1PPCE

Geometry of binding of the benzamidine-and arginine-based inhibitors n-alpha-(2-naphthyl-sulphonyl-glycyl)-dl-p-amidinophenylalanyl-piperidine (napap) and (2r,4r)-4-methyl-1-[n-alpha-(3-methyl-1,2,3,4-tetrahydro-8-quinolinesulphonyl)-l-arginyl]-2-piperidine carboxylic acid (mqpa) to human alpha-thrombin: x-ray crystallographic determination of the
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Geometry of binding of the benzamidine- and arginine-based inhibitors N alpha-(2-naphthyl-sulphonyl-glycyl)-DL-p-amidinophenylalanyl-pipe ridine (NAPAP) and (2R,4R)-4-methyl-1-[N alpha-(3-methyl-1,2,3,4-tetrahydr quinolinesulphonyl)-L-arginyl]-2-piperidine carboxylic acid (MQPA) to human alpha-thrombin.X-ray crystallographic determination of the NA
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1991-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppcE02
4AB9A 4Y7AA 4Y0ZE 4X8UH 4SGBE 4DY7B 1CSOE 3G01A 3L33A 1C5WB 1LHGH 3BV9B 1O3EA 1L4ZA 2QC2A 3M5OA 3LGWA 2TGDA 1EX3A 3RLYH 1T4VH 4ZAEA 2F83A 4JYTA 4NA9H 1TGTA 1GMHF 1MKXH 5PTPA 1VZQH 1AN1E 1CT0E 4VGCB 4FUGA 1UVOA 3IWMA 2C8XB 1TGCA 2OBOA 1GJ7B 1Z6JH 2A2XH 3M36A 1AGJA 3RXPA 1RRKA 3A7ZA 2VH6A 2KAIA 1TWXB 1TNGA 4RN6A 2GZ9A 1MAYA 4Y0YE 5EXNA 1UVUH 2OLGA 2OINA 1S85A 2ZU1A 2SGPE 3GCTG 1WTGH 1ANCA 2TRMA 1NRPH 4Q2KA 1K1NA 1TPAE 4GCHF 4AZ2B 4ZKNU 1HRTH 1EAIA 4Y8XA 5EQRA 5HYOA 2TGPZ 3BEIB 5FBIA 3IG6B 3SBKA 2O8LA 5K7RA 2VJ1A 1AB9B 2BQ6B 1BTXA 1PPZA 2AEIH 1ANDA 1DWDH 3TK6A 3RXAA 1GG6C 3A81A 1D9IA 2HVXA 4R0IA 5C1UA 1DSUA 3DFLA 1MH0A 3P70B 7GCHG 4ISNA 3M7TA 3LJOA 2J9NA 1WV7H 3RXSA 3VGCB 2Z9JA 3SQHE 1C1WH 2VIDA 2BZ6H 4JYVH 2ZDLA 2WPHS 1C1MA 2A4OA 2ZDNA 2ZDMA 4BTIB 2WUCA 1SGDE 3H7OA 3RXMA 1IQNA 1DY8A 1FONA 4AFQA 2NU0E 3MI4A 1SGRE 1ZZZA 1Y3UA 3RXUA 1O3HA 5DP7A 3T5FH 4WMEA 1HAZB 2PKAB 1G3CA 5A0BA 2G55A 3GY8A 1TALA 1ZTKA 1IOEA 3RU4D 2J92A 1CBWC 2QXIA 3S9CA 4RSPA 1Z8JB 2BD7A 4O3UA 3MH5A 1A61H 4U01A 5GCHG 1EAWA 1W3CA 2GT7A 4D8NA 1ZR0A 1PQ8A 4NZLA 3ZVGA 5JB8S 1Y3WA 2XBXA 3MFJA 1RJXB 5TCAA 4DURA 6GCHG 3Q00A 4IMZA 2PWXA 3V13A 1J14A 3ENSB 1IHTH 2QXHA 3QTOH 3PO1C 1L1GA 1ELCA 4YOJA 4YO9A 2EI6A 1LPZB 2Y5GA 1VCPA 4ZMAH 4QT8C 4FUCA 1B5GH 1LVYA 3PTBA 3M5MA 4DVAU 4Z0KA 4TY6A 1EZXC 1C5XB 2VIQA 1FPHH 1HIAB 2W3IA 1SG8B 2PTCE 2RA0A 1ESAA 3ZVDA 3SU1A 1W0YH 1HJAC 4ABFA 2ZHFH 1GI0A 4NIWA 2BY9X 3RMNH 2BQ7B 2K1QA 1W8BH 1MTNB 1HAXB 1TBRH 3HKJB 4NSVA 1RIWB 1QB1A 3RMOH 2XCFA 4BAOB 3A7XA 3PWBA 3O8BA 2GT8A 1GHAF 2ANYA 3RDZA 1P2JA 1UTJA 1KDQB 1TMBH 4AFZA 2QY0B 4CRAA 3U98H 1S0RA 3EA7A 1OP2A 5HM9A 1GMDG 1LQDB 1C5SA 3M35A 1BCUH 3UPEA 2XNIA 1AQ7A 2ZFRH 4JZEH 3QDZB 1BMNH 1FY5A 2H9HA 1LHFH 2A7CA 1F92A 1RD3B 4WXVA 3SU6A 2OP9A 1OYQA 4AB8A 4AYYB 2VU8E 3KQBA 1AE5A 1KXBA 3Q3YA 3SV8A 2B0FA 1SQTA 2UUYA 2A7JA 3Q77A 1GI4A 3UQVA 4X2WA 3GY4A 2AYWA 3A83A 3JZ1B 3NCLA 1K1MA 5JYIA 1V2OT 2CHAB 2PLXA 3TNSA 4YTAA 3P6ZB 2F91A 1S5SA 1ELBA 1O3NA 4NFFA 1Z7KA 1MQ6A 1O3OA 1TGBA 2P3TB 2A31A 1OYTH 3P8GA 1AKSB 5A0AE 4XBDA 4X2XA 1BB0B 3PM3A 2Y5HA 3ATMA 1OXGA 1AY6H 2XXLA 3LJJA 1P02A 2ULLA 5CHAC 3SJ9A 4F4OC 5F8ZA 1E36B 2GCTB 4Y10E 2Q6FA 3RXIA 3BTTE 3TJOA 4MPXA 1G9IE 3SU5A 1GJBB 1P8VC 4TPYA 1AVXA 1GI1A 3GY5A 1INCA 3PLBA 5EXMA 1E38B 1SB1H 1P2QA 1P3EA 2G5VA 3D65E 3GYMA 3M3TA 4ISHH 3SUFA 1TONA 1THPB 2ZIQH 1C2EA 3LC5A 1KXDA 1EOLA 1KTSB 2ZNKH 2BVSH 1AUJA 4JZIA 1UVPA 5C5OA 1C5VA 3SI3H 2FXRA 1LVOA 1HAIH 3LONA 3ODFA 3H7TA 3UQOA 1N6XA 1D3QB 4A5TS 3A8BA 3ZVFA 2GVFA 3ZZ6A 2D2DA 2GP9B 5TCCA 2ZEBA 2BXTH 4NSYA 1AO5A 1GDNA 2ZFTA 3MU4A 2UWPA 2F9UA 3BN9A 1YYY1 2GCHG 6CHAB 1G36A 1V6DA 1L4DA 3SV2H 1LO6A 3QWCH 1MTVA 2BY7X 3O8RA 5A8XA 2ESTE 3SO3A 2ZQ2A 1O2KA 5EU8A 1Z71A 1QB6A 2C8YB 4A1TA 1UVTH 2ZHEH 4R8TB 5L30H 1FI8A 3BG4B 3RXJA 1ZRKA 1CA8B 2CXVA 5JDUB 1GBAA 1O5CB 1BMAA 2TGAA 1EPTB 3P17H 2H2ZA 1SGYE 1TGSZ 2LNCA 3VB5A 1ZRBA 2R2WU 1OWKA 1NFUA 1ARCA 1MKWH 3VB4A 1EJAA 1DUEA 3GISB 1SHHB 3UNSA 3MNSA 5A8YA 3EGKH 1RFNA 4NIVA 2VIVA 1HUTH 2QA9E 3CS0A 3FZZA 1HAPH 3VPKA 2C4FH 3T26A 2FOEA 3MU1A 2V0BA 1SGTA 3OY5U 4MVNA 3SU0A 1UCYK 1ZPBA 2XBYA 3M5LA 2JH6D 3TITA 4LZ1H 3HKIB 4TWWA 4I8HA 4CR9A 4RKOB 3F6UH 1YPLH 1P12E 1VGCB 2F9OA 4FUEA 2ALVA 2C90B 1FNIA 4NWLA 1NROH 3FANA 1NRNH 1BRAA 2ZP0H 4JZFH 4XE4A 1C2GA 1NN6A 4IN2A 4A1VA 3MH7A 4ZHLU 1QURH 2BVXH 4D9QA 1LVMA 4XBBA 5GXPA 4HFPB 1OP0A 3QGJA 4JK5A 5DP9A 1GI2A 2O8TA 4KGAA 1EAXA 3LH3A 3UTUH 2ANWA 2H6MA 1C5LH 1ELDE 1P06A 1TRNA 4NIXA 3UIRA 2BB4A 3NPSA 3ZVCA 1AD8H 5E2OA 3GY3A 2UWOA 4ZHMU 3H5CB 1XKAC 3ZVEA 2FEQH 4KTCA 1Q3XA 1ELAA 3RXQA 2ZU2A 2BD4A 3NUMA 3NXPA 4Q7XA 4FUFA 4ABJA 4GPGA 2M5TA 4O3TA 2QV1A 2WPJS 3FVFB 2EEKA 2UUJB 1V2UT 2EC9H 2R0KA 3PV4A 1A1RA 1A0HB 1GMHG 1D6RA 2AIQA 3SU4A 2H9EH 1H9HE 1CE5A 1UTQA 2ZWLH 3SNBA 1XUJA 1QJ7B 1O5FH 1UTOA 2BLOA 2Z9KA 5HMAA 1Y5AT 1QL7A 4X1QU 4WH6A 1YGCH 1JIRA 4DW2U 1P2NA 1K1IA 4K2YA 2AFQB 4CHAC 2LPRA 2XC4A 3K9XB 4BTUB 4GCHG 4YM9A 1C2MA 2VWNA 1TLDA 4INHA 5EXLA 3EA8A 1LPKB 1ELEE 3SV7A 4I33A 3K6YA 3M5NA 2UUFB 1GJ6A 5DO4H 3BTDE 1O2LA 1AFQB 3DT0H 1OWIA 4I8KA 1YLCA 1W7XH 1QCPA 4Q7ZA 1DPOA 3TJUA 1BBRE 3A7YA 1MQ5A 5E0HA 1UTLM 3RXDA 1G32B 1V2ST 2HPQH 3A7TA 1A3EH 1O2GH 2ZGJA 1O2IA 4NCYA 1YP9A 3M37A 3UOPA 4IN1A 1LKBA 4AOQA 1ARBA 2VWLA 4AYVB 3DHKH 4MTBA 4ZXYH 1YCPM 5TJXA 1F5RA 4X2VA 2FI3E 2ZECA 2ZC9H 3L3TA 4IMQA 4CRGA 1NTPA 2ZHQH 1G3BA 1PYTD 5EOKA 1QNJA 1GHBF 3TGIE 2Q6DA 1V2NT 1W13U 2SGEE 3BTGE 2BDGA 2Y7XA 1FN8A 4B74A 3SNDA 1E37B 1BITA 1DE7H 3C27B 1F5KU 4TWYA 4AORA 1GCTB 3R0FA 1GGDB 5DP5A 4KP0A 4Y6DA 1SHYA 2ILNA 1SQAA 1O2HA 1UMAH 2P94A 1KSNA 3QX5H 1XKBC 1CGHA 1NO9H 3SZNA 1WQVH 2QN5T 1O33A 2GMTB 1FY3A 1EJMA 2F9NA 3STJA 4H42U 1C2KA 1SLXB 2BYAX 3PMAB 3RXFA 1C2JA 3VB3A 3OY6U 3RXBA 1AZ8A 1LQEA 5E8EH 3P92A 1YPMH 2OD3B 4Y8YA 5K0HA 2SNWA 3LH1A 4WVPE 4BXSA 1SBWA 2QGRA 2ZO3H 1PPGE 1SI5H 4ASHA 4AFUA 1FAKH 5FAHA 5AVDA 1EB2A 2I6QA 1D3DB 3RMLH 1EZQA 3I78A 1TPOA 2YNBA 5GPIB 1GHWH 2TGTA 2ALPA 3UFAA 4ZKSU 1BBRH 2VWMA 5T6GA 1O39A 1GHAG 3SGQE 1C2DA 1O0DH 3PWCA 4ZHAA 5FXLA 2HNTE 4K8BA 4OS6A 3KNXA 3O8CA 4B2CA 1ZJDA 2AGGX 1WOFA 1P01A 2A4GA 1J17T 5C5NA 3BTQE 2FWWA 1TYNA 4XFQA 1C5RA 1GL1A 3U8OH 1D3TB 3SW2B 1TGNA 1WCZA 3JZ2B 2J94A 3OYPA 4IC6A 1JWTA 2GZ7A 3VEQB 1S82A 2OQ5A 1UHBA 3W94A 1DITH 2Z94A 2GDDA 3A8CA 2THFB 2BLQA 2ODQA 1C1SA 1ID5H 4CRCA 4CH2B 3LIWA 1QFKH 1P3CA 3GYLB 4TPIZ 1MKXK 1ESBA 4CBOA 2FLBH 8LPRA 1ZHPA 3ZZ5A 5LGOA 2G8TA 1GJ4H 2J2UA 1AIXH 1B7XB 4JZDH 1XUFA 3RXVA 4K3JA 3TIUA 1DLEA 3V0XA 1GBMA 1HAYB 2O8MA 2IJOB 3RU4T 2HPPH 5FX5A 6ESTA 1DLKB 1ZPZA 5AHGH 4CRDA 1O2RA 2F9PA 1BT7A 3AVZA 3EDXB 1HAHH 3SJIA 3P8FA 3MH6A 1HAVA 1THRH 5F8TA 2ZGXH 5JB9S 1LHDH 1P09A 1XMNB 4X6NA 2XBWA 4NIYA 1TIOA 3GCHC 1GBLA 1KYNA 2P8OB 4UFGH 1P05A 4BAMB 2FOAA 1JIMA 4KTSA 4UD9H 5LPEA 2CF9H 2BD3A 2B8OH 2R9PA 3A89A 1YKTA 2BD9A 2PUQH 1DY9A 4BAQB 1EP5A 1P2OA 5JBTA 3E0PB 1SOZA 2OC0A 2W7UA 1O3GA 3KQDA 1S84A 1ORFA 2Y6TA 1YM0A 1LKAA 1IQKA 4ZKRU 2P95A 2XC5A 4XDEA 5FHTA 1MBQA 1RTKA 1O2QA 4DIIH 1GMCF 1HGTH 3QLPH 1HJ9A 1FIZA 3GDVA 3CP7A 1C2LA 2V35A 2Y7ZA 1F0SA 4E05H 4JCNA 3MU8A 1AVGH 4IC5A 1DANH 4K69A 1SGIB 4HI3A 1G37A 2AMQA 3MMGA 1DICA 2CJIA 2C8WB 1SVPA 2VNTA 2R3YA 1MCVA 3U8TH 1NM6A 1P9SA 4WH8A 4ABIA 1V2LT 2ZCHP 3TLOA 4GAWA 3E91A 2W5EA 1SGFA 1ETTH 5AFYH 1DVAH 3UWJH 4BOHA 3RXCA 1OPHB 3GICB 5F6MA 2A5KA 3T28A 3P95A 1O2YA 3ODDA 4Y79A 1BTZA 1TBZH 5E0GA 2EI8A 1AHTH 2XWAA 1UO6A 7LPRA 3AAVA 2AS9A 4FU8A 2RCEA 2FZZA 1TOCB 1A5HA 1Z8IB 1C5PA 3S9BA 1VITF 1P03A 3QN7A 3SI4H 2PUXB 4DG4A 3TH3H 3SNEA 4CBNA 1DOJA 2G51A 3GOVB 1IQEA 3BSQA 1K9OE 4D7FA 1O3AA 1BQYA 3BIUH 1M9UA 1FQ3A 3FZDA 1C1NA 2JH5D 1GJAB 1NT1A 1S81A 2Y82A 1HDTH 4X1RU 2NU2E 3SNAA 3DFJA 3UNQA 2ZGBH 3ZZCA 2ZCLP 1N6YA 1NRSH 1ZSJA 5GWZA 1YF4A 4I8GA 2JETC 1PYTC 1P2KA 5EQSA 3M7QA 4WJG2 1BUIA 3ELAH 1O2TA 1CO7E 2P3UB 5B6OA 1DUAA 1MD8A 3B8JA 1O5BB 2VIWA 3RXLA 4UDWH 1QGFA 1ETRH 2WPLS 5ESTE 1J8AA 2Y81A 4TY7A 4ZXXH 1GI9B 3EQ0H 1BRCE 1A2CH 1O37A 2ZHDA 2FPZA 3RC6A 3TH2H 2BHGA 3M7UA 1GCDA 1GG6B 1DX5M 2NU1E 3LKWA 3PLPA 2Z3CA 3KHVA 1E34B 4ABAA 3ZZAA 3LGUA 1V2RT 4D9RA 3OTJE 4D7GA 2WV5A 1JBUH 3ITIA 2ZFSA 1C5TA 1GBKA 1IQFA 3AAUA 1C4Y2 1S0QA 2VGCC 5JBBS 1GBHA 3FP8E 4THNH 2OCVB 1KTTB 5L6NH 4GLYA 1HNEE 1AFEH 1SGPE 1HAGE 1O3LA 1QL8A 1EUFA 3NKKA 1GPZA 2ANMH 1BTYA 1CBWB 1O3MA 1H8IH 2PV9B 2O8UA 1BJVA 3GY6A 3SJOA 1VJ9U 4B71A 2OUAA 1ZJKA 2H9TH 3F1SB 1G3DA 1ZHMA 5IYTA 1NS3A 2J4IA 1GBFA 1GI5A 1YCPK 2PHBA 3A85A 3A88A 2XBVA 3PO1B 4K60A 4I32A 1YPHC 5EW2H 1C1TA 4H4FA 1DWBH 2Z9GA 3E8LA 1QRZA 1AMHA 3BTKE 2DE8A 3OU0A 1G2MA 1DT2A 2P93A 4YOIA 1BIOA 1ZOMA 4UFEH 1FMGA 4LZ4B 1EJNA 1F5LA 9LPRA 2RDLA 2UWLA 1HJAB 1K28D 3A80A 1YPEH 1Q31A 2H1UA 1FZZA 1UJ1A 3FAOA 1TPSA 2A5AA 4KKDA 1L1NA 1GI6A 4GUXA 1TA6A 5CMXH 2GZ8A 1MCTA 1TQ0B 2P16A 1PQ5A 9ESTA 1FDPA 2G81E 2RG3A 3F9GA 3PROA 1Z8RA 3SORA 2FOGA 2Y80A 1PPFE 3I77A 1PJPA 3DD2H 2STAE 2BD8A 5GDSH 1Y5UT 1TNKA 4XSKU 1GJ5H 3HK3B 1GHBG 2ZG0H 3ZV8A 1CA0C 4UFDH 4B73A 1WAYB 2BY6X 1SFQB 2Z9IA 4PROA 3MOCA 4FVBA 1RTFB 4WMDA 1PFXC 1EB1H 2TPIZ 1PPHE 1YC0A 1KIGH 1SPJA 1BHXF 2C93B 1MKWK 1OWJA 4HZHA 4SGAE 2FYRA 1GI7B 1EASA 1C1UH 3KIDU 2VVCA 1PPBH 1QHRB 2PKSC 3SV9A 1GBDA 7ESTE 2BDCA 3RXGA 1O36A 3QUMP 3GCNA 2HALA 4AG2A 3C1KA 1NESE 2QIQA 3QK1A 2C8ZB 1FXYA 4BNRA 3VFEA 4JMYA 3F9HA 4NZQA 3RC4A 2J38A 4Y76A 1QR3E 3HGNA 4OS1A 5AFZH 1P2IA 3M3VA 1Z1JA 1JMOH 5CHAB 2PSXA 2GV7A 3NK8A 1EQ9A 5FCKA 1QTFA 3ZZ4A 4WY3A 1KLIH 1MU8B 6LPRA 1O5AB 4NGAH 2PR3A 3QTVH 2B9LA 3RXHA 1TB6H 4MQAA 3VB7A 3HPTB 5HXFA 1WUNH 4K8YA 3OSYA 1W7GH 2A5IA 3K2UA 1LHCH 1W11U 1A5IA 2R3UA 1ZSLA 1AKSA 1WU1A 3OX7U 4MPUA 1THSH 1SLWB 3Q3KA 4K1EA 3TJVA 2ZDVH 1N1LA 4UFFH 4MNXA 5T6FA 1T8MA 1K21H 1V2KT 1ACBE 2BD2A 1ZMNA 1TABE 1O5GH 2F9BH 2BVRH 3SUGA 1C5ZB 2FESH 4X1PU 1GCTC 1LTOA 1WTHD 1O2XA 2HGTH 4CRFA 1LCYA 5T3HA 4DGJA 1FY8E 1HV7A 3URDA 5EODA 4O9VA 1CVWH 1AE8H 4O03A 3O8DA 3BEUA 1A3BH 2B7DH 3KQEA 1QB9A 3CS7A 3U1JB 3RM0H 4X8SH 1T8NA 3PB1E 4F49A 2QXJA 1EZUC 1PPCE 3SV6A 1BRUP 4M7GA 1BTWA 2TBSA 5DP8A 1O2ZA 4Q80A 1J9CH 1ZTLA 1C1PA 2ZPSA 1Z6EA 1BTPA 1HPGA 1O3FA 1UHBB 4CH8B 2RA3A 3ZZ8A 4HGCA 1PPEE 1HLTH 1V2PT 1BHXB 2OC7A 1G3EA 1BMMH 1GVKB 1NPMA 1N8OC 3ZZBA 2H5CA 3LPRA 1F0RA 4J2YB 4RKJB 2FS9A 1GMCG 1KXAA 3T2NA 3T29A 2OC8A 1XXFA 1UK4A 3MNXA 5EPYA 3LGTA 1SMFE 1JXPA 1TFXA 1ETSH 2ODYB 1Y8TA 4FU9A 4A1XA 2AMDA 4OS4A 3AW0A 1EPTA 1LDTT 3VXFH 1QBOA 1KXCA 2G52A 1LHEH 2BY5X 3KGPA 2KAIB 3F9EA 3URCA 1ZGIA 2FYQA 3DA9B 3A87A 1SFIA 3QGNB 3KQCA 3K6ZA 2FODA 2IN2A 5ESBA 1O38A 1F0TA 1G2LA 4DCDA 4KTUA 4BAHB 2F9VA 3E3TA 3SGBE 5FPTA 2XWBI 1GBBA 2BOHB 3TK9A 8ESTE 1GHVH 3LGIA 2R0LA 3BTHE 1TQ7B 4ISLA 4UEHH 1NRQH 2DE9A 3SNCA 4VGCC 1VITG 4GSOA 5DP6A 1EP6A 1EATA 1QJ6B 1GVZA 1IQMA 4NFEA 1GJ8B 1MZDA 2BTCE 2ZKSA 1O2PA 1DWCH 5DKMA 4X8VH 3T25A 3SJKA 3ZZ7A 1MMJN 5H4IB 1EZSC 4K5ZA 2GV6A 4JZ1A 4O97A 4OS7A 1E0FD 2QXGA 1YLDA 2BOKA 4MNYA 1Z1IA 4NWKA 5J4QA 1SGNE 2BDIA 3PLKA 3RXEA 1EAUA 5BRRE 2I6SA 1TNHA 1AB9C 1K1OA 2Z7FE 1KXEA 3NWUA 2FOCA 4UE7H 1MBMA 1FY4A 2FTLE 4Y11E 5L2ZH 1O5DH 1YPGH 2Y5FA 4CHAB 2Q6GA 3TGJE 3STIA 1T32A 3VGCC 3PMJA 4OS5A 1TRYA 1CHGA 1NU7B 3BF6H 2ZF0H 3LGYA 5HGGA 3S9AA 2BDHA 3GY2A 2ZFFH 2NWNA 3RP2A 3A7WA 3AASA 2FOFA 2UUKB 1WSSH 3F68H 3S7HB 1DXPA 3HGPA 3U8RH 4OGYA 1P0SH 5L2YH 1MD7A 2CGAA 4H6SB 3KCGH 2HRVA 3MO6A 3ZZ9A 3MNCA 3EYDA 2D1JA 3UR9A 2AGEX 1WQSA 1V2TT 3UUZA 1Y5BT 4WWYA 3ATLA 2ZFPH 1QRWA 2V6NA 1IQGA 5DPAA 4ABDA 1HB0B 2AMPA 1MU6B 1V2MT 4FUHA 1TE0A 1P2MA 3FFGA 2BX4A 3A8DA 1SOTA 1QA7A 3MNBA 1GJDB 5C2ZA 1FJSA 2FS8A 1E35B 2DUCA 4AGJA 2GD4B 1UVSH 3MU0A 3A84A 2C3SA 4MNWA 1HCGA 4YLQH 4INLA 3BTEE 3ZYEA 1K1PA 1ZMJA 2WPMS 2ZU4A 1IAUA 4K1SA 1O31A 1K1LA 3E1XB 2SGQE 4FUIA 1AWFH 3LU9B 1O2SA 1D6WA 3GY7A 1MTNC 2ZTYA 4J1YA 1QA0A 1NZQH 1VR1H 1RIWC 1HXEH 3S7KB 2OBQA 2GTBA 5DJ7A 3D62A 1RS0A 1OKXA 2HWLB 1UTNA 3M61U 4MPWA 2BY8X 3RLWH 1O2JA 1IHSH 1O3KA 4D76A 5C3NA 5FBEA 3PMBB 1QL9A 4Z6AH 1ZHRA 8GCHF 1L0ZA 4NA7A 4MDSA 1O2VA 1V2WT 1CHOF 3RU4E 1H1BA 2BQWB 1XVMA 3MO3A 4KELA 4AX9H 3T27A 1A7SA 3N7OA 4ABHA 5IDKA 1IQLA 1P10A 5ETXA 1O2NA 2FI4E 5A09A 1TBQH 2A45B 3HK6B 3ATKA 1XUIA 1GHXH 1L2EA 3RXTA 3K65B 1OWHA 1OP8A 1UTKA 4LOYH 2EA3A 2PGBB 1V2VT 2ZTXA 2FMJA 3SQEE 4AFSA 3E6PH 3B23B 3R3GB 1BOQA 2ZGHA 3KN2A 5F8XA 3BIVH 5AF9H 1NFWA 1ZSKA 2CHAC 4ABEA 2HOBA 5E0JA 3TGKE 2D8WA 1A4WH 4I8LA 1CT4E 5C1XA 3ZYDA 1P57B 1RTLA 3SUDA 5C1YA 1IQJA 1AZZA 1RXPA 2YOLA 1H9LB 2YNAA 4XOJA 2BD5A 2GCTC 3MWIU 3LOXA 3UY9A 2QF0A 1QBNA 1KLJH 3MH4A 2XCNA 3W95A 1FN6A 3MO9A 2CF8H 2ZDKA 2AH4X 1SLVB 5FPSA 1IQIA 1NFXA 4OGXA 1BA8B 2ZI2H 4BANB 3GCHB 1O2OA 5I46H 3KF2A 2GKVE 2FOMB 5LH8A 2P3FH 1F2SE 4ZUHA 1A0LA 1RGQA 1UK3A 2JKHA 2FI5E 3I29A 2EI7A 4B1TA 1T31A 4YT7H 5GJ4B 4YESB 1JOUB 2BX3A 5JBAS 1O30A 5T6DA 2J34A 3SN8A 1YPKH 1OX1A 3GDSA 3PTNA 4X0WU 5FPYA 3PMHB 3U69H 1XX9A 1FPCH 1OOKB 3LT3A 2Z9LA 1HFDA 4B2BA 2A4QA 3M3SA 5A8ZA 1W0ZU 1GDQA 6CHAC 1C2HA 2PW8H 1K2I1 2ZU5A 1C9PA 1D3PB 3U1IB 4YOGA 4BTTB 2A2QH 2BXUH 1CGJE 1KXFA 1VCWA 3A8AA 1MUEB 3BG4C 1SGFG 5F03A 5J4SA 1TX7A 1GDUA 1FLEE 1EKBB 4E06H 1EPTC 1HBTH 2NU4E 1S6FA 1ZLRA 1ELGA 2SGFE 1QIXB 2XTTB 2CMYA 1U6QA 2ZA5A 1GJ9B 1QRXA 1OWDA 4MG3A 4YLUA 4LXBH 2CN0H 1DSTA 1TNLA 2W26A 4FUDA 2OTVA 1F0UA 4DOQA 1D4PB 4DT7B 1C5NH 1ZGVA 1SL3A 2Z6BD 2ZPRA 3SHAH 1SGCA 1C5UA 4WXIA 2HLCA 1GVLA 3SGAE 2FOHA 1GBEA 5ABWA 2QAAA 1OWEA 4B2AA 4ZROA 4FU7A 2W3KA 2ZZUH 1P04A 4A6LA 2CV3A 2PKAA 3UREA 1MTWA 2HNTF 3GCTF 1MAXA 1VGCC 1CGIE 4GVUA 2BM2A 5EPNA 1C1OA 1TAWA 3KL6A 2XW9A 4WF8A 1O32A 4IS5A 3WY8A 1DS2E 2FM2A 5DP4A 2VH0A 1FV9A 1KLTA 3AW1A 1B0EA 4FXGH 1YCPH 3V12A 2HNTC 1A5GH 4FUBA 5E2PA 1JRTA 4B75A 2JETB 2W7SA 1UCYE 4WMFA 5EG4A 1NRRH 4NG9H 1C5MD 1NC6A 4TYDA 7GCHF 4GHTA 2OC1A 1J15A 3MU5A 4NA8A 4X8TH 2IOTA 3SOSA 1HAOH 2GX4A 2VB0A 4YZUA 1OSSA 1HXFH 4OS2A 4AGKA 1A46H 1BTUA 1ESTA 2FO9A 1AUTC 2BDYA 5CE1A 1HIAA 2PGQB 2QYIA 4E7NA 2G4UA 3MHWU 4B76A 3TH4H 5C20A 3MYWA 1ANEA 2A0QB 2Q1JA 3TNTA 1ELVA 4IBLH 3D23A 2ZQ1A 1AVWA 5EW1H 1Y3VA 3S0NA 1QQUA 1WYKA 3D49H 1ABJH 1SR5C 2G5NA 1BZXE 3VXEH 4MPVA 1V2QT 1SSXA 1MTSA 1DWEH 1TX8A 1O2MA 5GCHF 1LVBA 1TPPA 5SGAE 3RM2H 2VGCB 1S6HA 2BDAA 1DDJA 1KDQA 2ODPA 2D26C 1IQHA 1C9TA 1GI8B 6GCHF 5DP3A 4ISOA 5JBCS 5JPMH 2ANKH 1C5OH 1C1QA 1YBWA 2VVVA 2ZU3A 3V7TA 5DGJA 5G4BA 2XRCA 3Q3XA 2XC0A 1T7CA 3GCOA 4U2WA 3SUEA 1GHYH 3TPIZ 1AFQC 1CT2E 1V3XA 1FIWA 1DXWA 3A82A 1A0JA 1CQQA 1GL0E 2G00A 1SGEE 3DUXH 1AI8H 1XUHA 1O3IA 4A7IB 1C4U2 1TRMA 2BMGB 3T62A 2FP7B 1C2FA 3EAJA 1YPJH 1GWAA 1FY1A 2J95A 3EE0B 1MTUA 1H9IE 3ZZDA 3VB6A 1DM4B 1UCYH 3V3MA 2BDBA 1O5EH 1O3JA 3P8OA 1TNJA 1VCQA 4K1TA 2WINI 1GMDF 2Z3EA 3CENA 5A0CA 7KMEH 4U32A 3BG8A 2SFAA 2VWOA 2FX4A 1Q2WA 1LPGB 2B5TB 4Y8ZA 1UTPA 1VJAU 4U30A 1S83A 2WV4A 1O2UA 2A7HA 1WBGB 2WPIS 2ZGCA 2ZTZA 1GI3A 1G30B 2JH0D 1GGDC 3HATH 2VIOA 2G4TA 2AGIX 1CU1A 2SNVA 3QZQA 1C5YB 2OQUA 1UK2A 2H5DA 4ABGA 3LDXH 1UTMA 5I25A 3TU7H 2P59A 1JRSA 1SLUB 1CA0B 2ZDAH 1W12U 2GMTC 5EGMA 1Z8GA 3FP6E 1ZYOA 3ZV9A 4X6MA 2BLWA 2F3CE 4YT6H 2QCYA 1FUJA 4Q7YA 1QJ1B 3SJ8A 5DK1A 3ZZ3A 2AIPA 1LMWB 2ZCKP 4IW4E 3RXOA 3P8NA 3MTYA 3SU3A 2V3HH 4X2YA 2VINA 2O8WA 1TA2A 2PKSB 4BXWA 2ASUB 4UONA 5FX6A 1X7AC 2FOBA 2BZAA 3U9AH 1Y59T 2AERH 2ZPQA 3A86A 2V3OH 3S69A 4Y71A 3ZVAA 4BAKB 5LPFA 1GHZA 5DG6A 3BTWE 4E7RG 1QY6A 3A7VA 1T4UH 3ATIA 5GIBA 3UWIA 8GCHG 1MZAA 1O3BA 1Y3YA 3LGVA 1CHOG 1O3CA 4X1SU 4H6TA 1SGQE 2ZHWH 2OXSA 1HAVB 3TK5A 4X6OA 2A1DB 1ELFA 2R2MB 4JK6A 1P9UA 3RC5A 3NZIA 2GGVB 4JYUH 5HM2A 4X1NU 1TNIA 3SHCH 4A92A 2STBE 2WYGA 3LC3A 3UOUA 4I7YH 4CRBA 1Y3XA 1DFPA 1PQ7A 2FDAA 1ZTJA 2FTMA 2GDEH 3RMMH 1HJ8A 1BTHH 4ZH8A 4I8JA 2A4RA 2TIOA 3RXKA 3E16B 2FLRH 2GCHF 1HYLA 1ABIH 1K1JA 3IITA 2PTNA 4CREA 2A32A 3TJNA 3ZVBA 8KME2 1C1VH 1XM1A 1XXDA 4I31A 3QZRA 4DJZB 3Q76A 3FP7E 4GHQA 2IPHA 1OS8A 4HTCH 5BPEA 4AN7A 3L6PA 3QO6A 1SC8U 3GDUA 2P8OC 5A2MH 4ISIH 1BRBE 1BDAA 1GJCB 1TMUH 4CR5A 4FVDA 4INKA 1BMLA 1K22H 1EXFA 1NY22 1W2KH 1J16A 2SGAA 3UNRA 1T8LA 4DIHH 3TVJB 4AG1A 2XYAA 1BBRK 3E0NB 1SQOA 1F7ZA 2FX6A 1GBTA 2Z3DA 1VITH 1O3DA 2PFEA 1O2WA 1QBVH 3EA9A 1TOMH 2WPKS 1B0FA 1TX6A 1YPHE 2PSYA 1FAXA 3BTME 1KY9A 1BJUA 3UR6A 3KEEA 1H4WA 3RXRA 5EQQA 3PYHA 1AWHB 2WYJA 2ZFQH 1ANBA 4XBCA 4ZKOU 2WUBA 5C67A 1XUGA 4Y7BA 1GBIA 3B9FH 1W10U 1XVOA 1O35A 5FCRA 4FUJA 4X6PA 1N8OB 1EOJA 3SU2A 1P11E 2VIPA 4MNVA 1GBCA 1AU8A 1C4V2 1C1RA 1TMTH 2VVUA 3E90B 1ZMLA 4IGDA 1T8OA 1XUKA 1C2IA 5LPRA 2FIRH 3RUOA 1O3PB 3BEFB 1ZPCA 1L1JA 1W14U 4MLFB 4ESTE 3F9FA 2BLVA 1ELTA 4LK4A 1PQAA 1O34A 3ATWA 2QF3A 2NU3E 1V2JT 1GBJA 1NFYA 1H8DH 3ESTA 2SGDE 2O9QA 3BTFE 1C5QA 1QQ4A 4ABBA 1NU9A
chains in the Genus database with same CATH superfamily
4AB9A 4Y7AA 4Y0ZE 4X8UH 4SGBE 4DY7B 1CSOE 3G01A 3L33A 1C5WB 1LHGH 3BV9B 1O3EA 1L4ZA 2QC2A 3M5OA 3LGWA 2TGDA 1EX3A 3RLYH 1T4VH 4ZAEA 2F83A 4JYTA 4NA9H 1TGTA 1GMHF 1MKXH 5PTPA 1VZQH 5GNDA 1AN1E 1CT0E 4VGCB 4ACAA 4FUGA 1UVOA 3IWMA 2C8XB 1TGCA 4RT0A 2OBOA 1GJ7B 1Z6JH 2A2XH 3M36A 1AGJA 3RXPA 1RRKA 3A7ZA 2VH6A 3U28C 2KAIA 1UW7A 1TWXB 3GS9A 1TNGA 4RN6A 2GZ9A 1MAYA 4Y0YE 5EXNA 1UVUH 2OLGA 2OINA 1S85A 2ZU1A 2SGPE 3GCTG 1WTGH 1ANCA 2TRMA 1NRPH 4Q2KA 4ASUD 1K1NA 1TPAE 4GCHF 4AZ2B 4ZKNU 1HRTH 1EAIA 4Y8XA 5EQRA 5HYOA 2TGPZ 3OFND 3BEIB 5FBIA 2KCOA 3IG6B 3SBKA 2O8LA 5K7RA 2VJ1A 1AB9B 2OK5A 2BQ6B 1BTXA 1PPZA 2AEIH 1ANDA 1DWDH 3TK6A 3RXAA 1GG6C 3A81A 1D9IA 2HVXA 4R0IA 5C1UA 1DSUA 3DFLA 1MH0A 3P70B 7GCHG 4ISNA 3M7TA 3LJOA 2J9NA 2AHME 1WV7H 3RXSA 3VGCB 2Z9JA 3SQHE 1C1WH 2VIDA 2BZ6H 4JYVH 2ZDLA 2WPHS 1C1MA 2A4OA 2ZDNA 2ZDMA 4BTIB 2WUCA 1SGDE 3H7OA 3RXMA 5EIYA 3FKSD 1IQNA 1DY8A 1FONA 3F2GA 3PRDA 4AFQA 2NU0E 3MI4A 1SGRE 1ZZZA 1Y3UA 3RXUA 3WWFA 1O3HA 5DP7A 3T5FH 4WMEA 1HAZB 1G3CA 2PKAB 5A0BA 2G55A 3GY8A 1TALA 1QZ8A 1IOEA 1ZTKA 2J92A 1CBWC 2QXIA 3RU4D 4RSPA 3S9CA 1Z8JB 2BD7A 4O3UA 4RI0A 3MH5A 1A61H 4U01A 5GCHG 1EAWA 1W3CA 2GT7A 4D8NA 1ZR0A 1PQ8A 4NZLA 3ZVGA 5JB8S 1Y3WA 2XBXA 3MFJA 1RJXB 5TCAA 4DURA 6GCHG 3Q00A 4IMZA 2PWXA 3V13A 1J14A 3ENSB 1IHTH 2QXHA 3QTOH 3PO1C 1L1GA 1ELCA 4YOJA 4YO9A 2EI6A 1LPZB 2Y5GA 3DSPA 1VCPA 4ZMAH 4QT8C 4FUCA 1B5GH 1LVYA 3PTBA 3M5MA 4DVAU 4Z0KA 4TY6A 1EZXC 1C5XB 2VIQA 1FPHH 1HIAB 2KCAA 2W3IA 1SG8B 2PTCE 2RA0A 1ESAA 3ZVDA 3SU1A 1W0YH 1HJAC 4ABFA 2ZHFH 1GI0A 4HG6A 4NIWA 2BY9X 3RMNH 2RDEA 2BQ7B 2K1QA 1W8BH 1MTNB 1HAXB 1TBRH 3HKJB 4NSVA 2PP6A 3KQ5A 1RIWB 1QB1A 2W6JD 3RMOH 2XCFA 4BAOB 3A7XA 3PWBA 2W6ID 3O8BA 2GT8A 1GHAF 2ANYA 2KCPA 3RDZA 1P2JA 1UTJA 1KDQB 1TMBH 4AFZA 2QY0B 1WXRA 4CRAA 3U98H 1S0RA 3EA7A 1OP2A 5HM9A 1GMDG 1LQDB 1C5SA 3M35A 1BCUH 3UPEA 2XNIA 1AQ7A 2ZFRH 4JZEH 3QDZB 1BMNH 1FY5A 2H9HA 1LHFH 2A7CA 1F92A 1RD3B 4WXVA 3SU6A 2OP9A 1OYQA 4AB8A 4AYYB 2VU8E 2KX4A 3KQBA 1AE5A 1KXBA 3Q3YA 2J97A 3SV8A 2B0FA 1SQTA 2UUYA 2A7JA 3Q77A 1GI4A 3UQVA 4X2WA 3GY4A 2AYWA 4FETA 3A83A 3JZ1B 3NCLA 1K1MA 5HKKD 5JYIA 1V2OT 2CHAB 2PLXA 3TNSA 4YTAA 5DN6D 3P6ZB 2F91A 2YMSD 1S5SA 1ELBA 1O3NA 4NFFA 1Z7KA 1MQ6A 1O3OA 1TGBA 2P3TB 2A31A 1OYTH 3P8GA 1AKSB 5A0AE 4XBDA 4X2XA 1BB0B 3PM3A 2Y5HA 3ATMA 1OXGA 1AY6H 2XXLA 3LJJA 1P02A 2ULLA 5CHAC 3SJ9A 4F4OC 5F8ZA 1E36B 2GCTB 4Y10E 2Q6FA 3RXIA 3BTTE 3TJOA 4MPXA 1G9IE 3SU5A 1GJBB 1P8VC 4TPYA 5T1VA 1AVXA 1GI1A 3GY5A 1INCA 3PLBA 5EXMA 1E38B 1SB1H 1P2QA 1P3EA 2G5VA 3D65E 3GYMA 3M3TA 4ISHH 3SUFA 1TONA 1THPB 2ZIQH 1C2EA 3LC5A 1KXDA 1EOLA 1KTSB 2ZNKH 2BVSH 1AUJA 4JZIA 1UVPA 5HIYA 5C5OA 4ZCNA 2VBCA 1C5VA 3SI3H 2FXRA 1LVOA 1HAIH 3LONA 3ODFA 3H7TA 3UQOA 1N6XA 1D3QB 4A5TS 3A8BA 3ZVFA 2GVFA 3ZZ6A 2D2DA 2GP9B 5TCCA 2ZEBA 2BXTH 4NSYA 1AO5A 1GDNA 2ZFTA 3MU4A 2UWPA 2F9UA 3BN9A 1YYY1 2GCHG 5HIZA 6CHAB 1G36A 1V6DA 1L4DA 3SV2H 1LO6A 3QWCH 1MTVA 2BY7X 3O8RA 5A8XA 2ESTE 3SO3A 1E1QD 2ZQ2A 1O2KA 5EU8A 1Z71A 1QB6A 2C8YB 4A1TA 1UVTH 2ZHEH 4R8TB 5L30H 1FI8A 3BG4B 3RXJA 1ZRKA 1CA8B 2CXVA 5JDUB 1GBAA 1O5CB 1BMAA 2TGAA 3F2HA 1EPTB 3P17H 2H2ZA 1SGYE 1TGSZ 2LNCA 5EJLA 3VB5A 1ZRBA 2R2WU 1OWKA 1NFUA 1ARCA 1MKWH 3VB4A 1EJAA 1DUEA 3GISB 1SHHB 3UNSA 3MNSA 5A8YA 3EGKH 1RFNA 4NIVA 5B6LA 2VIVA 1HUTH 2QA9E 3CS0A 3FZZA 1HAPH 3VPKA 2C4FH 3T26A 2FOEA 3MU1A 2V0BA 1SGTA 3OY5U 4MVNA 3SU0A 1UCYK 1ZPBA 2XBYA 3M5LA 2JH6D 3TITA 4LZ1H 3HKIB 4TWWA 4I8HA 4CR9A 4RKOB 3F6UH 1YPLH 1P12E 1VGCB 2F9OA 3N99A 4FUEA 2ALVA 2C90B 1FNIA 4NWLA 1NROH 3FANA 1NRNH 1BRAA 2ZP0H 4JZFH 4XE4A 1C2GA 1NN6A 4IN2A 4A1VA 3MH7A 4ZHLU 1QURH 2BVXH 4D9QA 1LVMA 4XBBA 5GXPA 4HFPB 1OP0A 3QGJA 4JK5A 5DP9A 1GI2A 2O8TA 4KGAA 1EAXA 3LH3A 3UTUH 2ANWA 2H6MA 3DCLA 1C5LH 1ELDE 1P06A 1TRNA 4NIXA 3UIRA 2BB4A 1OHHD 3NPSA 3ZVCA 1AD8H 5E2OA 3GY3A 2UWOA 4ZHMU 3H5CB 1XKAC 3ZVEA 2FEQH 4KTCA 1Q3XA 1ELAA 3RXQA 2ZU2A 2BD4A 3NUMA 3NXPA 4Q7XA 4FUFA 4ABJA 4GPGA 2M5TA 4O3TA 2QV1A 2WPJS 3FVFB 2EEKA 2UUJB 1V2UT 2EC9H 2R0KA 3PV4A 1A1RA 1A0HB 1GMHG 1D6RA 2AIQA 3SU4A 3AK5A 2H9EH 1H9HE 1CE5A 3VG8A 1UTQA 2ZWLH 3SNBA 1XUJA 1QJ7B 1O5FH 1UTOA 2BLOA 2Z9KA 3WW7A 5HMAA 1Y5AT 1QL7A 4X1QU 4WH6A 1YGCH 1JIRA 4DW2U 1P2NA 1K1IA 4K2YA 2AFQB 4CHAC 2LPRA 2XC4A 3K9XB 4BTUB 4GCHG 4YM9A 1C2MA 2VWNA 1TLDA 4INHA 5EXLA 3EA8A 1LPKB 1ELEE 2KR7A 3SV7A 4I33A 3K6YA 3M5NA 2UUFB 1GJ6A 5DO4H 3BTDE 1O2LA 1AFQB 3DT0H 1OWIA 4I8KA 1YLCA 1W7XH 5FL7D 1QCPA 4Q7ZA 1DPOA 3TJUA 1BBRE 3A7YA 1MQ5A 5E0HA 1UTLM 2K8IA 3RXDA 1G32B 1V2ST 2HPQH 3A7TA 1A3EH 1O2GH 2ZGJA 1O2IA 4NCYA 2M2AA 1YP9A 3M37A 3UOPA 2YMSC 4IN1A 1LKBA 4AOQA 1ARBA 2VWLA 4AYVB 3DHKH 4MTBA 4ZXYH 1YCPM 5TJXA 1F5RA 4X2VA 2FI3E 2ZECA 2ZC9H 3L3TA 4IMQA 4CRGA 1NTPA 2JJ2D 2ZHQH 1G3BA 1PYTD 5EOKA 1QNJA 1GHBF 3TGIE 2Q6DA 1V2NT 1W13U 2SGEE 5C17A 3BTGE 2BDGA 2Y7XA 1FN8A 4B74A 3SNDA 1E37B 1BITA 1DE7H 3C27B 1F5KU 4TWYA 4AORA 2J98A 1GCTB 3R0FA 3OEED 1GGDB 5DP5A 4KP0A 3OTPA 1SHYA 2ILNA 4Y6DA 1SQAA 1O2HA 1UMAH 2P94A 1KSNA 3QX5H 1XKBC 1CGHA 1NO9H 3SZNA 1WQVH 4Q63A 2QN5T 1O33A 2GMTB 1FY3A 1EJMA 2F9NA 3STJA 4H42U 1C2KA 1SLXB 2BYAX 3PMAB 3RXFA 1C2JA 3VB3A 3OY6U 3RXBA 1AZ8A 1LQEA 5E8EH 3P92A 1WDIA 1YPMH 2OD3B 4Y8YA 5K0HA 2SNWA 3LH1A 4WVPE 4BXSA 1SBWA 2QGRA 2ZO3H 1PPGE 1SI5H 4ASHA 4AFUA 1FAKH 5FAHA 5AVDA 1EB2A 2I6QA 1D3DB 3RMLH 1EZQA 3I78A 1TPOA 2YNBA 5GPIB 4YXWD 3WWBA 1GHWH 2TGTA 2ALPA 3UFAA 4ZKSU 1BBRH 2VWMA 5T6GA 1O39A 1GHAG 3SGQE 1C2DA 1O0DH 3PWCA 4ZHAA 5FXLA 2HNTE 4K8BA 4OS6A 3KNXA 3O8CA 4B2CA 1ZJDA 2AGGX 1WOFA 1P01A 2A4GA 1J17T 5C5NA 3BTQE 2FWWA 1TYNA 2WZQA 4XFQA 1C5RA 1GL1A 3U8OH 1D3TB 3SW2B 1TGNA 1WCZA 3JZ2B 2J94A 3OYPA 4IC6A 1JWTA 2GZ7A 3VEQB 1S82A 2OQ5A 1UHBA 3W94A 1DITH 2Z94A 2GDDA 3A8CA 2THFB 2BLQA 2ODQA 4P00A 1C1SA 1ID5H 4CRCA 4CH2B 3SYJA 3LIWA 1QFKH 1P3CA 3GYLB 3PV5A 4TPIZ 1MKXK 1ESBA 4CBOA 2FLBH 8LPRA 1ZHPA 3ZZ5A 5LGOA 2G8TA 1GJ4H 2J2UA 1AIXH 1B7XB 4JZDH 1XUFA 3RXVA 4K3JA 3TIUA 1DLEA 3V0XA 1GBMA 1HAYB 2O8MA 2IJOB 3RU4T 2HPPH 5FX5A 6ESTA 1DLKB 1ZPZA 5AHGH 4CRDA 1O2RA 2F9PA 1BT7A 3AVZA 3EDXB 1HAHH 3SJIA 3P8FA 2KM0A 3MH6A 1HAVA 1THRH 5F8TA 2ZGXH 5JB9S 1LHDH 1P09A 1XMNB 4X6NA 2XBWA 4NIYA 2XNDD 1TIOA 3GCHC 1GBLA 1KYNA 2P8OB 4UFGH 1P05A 4BAMB 2FOAA 1JIMA 4KTSA 4UD9H 5LPEA 2CF9H 2BD3A 2B8OH 2R9PA 3A89A 1YKTA 2BD9A 2PUQH 1DY9A 4BAQB 1EP5A 1P2OA 5JBTA 3E0PB 1SOZA 2F43B 2OC0A 2W7UA 1O3GA 3KQDA 1S84A 1ORFA 2Y6TA 1YM0A 1LKAA 1IQKA 4ZKRU 2P95A 2XC5A 4XDEA 5C94A 5FHTA 4F48B 1MBQA 1RTKA 1O2QA 4DIIH 1GMCF 1HGTH 3QLPH 1HJ9A 1FIZA 3GDVA 2IPQX 1C2LA 3CP7A 2V35A 2Y7ZA 1F0SA 4E05H 4JCNA 3MU8A 1AVGH 3F0PA 4IC5A 1DANH 4K69A 1SGIB 4HI3A 2K0QA 1G37A 2AMQA 3MMGA 1DICA 2CJIA 2C8WB 4RT1A 1SVPA 2VNTA 2R3YA 1MCVA 3U8TH 1NM6A 5CHBA 1P9SA 4WH8A 4ABIA 1V2LT 2ZCHP 3TLOA 4GAWA 3E91A 2W5EA 1SGFA 1ETTH 5AFYH 1DVAH 3UWJH 1YWUA 4BOHA 3RXCA 1OPHB 3GICB 5F6MA 5F53A 2A5KA 3T28A 3P95A 1O2YA 2RFKC 3ODDA 4Y79A 1BTZA 1TBZH 5E0GA 2EI8A 1AHTH 2XWAA 1UO6A 7LPRA 3AAVA 2AS9A 4FU8A 2RCEA 2FZZA 1TOCB 1A5HA 1Z8IB 1C5PA 3S9BA 1VITF 5CDFE 1P03A 2CK3D 3QN7A 3SI4H 2PUXB 4DG4A 3TH3H 3SNEA 4CBNA 1DOJA 2G51A 4Z1MD 2JIZD 3GOVB 2WHXA 1IQEA 3BSQA 1K9OE 4D7FA 1O3AA 1BQYA 3BIUH 1M9UA 1FQ3A 3FZDA 1C1NA 2JH5D 1GJAB 1NT1A 1S81A 2Y82A 1HDTH 4X1RU 2NU2E 3SNAA 3OEHD 3DFJA 4M9FA 2ZGBH 3UNQA 3ZZCA 2ZCLP 1N6YA 1NRSH 1ZSJA 5GWZA 1YF4A 4I8GA 2JETC 1PYTC 1P2KA 5EQSA 3M7QA 4WJG2 1BUIA 3ELAH 2J5UA 1O2TA 1CO7E 2P3UB 5B6OA 1DUAA 1MD8A 3B8JA 1O5BB 2VIWA 3RXLA 1W0KD 4UDWH 1QGFA 1H8ED 1ETRH 2WPLS 5ESTE 1J8AA 2Y81A 4TY7A 4ZXXH 1GI9B 3EQ0H 1BRCE 1A2CH 1O37A 2ZHDA 2FPZA 3RC6A 3TH2H 2BHGA 3M7UA 1GCDA 1GG6B 1DX5M 2NU1E 3LKWA 3PLPA 2Z3CA 3KHVA 1VKYA 1E34B 4ABAA 3ZZAA 3LGUA 1V2RT 4D9RA 3OTJE 4D7GA 2WV5A 1JBUH 3ITIA 3F2FA 2ZFSA 1C5TA 1GBKA 1IQFA 3AAUA 1C4Y2 1S0QA 2VGCC 5JBBS 1GBHA 3FP8E 4THNH 2OCVB 1KTTB 5L6NH 4GLYA 1HNEE 3FN8A 1AFEH 1SGPE 1HAGE 1O3LA 1QL8A 1EUFA 3NKKA 1GPZA 2ANMH 1BTYA 1CBWB 1O3MA 1H8IH 2PV9B 2O8UA 1BJVA 3GY6A 3SJOA 1VJ9U 3F0OA 4B71A 2OUAA 1ZJKA 2H9TH 3F1SB 1G3DA 1ZHMA 5IYTA 1NS3A 2J4IA 1GBFA 1GI5A 1YCPK 2PHBA 3A85A 3A88A 2XBVA 3PO1B 4K60A 4I32A 1YPHC 5EW2H 1C1TA 4H4FA 1DWBH 2Z9GA 3E8LA 1SKYE 1QRZA 1AMHA 3BTKE 2DE8A 3OU0A 1G2MA 1DT2A 2P93A 4YOIA 1BIOA 1ZOMA 4UFEH 1FMGA 4LZ4B 1EJNA 1F5LA 9LPRA 2RDLA 2UWLA 1HJAB 1K28D 3A80A 1YPEH 1Q31A 2H1UA 1FZZA 1UJ1A 3FAOA 1TPSA 2A5AA 4KKDA 1L1NA 1GI6A 4GUXA 1TA6A 5CMXH 2GZ8A 1MCTA 1TQ0B 2P16A 1PQ5A 9ESTA 5KGOA 1FDPA 2G81E 2RG3A 3UB0A 3F9GA 3PROA 1Z8RA 3SORA 2FOGA 2Y80A 1PPFE 3I77A 1PJPA 3DD2H 2STAE 2BD8A 5GDSH 1Y5UT 4TSFD 1TNKA 4XSKU 1GJ5H 3HK3B 1GHBG 2ZG0H 3ZV8A 1K0HA 1CA0C 4UFDH 4B73A 1WAYB 2BY6X 1SFQB 2Z9IA 4PROA 3MOCA 4FVBA 1RTFB 4WMDA 1PFXC 1EB1H 2TPIZ 1PPHE 1YC0A 1KIGH 1SPJA 1BHXF 2C93B 1MKWK 1OWJA 4HZHA 4SGAE 2FYRA 1GI7B 1EASA 1C1UH 3KYFA 3KIDU 2VVCA 1PPBH 1QHRB 2PKSC 3SV9A 1GBDA 7ESTE 2BDCA 3RXGA 1O36A 3QUMP 3GCNA 4XRNA 2HALA 4AG2A 3C1KA 1NESE 2QIQA 3QK1A 2C8ZB 1FXYA 4BNRA 3VFEA 4JMYA 3F9HA 4NZQA 3RC4A 2J38A 4Y76A 1QR3E 3HGNA 4OS1A 5C0UA 5AFZH 1P2IA 3M3VA 1Z1JA 1JMOH 5CHAB 2PSXA 5DSFA 2GV7A 3NK8A 1EQ9A 5FCKA 1QTFA 3ZZ4A 2IJD1 4WY3A 1KLIH 1MU8B 6LPRA 1O5AB 4NGAH 2PR3A 3QTVH 2B9LA 3RXHA 1TB6H 4MQAA 3VB7A 3HPTB 5HXFA 1WUNH 4K8YA 3OSYA 1W7GH 2A5IA 3K2UA 1LHCH 1NBME 1W11U 1A5IA 2R3UA 1ZSLA 1AKSA 1WU1A 3OX7U 4MPUA 1THSH 1SLWB 3Q3KA 4K1EA 3TJVA 2ZDVH 2WSSD 1N1LA 2EQNA 3FO8D 4UFFH 4MNXA 5T6FA 1T8MA 1K21H 1V2KT 1ACBE 2BD2A 1ZMNA 3SZEA 1TABE 1O5GH 2F9BH 2BVRH 3SUGA 1C5ZB 2FESH 4X1PU 1GCTC 1LTOA 1WTHD 1O2XA 2HGTH 4CRFA 1LCYA 5T3HA 4DGJA 1FY8E 1HV7A 3URDA 5EODA 4O9VA 1CVWH 1AE8H 4O03A 3O8DA 3BEUA 1A3BH 3OE7D 2B7DH 3KQEA 1QB9A 3CS7A 3DSGA 3U1JB 5KECA 3RM0H 4X8SH 1T8NA 3PB1E 4F49A 2QXJA 1EZUC 1PPCE 3SV6A 1BRUP 4M7GA 1BTWA 2TBSA 5DP8A 1O2ZA 3PRBA 4Q80A 1J9CH 1ZTLA 1C1PA 3UAIC 2ZPSA 1Z6EA 1BTPA 1HPGA 1O3FA 1UHBB 4CH8B 2RA3A 3ZZ8A 4HGCA 1PPEE 4FOUC 1HLTH 1V2PT 1BHXB 2OC7A 1G3EA 1BMMH 1GVKB 1NPMA 1N8OC 3ZZBA 2H5CA 3LPRA 1F0RA 4J2YB 4RKJB 3W1EA 2FS9A 1GMCG 1KXAA 1FX0B 3T2NA 3T29A 2OC8A 1XXFA 1UK4A 3MNXA 5EPYA 3LGTA 1SMFE 1JXPA 1TFXA 1ETSH 2ODYB 1Y8TA 4FU9A 4A1XA 2AMDA 4OS4A 3AW0A 4TT3D 1EPTA 1LDTT 3VXFH 1QBOA 1KXCA 1BMFD 2G52A 1LHEH 2BY5X 3KGPA 2KAIB 3F9EA 3URCA 1ZGIA 2FYQA 3DA9B 3A87A 1SFIA 3QGNB 3KQCA 3K6ZA 2FODA 2IN2A 5ESBA 1O38A 1F0TA 1G2LA 4DCDA 4KTUA 4BAHB 2F9VA 3E3TA 3SGBE 5FPTA 2XWBI 1GBBA 2BOHB 3TK9A 8ESTE 1GHVH 3LGIA 2R0LA 1COWD 1TQ7B 3BTHE 2V7QD 4ISLA 4UEHH 1NRQH 2DE9A 3SNCA 4VGCC 1VITG 4GSOA 2QF5A 1EP6A 5DP6A 1EATA 1QJ6B 1GVZA 1IQMA 4NFEA 1GJ8B 1MZDA 2BTCE 2ZKSA 1O2PA 1DWCH 5DKMA 4X8VH 3T25A 2HVYB 3SJKA 3ZZ7A 1MMJN 5H4IB 1EZSC 4K5ZA 2GV6A 4JZ1A 4Q4LA 4O97A 1YY3A 4OS7A 1E0FD 2QXGA 1YLDA 2BOKA 4MNYA 1Z1IA 4NWKA 5J4QA 1SGNE 2BDIA 3PLKA 3RXEA 1EAUA 5BRRE 2KFWA 2I6SA 1TNHA 1AB9C 2GJGA 1K1OA 2Z7FE 1KXEA 3NWUA 2FOCA 4UE7H 1MBMA 1FY4A 2FTLE 4Y11E 5L2ZH 1O5DH 1YPGH 2XOKD 2Y5FA 4CHAB 2Q6GA 3TGJE 3STIA 1T32A 3VGCC 3PMJA 4OS5A 1TRYA 1CHGA 4B6FA 1NU7B 3BF6H 2ZF0H 3LGYA 5HGGA 3S9AA 2BDHA 3GY2A 2ZFFH 2NWNA 3RP2A 3A7WA 3AASA 2FOFA 2UUKB 1WSSH 3F68H 3S7HB 1DXPA 3HGPA 3U8RH 4OGYA 1P0SH 5L2YH 1MD7A 2CGAA 4H6SB 3KCGH 2HRVA 3MO6A 3ZZ9A 3MNCA 3EYDA 2D1JA 3UR9A 2AGEX 1WQSA 1V2TT 3UUZA 1Y5BT 4WWYA 3ATLA 2ZFPH 2YMSB 1QRWA 2V6NA 1IQGA 5DPAA 4ABDA 1HB0B 2AMPA 1MU6B 1V2MT 4FUHA 1TE0A 1P2MA 3FFGA 2BX4A 3A8DA 1SOTA 1QA7A 3MNBA 3F3BA 1GJDB 5C2ZA 1FJSA 2FS8A 1E35B 2DUCA 4AGJA 2GD4B 1UVSH 3MU0A 3A84A 2C3SA 4MNWA 1HCGA 4YLQH 4INLA 3BTEE 3ZYEA 3EE7A 1K1PA 1ZMJA 2WPMS 5EJZA 2ZU4A 1IAUA 4K1SA 1O31A 1K1LA 5EJ1A 3E1XB 1EFRD 2SGQE 4FUIA 1AWFH 3LU9B 1O2SA 1D6WA 3GY7A 1MTNC 2ZTYA 4J1YA 1QA0A 4ACBA 1NZQH 1VR1H 1RIWC 1SQRA 1HXEH 3S7KB 2OBQA 2GTBA 5DJ7A 3D62A 1RS0A 1OKXA 2HWLB 1UTNA 5IK2D 3M61U 4MPWA 2BY8X 3RLWH 1O2JA 1IHSH 1O3KA 2QF4A 4D76A 5C3NA 5FBEA 4DT4A 3PMBB 1QL9A 4Z6AH 1ZHRA 8GCHF 1L0ZA 4NA7A 4MDSA 1O2VA 1V2WT 1CHOF 3RU4E 1H1BA 2BQWB 1XVMA 3MO3A 4KELA 4AX9H 4I86A 3T27A 4P02A 1A7SA 3N7OA 4ABHA 5IDKA 1IQLA 1P10A 5ETXA 1O2NA 2FI4E 5A09A 1TBQH 2A45B 3HK6B 3ATKA 1XUIA 1GHXH 1L2EA 3RXTA 3K65B 1OWHA 1OP8A 1UTKA 4LOYH 2EA3A 2PGBB 1V2VT 2ZTXA 2FMJA 3SQEE 4AFSA 3E6PH 3B23B 3R3GB 1BOQA 2ZGHA 3KN2A 5F8XA 3BIVH 5AF9H 1NFWA 1ZSKA 2CHAC 4ABEA 2HOBA 5E0JA 3TGKE 5KEDA 2D8WA 1A4WH 2WPDD 4I8LA 1CT4E 5C1XA 3ZYDA 1P57B 1RTLA 3SUDA 5C1YA 1IQJA 1AZZA 1RXPA 2YOLA 1H9LB 2YNAA 4XOJA 2BD5A 2GCTC 3MWIU 3LOXA 3UY9A 2QF0A 1QBNA 1KLJH 3MH4A 2XCNA 3W95A 1FN6A 2HLDD 3MO9A 2CF8H 2ZDKA 2AH4X 1SLVB 5FPSA 1IQIA 1NFXA 4OGXA 1BA8B 2ZI2H 4BANB 3GCHB 1O2OA 2JJ1D 5I46H 1KMHB 3KF2A 2GKVE 2FOMB 4B6EA 5LH8A 2P3FH 1F2SE 4ZUHA 1A0LA 1RGQA 1UK3A 2JKHA 2FI5E 3I29A 2EI7A 4B1TA 1T31A 4YT7H 5GJ4B 4YESB 1JOUB 2BX3A 5JBAS 1O30A 5T6DA 2J34A 3SN8A 1YPKH 1OX1A 3GDSA 3PTNA 4X0WU 5FPYA 3PMHB 3U69H 1XX9A 1FPCH 1OOKB 3LT3A 2Z9LA 1HFDA 4B2BA 2A4QA 3M3SA 5A8ZA 1W0ZU 1GDQA 6CHAC 1C2HA 2PW8H 1K2I1 2ZU5A 1C9PA 1D3PB 3U1IB 4YOGA 4BTTB 2A2QH 2BXUH 3KYGA 1CGJE 1KXFA 1VCWA 3A8AA 1MUEB 3BG4C 1SGFG 5F03A 5J4SA 1TX7A 2L6OA 1GDUA 1FLEE 1EKBB 4E06H 1EPTC 1HBTH 2NU4E 1S6FA 1ZLRA 1ELGA 2SGFE 1QIXB 2XTTB 2CMYA 1U6QA 2ZA5A 1GJ9B 1QRXA 1OWDA 4MG3A 4YLUA 4LXBH 2CN0H 1DSTA 1TNLA 2W26A 4FUDA 2OTVA 1F0UA 4DOQA 1D4PB 4DT7B 1C5NH 1ZGVA 1SL3A 2Z6BD 2ZPRA 3SHAH 1SGCA 1C5UA 4WXIA 2HLCA 1GVLA 3SGAE 1E79D 2FOHA 1GBEA 5ABWA 2QAAA 1OWEA 4B2AA 4ZROA 3DSOA 4FU7A 2W3KA 2ZZUH 1P04A 4A6LA 2CV3A 2PKAA 3UREA 1MTWA 2HNTF 3GCTF 1MAXA 4OM9A 1VGCC 3MQKC 1CGIE 4GVUA 2BM2A 5EPNA 1C1OA 1TAWA 3KL6A 2XW9A 3CNRA 4WF8A 1O32A 4IS5A 3WY8A 1DS2E 1H8HD 2FM2A 5DP4A 2VH0A 1FV9A 1KLTA 3AW1A 1B0EA 4FXGH 1YCPH 3V12A 2HNTC 1A5GH 4FUBA 5E2PA 1JRTA 4B75A 2JETB 2W7SA 1UCYE 4WMFA 5EG4A 1NRRH 4NG9H 1C5MD 1NC6A 4TYDA 7GCHF 4GHTA 2OC1A 1J15A 3MU5A 4NA8A 4X8TH 2IOTA 3SOSA 1HAOH 2GX4A 2VB0A 4YZUA 1OSSA 1HXFH 4OS2A 4AGKA 1A46H 1BTUA 1ESTA 2FO9A 1AUTC 2BDYA 5CE1A 1HIAA 2PGQB 2QYIA 4E7NA 2G4UA 3MHWU 4B76A 3TH4H 5C20A 3MYWA 1ANEA 2A0QB 2Q1JA 3TNTA 1ELVA 4IBLH 3D23A 2ZQ1A 1AVWA 2KZ4A 5EW1H 1W0JD 1Y3VA 3S0NA 1QQUA 1WYKA 5C0TA 3D49H 1ABJH 1SR5C 2G5NA 1BZXE 3VXEH 4MPVA 1V2QT 1SSXA 1MTSA 1DWEH 1TX8A 1O2MA 5GCHF 1LVBA 1TPPA 5SGAE 3RM2H 2VGCB 1S6HA 2BDAA 1DDJA 1KDQA 2ODPA 2D26C 1IQHA 1C9TA 1GI8B 6GCHF 5DP3A 4ISOA 5JBCS 5JPMH 2ANKH 1C5OH 3NRLA 1C1QA 1YBWA 2VVVA 2ZU3A 3V7TA 5DGJA 5G4BA 2XRCA 3Q3XA 2XC0A 1T7CA 3GCOA 4U2WA 3SUEA 1GHYH 3TPIZ 1AFQC 1CT2E 1V3XA 1FIWA 1DXWA 3A82A 1A0JA 1CQQA 1GL0E 2G00A 1SGEE 3DUXH 1AI8H 1XUHA 2EY4C 1O3IA 4A7IB 1C4U2 1TRMA 2BMGB 3T62A 2FP7B 1C2FA 3EAJA 1YPJH 1GWAA 1FY1A 2J95A 2J98B 3EE0B 1MTUA 1H9IE 3ZZDA 3VB6A 1DM4B 1UCYH 3V3MA 2BDBA 1O5EH 1O3JA 3P8OA 1TNJA 1VCQA 4K1TA 2WINI 1GMDF 2Z3EA 3CENA 5A0CA 7KMEH 4U32A 3BG8A 2SFAA 2VWOA 2FX4A 1Q2WA 1LPGB 1S6LA 2B5TB 4Y8ZA 1UTPA 1VJAU 4U30A 1S83A 2LP6A 2WV4A 1O2UA 2A7HA 1WBGB 2WPIS 2ZGCA 2ZTZA 1GI3A 1G30B 2JH0D 1GGDC 3HATH 2VIOA 2G4TA 2AGIX 2JDID 1CU1A 2SNVA 3QZQA 1C5YB 2V3MA 2OQUA 1YLNA 1UK2A 2H5DA 4ABGA 3LDXH 1UTMA 5I25A 3TU7H 2P59A 1JRSA 1SLUB 1CA0B 2ZDAH 1W12U 2GMTC 5EGMA 1NBMD 1Z8GA 1E1RD 3FP6E 3FOAA 1ZYOA 3ZV9A 4X6MA 2BLWA 2F3CE 4YT6H 2QCYA 1FUJA 4Q7YA 1QJ1B 3SJ8A 5DK1A 3ZZ3A 2AIPA 1LMWB 2ZCKP 4IW4E 3RXOA 2WV9A 3P8NA 3MTYA 3SU3A 3H09A 2V3HH 4X2YA 2VINA 2O8WA 2LELA 1TA2A 4F55A 2PKSB 4BXWA 2ASUB 4UONA 5FX6A 1X7AC 2FOBA 2BZAA 3U9AH 1Y59T 2AERH 2ZPQA 3A86A 2V3OH 3S69A 4Y71A 3ZVAA 4BAKB 5LPFA 1GHZA 5DG6A 3BTWE 4E7RG 1QY6A 3A7VA 1T4UH 3ATIA 5GIBA 3UWIA 8GCHG 1MZAA 1O3BA 1Y3YA 3LGVA 1CHOG 1O3CA 4X1SU 4H6TA 1SGQE 2ZHWH 2OXSA 1HAVB 3TK5A 4X6OA 2A1DB 1ELFA 2R2MB 4JK6A 1P9UA 3RC5A 3NZIA 2GGVB 4JYUH 5HM2A 4X1NU 1TNIA 3SHCH 4A92A 2STBE 4XD7D 2WYGA 3LC3A 3UOUA 3OAAD 4I7YH 4CRBA 1Y3XA 1DFPA 1PQ7A 2FDAA 1ZTJA 2FTMA 2GDEH 3RMMH 1HJ8A 1BTHH 4ZH8A 4I8JA 2A4RA 2TIOA 3RXKA 3E16B 2FLRH 2GCHF 1HYLA 1ABIH 1K1JA 3IITA 2PTNA 4CREA 2A32A 3TJNA 3ZVBA 8KME2 1C1VH 1XM1A 1XXDA 3PV2A 4I31A 3QZRA 4DJZB 3Q76A 3FP7E 2F4LA 4GHQA 2IPHA 1OS8A 4HTCH 5BPEA 4AN7A 3L6PA 3QO6A 1SC8U 3GDUA 3N7DA 2P8OC 5A2MH 4ISIH 1BRBE 3N7EA 1BDAA 1GJCB 1TMUH 4CR5A 4FVDA 4INKA 1BMLA 2KCYA 1K22H 1EXFA 1NY22 1W2KH 1J16A 2SGAA 3UNRA 1T8LA 2QE7D 4DIHH 3TVJB 4AG1A 2XYAA 1BBRK 3E0NB 1SQOA 1F7ZA 2FX6A 1GBTA 2Z3DA 1VITH 1O3DA 2PFEA 1O2WA 1QBVH 3EA9A 1TOMH 2WPKS 1B0FA 1TX6A 4AC9A 1YPHE 3ZIAD 2PSYA 1FAXA 3BTME 1KY9A 1BJUA 3UR6A 3KEEA 1H4WA 3RXRA 5EQQA 3PYHA 1AWHB 2WYJA 2ZFQH 1ANBA 4XBCA 4ZKOU 2WUBA 5C67A 2L74A 1XUGA 4Y7BA 1GBIA 3B9FH 1W10U 1XVOA 1O35A 5FCRA 4FUJA 4X6PA 1N8OB 1EOJA 3SU2A 1P11E 2VIPA 4MNVA 1GBCA 1AU8A 1C4V2 1C1RA 1TMTH 2VVUA 3E90B 1ZMLA 4IGDA 1T8OA 1XUKA 1C2IA 5LPRA 2FIRH 3RUOA 1O3PB 3BEFB 1MABB 1ZPCA 1L1JA 1W14U 4MLFB 4ESTE 3F9FA 2BLVA 1ELTA 4LK4A 1PQAA 1O34A 3ATWA 2QF3A 2NU3E 1V2JT 1GBJA 1NFYA 1H8DH 3ESTA 2SGDE 2O9QA 3BTFE 1C5QA 1QQ4A 4ABBA 1NU9A
chains in the Genus database with same CATH topology
4AB9A 4Y7AA 4Y0ZE 4X8UH 4SGBE 4DY7B 1CSOE 3G01A 3L33A 1C5WB 1LHGH 3BV9B 1O3EA 1L4ZA 2QC2A 3M5OA 3LGWA 2TGDA 1EX3A 3RLYH 1T4VH 4ZAEA 2F83A 4JYTA 4NA9H 1TGTA 1GMHF 1MKXH 5PTPA 1VZQH 1AN1E 1CT0E 4VGCB 4FUGA 1UVOA 3IWMA 2C8XB 1TGCA 2OBOA 1GJ7B 1Z6JH 2A2XH 3M36A 1AGJA 3RXPA 1RRKA 3A7ZA 2VH6A 2KAIA 1TWXB 1TNGA 4RN6A 2GZ9A 1MAYA 4Y0YE 5EXNA 1UVUH 2OLGA 2OINA 1S85A 2ZU1A 2SGPE 3GCTG 1WTGH 1ANCA 2TRMA 1NRPH 4Q2KA 1K1NA 1TPAE 4GCHF 4AZ2B 4ZKNU 1HRTH 1EAIA 4Y8XA 5EQRA 5HYOA 2TGPZ 3BEIB 5FBIA 3IG6B 3SBKA 2O8LA 5K7RA 2VJ1A 1AB9B 2BQ6B 1BTXA 1PPZA 2AEIH 1ANDA 1DWDH 3TK6A 3RXAA 1GG6C 3A81A 1D9IA 2HVXA 4R0IA 5C1UA 1DSUA 3DFLA 1MH0A 3P70B 7GCHG 4ISNA 3M7TA 3LJOA 2J9NA 1WV7H 3RXSA 3VGCB 2Z9JA 3SQHE 1C1WH 2VIDA 2BZ6H 4JYVH 2ZDLA 2WPHS 1C1MA 2A4OA 2ZDNA 2ZDMA 4BTIB 2WUCA 1SGDE 3H7OA 3RXMA 1IQNA 1DY8A 1FONA 4AFQA 2NU0E 3MI4A 1SGRE 1ZZZA 1Y3UA 3RXUA 1O3HA 5DP7A 3T5FH 4WMEA 1HAZB 2PKAB 1G3CA 5A0BA 2G55A 3GY8A 1TALA 1ZTKA 1IOEA 3RU4D 2J92A 1CBWC 2QXIA 3S9CA 4RSPA 1Z8JB 2BD7A 4O3UA 3MH5A 1A61H 4U01A 5GCHG 1EAWA 1W3CA 2GT7A 4D8NA 1ZR0A 1PQ8A 4NZLA 3ZVGA 5JB8S 1Y3WA 2XBXA 3MFJA 1RJXB 5TCAA 4DURA 6GCHG 3Q00A 4IMZA 2PWXA 3V13A 1J14A 3ENSB 1IHTH 2QXHA 3QTOH 3PO1C 1L1GA 1ELCA 4YOJA 4YO9A 2EI6A 1LPZB 2Y5GA 1VCPA 4ZMAH 4QT8C 4FUCA 1B5GH 1LVYA 3PTBA 3M5MA 4DVAU 4Z0KA 4TY6A 1EZXC 1C5XB 2VIQA 1FPHH 1HIAB 2W3IA 1SG8B 2PTCE 2RA0A 1ESAA 3ZVDA 3SU1A 1W0YH 1HJAC 4ABFA 2ZHFH 1GI0A 4NIWA 2BY9X 3RMNH 2BQ7B 2K1QA 1W8BH 1MTNB 1HAXB 1TBRH 3HKJB 4NSVA 1RIWB 1QB1A 3RMOH 2XCFA 4BAOB 3A7XA 3PWBA 3O8BA 2GT8A 1GHAF 2ANYA 3RDZA 1P2JA 1UTJA 1KDQB 1TMBH 4AFZA 2QY0B 4CRAA 3U98H 1S0RA 3EA7A 1OP2A 5HM9A 1GMDG 1LQDB 1C5SA 3M35A 1BCUH 3UPEA 2XNIA 1AQ7A 2ZFRH 4JZEH 3QDZB 1BMNH 1FY5A 2H9HA 1LHFH 2A7CA 1F92A 1RD3B 4WXVA 3SU6A 2OP9A 1OYQA 4AB8A 4AYYB 2VU8E 3KQBA 1AE5A 1KXBA 3Q3YA 3SV8A 2B0FA 1SQTA 2UUYA 2A7JA 3Q77A 1GI4A 3UQVA 4X2WA 3GY4A 2AYWA 3A83A 3JZ1B 3NCLA 1K1MA 5JYIA 1V2OT 2CHAB 2PLXA 3TNSA 4YTAA 3P6ZB 2F91A 1S5SA 1ELBA 1O3NA 4NFFA 1Z7KA 1MQ6A 1O3OA 1TGBA 2P3TB 2A31A 1OYTH 3P8GA 1AKSB 5A0AE 4XBDA 4X2XA 1BB0B 3PM3A 2Y5HA 3ATMA 1OXGA 1AY6H 2XXLA 3LJJA 1P02A 2ULLA 5CHAC 3SJ9A 4F4OC 5F8ZA 1E36B 2GCTB 4Y10E 2Q6FA 3RXIA 3BTTE 3TJOA 4MPXA 1G9IE 3SU5A 1GJBB 1P8VC 4TPYA 1AVXA 1GI1A 3GY5A 1INCA 3PLBA 5EXMA 1E38B 1SB1H 1P2QA 1P3EA 2G5VA 3D65E 3GYMA 3M3TA 4ISHH 3SUFA 1TONA 1THPB 2ZIQH 1C2EA 3LC5A 1KXDA 1EOLA 1KTSB 2ZNKH 2BVSH 1AUJA 4JZIA 1UVPA 5C5OA 1C5VA 3SI3H 2FXRA 1LVOA 1HAIH 3LONA 3ODFA 3H7TA 3UQOA 1N6XA 1D3QB 4A5TS 3A8BA 3ZVFA 2GVFA 3ZZ6A 2D2DA 2GP9B 5TCCA 2ZEBA 2BXTH 4NSYA 1AO5A 1GDNA 2ZFTA 3MU4A 2UWPA 2F9UA 3BN9A 1YYY1 2GCHG 6CHAB 1G36A 1V6DA 1L4DA 3SV2H 1LO6A 3QWCH 1MTVA 2BY7X 3O8RA 5A8XA 2ESTE 3SO3A 2ZQ2A 1O2KA 5EU8A 1Z71A 1QB6A 2C8YB 4A1TA 1UVTH 2ZHEH 4R8TB 5L30H 1FI8A 3BG4B 3RXJA 1ZRKA 1CA8B 2CXVA 5JDUB 1GBAA 1O5CB 1BMAA 2TGAA 1EPTB 3P17H 2H2ZA 1SGYE 1TGSZ 2LNCA 3VB5A 1ZRBA 2R2WU 1OWKA 1NFUA 1ARCA 1MKWH 3VB4A 1EJAA 1DUEA 3GISB 1SHHB 3UNSA 3MNSA 5A8YA 3EGKH 1RFNA 4NIVA 2VIVA 1HUTH 2QA9E 3CS0A 3FZZA 1HAPH 3VPKA 2C4FH 3T26A 2FOEA 3MU1A 2V0BA 1SGTA 3OY5U 4MVNA 3SU0A 1UCYK 1ZPBA 2XBYA 3M5LA 2JH6D 3TITA 4LZ1H 3HKIB 4TWWA 4I8HA 4CR9A 4RKOB 3F6UH 1YPLH 1P12E 1VGCB 2F9OA 4FUEA 2ALVA 2C90B 1FNIA 4NWLA 1NROH 3FANA 1NRNH 1BRAA 2ZP0H 4JZFH 4XE4A 1C2GA 1NN6A 4IN2A 4A1VA 3MH7A 4ZHLU 1QURH 2BVXH 4D9QA 1LVMA 4XBBA 5GXPA 4HFPB 1OP0A 3QGJA 4JK5A 5DP9A 1GI2A 2O8TA 4KGAA 1EAXA 3LH3A 3UTUH 2ANWA 2H6MA 1C5LH 1ELDE 1P06A 1TRNA 4NIXA 3UIRA 2BB4A 3NPSA 3ZVCA 1AD8H 5E2OA 3GY3A 2UWOA 4ZHMU 3H5CB 1XKAC 3ZVEA 2FEQH 4KTCA 1Q3XA 1ELAA 3RXQA 2ZU2A 2BD4A 3NUMA 3NXPA 4Q7XA 4FUFA 4ABJA 4GPGA 2M5TA 4O3TA 2QV1A 2WPJS 3FVFB 2EEKA 2UUJB 1V2UT 2EC9H 2R0KA 3PV4A 1A1RA 1A0HB 1GMHG 1D6RA 2AIQA 3SU4A 2H9EH 1H9HE 1CE5A 1UTQA 2ZWLH 3SNBA 1XUJA 1QJ7B 1O5FH 1UTOA 2BLOA 2Z9KA 5HMAA 1Y5AT 1QL7A 4X1QU 4WH6A 1YGCH 1JIRA 4DW2U 1P2NA 1K1IA 4K2YA 2AFQB 4CHAC 2LPRA 2XC4A 3K9XB 4BTUB 4GCHG 4YM9A 1C2MA 2VWNA 1TLDA 4INHA 5EXLA 3EA8A 1LPKB 1ELEE 3SV7A 4I33A 3K6YA 3M5NA 2UUFB 1GJ6A 5DO4H 3BTDE 1O2LA 1AFQB 3DT0H 1OWIA 4I8KA 1YLCA 1W7XH 1QCPA 4Q7ZA 1DPOA 3TJUA 1BBRE 3A7YA 1MQ5A 5E0HA 1UTLM 3RXDA 1G32B 1V2ST 2HPQH 3A7TA 1A3EH 1O2GH 2ZGJA 1O2IA 4NCYA 1YP9A 3M37A 3UOPA 4IN1A 1LKBA 4AOQA 1ARBA 2VWLA 4AYVB 3DHKH 4MTBA 4ZXYH 1YCPM 5TJXA 1F5RA 4X2VA 2FI3E 2ZECA 2ZC9H 3L3TA 4IMQA 4CRGA 1NTPA 2ZHQH 1G3BA 1PYTD 5EOKA 1QNJA 1GHBF 3TGIE 2Q6DA 1V2NT 1W13U 2SGEE 3BTGE 2BDGA 2Y7XA 1FN8A 4B74A 3SNDA 1E37B 1BITA 1DE7H 3C27B 1F5KU 4TWYA 4AORA 1GCTB 3R0FA 1GGDB 5DP5A 4KP0A 4Y6DA 1SHYA 2ILNA 1SQAA 1O2HA 1UMAH 2P94A 1KSNA 3QX5H 1XKBC 1CGHA 1NO9H 3SZNA 1WQVH 2QN5T 1O33A 2GMTB 1FY3A 1EJMA 2F9NA 3STJA 4H42U 1C2KA 1SLXB 2BYAX 3PMAB 3RXFA 1C2JA 3VB3A 3OY6U 3RXBA 1AZ8A 1LQEA 5E8EH 3P92A 1YPMH 2OD3B 4Y8YA 5K0HA 2SNWA 3LH1A 4WVPE 4BXSA 1SBWA 2QGRA 2ZO3H 1PPGE 1SI5H 4ASHA 4AFUA 1FAKH 5FAHA 5AVDA 1EB2A 2I6QA 1D3DB 3RMLH 1EZQA 3I78A 1TPOA 2YNBA 5GPIB 1GHWH 2TGTA 2ALPA 3UFAA 4ZKSU 1BBRH 2VWMA 5T6GA 1O39A 1GHAG 3SGQE 1C2DA 1O0DH 3PWCA 4ZHAA 5FXLA 2HNTE 4K8BA 4OS6A 3KNXA 3O8CA 4B2CA 1ZJDA 2AGGX 1WOFA 1P01A 2A4GA 1J17T 5C5NA 3BTQE 2FWWA 1TYNA 4XFQA 1C5RA 1GL1A 3U8OH 1D3TB 3SW2B 1TGNA 1WCZA 3JZ2B 2J94A 3OYPA 4IC6A 1JWTA 2GZ7A 3VEQB 1S82A 2OQ5A 1UHBA 3W94A 1DITH 2Z94A 2GDDA 3A8CA 2THFB 2BLQA 2ODQA 1C1SA 1ID5H 4CRCA 4CH2B 3LIWA 1QFKH 1P3CA 3GYLB 4TPIZ 1MKXK 1ESBA 4CBOA 2FLBH 8LPRA 1ZHPA 3ZZ5A 5LGOA 2G8TA 1GJ4H 2J2UA 1AIXH 1B7XB 4JZDH 1XUFA 3RXVA 4K3JA 3TIUA 1DLEA 3V0XA 1GBMA 1HAYB 2O8MA 2IJOB 3RU4T 2HPPH 5FX5A 6ESTA 1DLKB 1ZPZA 5AHGH 4CRDA 1O2RA 2F9PA 1BT7A 3AVZA 3EDXB 1HAHH 3SJIA 3P8FA 3MH6A 1HAVA 1THRH 5F8TA 2ZGXH 5JB9S 1LHDH 1P09A 1XMNB 4X6NA 2XBWA 4NIYA 1TIOA 3GCHC 1GBLA 1KYNA 2P8OB 4UFGH 1P05A 4BAMB 2FOAA 1JIMA 4KTSA 4UD9H 5LPEA 2CF9H 2BD3A 2B8OH 2R9PA 3A89A 1YKTA 2BD9A 2PUQH 1DY9A 4BAQB 1EP5A 1P2OA 5JBTA 3E0PB 1SOZA 2OC0A 2W7UA 1O3GA 3KQDA 1S84A 1ORFA 2Y6TA 1YM0A 1LKAA 1IQKA 4ZKRU 2P95A 2XC5A 4XDEA 5FHTA 1MBQA 1RTKA 1O2QA 4DIIH 1GMCF 1HGTH 3QLPH 1HJ9A 1FIZA 3GDVA 3CP7A 1C2LA 2V35A 2Y7ZA 1F0SA 4E05H 4JCNA 3MU8A 1AVGH 4IC5A 1DANH 4K69A 1SGIB 4HI3A 1G37A 2AMQA 3MMGA 1DICA 2CJIA 2C8WB 1SVPA 2VNTA 2R3YA 1MCVA 3U8TH 1NM6A 1P9SA 4WH8A 4ABIA 1V2LT 2ZCHP 3TLOA 4GAWA 3E91A 2W5EA 1SGFA 1ETTH 5AFYH 1DVAH 3UWJH 4BOHA 3RXCA 1OPHB 3GICB 5F6MA 2A5KA 3T28A 3P95A 1O2YA 3ODDA 4Y79A 1BTZA 1TBZH 5E0GA 2EI8A 1AHTH 2XWAA 1UO6A 7LPRA 3AAVA 2AS9A 4FU8A 2RCEA 2FZZA 1TOCB 1A5HA 1Z8IB 1C5PA 3S9BA 1VITF 1P03A 3QN7A 3SI4H 2PUXB 4DG4A 3TH3H 3SNEA 4CBNA 1DOJA 2G51A 3GOVB 1IQEA 3BSQA 1K9OE 4D7FA 1O3AA 1BQYA 3BIUH 1M9UA 1FQ3A 3FZDA 1C1NA 2JH5D 1GJAB 1NT1A 1S81A 2Y82A 1HDTH 4X1RU 2NU2E 3SNAA 3DFJA 3UNQA 2ZGBH 3ZZCA 2ZCLP 1N6YA 1NRSH 1ZSJA 5GWZA 1YF4A 4I8GA 2JETC 1PYTC 1P2KA 5EQSA 3M7QA 4WJG2 1BUIA 3ELAH 1O2TA 1CO7E 2P3UB 5B6OA 1DUAA 1MD8A 3B8JA 1O5BB 2VIWA 3RXLA 4UDWH 1QGFA 1ETRH 2WPLS 5ESTE 1J8AA 2Y81A 4TY7A 4ZXXH 1GI9B 3EQ0H 1BRCE 1A2CH 1O37A 2ZHDA 2FPZA 3RC6A 3TH2H 2BHGA 3M7UA 1GCDA 1GG6B 1DX5M 2NU1E 3LKWA 3PLPA 2Z3CA 3KHVA 1E34B 4ABAA 3ZZAA 3LGUA 1V2RT 4D9RA 3OTJE 4D7GA 2WV5A 1JBUH 3ITIA 2ZFSA 1C5TA 1GBKA 1IQFA 3AAUA 1C4Y2 1S0QA 2VGCC 5JBBS 1GBHA 3FP8E 4THNH 2OCVB 1KTTB 5L6NH 4GLYA 1HNEE 1AFEH 1SGPE 1HAGE 1O3LA 1QL8A 1EUFA 3NKKA 1GPZA 2ANMH 1BTYA 1CBWB 1O3MA 1H8IH 2PV9B 2O8UA 1BJVA 3GY6A 3SJOA 1VJ9U 4B71A 2OUAA 1ZJKA 2H9TH 3F1SB 1G3DA 1ZHMA 5IYTA 1NS3A 2J4IA 1GBFA 1GI5A 1YCPK 2PHBA 3A85A 3A88A 2XBVA 3PO1B 4K60A 4I32A 1YPHC 5EW2H 1C1TA 4H4FA 1DWBH 2Z9GA 3E8LA 1QRZA 1AMHA 3BTKE 2DE8A 3OU0A 1G2MA 1DT2A 2P93A 4YOIA 1BIOA 1ZOMA 4UFEH 1FMGA 4LZ4B 1EJNA 1F5LA 9LPRA 2RDLA 2UWLA 1HJAB 1K28D 3A80A 1YPEH 1Q31A 2H1UA 1FZZA 1UJ1A 3FAOA 1TPSA 2A5AA 4KKDA 1L1NA 1GI6A 4GUXA 1TA6A 5CMXH 2GZ8A 1MCTA 1TQ0B 2P16A 1PQ5A 9ESTA 1FDPA 2G81E 2RG3A 3F9GA 3PROA 1Z8RA 3SORA 2FOGA 2Y80A 1PPFE 3I77A 1PJPA 3DD2H 2STAE 2BD8A 5GDSH 1Y5UT 1TNKA