 2A2XH 4XBBA 1KDQB 8GCHG 1ETRH 1YC0A 1VGCC 4NFEA 5H4IB 2STBE 4JZDH 3RUOA 2QAAA 1ZR0A 2BX3A 2WPDD 3OEHD 1C5QA 1RTLA 3I77A 2Z9JA 2TGPZ 2J2UA 1FN8A 2W5EA 2A0QB 3SYJA 2FP7B 3DFLA 3KQEA 1AIXH 3VGCB 1QJ7B 3W94A 2VU8E 3GY2A 2PWXA 4U2WA 1C5VA 1YLCA 1G30B 4F55A 1EASA 3PTNA 1QJ1B 4UONA 2XRCA 4AB8A 1HFDA 1QR3E 2IOTA 2BOKA 2BM2A 2F43B 4LZ4B 3E8LA 5HGGA 4RI0A 1N6XA 1GCDA 4NA7A 5A0AE 4UFGH 3A89A 3FN8A 3C1KA 3MO9A 2CHAB 5T3HA 4CBNA 1A5HA 5C94A 1LHEH 3ZZ3A 1ELDE 4UE7H 1HAPH 2ZU4A 5KEDA 1K1LA 1O31A 1LKAA 1C9TA 1SPJA 2QA9E 1BJVA 4NWKA 1SGRE 4ESTE 1C1SA 1O30A 3ITIA 1MMJN 2ZA5A 1FY4A 2FS9A 3SN8A 5EXMA 2K1QA 1M9UA 2A5IA 3GDUA 1ESTA 2Y82A 1RIWB 1A3BH 2FOEA 3M7QA 1QA7A 5EW2H 5F6MA 3QX5H 1NROH 1JMOH 1RIWC 2Z3CA 1MD7A 3PWBA 1SGYE 2ALVA 2F9PA 1QRZA 2ZF0H 5A09A 3K9XB 3NPSA 3F68H 2GGVB 2GDDA 1GVZA 3A87A 1O2PA 1WU1A 4X8SH 3S0NA 1H4WA 1MKWH 3ZV9A 1BBRH 2QXJA 4OS2A 5I25A 3TK9A 2VH0A 1V2TT 1DY8A 2R0KA 1KMHB 2ODPA 3GCOA 2VIWA 1TX7A 2GDEH 1MAXA 1VR1H 2FEQH 1JXPA 1AB9B 4X6NA 1A4WH 3OTJE 4Y8YA 1QL7A 3A81A 1EPTA 3RXIA 5JB9S 1BRBE 1S6HA 3CNRA 4AG1A 1FI8A 3QDZB 1F5LA 3ZYEA 3M37A 1DVAH 1K28D 1Z8GA 2THFB 3T26A 1GHXH 5JB8S 1CGJE 1BA8B 4X0WU 5GIBA 4NZQA 1EQ9A 1ID5H 3KN2A 1P3EA 1BIOA 1YGCH 2I6SA 4ASUD 1ZPCA 1G37A 2G81E 2A5KA 2CN0H 2J95A 1UHBA 2FOHA 2ULLA 3VGCC 1KYNA 1V2PT 1H8ED 3GCTG 1VKYA 1Z8JB 5EQQA 2BDGA 3G01A 4ZROA 2ZC9H 2AMQA 5EJ1A 3BEFB 3K6ZA 5JPMH 2FS8A 1GBEA 2F9OA 2ZWLH 3UOUA 1O32A 1GDUA 3LGVA 2FTMA 2BDIA 1KXAA 2Z9IA 2P8OB 1AFQB 4CREA 1OP0A 1EAWA 1KTSB 1S0RA 4J1YA 3PWCA 3MU5A 1F0TA 5K7RA 2BMGB 3ZVFA 1D3TB 2WV9A 1FNIA 1YPEH 4AFUA 3FANA 4LZ1H 2Z3EA 7LPRA 2ZPQA 4Y8XA 1SGIB 1AWFH 1XUKA 4TPIZ 3U98H 4IC6A 1G32B 1V2MT 1HJAB 1ZSJA 1SGEE 1MBQA 2RDEA 3ZZ6A 1C5SA 1VJAU 1CO7E 3A86A 2O9QA 1W0JD 2A4OA 2M5TA 1G36A 3MTYA 2BXUH 2GKVE 1A0HB 1XKBC 5EODA 1F2SE 1HYLA 3QK1A 1O2XA 1DXWA 3GY7A 1BZXE 1AD8H 1F0UA 5DP3A 1XUJA 2ZFQH 2OCVB 3M5NA 3GY8A 1J16A 2JJ2D 2STAE 1C4U2 1ZRKA 3D49H 2ZPSA 3F2HA 1O3MA 3HGPA 3S9CA 1WQSA 1TIOA 1Y5BT 1BBRE 2PR3A 1TGNA 1V2OT 1YM0A 4D76A 3TNTA 2ZHEH 3M61U 2ODYB 4M7GA 3RXOA 1YKTA 5EW1H 2H5DA 4SGBE 4ZXYH 3KQBA 3STIA 2V0BA 3RXFA 3UTUH 3F9HA 1S6LA 1TBQH 2SGEE 1P10A 1O2GH 3MHWU 3T29A 1BUIA 1CHGA 1SLXB 5FHTA 4B76A 3RXCA 2YMSC 1P57B 1C1OA 1ZGVA 2JIZD 3SNCA 4FUFA 4HI3A 1C5UA 1G3EA 1SL3A 1W8BH 2V35A 4ABFA 1OP8A 2Z7FE 1O5AB 2HLCA 3E91A 2LNCA 2EY4C 3WWFA 1EOLA 3FO8D 5E8EH 3A85A 1C1TA 1K22H 2GV6A 1H8HD 3W1EA 5HYOA 1YPKH 1B5GH 1TAWA 1O3FA 4CRDA 2ZPRA 2QXHA 1EB1H 3EYDA 1GMHF 3FFGA 5KECA 1YLNA 2L74A 3RXTA 3LGUA 1SLUB 2ZDAH 2OC0A 1AB9C 1ANBA 1QCPA 1G2LA 2TGAA 5DPAA 3FOAA 4X2VA 1IQLA 3PLKA 3E16B 2PUXB 8LPRA 1O3CA 3KQ5A 5B6LA 2ZKSA 2UUKB 4O97A 4OS5A 3SI4H 1O5DH 4PROA 6LPRA 1TX6A 2WSSD 3CS0A 1HAOH 4CRGA 1FPCH 4OGYA 3K65B 4BOHA 1S5SA 1GBHA 2IJD1 2Z3DA 1MTNB 4MLFB 2K8IA 2QXIA 1RJXB 2FOAA 2J4IA 5F8ZA 1ESAA 1SR5C 2ZI2H 2ZQ1A 4NSVA 2EI7A 3MMGA 4B6FA 4MVNA 2VH6A 5HKKD 3A88A 2FLBH 2PSXA 1AUJA 4GLYA 3VPKA 2AIPA 4UFEH 5A8XA 1HRTH 4HTCH 3QZRA 4FUIA 3RXMA 4Z6AH 1GMDF 1O34A 3F9FA 1KLJH 2J94A 1CE5A 1YPGH 4X1RU 3E90B 1OWEA 2ZECA 1EOJA 3K2UA 2QE7D 1YCPK 1UTPA 5AFYH 1PPEE 1MAYA 1MKXH 3R3GB 1XUHA 1GDNA 1NT1A 3UUZA 2GCHG 2WPJS 5FXLA 3RU4E 1ELCA 2PGBB 1VITG 2BVSH 3M3SA 1AKSB 1E0FD 2ZHFH 1EB2A 1BOQA 4KTCA 4MG3A 4Y0ZE 1QBOA 3ATIA 2XBXA 3RU4T 3VB3A 3KHVA 1J14A 1ELVA 1X7AC 1EKBB 4OS7A 1SC8U 2FWWA 4LXBH 1YCPH 1GBBA 1DITH 4NIXA 2BTCE 3B8JA 4Y7BA 4A1XA 1TRNA 2D1JA 1MTUA 4ISIH 4NIYA 1WSSH 1K0HA 1ZZZA 5FX6A 3SU6A 4XRNA 4ISOA 3EAJA 4JK5A 1T7CA 1HJ9A 3HKJB 1IQNA 1MTVA 2ZFTA 1ANCA 3U1JB 3DFJA 2FOBA 1DY9A 1TNGA 1AHTH 1MUEB 3SHAH 2RG3A 2LPRA 3BTEE 2ZFFH 1TX8A 2VIQA 1P01A 3QTVH 1TALA 3CP7A 2CF8H 5DP6A 1SVPA 1WV7H 5FPTA 1GHWH 1V3XA 1AQ7A 1GHBF 2O8LA 1XUGA 4O9VA 1DSTA 1GI2A 4YLUA 4HG6A 5GPIB 3OSYA 2BVXH 1PPCE 2UUFB 1KY9A 1GMCF 1MZAA 1FONA 2O8TA 1LVYA 2G55A 1O37A 2ZCKP 3TNSA 1G2MA 4H6TA 4OS4A 1PQ5A 3NRLA 5G4BA 4OGXA 2YMSD 3PMAB 3VEQB 3MH7A 4A5TS 1P2JA 1THPB 1TPAE 2AHME 1O2QA 2BQ7B 2IPHA 1HAGE 1O3AA 4GCHG 1GPZA 3DSOA 2ALPA 1NBMD 4MPVA 1L1GA 3OYPA 1LQEA 3BTGE 4YLQH 2IPQX 1AGJA 1E35B 1FDPA 3C27B 1G3DA 4WXVA 1TYNA 1YYY1 2FPZA 3URDA 1XUIA 1MQ6A 3Q00A 1S0QA 5A2MH 5EJLA 4DGJA 2H6MA 2VINA 2D8WA 1UVUH 3BTKE 3H7OA 1E1QD 2BLVA 3EGKH 2C3SA 1NESE 2ZCHP 3F9GA 3SNBA 2QF5A 1GGDC 4Q4LA 3GCHB 2ZO3H 1UJ1A 1O2UA 2C8ZB 1P06A 4K1EA 1AMHA 2W6JD 3IWMA 5CMXH 2C4FH 1V2WT 4KKDA 4ASHA 2XYAA 3KQCA 1O5BB 1SQAA 1D3DB 2GTBA 5FX5A 1CHOF 1SKYE 1ZPBA 4AC9A 4ABAA 1XXDA 1U6QA 3F2GA 1P9UA 3M5OA 1Z1JA 3BG8A 1GBAA 3LPRA 3F0PA 2YNBA 3ZZ4A 2F9NA 3PLPA 3UWIA 4CR5A 5F53A 1O33A 3URCA 1TRMA 1PPFE 1N1LA 2BHGA 2CK3D 1O2VA 4TY7A 2QF4A 1CU1A 2ZU3A 1ORFA 3PO1C 3Q3YA 4I8JA 3SUEA 2QGRA 4MPWA 1WDIA 1UK3A 4K60A 4WF8A 1RTFB 1BMMH 5PTPA 1AE8H 5CE1A 1DS2E 2HALA 1BBRK 3BTFE 1TE0A 2G4TA 1JRTA 4FETA 4AYYB 1PPBH 1TOMH 2ZGXH 2FYQA 2JH0D 3L3TA 1QQ4A 4WH8A 1WXRA 3SI3H 4TPYA 2UWLA 3T25A 4IMQA 2XC4A 3QGJA 4KELA 3RXVA 1E79D 1FZZA 1Y5AT 4DJZB 2BY9X 3DSPA 3HK6B 1P2KA 1OYTH 1ZTKA 2FI5E 2AS9A 4AG2A 1A46H 1HLTH 1NO9H 3M7UA 3STJA 1D3PB 1NY22 4MNYA 5DN6D 3ATLA 1BMLA 1EZSC 3O8DA 3VXFH 1VITF 1QGFA 4X8TH 1JBUH 2D26C 2DE9A 3UNRA 3OEED 5DJ7A 1RS0A 2A5AA 3KYFA 3ZVBA 3NK8A 1ZHMA 1GJBB 5EPNA 1TBZH 2ZGCA 2VIPA 3NUMA 5A8ZA 4JZIA 1NFWA 2V3OH 1TQ7B 1A61H 2RA0A 2JDID 2ZNKH 4B6EA 1P03A 3M36A 1LTOA 2OC8A 4NIWA 2OBOA 5DO4H 1K1JA 2ZHWH 3U28C 1CBWB 4I33A 1WTHD 4Y8ZA 3KNXA 1HXEH 5E0HA 2QV1A 2QF3A 3UQVA 1FAKH 3RM2H 2WPLS 1HAZB 1XXFA 2ZGHA 4FUJA 1XMNB 1P0SH 1N8OC 4THNH 1XVOA 1EFRD 3P8FA 3GISB 3FZDA 3P17H 2P3FH 1IAUA 1Y8TA 1CT0E 3TVJB 4E7NA 1TA2A 5C67A 3SNEA 1AN1E 1OXGA 3GDVA 2BXTH 3QN7A 4FUGA 1Y3UA 2L6OA 3M5MA 1YWUA 1F5KU 2BY7X 1HBTH 4U32A 4NCYA 2NWNA 2HRVA 3A7YA 3KQDA 4WY3A 1SGDE 3H5CB 3F6UH 1QA0A 1W14U 1E36B 1SFQB 1EPTC 1UMAH 2PHBA 4MNXA 5GXPA 2GX4A 2BD5A 1S81A 1ZRBA 4TSFD 4UFFH 4ZKOU 1UTNA 1A0LA 3VB5A 1E1RD 1BRCE 2W7UA 5K0HA 3Q3XA 3JZ1B 3SGAE 4Q80A 2V3MA 1S85A 4BTIB 1PYTC 1THRH 4JMYA 4RKOB 5ETXA 4F49A 1O2NA 1GL0E 2GT7A 1BQYA 3MNSA 1O2OA 1K1IA 1O3NA 4AYVB 2ZG0H 3VXEH 1EJAA 1IQFA 1NPMA 4FUEA 3L6PA 7GCHG 1GDQA 1C1WH 2QXGA 3BTTE 3P92A 4B71A 2FO9A 3A80A 1AVXA 2DUCA 2F3CE 1CGHA 4I8GA 2AFQB 1FAXA 2VIOA 1TLDA 3MWIU 1L0ZA 1O3PB 2R2WU 1DLEA 4X8VH 4YM9A 3BF6H 4Z1MD 1LVMA 2HNTF 1QBVH 1NRRH 4UDWH 1KSNA 1FMGA 1SGPE 2KFWA 3N7EA 3EA8A 2GVFA 2QCYA 3OAAD 1LPZB 1UCYH 1AZ8A 4B74A 2BY5X 4Q2KA 1P9SA 4ABDA 1BMNH 1ZTLA 5HIZA 1EZXC 1DWCH 1LO6A 4AFSA 1O36A 2SNWA 2P94A 1Y3XA 2C8XB 1KTTB 4Y7AA 1TWXB 2OC7A 1ELFA 5LPRA 4K1SA 2PTCE 1NRSH 2GZ9A 1WOFA 3ZZAA 3SV7A 3LC5A 8ESTE 4FXGH 5C1UA 1HDTH 4B2CA 1CA0B 2WPHS 1GJ4H 1BTPA 3LJJA 1L2EA 3MFJA 3SU0A 1CGIE 2J9NA 3FVFB 5FPYA 1GHZA 1GMDG 3RXEA 3WW7A 2UUJB 1L1NA 3OFND 4TYDA 2JH5D 3PMJA 1O2SA 5AHGH 2CJIA 1QHRB 1UCYE 2FX6A 1FV9A 1QIXB 3CENA 1NBME 2KM0A 1OWKA 2TRMA 3IITA 1P8VC 1SGFG 4JK6A 2H9TH 2A7JA 2UWPA 1DDJA 4JYTA 2R0LA 4WMFA 1HJAC 1ANDA 4B1TA 4ZHLU 2PV9B 1UTJA 1BRAA 4BANB 2H5CA 3HATH 5J4SA 4XD7D 3T28A 2GCTB 2XXLA 1KDQA 4U30A 1Y3VA 5TCAA 3EE7A 3P8GA 4BNRA 2NU0E 1DOJA 3LOXA 1J9CH 1OOKB 3SOSA 1B7XB 4IGDA 3PRBA 1NM6A 1O5CB 2VVUA 1CHOG 3DUXH 2GMTC 4D9RA 4J2YB 4BAQB 1AVGH 2EC9H 4OS1A 1C1MA 4A92A 1LPGB 1NZQH 4WH6A 1A5GH 5C2ZA 1AY6H 3SU2A 3LGIA 1W0YH 3P95A 2FTLE 1EPTB 1YLDA 1JOUB 2TGDA 2GT8A 2P59A 3DHKH 1FLEE 3SU4A 3HGNA 1P12E 3RMNH 3SBKA 1MU8B 1SI5H 1T8MA 4ZH8A 3NXPA 4FVBA 1K1MA 5T1VA 1ELBA 3DSGA 3GCHC 1ETTH 1EX3A 1O2ZA 1ZHPA 4A7IB 2J97A 2ZDLA 4WVPE 3ZVEA 3JZ2B 2CXVA 3FKSD 4FU8A 1FX0B 1K1NA 1MH0A 1N8OB 3T2NA 2BQWB 3RXJA 2BLQA 4WMEA 1OS8A 5DK1A 2SGAA 3RXUA 3SUGA 5E2OA 5C5NA 2GZ7A 3ENSB 3TJUA 2P93A 4K2YA 1NTPA 1VJ9U 1TNIA 3QUMP 4TT3D 1C5WB 4X1NU 1HGTH 1OPHB 3ATMA 3DCLA 4ABEA 1AKSA 3QZQA 1AU8A 1K1PA 2SGQE 3SQHE 4DOQA 3UAIC 2FODA 3UWJH 1GG6B 4ZHMU 2QYIA 1MCTA 1ZSKA 1TMUH 1GHAG 2C90B 3AAUA 2BLWA 2R2MB 3HKIB 1DX5M 2Z9LA 3M3TA 2C8YB 1JIMA 1W10U 3LKWA 2R9PA 4AZ2B 3BTWE 1SQOA 4BXSA 1ACBE 1D6WA 4BTUB 2Y7ZA 4AFQA 4CR9A 3A84A 1AE5A 2JETC 3LDXH 4KP0A 3OTPA 2CHAC 3MYWA 1L4ZA 1ABJH 1E37B 2YOLA 2QIQA 4E05H 3LC3A 3A82A 5FCKA 2OXSA 1V6DA 1XKAC 2OK5A 1EJNA 1QBNA 3BG4C 5EGMA 2FI3E 2F91A 3SJIA 2XNIA 3PM3A 4ISNA 1V2UT 3PB1E 3TH2H 1O3KA 2AERH 1GBLA 1GHBG 3M35A 2WINI 3A8AA 1TBRH 2ZDKA 3U8RH 3S9BA 1YCPM 2KAIB 2ZGJA 3ZVDA 2HLDD 5F03A 2KCPA 3GDSA 3KGPA 1EATA 4JYVH 2BD7A 3TU7H 3U8TH 1MKWK 4RT0A 1XM1A 3SNAA 1IQKA 4K1TA 2AH4X 4INLA 1C5ZB 2A32A 2OQUA 3TJOA 1FY1A 3RXSA 1O38A 1GHYH 1DANH 1Y5UT 3TJNA 3RXQA 1T8LA 2D2DA 2ZTYA 3BIVH 3FZZA 2BDBA 4FU7A 1DT2A 2ANYA 3U9AH 3RXGA 1DUEA 1QL9A 1H9HE 2B9LA 4ACAA 5DGJA 3BTDE 3Q76A 2ZDMA 4IW4E 1TPPA 3WY8A 1GJ6A 3ATKA 1GGDB 5JBBS 1QJ6B 1T8OA 4NWLA 1TMBH 3NWUA 1SBWA 1GJCB 3MOCA 1O5EH 1HJ8A 3L33A 2ANKH 2J5UA 5ESBA 1V2QT 2A7HA 2BD8A 2VNTA 1XUFA 2Z94A 5KGOA 3MU0A 1IQIA 3ODDA 4QT8C 2VGCB 4IBLH 3BSQA 2A7CA 2ASUB 2IJOB 1SFIA 1OWHA 2O8WA 4IN1A 1UTQA 2I6QA 2SGFE 3UREA 1ZSLA 4CHAB 1HIAA 2VJ1A 2FM2A 1AO5A 1L4DA 1TGSZ 3RLYH 3UIRA 2NU4E 1P11E 3F2FA 3VB6A 1GJ5H 1PPGE 1C1UH 1MTNC 1G3BA 2FZZA 4ZKRU 1K21H 3RC5A 2FESH 2GJGA 2VWLA 1O3EA 1YPMH 5JBCS 3SZEA 1W0KD 4GHQA 1SHHB 5L30H 1AVWA 7KMEH 1PPZA 1Q3XA 3ZVGA 1GI3A 3IG6B 1O3BA 1YPJH 4I86A 2XWBI 3E3TA 3WWBA 1O3IA 1TMTH 2O8UA 3AASA 4GSOA 1D3QB 1QY6A 1PQAA 1A7SA 3SQEE 1FUJA 4F4OC 2VGCC 2BZAA 2H1UA 2KZ4A 1LKBA 2LP6A 4BAMB 6CHAB 1O5FH 3E0NB 3ZZCA 1KXCA 3UR9A 1WQVH 2BLOA 1LDTT 3GY5A 3ZZDA 1SOTA 3RXDA 1GHVH 1GL1A 5CHBA 2DE8A 3KEEA 2Q6FA 1H8IH 4I8LA 1LCYA 4AN7A 1VITH 2Y80A 4A6LA 2PKSB 4ZKNU 2AGIX 1GCTC 1SB1H 2TBSA 1P2OA 5C1XA 3LGTA 5HM2A 3UPEA 4ZMAH 1BITA 2GP9B 4ZCNA 1PJPA 4KTSA 2ZEBA 1VCWA 1IOEA 3SV6A 4ZKSU 3BEIB 2W3KA 1RRKA 4DW2U 1QRXA 4TY6A 2KCYA 1HCGA 3OE7D 1GI6A 1SQTA 5DG6A 2SGPE 2ZQ2A 3RMLH 4MPUA 1C1VH 3LH1A 1O3GA 3GCTF 3GOVB 3SGQE 1JRSA 1ELGA 1WUNH 3RXRA 2BY6X 2YNAA 3BG4B 3SUFA 4BAKB 2XBWA 1IHSH 1P2NA 1HUTH 1A0JA 1GBFA 1V2RT 3SNDA 5C5OA 2FOCA 2A45B 1Q31A 2EEKA 1HAXB 4FUHA 1SLWB 3UNQA 2PFEA 1ANEA 4RSPA 3TK6A 1SGCA 1UO6A 2FYRA 3SORA 1IQMA 1Z71A 1YBWA 4XDEA 4BTTB 3A8DA 1O5GH 1C4Y2 1NU7B 4INHA 1HV7A 2WYGA 3PO1B 2WV5A 3V13A 4RKJB 2G52A 1IQJA 5LPEA 2WUBA 1S84A 1O0DH 1AZZA 2XOKD 2VBCA 5TCCA 1QL8A 3K6YA 5HIYA 2KAIA 1PQ7A 1OYQA 4KTUA 2Y5HA 4IMZA 1UVPA 3HK3B 2Q6DA 2GZ8A 3LGWA 3V0XA 4TWYA 1GJ7B 2F9UA 2AMDA 4WXIA 1H9IE 1RFNA 2WPMS 1JIRA 3SV9A 1D6RA 1AWHB 1C2MA 3LT3A 2QY0B 4MQAA 3SO3A 1YPHE 3A7WA 3TIUA 3AW1A 1F7ZA 5AFZH 1EAIA 3U69H 2HVYB 1RD3B 3PRDA 7ESTE 4IC5A 1ZMLA 1GCTB 1LPKB 4GAWA 4YESB 1DLKB 2A4GA 1QB1A 1UHBB 4H4FA 1J15A 2PKAB 5DP4A 8GCHF 1KXFA 4H6SB 3TPIZ 1N6YA 2W26A 4DG4A 2PTNA 1W2KH 2Y5GA 4ZAEA 3MU4A 1DWBH 1CBWC 5B6OA 2J98A 1J17T 6CHAC 1OSSA 2Q1JA 1LHCH 1Z6JH 1Z1IA 1UW7A 1C2LA 5C20A 1F92A 1OP2A 2VIDA 4FUBA 4FUCA 2ZDVH 1DM4B 2GMTB 4WJG2 1QFKH 4X6OA 9ESTA 4CRCA 1W12U 1WBGB 1BTXA 1AI8H 3P70B 5DP9A 1BCUH 4U01A 3N7OA 2G5NA 2G5VA 4XE4A 1COWD 1LVOA 4XOJA 1UK2A 2HWLB 3RMOH 2WV4A 3RXAA 4ABIA 2B7DH 4CRFA 1F5RA 1CT4E 4AB9A 1H9LB 1GI4A 2BOHB 5FBIA 2ZU5A 8KME2 1IQHA 3EDXB 2TIOA 2XCFA 1TA6A 4JZEH 1HAVA 3TGKE 1KXDA 2AIQA 3SU5A 4CRAA 4NIVA 5DKMA 3NCLA 4AGJA 1SGFA 3U8OH 1GBCA 3D65E 4OM9A 2M2AA 5A8YA 1DWDH 4X2WA 1LVBA 2RFKC 3TGIE 3SJ8A 2BDYA 1DPOA 2BZ6H 4AOQA 3FP6E 4NGAH 6GCHG 3GYLB 3A8BA 3TLOA 1QB9A 4DCDA 1C9PA 2OINA 5LPFA 2IN2A 5EJZA 1TNJA 4I7YH 1YF4A 5I46H 1C1NA 5A0CA 1IQEA 5ESTE 3KCGH 4P00A 4ISHH 2BDHA 3RU4D 1P2IA 5FPSA 3GY6A 1IQGA 1F0SA 1V2LT 1CSOE 4Y79A 4AORA 4MNWA 1O3HA 1NRNH 1ZJDA 3RXPA 3ZZ8A 3BIUH 3PTBA 3SZNA 1HAIH 2BD9A 2OUAA 1LHDH 2XC0A 1AFQC 2BB4A 2RA3A 1C2GA 1TRYA 3B23B 3FP8E 3MQKC 1C5LH 1P02A 5HM9A 4RT1A 1O3OA 3EA7A 3F0OA 2ANWA 4X6PA 1GHAF 3VB4A 1YP9A 4FUDA 1PPHE 4FVDA 3ELAH 5C17A 4D8NA 4NSYA 4CRBA 1VZQH 4AFZA 5AVDA 4K8YA 1Y59T 4I31A 3KIDU 4NZLA 2PKSC 3Q77A 5JDUB 3M7TA 2ILNA 1ARBA 2PLXA 3EQ0H 4YXWD 1KIGH 2J92A 1YPHC 2EI8A 5DSFA 4ABHA 1QB6A 2FI4E 1HNEE 3F3BA 2G00A 2FOFA 4YO9A 1ETSH 4X1SU 2EA3A 3E0PB 1DWEH 5C0UA 1BMAA 1DE7H 2ZTXA 1FQ3A 3KL6A 1TGTA 1WTGH 3RXKA 2ZU2A 2FOMB 1GMCG 3PV4A 4FOUC 4K5ZA 5BPEA 1GVLA 1FY8E 2BQ6B 2VIVA 3A7VA 4X2YA 1F0RA 1MTWA 3RC4A 1QTFA 2ZU1A 1BHXF 1S82A 4P02A 2ZIQH 3AAVA 4UEHH 4FU9A 3UNSA 3T62A 4AX9H 3GY4A 3BV9B 1C1QA 3NZIA 4AGKA 2XNDD 1NS3A 3S7KB 1TNHA 5GCHG 3ZV8A 4JZFH 5GJ4B 2WZQA 3ODFA 2F4LA 2P3UB 4WMDA 3KYGA 5LGOA 5AF9H 2ZCLP 3MH4A 1ABIH 1L1JA 3MNXA 1C2JA 3SV2H 1O2JA 1FIZA 2A4QA 4Y0YE 2SFAA 5C1YA 2XBYA 1BHXB 2JJ1D 1ZMJA 2K0QA 3AW0A 3I78A 3N99A 4SGAE 4ACBA 3P6ZB 3A83A 1Z8RA 1D9IA 2AYWA 4HZHA 4YOIA 2HPQH 4YZUA 2TGTA 4OS6A 3M3VA 1P2QA 4O03A 4GVUA 1Y3WA 1CT2E 3FP7E 4XFQA 2B0FA 1FXYA 2OC1A 1T4UH 1LQDB 1BDAA 2UUYA 4LOYH 1GJAB 1MD8A 4BAOB 3GY3A 3TH4H 1QNJA 2W3IA 1O2KA 3RM0H 1FN6A 3MO6A 3KF2A 4O3UA 1GI7B 1CA0C 1ZMNA 5T6GA 1C2IA 2P16A 1UTOA 4X1PU 3ZYDA 5IK2D 3D62A 4IS5A 2WUCA 1HAYB 1GMHG 4ABJA 2ANMH 2PKAA 1TGBA 5CDFE 2HNTC 2AMPA 3V7TA 1GVKB 1BTZA 3S7HB 4XSKU 4JCNA 4E7RG 4Y11E 1T32A 1NN6A 1KXEA 3AVZA 3RXHA 4B73A 1A2CH 2CGAA 4A1TA 1TPOA 1P2MA 2RDLA 1OKXA 2ZHQH 2Z9KA 1MBMA 5EQSA 2HNTE 3BTME 1VGCB 3OU0A 4D9QA 4XBCA 3S9AA 3PROA 1XX9A 1UTMA 4YOJA 4MTBA 1Y3YA 4DT4A 1TNLA 1LHGH 4WWYA 1NC6A 4KGAA 2F83A 2KX4A 1V2ST 1O3JA 2J34A 5DP5A 2A31A 1C2EA 4M9FA 4Y6DA 2KCOA 2W6ID 3Q3KA 3T27A 1VCQA 2ZFPH 3LONA 2V3HH 1QRWA 4UD9H 2NU2E 1C5XB 1NFUA 4BAHB 3PMBB 2ZFSA 3UB0A 2FIRH 1ZJKA 3PLBA 1MQ5A 1O39A 2H9HA 2QC2A 4D7GA 4XBDA 1AFEH 3VG8A 1LHFH 1QQUA 2WPIS 4X8UH 1BTUA 1WAYB 1SMFE 4E06H 2JETB 1O2WA 4R0IA 1YPLH 1TABE 5EIYA 3RP2A 4BXWA 4A1VA 2O8MA 2Y6TA 4B2BA 1O3LA 3LGYA 1ZGIA 3VB7A 2ZDNA 5EG4A 2PSYA 2PUQH 2VVVA 3UOPA 2GCHF 4O3TA 1E34B 1NRPH 5F8TA 4CBOA 3BTHE 3SU3A 5JYIA 3BN9A 1HAHH 4NA8A 1V2NT 1GI8B 2ZGBH 4ABGA 4YTAA 5T6FA 4CH2B 1SGTA 1EP5A 2J98B 2HOBA 4JYUH 2OTVA 4MPXA 3SV8A 1SSXA 4I32A 3GS9A 1DFPA 1NFXA 3SJKA 3W95A 2B5TB 1C2KA 2BD3A 2AEIH 1GBKA 2NU3E 1IHTH 1NU9A 1GBIA 1Q2WA 3FAOA 1D4PB 3ATWA 1KLIH 2ZTZA 1W3CA 2ZP0H 1EZQA 5EOKA 2OP9A 1HAVB 3NKKA 2LELA 1BTYA 3MH6A 2F9BH 4YT7H 1LMWB 4LK4A 1OX1A 4DVAU 5C0TA 4ISLA 5GWZA 4K8BA 5FCRA 4K69A 5BRRE 2FX4A 3ZZ9A 1MABB 1DSUA 5CHAC 3RXBA 5E0GA 4Z0KA 5DP8A 1MTSA 4INKA 3RMMH 3PYHA 3O8RA 2SGDE 1UVOA 2PP6A 1GJDB 3V3MA 1C1RA 4Q63A 3ZVAA 1RGQA 2AGEX 3P8NA 4NFFA 2VWOA 1OWJA 4GUXA 1KXBA 4DIHH 3I29A 2FLRH 1ZHRA 1EZUC 1BT7A 3MO3A 4Y10E 1UVTH 1RTKA 2BDAA 1O2RA 2Y5FA 3TH3H 2VWNA 1A3EH 1O2YA 2XTTB 2QN5T 1GBTA 3RC6A 1C5NH 2XW9A 3F9EA 1C5TA 2V7QD 3LJOA 4B75A 1GI0A 5CHAB 4DT7B 2R3UA 1ZLRA 2GCTC 4Q7XA 4TWWA 2ESTE 1DXPA 1O2TA 2WHXA 3SW2B 1KLTA 1TOCB 1YY3A 1TNKA 1CQQA 3OX7U 1OWIA 3OY6U 4X2XA 1SOZA 1W11U 1SHYA 2ZFRH 4Q7ZA 3QGNB 5IDKA 1FY3A 3ZZ7A 1OWDA 1PFXC 2UWOA 1T31A 5EXLA 4CH8B 5HXFA 4ZUHA 4I8HA 3QTOH 5JBTA 3R0FA 2YMSB 3GCNA 3LIWA 1EAUA 1C5YB 2GV7A 3U1IB 5FBEA 4I8KA 3N7DA 2BX4A 2PW8H 4B2AA 4VGCC 3OY5U 2WYJA 2G51A 1HXFH 2G8TA 5EQRA 5GNDA 4ZHAA 1S83A 3SUDA 3O8BA 3UR6A 1SQRA 1WYKA 1UCYK 1A1RA 2Y7XA 1HPGA 2SNVA 3MU8A 4VGCB 1AUTC 3D23A 3BTQE 3LH3A 1FY5A 2CMYA 1O2IA 5E0JA 3M5LA 5SGAE 3A7ZA 2RCEA 5L6NH 4Q7YA 5GDSH 1Z8IB 2W7SA 1EAXA 4F48B 3MH5A 4DIIH 3QLPH 4X6MA 1Z7KA 2FMJA 1ELTA 4ABBA 2QF0A 3A8CA 4YT6H 3P8OA 4ZXXH 3TGJE 4HFPB 2KR7A 5LH8A 1CVWH 2Z9GA 2PGQB 2XWAA 1K9OE 2NU1E 2V6NA 1P09A 1SGQE 1ZOMA 4H42U 1BRUP 1W0ZU 2P3TB 3RXLA 3F1SB 1BTHH 2TPIZ 1TPSA 3DT0H 2CV3A 4Y71A 3RLWH 1T8NA 2VVCA 4GPGA 3RDZA 3EE0B 2HVXA 1TONA 1BJUA 2FDAA 1GJ9B 2F9VA 1O3DA 2Y81A 3E1XB 3SHCH 1C2HA 3ZZ5A 1QZ8A 2P8OC 3MNBA 4CHAC 3ESTA 2BYAX 1K1OA 1HB0B 1C4V2 3HPTB 4YOGA 1ZTJA 1VCPA 2ZHDA 1FPHH 1THSH 1P05A 4MDSA 2BD2A 2A4RA 3UFAA 1ELEE 1MCVA 4DURA 3GYMA 2BDCA 1V2JT 1C2FA 2HGTH 1O35A 1SG8B 1XVMA 5EXNA 9LPRA 1FIWA 4NA9H 2OD3B 5FAHA 5T6DA 1C5OH 4K3JA 2R3YA 1W7XH 1GI5A 1C5RA 1T4VH 2OLGA 4D7FA 1EP6A 1EJMA 3V12A 3MNCA 2VWMA 1ARCA 1PYTD 1SGNE 1GBJA 5DP7A 3CS7A 1MKXK 3TITA 5HMAA 3DD2H 1GI1A 1TGCA 5GCHF 1H8DH 2OQ5A 2C8WB 1G3CA 1C5MD 1EUFA 2EQNA 3PV2A 1V2VT 2WPKS 2CF9H 1ZYOA 1C5PA 2Z6BD 3T5FH 1P04A 1GI9B 2OBQA 4X1QU 1C2DA 2BD4A 3QO6A 1H1BA 3H7TA 1V2KT 2HPPH 2XCNA 2XC5A 1GWAA 1TQ0B 6ESTA
chains in the Genus database with same CATH topology
1BTWA 2H2ZA 5IYTA 1O2LA 2JKHA 5L2ZH 1NFYA 2J38A 1UTKA 2ODQA 1DICA 6GCHF 5J4QA 5L2YH 1DUAA 3ZZBA 2FOGA 2A2QH 2GD4B 4Y76A 3B9FH 1UVSH 5E2PA 1SLVB 1WCZA 3SJOA 5F8XA 1G9IE 2ZZUH 5EPYA 1GJ8B 3TK5A 1W7GH 1CA8B 2BY8X 1MU6B 1S6FA 2XBVA 2AGGX 1JWTA 1E38B 1ELAA 1J8AA 3A7TA 1C1PA 3VFEA 1BB0B 1B0FA 1HIAB 3MU1A 2P95A 4JZ1A 1O2HA 1UTLM 4GHTA 1K2I1 3E6PH 1GBDA 5C3NA 4UFDH 1RXPA 1ZPZA 3SGBE 5ABWA 2BVRH 1EXFA 2G4UA 1TFXA 3UY9A 4RN6A 2A1DB 1INCA 2EI6A 4GCHF 2B8OH 2Q6GA 4IN2A 2VB0A 1FJSA 5A0BA 1ESBA 3SJ9A 3BEUA 1GG6C 5TJXA 3MI4A 3LU9B 1MZDA 3EA9A 1Z6EA 1B0EA 1GBMA 4MNVA 1O2MA 2H9EH 3A7XA 3TJVA 2FXRA 1P3CA 1UK4A 3QWCH 3UQOA 1A5IA 4NG9H 2C93B 3SU1A 4HGCA 7GCHF 5EU8A 4R8TB 3ZVCA 3GICB 3O8CA 1QURH 3PMHB 4DY7B 1NRQH 3DA9B 5JBAS 3S69A 1TB6H 2JH6D 1W13U 1PQ8A 2A2XH 4XBBA 1KDQB 8GCHG 1ETRH 1YC0A 1VGCC 4NFEA 5H4IB 2STBE 4JZDH 3RUOA 2QAAA 1ZR0A 2BX3A 1C5QA 1RTLA 3I77A 2Z9JA 2TGPZ 2J2UA 1FN8A 2W5EA 2A0QB 2FP7B 3DFLA 3KQEA 1AIXH 3VGCB 1QJ7B 3W94A 2VU8E 3GY2A 2PWXA 4U2WA 1C5VA 1YLCA 1G30B 1EASA 3PTNA 1QJ1B 4UONA 2XRCA 4AB8A 1HFDA 1QR3E 2IOTA 2BOKA 2BM2A 4LZ4B 3E8LA 5HGGA 1N6XA 1GCDA 4NA7A 5A0AE 4UFGH 3A89A 3C1KA 3MO9A 2CHAB 5T3HA 4CBNA 1A5HA 1LHEH 3ZZ3A 1ELDE 4UE7H 1HAPH 2ZU4A 1K1LA 1O31A 1LKAA 1C9TA 1SPJA 2QA9E 1BJVA 4NWKA 1SGRE 4ESTE 1C1SA 1O30A 3ITIA 1MMJN 2ZA5A 1FY4A 2FS9A 3SN8A 5EXMA 2K1QA 1M9UA 2A5IA 3GDUA 1ESTA 2Y82A 1RIWB 1A3BH 2FOEA 3M7QA 1QA7A 5EW2H 5F6MA 3QX5H 1NROH 1JMOH 1RIWC 2Z3CA 1MD7A 3PWBA 1SGYE 2ALVA 2F9PA 1QRZA 2ZF0H 5A09A 3K9XB 3NPSA 3F68H 2GGVB 2GDDA 1GVZA 3A87A 1O2PA 1WU1A 4X8SH 3S0NA 1H4WA 1MKWH 3ZV9A 1BBRH 2QXJA 4OS2A 5I25A 3TK9A 2VH0A 1V2TT 1DY8A 2R0KA 2ODPA 3GCOA 2VIWA 1TX7A 2GDEH 1MAXA 1VR1H 2FEQH 1JXPA 1AB9B 4X6NA 1A4WH 3OTJE 4Y8YA 1QL7A 3A81A 1EPTA 3RXIA 5JB9S 1BRBE 1S6HA 4AG1A 1FI8A 3QDZB 1F5LA 3ZYEA 3M37A 1DVAH 1K28D 1Z8GA 2THFB 3T26A 1GHXH 5JB8S 1CGJE 1BA8B 4X0WU 5GIBA 4NZQA 1EQ9A 1ID5H 3KN2A 1P3EA 1BIOA 1YGCH 2I6SA 1ZPCA 1G37A 2G81E 2A5KA 2CN0H 2J95A 1UHBA 2FOHA 2ULLA 3VGCC 1KYNA 1V2PT 3GCTG 1Z8JB 5EQQA 2BDGA 3G01A 4ZROA 2ZC9H 2AMQA 3BEFB 3K6ZA 5JPMH 2FS8A 1GBEA 2F9OA 2ZWLH 3UOUA 1O32A 1GDUA 3LGVA 2FTMA 2BDIA 1KXAA 2Z9IA 2P8OB 1AFQB 4CREA 1OP0A 1EAWA 1KTSB 1S0RA 4J1YA 3PWCA 3MU5A 1F0TA 5K7RA 2BMGB 3ZVFA 1D3TB 1FNIA 1YPEH 4AFUA 3FANA 4LZ1H 2Z3EA 7LPRA 2ZPQA 4Y8XA 1SGIB 1AWFH 1XUKA 4TPIZ 3U98H 4IC6A 1G32B 1V2MT 1HJAB 1ZSJA 1SGEE 1MBQA 3ZZ6A 1C5SA 1VJAU 1CO7E 3A86A 2O9QA 2A4OA 2M5TA 1G36A 3MTYA 2BXUH 2GKVE 1A0HB 1XKBC 5EODA 1F2SE 1HYLA 3QK1A 1O2XA 1DXWA 3GY7A 1BZXE 1AD8H 1F0UA 5DP3A 1XUJA 2ZFQH 2OCVB 3M5NA 3GY8A 1J16A 2STAE 1C4U2 1ZRKA 3D49H 2ZPSA 1O3MA 3HGPA 3S9CA 1WQSA 1TIOA 1Y5BT 1BBRE 2PR3A 1TGNA 1V2OT 1YM0A 4D76A 3TNTA 2ZHEH 3M61U 2ODYB 4M7GA 3RXOA 1YKTA 5EW1H 2H5DA 4SGBE 4ZXYH 3KQBA 3STIA 2V0BA 3RXFA 3UTUH 3F9HA 1TBQH 2SGEE 1P10A 1O2GH 3MHWU 3T29A 1BUIA 1CHGA 1SLXB 5FHTA 4B76A 3RXCA 1P57B 1C1OA 1ZGVA 3SNCA 4FUFA 4HI3A 1C5UA 1G3EA 1SL3A 1W8BH 2V35A 4ABFA 1OP8A 2Z7FE 1O5AB 2HLCA 3E91A 2LNCA 1EOLA 5E8EH 3A85A 1C1TA 1K22H 2GV6A 5HYOA 1YPKH 1B5GH 1TAWA 1O3FA 4CRDA 2ZPRA 2QXHA 1EB1H 3EYDA 1GMHF 3FFGA 3RXTA 3LGUA 1SLUB 2ZDAH 2OC0A 1AB9C 1ANBA 1QCPA 1G2LA 2TGAA 5DPAA 4X2VA 1IQLA 3PLKA 3E16B 2PUXB 8LPRA 1O3CA 2ZKSA 2UUKB 4O97A 4OS5A 3SI4H 1O5DH 4PROA 6LPRA 1TX6A 3CS0A 1HAOH 4CRGA 1FPCH 4OGYA 3K65B 4BOHA 1S5SA 1GBHA 2Z3DA 1MTNB 4MLFB 2QXIA 1RJXB 2FOAA 2J4IA 5F8ZA 1ESAA 1SR5C 2ZI2H 2ZQ1A 4NSVA 2EI7A 3MMGA 4MVNA 2VH6A 3A88A 2FLBH 2PSXA 1AUJA 4GLYA 3VPKA 2AIPA 4UFEH 5A8XA 1HRTH 4HTCH 3QZRA 4FUIA 3RXMA 4Z6AH 1GMDF 1O34A 3F9FA 1KLJH 2J94A 1CE5A 1YPGH 4X1RU 3E90B 1OWEA 2ZECA 1EOJA 3K2UA 1YCPK 1UTPA 5AFYH 1PPEE 1MAYA 1MKXH 3R3GB 1XUHA 1GDNA 1NT1A 3UUZA 2GCHG 2WPJS 5FXLA 3RU4E 1ELCA 2PGBB 1VITG 2BVSH 3M3SA 1AKSB 1E0FD 2ZHFH 1EB2A 1BOQA 4KTCA 4MG3A 4Y0ZE 1QBOA 3ATIA 2XBXA 3RU4T 3VB3A 3KHVA 1J14A 1ELVA 1X7AC 1EKBB 4OS7A 1SC8U 2FWWA 4LXBH 1YCPH 1GBBA 1DITH 4NIXA 2BTCE 3B8JA 4Y7BA 4A1XA 1TRNA 2D1JA 1MTUA 4ISIH 4NIYA 1WSSH 1ZZZA 5FX6A 3SU6A 4ISOA 3EAJA 4JK5A 1T7CA 1HJ9A 3HKJB 1IQNA 1MTVA 2ZFTA 1ANCA 3U1JB 3DFJA 2FOBA 1DY9A 1TNGA 1AHTH 1MUEB 3SHAH 2RG3A 2LPRA 3BTEE 2ZFFH 1TX8A 2VIQA 1P01A 3QTVH 1TALA 3CP7A 2CF8H 5DP6A 1SVPA 1WV7H 5FPTA 1GHWH 1V3XA 1AQ7A 1GHBF 2O8LA 1XUGA 4O9VA 1DSTA 1GI2A 4YLUA 5GPIB 3OSYA 2BVXH 1PPCE 2UUFB 1KY9A 1GMCF 1MZAA 1FONA 2O8TA 1LVYA 2G55A 1O37A 2ZCKP 3TNSA 1G2MA 4H6TA 4OS4A 1PQ5A 5G4BA 4OGXA 3PMAB 3VEQB 3MH7A 4A5TS 1P2JA 1THPB 1TPAE 1O2QA 2BQ7B 2IPHA 1HAGE 1O3AA 4GCHG 1GPZA 2ALPA 4MPVA 1L1GA 3OYPA 1LQEA 3BTGE 4YLQH 1AGJA 1E35B 1FDPA 3C27B 1G3DA 4WXVA 1TYNA 1YYY1 2FPZA 3URDA 1XUIA 1MQ6A 3Q00A 1S0QA 5A2MH 4DGJA 2H6MA 2VINA 2D8WA 1UVUH 3BTKE 3H7OA 3EGKH 2BLVA 2C3SA 1NESE 2ZCHP 3F9GA 3SNBA 1GGDC 3GCHB 2ZO3H 1UJ1A 1O2UA 2C8ZB 1P06A 4K1EA 1AMHA 3IWMA 5CMXH 2C4FH 1V2WT 4KKDA 4ASHA 2XYAA 3KQCA 1O5BB 1SQAA 1D3DB 2GTBA 5FX5A 1CHOF 1ZPBA 4ABAA 1XXDA 1U6QA 1P9UA 3M5OA 1Z1JA 3BG8A 1GBAA 3LPRA 2YNBA 3ZZ4A 2F9NA 3PLPA 3UWIA 4CR5A 1O33A 3URCA 1TRMA 1PPFE 1N1LA 2BHGA 1O2VA 4TY7A 1CU1A 2ZU3A 1ORFA 3PO1C 3Q3YA 4I8JA 3SUEA 2QGRA 4MPWA 1UK3A 4K60A 4WF8A 1RTFB 1BMMH 5PTPA 1AE8H 5CE1A 1DS2E 2HALA 1BBRK 3BTFE 1TE0A 2G4TA 1JRTA 4AYYB 1PPBH 1TOMH 2ZGXH 2FYQA 2JH0D 3L3TA 1QQ4A 4WH8A 3SI3H 4TPYA 2UWLA 3T25A 4IMQA 2XC4A 3QGJA 4KELA 3RXVA 1FZZA 1Y5AT 4DJZB 2BY9X 3HK6B 1P2KA 1OYTH 1ZTKA 2FI5E 2AS9A 4AG2A 1A46H 1HLTH 1NO9H 3M7UA 3STJA 1D3PB 1NY22 4MNYA 3ATLA 1BMLA 1EZSC 3O8DA 3VXFH 1VITF 1QGFA 4X8TH 1JBUH 2D26C 2DE9A 3UNRA 5DJ7A 1RS0A 2A5AA 3ZVBA 3NK8A 1ZHMA 1GJBB 5EPNA 1TBZH 2ZGCA 2VIPA 3NUMA 5A8ZA 4JZIA 1NFWA 2V3OH 1TQ7B 1A61H 2RA0A 2ZNKH 1P03A 3M36A 1LTOA 2OC8A 4NIWA 2OBOA 5DO4H 1K1JA 2ZHWH 1CBWB 4I33A 1WTHD 4Y8ZA 3KNXA 1HXEH 5E0HA 2QV1A 2QF3A 3UQVA 1FAKH 3RM2H 2WPLS 1HAZB 1XXFA 2ZGHA 4FUJA 1XMNB 1P0SH 1N8OC 4THNH 1XVOA 3P8FA 3GISB 3FZDA 3P17H 2P3FH 1IAUA 1Y8TA 1CT0E 3TVJB 4E7NA 1TA2A 5C67A 3SNEA 1AN1E 1OXGA 3GDVA 2BXTH 3QN7A 4FUGA 1Y3UA 3M5MA 1F5KU 2BY7X 1HBTH 4U32A 4NCYA 2NWNA 2HRVA 3A7YA 3KQDA 4WY3A 1SGDE 3H5CB 3F6UH 1QA0A 1W14U 1E36B 1SFQB 1EPTC 1UMAH 2PHBA 4MNXA 5GXPA 2GX4A 2BD5A 1S81A 1ZRBA 4UFFH 4ZKOU 1UTNA 1A0LA 3VB5A 1BRCE 2W7UA 5K0HA 3Q3XA 3JZ1B 3SGAE 4Q80A 1S85A 4BTIB 1PYTC 1THRH 4JMYA 4RKOB 5ETXA 4F49A 1O2NA 1GL0E 2GT7A 1BQYA 3MNSA 1O2OA 1K1IA 1O3NA 4AYVB 2ZG0H 3VXEH 1EJAA 1IQFA 1NPMA 4FUEA 3L6PA 7GCHG 1GDQA 1C1WH 2QXGA 3BTTE 3P92A 4B71A 2FO9A 3A80A 1AVXA 2DUCA 2F3CE 1CGHA 4I8GA 2AFQB 1FAXA 2VIOA 1TLDA 3MWIU 1L0ZA 1O3PB 2R2WU 1DLEA 4X8VH 4YM9A 3BF6H 1LVMA 2HNTF 1QBVH 1NRRH 4UDWH 1KSNA 1FMGA 1SGPE 3EA8A 2GVFA 2QCYA 1LPZB 1UCYH 1AZ8A 4B74A 2BY5X 4Q2KA 1P9SA 4ABDA 1BMNH 1ZTLA 1EZXC 1DWCH 1LO6A 4AFSA 1O36A 2SNWA 2P94A 1Y3XA 2C8XB 1KTTB 4Y7AA 1TWXB 2OC7A 1ELFA 5LPRA 4K1SA 2PTCE 1NRSH 2GZ9A 1WOFA 3ZZAA 3SV7A 3LC5A 8ESTE 4FXGH 5C1UA 1HDTH 4B2CA 1CA0B 2WPHS 1GJ4H 1BTPA 3LJJA 1L2EA 3MFJA 3SU0A 1CGIE 2J9NA 3FVFB 5FPYA 1GHZA 1GMDG 3RXEA 2UUJB 1L1NA 4TYDA 2JH5D 3PMJA 1O2SA 5AHGH 2CJIA 1QHRB 1UCYE 2FX6A 1FV9A 1QIXB 3CENA 1OWKA 2TRMA 3IITA 1P8VC 1SGFG 4JK6A 2H9TH 2A7JA 2UWPA 1DDJA 4JYTA 2R0LA 4WMFA 1HJAC 1ANDA 4B1TA 4ZHLU 2PV9B 1UTJA 1BRAA 4BANB 2H5CA 3HATH 5J4SA 3T28A 2GCTB 2XXLA 1KDQA 4U30A 1Y3VA 5TCAA 3P8GA 4BNRA 2NU0E 1DOJA 3LOXA 1J9CH 1OOKB 3SOSA 1B7XB 4IGDA 1NM6A 1O5CB 2VVUA 1CHOG 3DUXH 2GMTC 4D9RA 4J2YB 4BAQB 1AVGH 2EC9H 4OS1A 1C1MA 4A92A 1LPGB 1NZQH 4WH6A 1A5GH 5C2ZA 1AY6H 3SU2A 3LGIA 1W0YH 3P95A 2FTLE 1EPTB 1YLDA 1JOUB 2TGDA 2GT8A 2P59A 3DHKH 1FLEE 3SU4A 3HGNA 1P12E 3RMNH 3SBKA 1MU8B 1SI5H 1T8MA 4ZH8A 3NXPA 4FVBA 1K1MA 1ELBA 3GCHC 1ETTH 1EX3A 1O2ZA 1ZHPA 4A7IB 2ZDLA 4WVPE 3ZVEA 3JZ2B 2CXVA 4FU8A 1K1NA 1MH0A 1N8OB 3T2NA 2BQWB 3RXJA 2BLQA 4WMEA 1OS8A 5DK1A 2SGAA 3RXUA 3SUGA 5E2OA 5C5NA 2GZ7A 3ENSB 3TJUA 2P93A 4K2YA 1NTPA 1VJ9U 1TNIA 3QUMP 1C5WB 4X1NU 1HGTH 1OPHB 3ATMA 4ABEA 1AKSA 3QZQA 1AU8A 1K1PA 2SGQE 3SQHE 4DOQA 2FODA 3UWJH 1GG6B 4ZHMU 2QYIA