1PPEE

The refined 2.0 angstroms x-ray crystal structure of the complex formed between bovine beta-trypsin and cmti-i, a trypsin inhibitor from squash seeds (cucurbita maxima): topological similarity of the squash seed inhibitors with the carboxypeptidase a inhibitor from potatoes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The refined 2.0 A X-ray crystal structure of the complex formed between bovine beta-trypsin and CMTI-I, a trypsin inhibitor from squash seeds (Cucurbita maxima). Topological similarity of the squash seed inhibitors with the carboxypeptidase A inhibitor from potatoes
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1991-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppeE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppeE02
1SHHB 2SGDE 1H8IH 4KGAA 5JBCS 1ESAA 1DX5M 1ID5H 2BMGB 1C2FA 3K65B 1GJAB 1ANBA 5C1XA 4ABJA 1RTKA 1TGNA 1AWHB 2EI8A 1DSUA 1HLTH 4K2YA 3FZZA 3T29A 3MNCA 1C2DA 4IS5A 3Q76A 3LC3A 1KSNA 2GCHF 1MD7A 1TX6A 1DUEA 1Z8GA 1WCZA 1O5CB 4X8TH 2C8XB 4MVNA 5TJXA 1MTWA 2YNAA 3RLYH 1Q31A 3RC4A 2NU3E 1UMAH 3FVFB 5E2OA 1K22H 3GY5A 2A4QA 1Q3XA 4UE7H 3T27A 1O32A 5J4QA 1PPHE 1M9UA 1DDJA 1TPSA 3SU4A 3LIWA 3DFJA 1ELFA 3NCLA 4XFQA 2FOFA 2ZIQH 2G81E 2H9HA 1C2MA 3C27B 1CA8B 3EE0B 3LH3A 4YOGA 2ZFRH 4ESTE 5EQSA 3MOCA 2WPHS 2FXRA 3GICB 4JZFH 3LPRA 1YKTA 1O2RA 2A4RA 1CGJE 1NY22 1ZTKA 1VCQA 5CMXH 1Y3XA 1QL9A 1YCPH 3GY4A 4FUBA 5A8YA 3NXPA 1O2XA 1MTVA 3ZVGA 4IMQA 1IHTH 5FHTA 3SU0A 1SB1H 1CA0C 4IMZA 2R0LA 1P03A 3M5MA 1C2HA 3QDZB 5DP6A 2BQ6B 2QY0B 1UCYE 1SGIB 3ZZ9A 1MQ6A 1GJ4H 2H5DA 2UWOA 1VGCB 3RXVA 1C9PA 3HATH 1CT4E 3O8DA 1P2NA 1HJ8A 1BTWA 3LONA 3QLPH 4R0IA 1TABE 3ITIA 2PKSB 3VFEA 2G4TA 1DXPA 1O3EA 3KQBA 1PQ8A 4O3UA 2P8OB 3M3TA 5DO4H 2FODA 3UNQA 2GV7A 1SGTA 1BTZA 2PGQB 4CR5A 1HV7A 1WUNH 1CGIE 2WV4A 5C3NA 2ZFPH 4MNVA 2H1UA 4ZKOU 2ZGXH 2AFQB 2DE8A 1LKAA 1BTYA 1O3MA 2XWBI 1NFUA 4Y0ZE 2BLWA 1BMMH 1F0UA 1O3AA 2FDAA 4D9QA 1MQ5A 1N1LA 1IHSH 4E7NA 2OUAA 1UVTH 1DSTA 1KIGH 2AIPA 1YPJH 1HCGA 1P2MA 4Z0KA 5GDSH 1QJ1B 2ZFTA 2ZTXA 4GLYA 1W13U 1ORFA 1OP0A 2PSXA 3M7QA 1UTJA 1AD8H 2F3CE 2EEKA 1O2SA 1C1OA 4ISHH 1P9UA 2UWLA 1EXFA 3ZZAA 1P12E 4NSYA 1LHFH 1X7AC 2ZGCA 4I33A 3HK6B 2BVXH 5FXLA 1C5PA 2BHGA 2RDLA 1SL3A 2TPIZ 2J95A 2NU4E 2A31A 1TBQH 3GDVA 2ZI2H 4LZ4B 4X2WA 4O97A 3TJUA 1ZHPA 1B5GH 2ZU1A 1WAYB 1AY6H 1UTMA 3K9XB 1Y3VA 4AX9H 2VGCB 1TLDA 1C1VH 1DPOA 3SNDA 4RKJB 2XC5A 2NWNA 1GDUA 5AHGH 2ALVA 1GHVH 2CXVA 2PLXA 1Z8IB 4SGAE 3NUMA 2Q1JA 3TJNA 1Z6EA 2OTVA 1P02A 1EX3A 1CBWC 1MKXK 2ZNKH 1RTLA 1H8DH 2ZDVH 3RXUA 1JRSA 1T8NA 1YBWA 1PPBH 3GY3A 1G3CA 3QTVH 3SU1A 3PLBA 2ZU5A 4CREA 1TNGA 1PJPA 1SC8U 2BVSH 1EPTC 5A0AE 4ISIH 2B9LA 4E05H 1QFKH 2XXLA 1JXPA 2ZZUH 5L30H 1GHAF 4F4OC 1UTLM 2WINI 3I78A 1ZGIA 2P93A 4IBLH 1ACBE 2VWMA 1UVOA 1YPMH 1NTPA 4OGYA 4XBBA 3UNSA 1S6FA 4RSPA 1FMGA 3KCGH 4GCHF 5G4BA 4CRGA 2XCFA 3S9BA 1BCUH 2BD8A 4Z6AH 4JZ1A 1GI8B 1W12U 4B2CA 1ZPZA 3ZZ3A 9ESTA 3PM3A 3ATWA 1CO7E 1QQUA 4YESB 1MKWK 2D8WA 2BLQA 1HAGE 2PSYA 2R9PA 5TCAA 1GHYH 1L0ZA 1SFQB 1O35A 1TX7A 3M3VA 1D4PB 2O8LA 3PWCA 4DURA 5HM9A 3TK9A 1GMHG 3P6ZB 1RTFB 2F9VA 1OX1A 1D6RA 1XX9A 3AASA 3D65E 5GXPA 5C1UA 4OS2A 3MI4A 1O36A 1AB9B 3CP7A 4JZDH 2SFAA 3KEEA 4H6TA 5JB8S 1C5LH 3VXFH 2Z3EA 1OS8A 4FUJA 1GJ6A 4B1TA 2QC2A 1J16A 1E37B 2STBE 1ZJKA 2XBXA 4NWKA 1A1RA 5PTPA 3UQVA 3T5FH 2FYQA 2ZA5A 2C8YB 4D7GA 2CGAA 3LGVA 1V2VT 3ENSB 1B0FA 1BMAA 3S9AA 1OPHB 2AEIH 1O2VA 3S7HB 3UUZA 1GG6C 1O5EH 2OQ5A 4X8UH 2H5CA 1C2JA 2R2WU 3MNSA 5F03A 1KY9A 4JK5A 2A7JA 3GCOA 1GMCF 4ZHMU 2Z9KA 2P3UB 4BNRA 6LPRA 2KAIA 5LGOA 1SLXB 8GCHF 1ESTA 1EOLA 5BRRE 2IN2A 1VITG 3SU5A 4A1TA 1EJAA 2PUQH 4RN6A 1VGCC 2WPLS 5FPSA 3WY8A 4MLFB 2XTTB 1TFXA 1FY3A 5L6NH 1GI9B 5GPIB 3ZZ5A 1XM1A 2O8MA 1TNIA 1YLDA 1EZUC 1NN6A 1ELEE 4FUIA 3NPSA 1IOEA 2OBQA 2FLBH 1AE5A 1SLVB 1V2KT 2P8OC 3GY7A 4J1YA 4KTSA 1BRUP 3PB1E 5EXLA 1N6XA 2R3YA 3D49H 2Y7XA 1YPHE 1K2I1 1Z8RA 1QB1A 2BDGA 1BMNH 3B8JA 5T3HA 1O3DA 2K1QA 5FPYA 1OWDA 1H9HE 2XC4A 5K0HA 1P3EA 4KTUA 3TNSA 3QGJA 2FOHA 3JZ2B 4MQAA 1GPZA 4LOYH 3GCHB 2ZPQA 1HXEH 1P2KA 3RXOA 1G9IE 1KLTA 3V12A 1D3TB 1LVBA 2J92A 5HMAA 2FP7B 2J9NA 1ZZZA 2FOAA 1A3EH 1A0HB 2HGTH 3OSYA 2ZFSA 1ETSH 3A8DA 3RXHA 1C1PA 2BQ7B 1W2KH 1GVLA 1SGCA 1NO9H 1C5ZB 1C4V2 2A0QB 1PPGE 1S84A 4YT6H 5GCHF 1GBMA 2FMJA 3E1XB 4X2VA 4Y11E 2VGCC 1J9CH 1SMFE 2W7SA 3SQEE 4H4FA 3TJVA 2BQWB 4X1NU 4LXBH 3M7TA 4YLUA 3T26A 1BQYA 2ZF0H 3H7OA 3ZVCA 4JYUH 2O8UA 2ZG0H 2A5AA 3F6UH 7ESTE 1UVUH 3RXAA 3KQCA 1O2IA 1O33A 1YP9A 4BXSA 5L2YH 4JCNA 1RJXB 2VIVA 1OYQA 5ESTE 1QA0A 4AB8A 1FPHH 1H1BA 3GCTF 3TIUA 1EUFA 3RXQA 4DY7B 1ZOMA 1PPEE 1QIXB 1Y8TA 2ZFFH 2G5VA 3U8TH 4Y6DA 3KF2A 4MPUA 1W8BH 3ZZCA 3RMLH 1YGCH 1ABIH 1BUIA 3P17H 1XUKA 3RDZA 3A7TA 1EZQA 1GBJA 1HIAA 4AFQA 3F9EA 4AFUA 2RA3A 5DJ7A 3DFLA 1ELTA 1V2MT 4BTIB 5AVDA 1DWDH 1IQIA 3RXRA 1EATA 3SU3A 3U8OH 1SPJA 1AGJA 3SN8A 3SNAA 4MDSA 3U98H 4ABAA 2FPZA 1ZHRA 1FIWA 1Y5AT 5FBIA 2CMYA 2R0KA 4U30A 1EZSC 3SU6A 2TBSA 1HB0B 2BLOA 2R3UA 3P95A 3GYMA 1PYTD 3SQHE 1C2EA 5EXNA 2V6NA 1QRXA 3E8LA 5HM2A 2BDIA 2IOTA 2ZU2A 4X1QU 2QIQA 2AMDA 1CHGA 1EAUA 2J34A 2J4IA 3PWBA 2BY9X 1UCYK 3Q3KA 2VIPA 4NGAH 1P06A 3RXKA 1A4WH 3MU5A 3PO1C 2H9EH 3SGAE 1ELDE 1WSSH 6GCHF 1LPZB 5EW2H 3UR6A 1SGNE 3KQEA 2BOKA 2FTLE 1SHYA 2C8ZB 2ZDMA 3KL6A 1LVMA 1QL7A 1G3DA 1SGFG 1GBLA 4XBDA 1V2OT 2PTCE 3PTNA 2LPRA 1PQ5A 4OS1A 4U32A 2WYGA 3MH5A 4GSOA 1BJUA 4CH8B 2TGDA 1GBKA 1PPFE 1BHXB 1AKSA 2ZDNA 1NESE 3K6YA 4XE4A 1RRKA 4AFZA 4F49A 1SLWB 1NROH 1C5VA 5C5NA 3RMNH 2O8TA 3B9FH 1EPTB 1SVPA 2ZHEH 1EP5A 1O38A 4ZHAA 5AFYH 3RXBA 1IQFA 2YOLA 1IQEA 1LCYA 2FZZA 1BITA 3UOPA 1ZTJA 2Y6TA 1TPAE 1TNKA 5JYIA 1HXFH 3HK3B 2Y80A 2G51A 4MPVA 2OXSA 2ZO3H 2G55A 1AO5A 1ESBA 1W3CA 3A8BA 2HNTC 2TRMA 3JZ1B 1A61H 1NRQH 3UPEA 3IWMA 2B0FA 4Y71A 1TOMH 3ZV8A 4AYVB 1O2LA 2FTMA 3ZVFA 1NFWA 1GL1A 1E36B 1P0SH 1QHRB 3SV7A 5JDUB 4ZROA 1TMBH 3FP8E 1RGQA 3EAJA 4X8VH 1QL8A 4DJZB 1YPEH 2GCTB 3A7XA 2A45B 1O3NA 4CRCA 2B7DH 1GBDA 2BY7X 3FP7E 3OU0A 3A83A 4K69A 4Y10E 5HXFA 4FXGH 2GCHG 5E0JA 5HYOA 3ATKA 3GDSA 4HI3A 1V2ST 3GCHC 5IYTA 3TNTA 3ZYEA 3DUXH 2QGRA 1GWAA 2GZ8A 4BTUB 2ZGJA 4CBOA 4NIWA 2HVXA 4FUCA 1GHZA 2CHAB 4AGKA 2BXTH 1EB1H 4IN1A 4VGCB 1QURH 1T31A 3LKWA 3S7KB 1GMDG 3PMJA 1BBRK 2GT8A 6ESTA 2VIDA 1FXYA 2C8WB 2I6SA 4WJG2 1AVWA 2QXIA 1GHXH 1C2LA 2ANWA 3PMAB 2ZKSA 1O3KA 3RC6A 3P8GA 4YT7H 2WYJA 3TH3H 1NC6A 3UTUH 3M5OA 1P09A 2ALPA 4FUDA 3K2UA 2OC1A 1GG6B 4BANB 4A5TS 1D3QB 1GJ7B 4AORA 1O2PA 1O3LA 7GCHG 5A0CA 1WTGH 1H4WA 4JYVH 1C1SA 4B76A 2BDHA 1AU8A 4UFGH 4A6LA 2ZDAH 2XRCA 1VZQH 4CRBA 1TBRH 1C5YB 1S82A 4AN7A 4BAKB 1BRBE 5JPMH 3OTJE 1TMUH 2F9BH 4Q80A 5DP3A 2VIOA 5C5OA 1C5SA 4AZ2B 1Y3WA 3D62A 2H9TH 3MH4A 4X6PA 5L2ZH 2V0BA 2WUCA 1D9IA 1C5UA 5HGGA 2TIOA 3RXEA 2FI4E 3E16B 3SUDA 1OWHA 1THPB 4B2BA 1RD3B 3ZZDA 4BAQB 3MO6A 3VB5A 2BD2A 3VB4A 2ZECA 4ZKNU 2FOBA 1Z6JH 3MU1A 4Y79A 1VITH 3SV9A 1QNJA 1O2YA 5AF9H 4A1VA 4I31A 3HGNA 5E8EH 5EQRA 2FIRH 2R2MB 1OOKB 5EOKA 3BF6H 4FUFA 4BXWA 5T6GA 3V7TA 1UHBB 3UR9A 3ZVDA 3KQDA 1F0RA 4ISNA 1RFNA 3QK1A 1O2TA 5A2MH 1THRH 1WBGB 4MNYA 3GY6A 2FO9A 3HGPA 1QJ6B 2F9UA 2Z9LA 1EKBB 4NSVA 1TIOA 4TWYA 2SNWA 1OWKA 5I46H 1V2PT 1MZDA 3LT3A 2VVUA 1RIWB 1HUTH 1S5SA 1SFIA 2BD3A 2FOCA 3ZZBA 1O31A 2HPPH 3R3GB 3C1KA 4FUEA 1K28D 1ZRBA 3LJOA 1YLCA 1AFEH 1MAYA 1ZHMA 1HNEE 1HAVA 1NRNH 2XNIA 1E0FD 3MHWU 1NFYA 2F9OA 3V0XA 4I8GA 1QRZA 3MTYA 4MTBA 5FX6A 1K1JA 1ABJH 4YOJA 4H6SB 1KDQA 3QTOH 1S0RA 1ZTLA 2CJIA 4CRAA 4LZ1H 1F5LA 3PMBB 3F9HA 3L3TA 3AAVA 2VWLA 1PPZA 3I29A 1UTPA 3QO6A 4WMDA 4ZAEA 4O9VA 1C5MD 3VB3A 4OGXA 4O03A 3ATMA 1P3CA 1UTKA 3BTGE 2ODPA 4OS7A 1P2QA 2VWNA 2HALA 4Q7YA 1O30A 5DPAA 1GHAG 1XVOA 3DT0H 3BTHE 1SOZA 1AUJA 3MH7A 4GAWA 1GBCA 1CVWH 5A0BA 2XCNA 3P8OA 3TLOA 4GHTA 1QTFA 3H7TA 3OX7U 4GCHG 3R0FA 1BOQA 1O5FH 2LNCA 4OS6A 1FN6A 1KLIH 1MKXH 4DGJA 1BTUA 2FX4A 2OCVB 4XDEA 1C5QA 5B6OA 2V3OH 1GI6A 1HFDA 1C4Y2 4I8JA 1C1WH 3ATLA 5JBTA 1Q2WA 1EQ9A 4NIYA 3LGIA 4NG9H 1W10U 1P10A 2GCTC 3CS0A 1MU6B 1RXPA 5EXMA 2O8WA 1MCVA 1SGDE 1KXEA 1OXGA 1SGRE 3QZRA 2BDCA 4ABIA 1C2IA 2Z9GA 5LPFA 4THNH 1L1GA 1MBMA 3HKJB 3GY8A 4HTCH 4INLA 5BPEA 1IAUA 2Z6BD 2VVVA 2W3KA 3RXLA 1LHDH 1CU1A 3TGKE 4DIIH 2XWAA 2CHAC 4VGCC 1A46H 1UO6A 4B74A 1LPKB 3SV8A 1AIXH 3BIUH 1E35B 3SOSA 4K60A 1BT7A 2PGBB 1LQEA 1C1MA 1XXFA 1MKWH 1XUJA 3F9FA 3UY9A 1GJCB 1WV7H 2VH0A 1TALA 3PO1B 2Y5GA 3RUOA 2PWXA 3AVZA 4WH6A 1UJ1A 2VVCA 1FY8E 1GBIA 5AFZH 4DT7B 3BEFB 2XYAA 1CQQA 4J2YB 1HAYB 3ZZ7A 2ZCKP 3O8RA 2Q6GA 3HKIB 3SHCH 4B2AA 4NA9H 2AMQA 3TITA 4Q7ZA 1DXWA 1QBNA 1G36A 1GBBA 4O3TA 3RM2H 1F5RA 1O5GH 1D6WA 1UK3A 3LGWA 3U1JB 2CV3A 4HGCA 1GI3A 3EDXB 1CHOF 1TOCB 1Y3YA 4D8NA 5F6MA 2FOGA 1CT2E 2VIWA 3MFJA 4FUHA 4Q7XA 2B8OH 1L1NA 1IQMA 1T8LA 3A82A 2PUXB 1TA6A 1OWEA 2Q6FA 1NM6A 3LC5A 1V2QT 2C3SA 3PLKA 1O2OA 3F9GA 1ZPBA 1T7CA 1TNHA 4MNWA 3IITA 3UFAA 4BAMB 1IQGA 3RLWH 1TE0A 1SQTA 3RMMH 2PHBA 1YC0A 1KXDA 1GJ5H 2HWLB 1ETTH 5E0HA 3ATIA 2UWPA 3F1SB 1AUTC 3A80A 4NIXA 3UIRA 1OKXA 2ZEBA 3Q3XA 2GVFA 5DGJA 1O0DH 3MYWA 1KXCA 3V13A 2W5EA 4CHAB 2ZP0H 1UVSH 4XBCA 5ABWA 3A86A 2A2XH 1KYNA 1C1QA 3TGJE 1DS2E 3U9AH 3VPKA 2CN0H 5EPNA 1GGDC 3P8NA 1W7GH 3TH4H 3F68H 5SGAE 1T4UH 3AAUA 2A4GA 2V35A 1HAOH 1RIWC 1SQOA 2GMTC 1RS0A 1OP2A 1V2NT 5DG6A 3RU4T 3M36A 1J8AA 1OP8A 1FV9A 1MU8B 1K21H 3NZIA 2HRVA 3KHVA 4FU7A 1EAIA 3RU4D 1FN8A 9LPRA 3QZQA 3NK8A 2ZQ1A 1K1OA 1MTSA 1AFQC 1TGTA 3A7ZA 3A89A 1F92A 4ISOA 1MD8A 1HIAB 3SUEA 1QQ4A 1VJ9U 3RU4E 4UDWH 3T25A 5EW1H 2ULLA 1P9SA 4QT8C 4UFEH 3TK5A 2ZWLH 5GIBA 1FAKH 2PV9B 2VB0A 4X0WU 4FU8A 4TYDA 3TGIE 1O2QA 1LTOA 1SQAA 3ZYDA 1A5HA 3UNRA 5FAHA 2BVRH 3E0NB 3G01A 3VB6A 4A1XA 5GJ4B 4YM9A 3O8CA 2BY6X 4NFFA 2PKAA 1NZQH 1W14U 3O8BA 2A4OA 1BDAA 3EA9A 2ZGHA 3M61U 2Y81A 2ODYB 3GCTG 4WXIA 1P04A 3VEQB 3LGTA 1AN1E 1S6HA 1QA7A 2W26A 4ABHA 2FWWA 5A09A 2GTBA 3E90B 1MTNC 2VH6A 1GDQA 4PROA 1J15A 1TGSZ 1SGYE 3DA9B 4X1SU 3SGQE 1S0QA 3VB7A 1GVZA 3KNXA 4NA7A 1A5GH 1HAHH 4ISLA 4AFSA 3SV6A 1FI8A 3OYPA 5LPRA 2BDYA 4UONA 4ABFA 1KTSB 2BY5X 1Y5UT 5CE1A 4ZKSU 1G37A 4INHA 3MU0A 1DY8A 1FPCH 1O2UA 4TWWA 1GHBG 2JKHA 4E7RG 3N7OA 1GDNA 2H6MA 1K1IA 2OP9A 1P05A 3RXFA 1XKAC 1L1JA 5F8TA 2BD4A 3EA7A 1JIRA 4X6OA 3PMHB 4Y8YA 1YPKH 1FLEE 1S81A 5C2ZA 1G3EA 1G30B 3PROA 1MZAA 4ZMAH 4UFDH 2AH4X 6CHAB 2OLGA 3U8RH 4GVUA 1D3DB 3PLPA 5LH8A 4WVPE 4XSKU 1GI5A 1O3FA 5DP4A 1DWBH 1G32B 3E6PH 3BTDE 2OC0A 6GCHG 1HAPH 2CF9H 1LVOA 2G00A 2V3HH 4RKOB 3UWIA 4UFFH 3URDA 1BTHH 3KN2A 1XUFA 1CGHA 3SNCA 1SGEE 1GCDA 1C2KA 4YZUA 1C5XB 5CHAB 4FVDA 4ZH8A 4Q2KA 1C5TA 2CF8H 1DOJA 4GHQA 2Z9JA 1GJBB 2VIQA 1UCYH 2OQUA 2Z3DA 1SOTA 4K1SA 1FJSA 2JETB 5F8XA 2G8TA 1AWFH 5K7RA 3K6ZA 3A7WA 1Z71A 2OBOA 5GWZA 2WPIS 4Y76A 3E3TA 1ANEA 1O3JA 3L33A 2J38A 1CE5A 5EQQA 3W94A 3BG4C 4WY3A 2UUYA 3MNXA 3BSQA 8LPRA 1SLUB 5DKMA 2NU1E 1L2EA 1FDPA 2VWOA 1T4VH 3SUFA 3A87A 3I77A 4UEHH 1WU1A 2Z94A 3RXGA 2BD7A 1DE7H 1G2LA 2BDBA 1JMOH 4U2WA 1C9TA 1GI7B 4YLQH 1O2NA 1YPHC 4SGBE 1TRMA 1Y5BT 2GGVB 1TB6H 4MPXA 5EG4A 4IC5A 1ELVA 1QY6A 5T6DA 4CHAC 1S85A 1O2GH 3BIVH 5C20A 1NRSH 3GY2A 4E06H 1BB0B 3E91A 1JOUB 2WUBA 1T32A 1GI0A 1G3BA 1JWTA 1EP6A 1L4DA 2FOEA 2EA3A 4FUGA 5DP8A 1V2WT 2PFEA 3P70B 5E0GA 4AGJA 4Y7BA 1QGFA 1NPMA 1GL0E 1AMHA 4IN2A 2ESTE 2FEQH 1O3OA 1WQSA 1LHCH 5FX5A 5EU8A 4K3JA 1DICA 2QA9E 2WPKS 3ELAH 3RXDA 4B75A 2BOHB 1EPTA 1BHXF 1EAWA 2QF3A 4TY6A 2AGGX 3ZVAA 4D9RA 1HYLA 3FP6E 1K1LA 5H4IB 4DW2U 5T6FA 4X6MA 4ABDA 1A0JA 1GJ8B 1GMDF 4U01A 1YCPK 3E0PB 1O3BA 1QB6A 3VGCB 3P8FA 2O9QA 4K8YA 3PV4A 3AW1A 1HPGA 5I25A 1HAIH 2JH5D 1A3BH 2AYWA 1TQ0B 1BBRH 2XC0A 1Z7KA 5EPYA 4INKA 3Q3YA 3TPIZ 1EASA 2IPHA 3QUMP 1GCTC 2W7UA 3PTBA 2G5NA 2BTCE 1AE8H 2STAE 3S0NA 3T2NA 3T28A 1W0ZU 1HJAB 2BY8X 1BZXE 1MH0A 1P8VC 3LGYA 3LOXA 4UD9H 1Z8JB 4KTCA 1EZXC 2AGEX 1BRCE 2BZ6H 3BTME 3U1IB 2AERH 2FS8A 2GT7A 1AZ8A 1BMLA 1XKBC 4I8KA 7GCHF 2SGPE 1HAXB 3SW2B 3ESTA 3M7UA 2QYIA 3ZZ6A 3MO9A 1QB9A 1EJNA 1O3IA 4FVBA 3AW0A 4OS4A 1DWEH 1GBTA 1HAVB 1LKBA 4M7GA 3A8AA 1ELCA 1ZR0A 3ZZ4A 1LHGH 1KDQB 4Y8ZA 4AG1A 3TJOA 1A0LA 2THFB 4GUXA 1K1NA 4CRDA 1THSH 3FFGA 1FAXA 3S9CA 4BAOB 1O5AB 2BXUH 1P57B 5C1YA 1YM0A 1B7XB 5DP5A 2TGAA 1XXDA 1WOFA 1TAWA 3GOVB 1QBOA 2D1JA 1O3GA 3QN7A 3UOUA 1K1PA 2Y5FA 3EQ0H 2GP9B 3NKKA 1GGDB 2FESH 3A85A 1IQKA 4HFPB 1CSOE 3KIDU 4YO9A 4ABBA 4CBNA 4ZUHA 2UUJB 3BV9B 1TGCA 4A92A 2A5IA 2GMTB 1SGQE 6CHAC 1KXBA 2ZDLA 4GPGA 5DK1A 1P11E 1O3CA 2ZFQH 4NFEA 1WTHD 3RXPA 2BB4A 1WYKA 4CH2B 1C4U2 2VINA 1PYTC 2GZ7A 2ZPRA 4Y0YE 5DP9A 2TGTA 2SGQE 3SI3H 1NU9A 3B23B 3D23A 1AFQB 1QJ7B 2Z9IA 3EYDA 1W7XH 2FM2A 4NA8A 4X1RU 4ZHLU 1ARBA 3FANA 2OC7A 2DUCA 3M3SA 1XUGA 3SORA 2OC8A 1GJ9B 1MUEB 5CHAC 1NFXA 1FY5A 4JMYA 1FQ3A 1BTPA 5JB9S 1KTTB 2G4UA 3GCNA 3MMGA 1S83A 2JETC 3FAOA 3A8CA 1V3XA 5DP7A 3L6PA 3SNEA 5ETXA 1YF4A 3OY6U 2RG3A 2QXHA 3SNBA 3NWUA 4NWLA 1SBWA 2P16A 2P94A 5E2PA 8ESTE 1KXAA 1IQJA 2Q6DA 2FLRH 2P59A 3SO3A 1UHBA 4JZEH 1N8OC 1ZYOA 4WMEA 3UQOA 1C1NA 2TGPZ 5IDKA 2ZC9H 2FI3E 2QV1A 1BBRE 1KLJH 1NRPH 2ILNA 1MTNB 2IJOB 1JIMA 1DANH 3BTEE 2OINA 3SV2H 1HBTH 1BA8B 5LPEA 3LGUA 1KXFA 1GBAA 1C5RA 4TY7A 3OY5U 4D7FA 2G52A 4KELA 4NZQA 1DY9A 3GDUA 1PQAA 1YYY1 1C5NH 1VR1H 2D2DA 3BN9A 1O2JA 1E38B 1XVMA 5EGMA 1QBVH 2P95A 2KAIB 3RM0H 1B0EA 4WH8A 4MNXA 3H5CB 3MWIU 1Y59T 3W95A 1C1RA 2P3TB 1PQ7A 1HGTH 1C1TA 5FPTA 1O2WA 2PW8H 1ZSLA 1UTNA 1K1MA 1AVXA 1Z1IA 3DHKH 5TCCA 2SGEE 1NS3A 1O5DH 1FIZA 4R8TB 3Q77A 2F91A 3QWCH 3S69A 2HLCA 1VJAU 3MO3A 4Y8XA 3BEIB 1UTQA 1TMTH 1IQNA 1GMHF 2J2UA 2ZGBH 3BG8A 5FCRA 1AZZA 4ABEA 3M5NA 1DVAH 1YCPM 4IGDA 1O2MA 2ZCLP 2VU8E 2GX4A 3SJKA 2BLVA 2ZPSA 3A7YA 4NIVA 2WPMS 1EAXA 1XUHA 2UUFB 3CENA 3VGCC 5FBEA 1A5IA 3CS7A 2BM2A 3VXEH 1GMCG 1HJ9A 2AS9A 2ZHFH 1CT0E 4YTAA 8GCHG 1SG8B 4B71A 5JBAS 2FX6A 3SI4H 2A7CA 1HDTH 2BX3A 2C93B 2A7HA 2F83A 1CHOG 1C5OH 1HJAC 1LVYA 2BD5A 1MAXA 1Y3UA 1TA2A 1QR3E 1F5KU 4DCDA 2HOBA 2M5TA 1DLKB 3GYLB 1F0SA 3RXJA 1EOJA 3BG4B 4I8LA 1U6QA 1C5WB 3LDXH 1TWXB 4ZXXH 5A8ZA 1NRRH 1GBFA 7LPRA 1VITF 1NU7B 1TQ7B 2WV5A 4I32A 1ELBA 2WPJS 1W11U 3ODDA 3RXTA 1FY1A 1AI8H 3MU8A 2EC9H 3TVJB 4NCYA 1TONA 4JYTA 1O3HA 1FUJA 1L4ZA 1TPOA 2PKSC 3MH6A 2ZHWH 1A7SA 1HRTH 3M35A 2HNTE 1ZRKA 1BTXA 1DT2A 2EI6A 3A88A 1UK4A 1LO6A 2FOMB 2BYAX 1ANCA 1ZLRA 5A8XA 2PTNA 5JBBS 1LPGB 1OSSA 1SI5H 1OWJA 2PKAB 1MBQA 1MTUA 2J94A 3V3MA 4TPIZ 2Y7ZA 1XUIA 1F0TA 1V6DA 2QXGA 1LHEH 1T8OA 4K8BA 1ELGA 1TPPA 2QCYA 2ZU4A 2QF0A 4KKDA 3TU7H 3LU9B 3Q00A 1TBZH 1O37A 3DD2H 2XBYA 3SU2A 2ASUB 2BZAA 3IG6B 1VCWA 3A84A 5FCKA 3BTKE 1ZMLA 2GDEH 2ZQ2A 2DE9A 2P3FH 2Y82A 1ZGVA 1MMJN 2BDAA 1N6YA 5GCHG 1SGPE 3SBKA 2ANKH 4MPWA 2C4FH 1FY4A 1O3PB 3UREA 3ZZ8A 1XMNB 3BTTE 2RA0A 4ZKRU 2NU0E 2A32A 3BTQE 3EGKH 1EB2A 4X2XA 2SGFE 1FZZA 1C2GA 2ZHQH 2QAAA 4JZIA 1GCTB 2ODQA 2RCEA 1IQLA 4WMFA 1UK2A 3BTWE 3HPTB 1JRTA 2A1DB 4D76A 1GJDB 5EODA 2QXJA 2F9PA 1GHWH 2FI5E 5J4SA 2XW9A 2HNTF 2Y5HA 4B73A 2B5TB 1DUAA 1O2KA 1BIOA 3SZNA 1H9IE 3LH1A 2SNVA 1GVKB 3SJ9A 2HPQH 4H42U 1ETRH 3LJJA 1W0YH 2JH6D 2D26C 4K1TA 2GV6A 2ZU3A 2GD4B 1OYTH 3RXSA 2QN5T 4Y7AA 3SJOA 3RP2A 3SHAH 1GI4A 4HZHA 4DIHH 1QRWA 1F7ZA 3M37A 1P2JA 1YPGH 1ELAA 1V2TT 1CA0B 4YOIA 3FZDA 1GI1A 1O2HA 1FNIA 4X1PU 3ZVEA 1FONA 2FYRA 4K5ZA 2A2QH 1LDTT 4BAHB 3SUGA 2AGIX 4NZLA 1J17T 2ZTZA 1SR5C 1P2OA 1ARCA 3A7VA 1K9OE 4A7IB 1O39A 1DFPA 1BRAA 1P01A 2GZ9A 3STJA 1ANDA 5F8ZA 1PPCE 1DWCH 3RC5A 4AG2A 1V2UT 2YNBA 1ZMJA 2ZCHP 1MCTA 4TPYA 1AHTH 3TH2H 1ZPCA 2A5KA 1AKSB 1ZJDA 3MU4A 3U69H 1GI2A 1O2ZA 2ANMH 3RXCA 4CRFA 4DVAU 1DITH 3ZVBA 1TRNA 1J14A 1PFXC 3T62A 8KME2 1TRYA 1UTOA 1SSXA 7KMEH 3PYHA 3P92A 2GDDA 1IQHA 3QX5H 5ESBA 2UUKB 1LQDB 1P2IA 1VCPA 1Z1JA 2ZDKA 1A2CH 3BTFE 4ZXYH 1DLEA 3RXMA 4JK6A 4BOHA 1TX8A 2BD9A 3KGPA 1WQVH 1YPLH 1TYNA 4OS5A 1GHBF 1ZSKA 1INCA 3SJIA 4IC6A 2EI7A 1BJVA 2F9NA 1AB9C 1NT1A 1TGBA 4WF8A 4AYYB 1F2SE 4IW4E 1V2JT 4I8HA 1EJMA 3GISB 3EA8A 2ANYA 4I7YH 1G2MA 3ZV9A 1O34A 3RMOH 1JBUH 2GKVE 4ABGA 4DG4A 2NU2E 1ZSJA 4WWYA 2OD3B 2XBWA 3MNBA 1SGFA 2PR3A 2AIQA 1TNLA 2VNTA 3M5LA 1HAZB 2JH0D 1AQ7A 2Z3CA 1QCPA 4MG3A 3ODFA 2ZTYA 4DOQA 1T8MA 2C90B 4X8SH 2BX4A 1DM4B 1AVGH 4WXVA 3BEUA 2XBVA 4AB9A 3RXIA 1CBWB 1N8OB 4BTTB 2I6QA 1TNJA 3TK6A 2W3IA 1ZMNA 4CR9A 2Z7FE 1E34B 4XOJA 1H9LB 5C67A 4ASHA 1C1UH 1OWIA 2H2ZA 3SJ8A 1V2RT 1LMWB 1D3PB 1UVPA 3SGBE 1GBHA 4AOQA 4FU9A 2AMPA 2FS9A 2SGAA 4X6NA 3UWJH 1O5BB 4X2YA 3A81A 2ZHDA 3STIA 1GBEA 3QGNB 4LK4A 2VJ1A 4KP0A 3URCA 4K1EA 1V2LT
chains in the Genus database with same CATH superfamily
1SHHB 2SGDE 1H8IH 4KGAA 5JBCS 1ESAA 2JJ2D 1DX5M 1ID5H 1WDIA 2BMGB 1C2FA 3K65B 1GJAB 1ANBA 5C1XA 4ABJA 1RTKA 1TGNA 1AWHB 3DSGA 2EI8A 1DSUA 1HLTH 4K2YA 3FZZA 3T29A 3MNCA 1C2DA 4IS5A 3Q76A 3LC3A 1KSNA 2GCHF 1MD7A 1TX6A 1DUEA 1Z8GA 1WCZA 1O5CB 4X8TH 2C8XB 4MVNA 5TJXA 1MTWA 2YNAA 3RLYH 1Q31A 3RC4A 2NU3E 1UMAH 3FVFB 5E2OA 1K22H 3GY5A 2A4QA 1Q3XA 2KX4A 4UE7H 3T27A 3OTPA 1O32A 5J4QA 1PPHE 1M9UA 1DDJA 1TPSA 3SU4A 3LIWA 3DFJA 1ELFA 3NCLA 4XFQA 2FOFA 2ZIQH 2G81E 2H9HA 1C2MA 3C27B 1CA8B 3EE0B 3LH3A 4YOGA 2ZFRH 4ESTE 5EQSA 3MOCA 2LP6A 2WPHS 4I86A 2FXRA 3GICB 4JZFH 3LPRA 5HIZA 1YKTA 1O2RA 2A4RA 2KCAA 1CGJE 1NY22 1ZTKA 1VCQA 3WW7A 5CMXH 1Y3XA 1QL9A 1YCPH 3GY4A 4F48B 4FUBA 3N7DA 5A8YA 2JIZD 1O2XA 3NXPA 1MTVA 3ZVGA 4IMQA 1IHTH 5FHTA 3SU0A 1SB1H 1CA0C 4IMZA 2R0LA 1P03A 3M5MA 1C2HA 3QDZB 1WXRA 5DP6A 2BQ6B 2QY0B 1UCYE 1SGIB 3ZZ9A 1MQ6A 1GJ4H 2H5DA 2UWOA 1VGCB 3RXVA 1C9PA 2W6JD 3HATH 1CT4E 3O8DA 1P2NA 1HJ8A 1BTWA 3LONA 3QLPH 4R0IA 1TABE 3ITIA 2PKSB 3VFEA 2G4TA 1DXPA 1O3EA 3KQBA 1PQ8A 4O3UA 2P8OB 3M3TA 2J98B 5DO4H 3N7EA 2FODA 3UNQA 2GV7A 1SGTA 1BTZA 2PGQB 3DSOA 4CR5A 1HV7A 1WUNH 1CGIE 2WV4A 5C3NA 2ZFPH 4MNVA 2H1UA 4ZKOU 2ZGXH 2AFQB 2DE8A 1LKAA 1BTYA 1O3MA 2XWBI 1NFUA 4Y0ZE 3UB0A 2BLWA 2RFKC 1BMMH 1F0UA 1O3AA 2FDAA 4D9QA 1MQ5A 3FO8D 1N1LA 1IHSH 4E7NA 2OUAA 1UVTH 1DSTA 1KIGH 2AIPA 1YPJH 1HCGA 1P2MA 4Z0KA 5GDSH 1QJ1B 2ZFTA 2ZTXA 4GLYA 1W13U 1ORFA 1OP0A 2PSXA 3M7QA 1UTJA 1AD8H 2F3CE 2EEKA 1O2SA 1C1OA 4ISHH 1P9UA 2UWLA 1YY3A 1EXFA 3ZZAA 1P12E 4NSYA 1LHFH 1X7AC 2ZGCA 4I33A 3HK6B 2BVXH 2L74A 5FXLA 1C5PA 2BHGA 2RDLA 1SL3A 2TPIZ 2J95A 3UAIC 2NU4E 2A31A 1TBQH 3GDVA 2ZI2H 4LZ4B 4X2WA 4O97A 5KECA 3TJUA 1ZHPA 1B5GH 2ZU1A 2WPDD 1WAYB 1AY6H 1UTMA 3K9XB 1Y3VA 4AX9H 2VGCB 1TLDA 1C1VH 1DPOA 3SNDA 4RKJB 2XC5A 1E1QD 2NWNA 1GDUA 5AHGH 2ALVA 3AK5A 1BMFD 1GHVH 2CXVA 2PLXA 1Z8IB 4SGAE 3NUMA 2Q1JA 3TJNA 1Z6EA 2OTVA 1P02A 1EX3A 1CBWC 1MKXK 2ZNKH 1RTLA 1H8DH 2ZDVH 3RXUA 1JRSA 1T8NA 1YBWA 1PPBH 3GY3A 1G3CA 3QTVH 3SU1A 3PLBA 2ZU5A 4CREA 1TNGA 1PJPA 1SC8U 2BVSH 1EPTC 5A0AE 2V7QD 4ISIH 2B9LA 4E05H 1QFKH 2XXLA 1JXPA 2ZZUH 5L30H 1GHAF 4F4OC 4XRNA 1UTLM 2WINI 3I78A 1ZGIA 2P93A 4IBLH 1ACBE 2VWMA 1UVOA 1YPMH 1NTPA 4OGYA 4XBBA 3UNSA 1S6FA 3F0PA 1FMGA 4RSPA 3KCGH 4GCHF 5G4BA 4CRGA 2XCFA 3S9BA 1BCUH 2BD8A 4Z6AH 4JZ1A 1GI8B 2KFWA 1W12U 4B2CA 1ZPZA 3ZZ3A 9ESTA 3PM3A 3ATWA 1CO7E 1QQUA 4YESB 1MKWK 2D8WA 2BLQA 1HAGE 2PSYA 2R9PA 5TCAA 1GHYH 1L0ZA 1SFQB 1O35A 1TX7A 3M3VA 1D4PB 2O8LA 3PWCA 4DURA 5HM9A 3TK9A 1GMHG 3P6ZB 1RTFB 2F9VA 1OX1A 1D6RA 1XX9A 3AASA 3D65E 5GXPA 5C1UA 4OS2A 3MI4A 1O36A 1AB9B 3CP7A 4JZDH 5KGOA 2SFAA 3KEEA 4H6TA 3CNRA 5JB8S 1C5LH 4P02A 3VXFH 2Z3EA 1OS8A 4FUJA 1GJ6A 4B1TA 2QC2A 1J16A 1E37B 2STBE 1ZJKA 2XBXA 4NWKA 1A1RA 5PTPA 3UQVA 3T5FH 2FYQA 2ZA5A 2C8YB 4D7GA 2CGAA 3LGVA 1V2VT 3ENSB 1B0FA 4ASUD 1BMAA 3S9AA 1OPHB 2AEIH 1O2VA 3S7HB 3UUZA 1GG6C 5HIYA 1O5EH 2OQ5A 4X8UH 2H5CA 1C2JA 2R2WU 3MNSA 5F03A 1KY9A 4JK5A 2A7JA 5B6LA 3GCOA 1GMCF 4ZHMU 2Z9KA 2P3UB 4Q4LA 4BNRA 6LPRA 2KAIA 5LGOA 1SLXB 8GCHF 1ESTA 1EOLA 5BRRE 2IN2A 1VITG 3SU5A 4A1TA 1EJAA 2PUQH 4RN6A 1VGCC 2WPLS 5FPSA 3WY8A 4MLFB 2XTTB 1TFXA 1FY3A 5L6NH 1GI9B 5GPIB 3ZZ5A 1XM1A 2O8MA 1TNIA 1YLDA 1EZUC 1NN6A 1ELEE 4FUIA 3NPSA 1IOEA 2OBQA 2FLBH 1AE5A 1SLVB 1K0HA 1V2KT 2P8OC 3GY7A 4J1YA 4KTSA 1BRUP 3PB1E 5EXLA 1N6XA 2R3YA 3D49H 2Y7XA 1YPHE 1K2I1 1Z8RA 1QB1A 2BDGA 1BMNH 3B8JA 5T3HA 1O3DA 2K1QA 5FPYA 1OWDA 1H9HE 2XC4A 2YMSD 5K0HA 1P3EA 4KTUA 3TNSA 3QGJA 2FOHA 3JZ2B 4MQAA 1GPZA 4LOYH 3GCHB 2ZPQA 1HXEH 1P2KA 3RXOA 1G9IE 1KLTA 3V12A 1D3TB 1LVBA 2J92A 5HMAA 1UW7A 3MQKC 2FP7B 2J9NA 1ZZZA 2FOAA 1A3EH 1A0HB 2HGTH 3OSYA 2ZFSA 1ETSH 3A8DA 3RXHA 1C1PA 2BQ7B 1W2KH 1GVLA 1SGCA 1NO9H 1C5ZB 1C4V2 2A0QB 1PPGE 1S84A 4YT6H 5GCHF 1GBMA 2FMJA 3E1XB 4X2VA 4Y11E 2VGCC 1J9CH 1SMFE 2W7SA 3SQEE 4H4FA 3TJVA 3OAAD 2BQWB 4X1NU 4LXBH 3M7TA 4YLUA 3T26A 1BQYA 2ZF0H 3H7OA 3ZVCA 2KZ4A 4JYUH 2O8UA 3KQ5A 2ZG0H 2A5AA 3F6UH 7ESTE 1UVUH 4B6FA 3RXAA 3KQCA 1O2IA 1O33A 1YP9A 4BXSA 5L2YH 4JCNA 1RJXB 4FETA 2VIVA 1OYQA 5ESTE 1QA0A 4AB8A 1FPHH 1H1BA 3GCTF 3TIUA 1EUFA 4TT3D 3RXQA 4DY7B 1ZOMA 1PPEE 1QIXB 2QE7D 1Y8TA 2ZFFH 2G5VA 3U8TH 4Y6DA 3KF2A 4MPUA 1W8BH 3ZZCA 3RMLH 1YGCH 1ABIH 1BUIA 3P17H 1XUKA 3RDZA 3A7TA 1EZQA 1GBJA 1HIAA 4AFQA 3F9EA 4AFUA 2RA3A 5DJ7A 3DFLA 1ELTA 2J5UA 1V2MT 4BTIB 5AVDA 1DWDH 1IQIA 3RXRA 1EATA 3SU3A 3U8OH 1SPJA 1AGJA 3SN8A 3SNAA 4MDSA 3U98H 4ABAA 2FPZA 1ZHRA 1FIWA 1Y5AT 5FBIA 2CMYA 2R0KA 4U30A 1EZSC 3SU6A 2TBSA 1HB0B 2BLOA 2R3UA 3P95A 3GYMA 1PYTD 3SQHE 1C2EA 5EXNA 2V6NA 1QRXA 3E8LA 5HM2A 2BDIA 2IOTA 2ZU2A 4X1QU 2QIQA 2AMDA 1CHGA 1EAUA 2J34A 2J4IA 3PWBA 2BY9X 1UCYK 3Q3KA 2VIPA 4NGAH 1P06A 3RXKA 1A4WH 3MU5A 3PO1C 2H9EH 3SGAE 1ELDE 1WSSH 6GCHF 1LPZB 5EW2H 3UR6A 1SGNE 3F3BA 3KQEA 2BOKA 2FTLE 1SHYA 2C8ZB 2ZDMA 3KL6A 1LVMA 1QL7A 1G3DA 1SGFG 1GBLA 4XBDA 1V2OT 2PTCE 3PTNA 2LPRA 1PQ5A 4OS1A 4U32A 2WYGA 3MH5A 4GSOA 2OK5A 1BJUA 3SZEA 4CH8B 2TGDA 1GBKA 1PPFE 1BHXB 1AKSA 2ZDNA 1NESE 3K6YA 4XE4A 1RRKA 4AFZA 4F49A 1SLWB 1NROH 1C5VA 5C5NA 3RMNH 2O8TA 3B9FH 1EPTB 1SVPA 2ZHEH 1EP5A 1O38A 4ZHAA 5AFYH 3RXBA 1IQFA 2YOLA 1IQEA 1LCYA 2FZZA 1BITA 3UOPA 1ZTJA 2Y6TA 1TPAE 3F2HA 1TNKA 5JYIA 1HXFH 3HK3B 2Y80A 2G51A 4MPVA 2OXSA 2IPQX 2ZO3H 2G55A 1AO5A 1ESBA 1W3CA 3A8BA 2HNTC 2TRMA 3JZ1B 1A61H 1NRQH 3UPEA 3IWMA 2B0FA 4Y71A 1NBMD 1TOMH 3ZV8A 4AYVB 1O2LA 2FTMA 3ZVFA 1NFWA 1GL1A 1E36B 1P0SH 1QHRB 3SV7A 5JDUB 4ZROA 1TMBH 3FP8E 1RGQA 3EAJA 4X8VH 1NBME 1QL8A 4DJZB 1YPEH 2GCTB 3A7XA 2A45B 1O3NA 4CRCA 2B7DH 1GBDA 2BY7X 3FP7E 3OU0A 3A83A 4K69A 4Y10E 5HXFA 4FXGH 2GCHG 5E0JA 5HYOA 3ATKA 3GDSA 4HI3A 1V2ST 3GCHC 5IYTA 3TNTA 3ZYEA 3DUXH 2QGRA 1GWAA 2GZ8A 4BTUB 2ZGJA 4CBOA 4NIWA 2HVXA 4FUCA 1GHZA 2CHAB 4AGKA 2BXTH 1EB1H 4IN1A 4VGCB 1QURH 1T31A 3LKWA 3S7KB 1GMDG 3PMJA 1BBRK 2GT8A 6ESTA 2VIDA 1FXYA 2C8WB 2I6SA 4WJG2 1AVWA 2QXIA 1GHXH 1C2LA 2ANWA 3PMAB 2ZKSA 1O3KA 3RC6A 3P8GA 4YT7H 2WYJA 3TH3H 1OHHD 1NC6A 3UTUH 3M5OA 1P09A 2ALPA 4FUDA 3K2UA 2OC1A 1GG6B 4BANB 4A5TS 1D3QB 1GJ7B 4AORA 1O2PA 1O3LA 4TSFD 7GCHG 5A0CA 1WTGH 1H4WA 4JYVH 1C1SA 4B76A 2BDHA 1AU8A 4UFGH 4A6LA 2ZDAH 2XRCA 1VZQH 4CRBA 1TBRH 1C5YB 2L6OA 1S82A 5T1VA 4AN7A 4BAKB 1BRBE 5JPMH 3OTJE 1TMUH 2F9BH 4Q80A 5DP3A 2VIOA 5C5OA 1C5SA 4AZ2B 1Y3WA 3D62A 2H9TH 3MH4A 4X6PA 5L2ZH 2V0BA 2WUCA 1D9IA 1C5UA 5HGGA 1YLNA 2TIOA 3RXEA 2FI4E 3E16B 3SUDA 1OWHA 1THPB 4B2BA 1RD3B 3ZZDA 4BAQB 3MO6A 3VB5A 4XD7D 2BD2A 3VB4A 2ZECA 4ZKNU 4YXWD 2FOBA 1Z6JH 3MU1A 4Y79A 1VITH 3SV9A 1QNJA 1O2YA 5AF9H 4A1VA 4I31A 3HGNA 5E8EH 5EQRA 2FIRH 2R2MB 1OOKB 5EOKA 3BF6H 4FUFA 4BXWA 5T6GA 3V7TA 1UHBB 3UR9A 3ZVDA 3KQDA 1F0RA 4ISNA 1RFNA 3QK1A 1O2TA 2QF4A 5A2MH 5DSFA 1THRH 1WBGB 4MNYA 3GY6A 2FO9A 3HGPA 1QJ6B 2F9UA 2Z9LA 1EKBB 4NSVA 1TIOA 4TWYA 2SNWA 1OWKA 5I46H 1V2PT 1MZDA 3LT3A 2VVUA 1RIWB 1HUTH 1S5SA 1SFIA 2BD3A 2FOCA 2W6ID 3ZZBA 5C0TA 1O31A 2AHME 2HPPH 3R3GB 3C1KA 3VG8A 4FUEA 1K28D 1S6LA 1ZRBA 3LJOA 1YLCA 1AFEH 1MAYA 1ZHMA 1HNEE 5FL7D 1HAVA 1NRNH 5GNDA 4OM9A 2XNIA 1E0FD 3MHWU 1NFYA 2F9OA 3V0XA 4I8GA 1QRZA 2EY4C 3MTYA 4MTBA 5FX6A 1K1JA 1ABJH 4YOJA 4H6SB 1KDQA 3QTOH 1S0RA 1ZTLA 2CJIA 4CRAA 4LZ1H 4Q63A 1F5LA 3PMBB 3F9HA 3L3TA 3AAVA 2VWLA 2J98A 1PPZA 3I29A 1UTPA 3QO6A 4WMDA 5C94A 4ZAEA 4O9VA 1C5MD 3VB3A 4OGXA 4O03A 3H09A 3ATMA 1P3CA 1UTKA 3BTGE 2ODPA 4OS7A 1P2QA 2VWNA 2HALA 4Q7YA 1O30A 2WSSD 5DPAA 1GHAG 1XVOA 3DT0H 3BTHE 1SOZA 1AUJA 3MH7A 4GAWA 1GBCA 3WWBA 1CVWH 5A0BA 2XCNA 3P8OA 3TLOA 4GHTA 1QTFA 3H7TA 3OX7U 4GCHG 3R0FA 1BOQA 1O5FH 2LNCA 4OS6A 1FN6A 1KLIH 1MKXH 4DGJA 1BTUA 2FX4A 2OCVB 4XDEA 1C5QA 5B6OA 2V3OH 1GI6A 1HFDA 1C4Y2 4I8JA 2WV9A 1QZ8A 1C1WH 3ATLA 5JBTA 1Q2WA 1EQ9A 4NIYA 2F43B 3LGIA 4NG9H 1W10U 1P10A 2GCTC 3CS0A 1MU6B 1RXPA 5EXMA 2O8WA 1MCVA 1SGDE 1KXEA 1OXGA 1SGRE 3QZRA 2BDCA 4ABIA 1C2IA 2Z9GA 5LPFA 4THNH 1L1GA 1MBMA 3HKJB 3GY8A 4HTCH 4INLA 5BPEA 1IAUA 2Z6BD 2VVVA 2W3KA 3RXLA 3W1EA 1LHDH 1CU1A 3TGKE 4DIIH 2XWAA 2CHAC 4VGCC 1A46H 1UO6A 4B74A 1LPKB 3SV8A 1AIXH 3BIUH 1E35B 3SOSA 4K60A 1BT7A 2PGBB 5C0UA 1LQEA 1C1MA 1XXFA 1MKWH 1XUJA 1SQRA 3F9FA 3UY9A 2M2AA 1GJCB 1WV7H 4HG6A 2VH0A 1TALA 3PO1B 2Y5GA 3RUOA 2PWXA 3AVZA 4WH6A 1UJ1A 2VVCA 1FY8E 1GBIA 5AFZH 4DT7B 3BEFB 2XYAA 1CQQA 4J2YB 1HAYB 3OFND 2ZCKP 3ZZ7A 2Q6GA 3O8RA 3HKIB 3SHCH 4B2AA 4NA9H 2AMQA 3TITA 4Q7ZA 1DXWA 1QBNA 1G36A 1GBBA 4O3TA 3RM2H 1F5RA 1O5GH 1D6WA 1UK3A 3LGWA 3U1JB 2CV3A 4HGCA 1GI3A 3EDXB 1CHOF 1TOCB 1Y3YA 4D8NA 5F6MA 2FOGA 1CT2E 2VIWA 3MFJA 4FUHA 4Q7XA 2B8OH 3F2GA 1L1NA 1IQMA 1T8LA 3A82A 2PUXB 1H8HD 1TA6A 2WHXA 1OWEA 2Q6FA 1NM6A 3LC5A 1V2QT 2C3SA 2EQNA 3PLKA 1O2OA 3F9GA 1ZPBA 1T7CA 1TNHA 4MNWA 3IITA 3UFAA 4BAMB 3OEHD 1IQGA 3RLWH 1TE0A 1SQTA 3RMMH 2PHBA 1YC0A 1KXDA 1GJ5H 2HWLB 1ETTH 5E0HA 3ATIA 2UWPA 3F1SB 1AUTC 3A80A 4NIXA 3UIRA 1OKXA 2ZEBA 3Q3XA 2GVFA 5DGJA 1O0DH 2KR7A 1YWUA 3MYWA 1KXCA 3V13A 2W5EA 4CHAB 2ZP0H 1UVSH 4XBCA 5ABWA 3A86A 2A2XH 1KYNA 1C1QA 3TGJE 2K0QA 1DS2E 3U9AH 3VPKA 2CN0H 5EPNA 1GGDC 3P8NA 1W7GH 3TH4H 3F68H 5SGAE 1T4UH 3AAUA 2A4GA 2V35A 1HAOH 1RIWC 1SQOA 2GMTC 1RS0A 1OP2A 1V2NT 5DG6A 3RU4T 3M36A 1J8AA 1OP8A 1FV9A 1MU8B 1K21H 3NZIA 2HRVA 3KHVA 4FU7A 1EAIA 3RU4D 3NRLA 1FN8A 9LPRA 3QZQA 3NK8A 2ZQ1A 1K1OA 1MTSA 1AFQC 1TGTA 3A7ZA 3A89A 1F92A 4ISOA 1MD8A 1HIAB 3SUEA 1QQ4A 1VJ9U 3RU4E 4UDWH 2JDID 3T25A 5EW1H 2ULLA 1P9SA 3PV5A 4QT8C 4UFEH 2XOKD 3TK5A 2ZWLH 4ACAA 5GIBA 1FAKH 2PV9B 2VB0A 4X0WU 4FU8A 4TYDA 3TGIE 1O2QA 1LTOA 1SQAA 3ZYDA 3U28C 1A5HA 3UNRA 5FAHA 2BVRH 3E0NB 3G01A 3VB6A 4A1XA 5GJ4B 4YM9A 3O8CA 2BY6X 1SKYE 4NFFA 2PKAA 2RDEA 1NZQH 1W14U 3O8BA 2A4OA 1BDAA 2JJ1D 3EA9A 2ZGHA 3M61U 3F0OA 1H8ED 2Y81A 2ODYB 3GCTG 4WXIA 1P04A 3VEQB 3LGTA 1AN1E 1S6HA 1QA7A 2W26A 4ABHA 2FWWA 5A09A 2GTBA 3E90B 1MTNC 2VH6A 1GDQA 4PROA 5EJZA 1J15A 1TGSZ 1SGYE 3DA9B 4X1SU 3SGQE 1S0QA 3VB7A 1GVZA 3KNXA 4NA7A 1A5GH 1HAHH 4ISLA 4AFSA 3SV6A 1FI8A 3OYPA 2V3MA 2BDYA 5LPRA 4UONA 4ABFA 1MABB 1KTSB 2BY5X 1Y5UT 5CE1A 4ZKSU 1G37A 1KMHB 3MU0A 4INHA 5EJ1A 1DY8A 1FPCH 1O2UA 4TWWA 1GHBG 2JKHA 4E7RG 3N7OA 2KM0A 1GDNA 2H6MA 1K1IA 2OP9A 5IK2D 1P05A 3RXFA 1XKAC 1L1JA 5F8TA 2BD4A 3EA7A 1JIRA 4X6OA 3PMHB 4Y8YA 1YPKH 1FLEE 1S81A 3GS9A 5C2ZA 1G3EA 3ZIAD 1G30B 3PROA 1MZAA 4ZMAH 4UFDH 4ACBA 2AH4X 6CHAB 2OLGA 3U8RH 4GVUA 1D3DB 3PLPA 5LH8A 4WVPE 4XSKU 1GI5A 1O3FA 5DP4A 1DWBH 1G32B 3E6PH 3BTDE 2OC0A 6GCHG 1HAPH 2IJD1 2CF9H 1LVOA 2G00A 2V3HH 4RKOB 3FN8A 3UWIA 4UFFH 3URDA 1BTHH 3KN2A 1XUFA 1CGHA 3SNCA 1SGEE 1GCDA 1C2KA 4YZUA 1C5XB 5CHAB 4FVDA 4ZH8A 3PV2A 4Q2KA 1C5TA 2CF8H 1DOJA 4GHQA 2Z9JA 5EIYA 1GJBB 2VIQA 1UCYH 2OQUA 2Z3DA 1SOTA 4K1SA 1FJSA 2JETB 5F8XA 2G8TA 1AWFH 5K7RA 3K6ZA 3A7WA 1Z71A 2OBOA 5GWZA 2WPIS 4Y76A 3E3TA 1ANEA 1O3JA 3L33A 5C17A 2J38A 1CE5A 5EQQA 3W94A 3BG4C 4WY3A 4RT1A 2UUYA 3MNXA 3BSQA 8LPRA 1SLUB 5DKMA 2NU1E 1L2EA 1FDPA 2VWOA 1T4VH 3SUFA 3DCLA 3A87A 3I77A 4UEHH 1WU1A 2Z94A 3RXGA 2BD7A 1DE7H 1G2LA 2BDBA 1JMOH 4U2WA 1C9TA 1GI7B 5CHBA 4YLQH 1O2NA 1YPHC 4SGBE 1TRMA 1Y5BT 2GGVB 1TB6H 4MPXA 5EG4A 4IC5A 1ELVA 1QY6A 5T6DA 4CHAC 1S85A 1O2GH 3BIVH 5C20A 1NRSH 3GY2A 4E06H 1BB0B 3E91A 1JOUB 2WUBA 1T32A 1GI0A 1G3BA 1JWTA 1EP6A 1L4DA 2YMSC 2FOEA 2EA3A 4FUGA 4F55A 5DP8A 1V2WT 2PFEA 3P70B 5E0GA 4AGJA 4Y7BA 1QGFA 1NPMA 1GL0E 1AMHA 4IN2A 2ESTE 2FEQH 1O3OA 1WQSA 1LHCH 3KYFA 5FX5A 5EU8A 4K3JA 1DICA 2QA9E 4AC9A 2WPKS 3ELAH 3RXDA 4B75A 2BOHB 1EPTA 1BHXF 1EAWA 2QF3A 4TY6A 2AGGX 3ZVAA 4D9RA 1HYLA 3FP6E 1K1LA 5H4IB 4DW2U 5T6FA 4X6MA 4ABDA 1A0JA 1GJ8B 1GMDF 4U01A 1YCPK 3E0PB 1O3BA 1QB6A 3VGCB 3P8FA 2O9QA 4K8YA 3PV4A 3AW1A 1HPGA 5I25A 1HAIH 2JH5D 1A3BH 2AYWA 1TQ0B 1BBRH 2XC0A 1Z7KA 5EPYA 4INKA 3Q3YA 3TPIZ 1EASA 2IPHA 2GJGA 3QUMP 1GCTC 2W7UA 3PTBA 2G5NA 2BTCE 1AE8H 2STAE 3S0NA 3KYGA 3T2NA 3T28A 1W0ZU 1HJAB 2BY8X 1BZXE 1MH0A 1P8VC 3LGYA 3LOXA 4UD9H 1Z8JB 4KTCA 1EZXC 2AGEX 1BRCE 2BZ6H 3BTME 3U1IB 2AERH 2FS8A 2GT7A 1AZ8A 1BMLA 1XKBC 4I8KA 7GCHF 2SGPE 1HAXB 3SW2B 3ESTA 3M7UA 2QYIA 3ZZ6A 3MO9A 1QB9A 1EJNA 1O3IA 4FVBA 3AW0A 4OS4A 1DWEH 2HVYB 1GBTA 1HAVB 1LKBA 4M7GA 3A8AA 1ELCA 1ZR0A 3ZZ4A 4Z1MD 1LHGH 1KDQB 4Y8ZA 4AG1A 3TJOA 1A0LA 2THFB 4GUXA 1K1NA 4CRDA 1THSH 3FFGA 1FAXA 3S9CA 4BAOB 1O5AB 2BXUH 1P57B 5C1YA 1YM0A 1B7XB 5DP5A 2TGAA 1XXDA 1WOFA 3EE7A 1TAWA 2LELA 3GOVB 1QBOA 2D1JA 1O3GA 3QN7A 3UOUA 1K1PA 2Y5FA 3EQ0H 2GP9B 3NKKA 1GGDB 2FESH 3A85A 1IQKA 4HFPB 1CSOE 3KIDU 4YO9A 4ABBA 4CBNA 4ZUHA 2UUJB 3BV9B 1TGCA 4A92A 2A5IA 2GMTB 1SGQE 6CHAC 1KXBA 2ZDLA 4GPGA 5DK1A 1P11E 1O3CA 2ZFQH 4NFEA 1WTHD 3RXPA 2BB4A 1WYKA 4FOUC 4CH2B 1C4U2 2VINA 4P00A 1PYTC 2GZ7A 2ZPRA 4Y0YE 5DP9A 2TGTA 2SGQE 3SI3H 1NU9A 3B23B 3D23A 1AFQB 1QJ7B 2Z9IA 3EYDA 1W7XH 2FM2A 4NA8A 4X1RU 4ZHLU 1ARBA 3FANA 2OC7A 2DUCA 3M3SA 1XUGA 3SORA 2OC8A 1GJ9B 1MUEB 5CHAC 1NFXA 1FY5A 4JMYA 1FQ3A 1BTPA 5JB9S 1KTTB 2G4UA 2QF5A 3WWFA 3GCNA 3MMGA 1S83A 2JETC 3FAOA 3A8CA 1V3XA 5DP7A 3L6PA 3SNEA 5ETXA 1YF4A 3OY6U 2RG3A 2QXHA 3SNBA 3NWUA 4NWLA 1SBWA 2P16A 2P94A 3OEED 5E2PA 8ESTE 1KXAA 1IQJA 2Q6DA 2KCOA 2FLRH 2P59A 3SO3A 1UHBA 4JZEH 1N8OC 1ZYOA 4WMEA 3UQOA 1C1NA 2TGPZ 5IDKA 2ZC9H 4B6EA 2FI3E 2QV1A 1BBRE 5HKKD 1KLJH 1NRPH 2ILNA 2K8IA 3PRDA 1MTNB 2IJOB 1JIMA 1DANH 3BTEE 2OINA 3SV2H 1HBTH 1BA8B 5LPEA 3LGUA 1KXFA 1GBAA 1C5RA 4TY7A 3OY5U 4D7FA 2G52A 4KELA 4NZQA 1DY9A 3GDUA 1PQAA 1YYY1 1C5NH 1VR1H 2D2DA 3BN9A 1O2JA 1E38B 1XVMA 5EGMA 1QBVH 2P95A 4RT0A 2KAIB 3RM0H 1B0EA 4WH8A 4MNXA 3H5CB 3MWIU 1Y59T 3W95A 1C1RA 2P3TB 1PQ7A 1HGTH 1C1TA 5FPTA 1O2WA 2PW8H 1ZSLA 1UTNA 1K1MA 1AVXA 1Z1IA 3DHKH 5TCCA 2SGEE 1NS3A 1O5DH 1FIZA 4R8TB 3Q77A 2F91A 2J97A 3QWCH 3S69A 2HLCA 1VJAU 3MO3A 4Y8XA 2CK3D 3BEIB 1UTQA 1TMTH 1IQNA 1GMHF 2J2UA 2ZGBH 3BG8A 5FCRA 1AZZA 4ABEA 3M5NA 1DVAH 1YCPM 4IGDA 1O2MA 2ZCLP 2VU8E 2GX4A 3SJKA 2BLVA 2ZPSA 3A7YA 4NIVA 2WPMS 1EAXA 1XUHA 2UUFB 3CENA 3VGCC 4DT4A 5FBEA 1A5IA 3CS7A 2BM2A 3VXEH 1GMCG 1HJ9A 2AS9A 2ZHFH 1CT0E 4YTAA 8GCHG 1SG8B 4B71A 5JBAS 2FX6A 3SI4H 2A7CA 1HDTH 2BX3A 2C93B 2A7HA 2F83A 1CHOG 1C5OH 1HJAC 1LVYA 2BD5A 1MAXA 1Y3UA 1TA2A 1QR3E 1F5KU 4DCDA 2HOBA 2M5TA 1DLKB 3GYLB 1F0SA 3RXJA 1EOJA 2KCYA 3BG4B 4I8LA 1FX0B 1U6QA 1C5WB 3LDXH 1TWXB 2VBCA 3FOAA 4ZXXH 5A8ZA 1NRRH 1GBFA 7LPRA 1VITF 4RI0A 1NU7B 1TQ7B 2WV5A 4I32A 1ELBA 2WPJS 1W11U 3ODDA 3RXTA 1FY1A 1AI8H 3MU8A 2EC9H 3TVJB 4NCYA 1TONA 4JYTA 1O3HA 1FUJA 1L4ZA 1TPOA 2PKSC 3MH6A 2ZHWH 1A7SA 1HRTH 3M35A 2HNTE 1ZRKA 1BTXA 1DT2A 2EI6A 3A88A 1UK4A 1LO6A 2FOMB 2BYAX 1ANCA 1ZLRA 2F4LA 5A8XA 2PTNA 5JBBS 1LPGB 2PP6A 1OSSA 1SI5H 5KEDA 1OWJA 2PKAB 1MBQA 1MTUA 2J94A 3V3MA 4TPIZ 2Y7ZA 2YMSB 1XUIA 1F0TA 1V6DA 2QXGA 1LHEH 1T8OA 4K8BA 1ELGA 1TPPA 5DN6D 2QCYA 1COWD 2ZU4A 2QF0A 4KKDA 3TU7H 3LU9B 3Q00A 1TBZH 1O37A 3DD2H 2XBYA 3SU2A 2ASUB 2BZAA 3IG6B 1VCWA 3A84A 5FCKA 3BTKE 1ZMLA 2GDEH 2ZQ2A 2DE9A 2P3FH 2Y82A 1ZGVA 1MMJN 2BDAA 1N6YA 5GCHG 1SGPE 3SBKA 2ANKH 4MPWA 2C4FH 1FY4A 1O3PB 3UREA 3ZZ8A 1XMNB 3BTTE 3OE7D 2RA0A 4ZKRU 2NU0E 2A32A 3BTQE 3EGKH 1EB2A 2XNDD 4X2XA 3PRBA 2SGFE 1FZZA 1C2GA 2ZHQH 2QAAA 4JZIA 1GCTB 2ODQA 2RCEA 1IQLA 4WMFA 1UK2A 3BTWE 3HPTB 1JRTA 2A1DB 4D76A 1GJDB 5EODA 2QXJA 2F9PA 1GHWH 2FI5E 5J4SA 2XW9A 2HNTF 2Y5HA 4B73A 2B5TB 1DUAA 1O2KA 1BIOA 3SZNA 1H9IE 3LH1A 2SNVA 1GVKB 3SJ9A 2HPQH 4H42U 1ETRH 3LJJA 1W0YH 2JH6D 2D26C 4K1TA 2GV6A 2ZU3A 2GD4B 1OYTH 3RXSA 2QN5T 4Y7AA 3SJOA 3RP2A 3SHAH 1GI4A 4HZHA 4DIHH 1QRWA 1F7ZA 3M37A 1P2JA 1YPGH 1ELAA 1V2TT 2KCPA 1CA0B 4YOIA 3FZDA 1GI1A 1O2HA 1FNIA 4X1PU 3ZVEA 1FONA 2FYRA 4K5ZA 3SYJA 2A2QH 1LDTT 4BAHB 2WZQA 3SUGA 2AGIX 3N99A 4NZLA 1J17T 2ZTZA 1SR5C 1P2OA 1ARCA 3A7VA 1K9OE 5F53A 4A7IB 1O39A 1DFPA 1VKYA 1BRAA 1P01A 2GZ9A 3STJA 1ANDA 5F8ZA 1PPCE 1DWCH 3RC5A 4AG2A 1V2UT 2YNBA 1ZMJA 2ZCHP 1MCTA 4TPYA 5CDFE 1AHTH 3TH2H 1ZPCA 2A5KA 1AKSB 1ZJDA 3MU4A 3U69H 1GI2A 1O2ZA 2ANMH 3RXCA 4CRFA 4DVAU 1DITH 3ZVBA 1TRNA 1J14A 1PFXC 3T62A 8KME2 1TRYA 1E1RD 1UTOA 1SSXA 7KMEH 3PYHA 3P92A 2GDDA 1IQHA 3QX5H 5ESBA 2UUKB 1LQDB 1P2IA 1VCPA 1Z1JA 2ZDKA 1A2CH 3BTFE 4ZXYH 1DLEA 3RXMA 4JK6A 4BOHA 1TX8A 2BD9A 3KGPA 1WQVH 1YPLH 1TYNA 4OS5A 1GHBF 1ZSKA 1INCA 3SJIA 4IC6A 2EI7A 1BJVA 2F9NA 1AB9C 1NT1A 1TGBA 4WF8A 4AYYB 1F2SE 3F2FA 4IW4E 1V2JT 4I8HA 1EJMA 3GISB 3EA8A 2ANYA 4I7YH 1G2MA 3ZV9A 1O34A 3FKSD 3RMOH 1JBUH 2GKVE 4ABGA 4DG4A 2NU2E 1ZSJA 4WWYA 2OD3B 2XBWA 3MNBA 1SGFA 2PR3A 2AIQA 1TNLA 2VNTA 3M5LA 1HAZB 2JH0D 1AQ7A 2Z3CA 1QCPA 4MG3A 3ODFA 4ZCNA 2ZTYA 4DOQA 1T8MA 2C90B 4X8SH 2BX4A 1DM4B 2HLDD 1AVGH 5EJLA 4WXVA 3BEUA 2XBVA 4AB9A 3RXIA 1CBWB 1N8OB 4BTTB 1EFRD 2I6QA 1TNJA 3TK6A 2W3IA 1ZMNA 4CR9A 2Z7FE 1E34B 4XOJA 1H9LB 5C67A 4ASHA 1C1UH 1OWIA 2H2ZA 3SJ8A 1V2RT 1LMWB 1W0KD 1W0JD 1D3PB 1UVPA 4M9FA 3SGBE 1GBHA 4AOQA 4FU9A 1E79D 2AMPA 2FS9A 2SGAA 4X6NA 3UWJH 1O5BB 4X2YA 3A81A 2ZHDA 3STIA 3DSPA 1GBEA 3QGNB 4LK4A 2VJ1A 4KP0A 3URCA 4K1EA 1V2LT
chains in the Genus database with same CATH topology
1SHHB 2SGDE 1H8IH 4KGAA 5JBCS 1ESAA 1DX5M 1ID5H 2BMGB 1C2FA 3K65B 1GJAB 1ANBA 5C1XA 4ABJA 1RTKA 1TGNA 1AWHB 2EI8A 1DSUA 1HLTH 4K2YA 3FZZA 3T29A 3MNCA 1C2DA 4IS5A 3Q76A 3LC3A 1KSNA 2GCHF 1MD7A 1TX6A 1DUEA 1Z8GA 1WCZA 1O5CB 4X8TH 2C8XB 4MVNA 5TJXA 1MTWA 2YNAA 3RLYH 1Q31A 3RC4A 2NU3E 1UMAH 3FVFB 5E2OA 1K22H 3GY5A 2A4QA 1Q3XA 4UE7H 3T27A 1O32A 5J4QA 1PPHE 1M9UA 1DDJA 1TPSA 3SU4A 3LIWA 3DFJA 1ELFA 3NCLA 4XFQA 2FOFA 2ZIQH 2G81E 2H9HA 1C2MA 3C27B 1CA8B 3EE0B 3LH3A 4YOGA 2ZFRH 4ESTE 5EQSA 3MOCA 2WPHS 2FXRA 3GICB 4JZFH 3LPRA 1YKTA 1O2RA 2A4RA 1CGJE 1NY22 1ZTKA 1VCQA 5CMXH 1Y3XA 1QL9A 1YCPH 3GY4A 4FUBA 5A8YA 3NXPA 1O2XA 1MTVA 3ZVGA 4IMQA 1IHTH 5FHTA 3SU0A 1SB1H 1CA0C 4IMZA 2R0LA 1P03A 3M5MA 1C2HA 3QDZB 5DP6A 2BQ6B 2QY0B 1UCYE 1SGIB 3ZZ9A 1MQ6A 1GJ4H 2H5DA 2UWOA 1VGCB 3RXVA 1C9PA 3HATH 1CT4E 3O8DA 1P2NA 1HJ8A 1BTWA 3LONA 3QLPH 4R0IA 1TABE 3ITIA 2PKSB 3VFEA 2G4TA 1DXPA 1O3EA 3KQBA 1PQ8A 4O3UA 2P8OB 3M3TA 5DO4H 2FODA 3UNQA 2GV7A 1SGTA 1BTZA 2PGQB 4CR5A 1HV7A 1WUNH 1CGIE 2WV4A 5C3NA 2ZFPH 4MNVA 2H1UA 4ZKOU 2ZGXH 2AFQB 2DE8A 1LKAA 1BTYA 1O3MA 2XWBI 1NFUA 4Y0ZE 2BLWA 1BMMH 1F0UA 1O3AA 2FDAA 4D9QA 1MQ5A 1N1LA 1IHSH 4E7NA 2OUAA 1UVTH 1DSTA 1KIGH 2AIPA 1YPJH 1HCGA 1P2MA 4Z0KA 5GDSH 1QJ1B 2ZFTA 2ZTXA 4GLYA 1W13U 1ORFA 1OP0A 2PSXA 3M7QA 1UTJA 1AD8H 2F3CE 2EEKA 1O2SA 1C1OA 4ISHH 1P9UA 2UWLA 1EXFA 3ZZAA 1P12E 4NSYA 1LHFH 1X7AC 2ZGCA 4I33A 3HK6B 2BVXH 5FXLA 1C5PA 2BHGA 2RDLA 1SL3A 2TPIZ 2J95A 2NU4E 2A31A 1TBQH 3GDVA 2ZI2H 4LZ4B 4X2WA 4O97A 3TJUA 1ZHPA 1B5GH 2ZU1A 1WAYB 1AY6H 1UTMA 3K9XB 1Y3VA 4AX9H 2VGCB 1TLDA 1C1VH 1DPOA 3SNDA 4RKJB 2XC5A 2NWNA 1GDUA 5AHGH 2ALVA 1GHVH 2CXVA 2PLXA 1Z8IB 4SGAE 3NUMA 2Q1JA 3TJNA 1Z6EA 2OTVA 1P02A 1EX3A 1CBWC 1MKXK 2ZNKH 1RTLA 1H8DH 2ZDVH 3RXUA 1JRSA 1T8NA 1YBWA 1PPBH 3GY3A 1G3CA 3QTVH 3SU1A 3PLBA 2ZU5A 4CREA 1TNGA 1PJPA 1SC8U 2BVSH 1EPTC 5A0AE 4ISIH 2B9LA 4E05H 1QFKH 2XXLA 1JXPA 2ZZUH 5L30H 1GHAF 4F4OC 1UTLM 2WINI 3I78A 1ZGIA 2P93A 4IBLH 1ACBE 2VWMA 1UVOA 1YPMH 1NTPA 4OGYA 4XBBA 3UNSA 1S6FA 4RSPA 1FMGA 3KCGH 4GCHF 5G4BA 4CRGA 2XCFA 3S9BA 1BCUH 2BD8A 4Z6AH 4JZ1A 1GI8B 1W12U 4B2CA 1ZPZA 3ZZ3A 9ESTA 3PM3A 3ATWA 1CO7E 1QQUA 4YESB 1MKWK 2D8WA 2BLQA 1HAGE 2PSYA 2R9PA 5TCAA 1GHYH 1L0ZA 1SFQB 1O35A 1TX7A 3M3VA 1D4PB 2O8LA 3PWCA 4DURA 5HM9A 3TK9A 1GMHG 3P6ZB 1RTFB 2F9VA 1OX1A 1D6RA 1XX9A 3AASA 3D65E 5GXPA 5C1UA 4OS2A 3MI4A 1O36A 1AB9B 3CP7A 4JZDH 2SFAA 3KEEA 4H6TA 5JB8S 1C5LH 3VXFH 2Z3EA 1OS8A 4FUJA 1GJ6A 4B1TA 2QC2A 1J16A 1E37B 2STBE 1ZJKA 2XBXA 4NWKA 1A1RA 5PTPA 3UQVA 3T5FH 2FYQA 2ZA5A 2C8YB 4D7GA 2CGAA 3LGVA 1V2VT 3ENSB 1B0FA 1BMAA 3S9AA 1OPHB 2AEIH 1O2VA 3S7HB 3UUZA 1GG6C 1O5EH 2OQ5A 4X8UH 2H5CA 1C2JA 2R2WU 3MNSA 5F03A 1KY9A 4JK5A 2A7JA 3GCOA 1GMCF 4ZHMU 2Z9KA 2P3UB 4BNRA 6LPRA 2KAIA 5LGOA 1SLXB 8GCHF 1ESTA 1EOLA 5BRRE 2IN2A 1VITG 3SU5A 4A1TA 1EJAA 2PUQH 4RN6A 1VGCC 2WPLS 5FPSA 3WY8A 4MLFB 2XTTB 1TFXA 1FY3A 5L6NH 1GI9B 5GPIB 3ZZ5A 1XM1A 2O8MA 1TNIA 1YLDA 1EZUC 1NN6A 1ELEE 4FUIA 3NPSA 1IOEA 2OBQA 2FLBH 1AE5A 1SLVB 1V2KT 2P8OC 3GY7A 4J1YA 4KTSA 1BRUP 3PB1E 5EXLA 1N6XA 2R3YA 3D49H 2Y7XA 1YPHE 1K2I1 1Z8RA 1QB1A 2BDGA 1BMNH 3B8JA 5T3HA 1O3DA 2K1QA 5FPYA 1OWDA 1H9HE 2XC4A 5K0HA 1P3EA 4KTUA 3TNSA 3QGJA 2FOHA 3JZ2B 4MQAA 1GPZA 4LOYH 3GCHB 2ZPQA 1HXEH 1P2KA 3RXOA 1G9IE 1KLTA 3V12A 1D3TB 1LVBA 2J92A 5HMAA 2FP7B 2J9NA 1ZZZA 2FOAA 1A3EH 1A0HB 2HGTH 3OSYA 2ZFSA 1ETSH 3A8DA 3RXHA 1C1PA 2BQ7B 1W2KH 1GVLA 1SGCA 1NO9H 1C5ZB 1C4V2 2A0QB 1PPGE 1S84A 4YT6H 5GCHF 1GBMA 2FMJA 3E1XB 4X2VA 4Y11E 2VGCC 1J9CH 1SMFE 2W7SA 3SQEE 4H4FA 3TJVA 2BQWB 4X1NU 4LXBH 3M7TA 4YLUA 3T26A 1BQYA 2ZF0H 3H7OA 3ZVCA 4JYUH 2O8UA 2ZG0H 2A5AA 3F6UH 7ESTE 1UVUH 3RXAA 3KQCA 1O2IA 1O33A 1YP9A 4BXSA 5L2YH 4JCNA 1RJXB 2VIVA 1OYQA 5ESTE 1QA0A 4AB8A 1FPHH 1H1BA 3GCTF 3TIUA 1EUFA 3RXQA 4DY7B 1ZOMA 1PPEE 1QIXB 1Y8TA 2ZFFH 2G5VA 3U8TH 4Y6DA 3KF2A 4MPUA 1W8BH 3ZZCA 3RMLH 1YGCH 1ABIH 1BUIA 3P17H 1XUKA 3RDZA 3A7TA 1EZQA 1GBJA 1HIAA 4AFQA 3F9EA 4AFUA 2RA3A 5DJ7A 3DFLA 1ELTA 1V2MT 4BTIB 5AVDA 1DWDH 1IQIA 3RXRA 1EATA 3SU3A 3U8OH 1SPJA 1AGJA 3SN8A 3SNAA 4MDSA 3U98H 4ABAA 2FPZA 1ZHRA 1FIWA 1Y5AT 5FBIA 2CMYA 2R0KA 4U30A 1EZSC 3SU6A 2TBSA 1HB0B 2BLOA 2R3UA 3P95A 3GYMA 1PYTD 3SQHE 1C2EA 5EXNA 2V6NA 1QRXA 3E8LA 5HM2A 2BDIA 2IOTA 2ZU2A 4X1QU 2QIQA 2AMDA 1CHGA 1EAUA 2J34A 2J4IA 3PWBA 2BY9X 1UCYK 3Q3KA 2VIPA 4NGAH 1P06A 3RXKA 1A4WH 3MU5A 3PO1C 2H9EH 3SGAE 1ELDE 1WSSH 6GCHF 1LPZB 5EW2H 3UR6A 1SGNE 3KQEA 2BOKA 2FTLE 1SHYA 2C8ZB 2ZDMA 3KL6A 1LVMA 1QL7A 1G3DA 1SGFG 1GBLA 4XBDA 1V2OT 2PTCE 3PTNA 2LPRA 1PQ5A 4OS1A 4U32A 2WYGA 3MH5A 4GSOA 1BJUA 4CH8B 2TGDA 1GBKA 1PPFE 1BHXB 1AKSA 2ZDNA 1NESE 3K6YA 4XE4A 1RRKA 4AFZA 4F49A 1SLWB 1NROH 1C5VA 5C5NA 3RMNH 2O8TA 3B9FH 1EPTB 1SVPA 2ZHEH 1EP5A 1O38A 4ZHAA 5AFYH 3RXBA 1IQFA 2YOLA 1IQEA 1LCYA 2FZZA 1BITA 3UOPA 1ZTJA 2Y6TA 1TPAE 1TNKA 5JYIA 1HXFH 3HK3B 2Y80A 2G51A 4MPVA 2OXSA 2ZO3H 2G55A 1AO5A 1ESBA 1W3CA 3A8BA 2HNTC 2TRMA 3JZ1B 1A61H 1NRQH 3UPEA 3IWMA 2B0FA 4Y71A 1TOMH 3ZV8A 4AYVB 1O2LA 2FTMA 3ZVFA 1NFWA 1GL1A 1E36B 1P0SH 1QHRB 3SV7A 5JDUB 4ZROA 1TMBH 3FP8E 1RGQA 3EAJA 4X8VH 1QL8A 4DJZB 1YPEH 2GCTB 3A7XA 2A45B 1O3NA 4CRCA 2B7DH 1GBDA 2BY7X 3FP7E 3OU0A 3A83A 4K69A 4Y10E 5HXFA 4FXGH 2GCHG 5E0JA 5HYOA 3ATKA 3GDSA 4HI3A 1V2ST 3GCHC 5IYTA 3TNTA 3ZYEA 3DUXH 2QGRA 1GWAA 2GZ8A 4BTUB 2ZGJA 4CBOA 4NIWA 2HVXA 4FUCA 1GHZA 2CHAB 4AGKA 2BXTH 1EB1H 4IN1A 4VGCB 1QURH 1T31A 3LKWA 3S7KB 1GMDG 3PMJA 1BBRK 2GT8A 6ESTA 2VIDA 1FXYA 2C8WB 2I6SA 4WJG2 1AVWA 2QXIA 1GHXH 1C2LA 2ANWA 3PMAB 2ZKSA 1O3KA 3RC6A 3P8GA 4YT7H 2WYJA 3TH3H 1NC6A 3UTUH 3M5OA 1P09A 2ALPA 4FUDA 3K2UA 2OC1A 1GG6B 4BANB 4A5TS 1D3QB 1GJ7B 4AORA 1O2PA 1O3LA 7GCHG 5A0CA 1WTGH 1H4WA 4JYVH 1C1SA 4B76A 2BDHA 1AU8A 4UFGH 4A6LA 2ZDAH 2XRCA 1VZQH 4CRBA 1TBRH 1C5YB 1S82A 4AN7A 4BAKB 1BRBE 5JPMH 3OTJE 1TMUH 2F9BH 4Q80A 5DP3A 2VIOA 5C5OA 1C5SA 4AZ2B 1Y3WA 3D62A 2H9TH 3MH4A 4X6PA 5L2ZH 2V0BA 2WUCA 1D9IA 1C5UA 5HGGA 2TIOA 3RXEA 2FI4E 3E16B 3SUDA 1OWHA 1THPB 4B2BA 1RD3B 3ZZDA 4BAQB 3MO6A 3VB5A 2BD2A 3VB4A 2ZECA 4ZKNU 2FOBA 1Z6JH 3MU1A 4Y79A 1VITH 3SV9A 1QNJA 1O2YA 5AF9H 4A1VA 4I31A 3HGNA 5E8EH 5EQRA 2FIRH 2R2MB 1OOKB 5EOKA 3BF6H 4FUFA 4BXWA 5T6GA 3V7TA 1UHBB 3UR9A 3ZVDA 3KQDA 1F0RA 4ISNA 1RFNA 3QK1A 1O2TA 5A2MH 1THRH 1WBGB 4MNYA 3GY6A 2FO9A 3HGPA 1QJ6B 2F9UA 2Z9LA 1EKBB 4NSVA 1TIOA 4TWYA 2SNWA 1OWKA 5I46H 1V2PT 1MZDA 3LT3A 2VVUA 1RIWB 1HUTH 1S5SA 1SFIA 2BD3A 2FOCA 3ZZBA 1O31A 2HPPH 3R3GB 3C1KA 4FUEA 1K28D 1ZRBA 3LJOA 1YLCA 1AFEH 1MAYA 1ZHMA 1HNEE 1HAVA 1NRNH 2XNIA 1E0FD 3MHWU 1NFYA 2F9OA 3V0XA 4I8GA 1QRZA 3MTYA 4MTBA 5FX6A 1K1JA 1ABJH 4YOJA 4H6SB 1KDQA 3QTOH 1S0RA 1ZTLA 2CJIA 4CRAA 4LZ1H 1F5LA 3PMBB 3F9HA 3L3TA 3AAVA 2VWLA 1PPZA 3I29A 1UTPA 3QO6A 4WMDA 4ZAEA 4O9VA 1C5MD 3VB3A 4OGXA 4O03A 3ATMA 1P3CA 1UTKA 3BTGE 2ODPA 4OS7A 1P2QA 2VWNA 2HALA 4Q7YA 1O30A 5DPAA 1GHAG 1XVOA 3DT0H 3BTHE 1SOZA 1AUJA 3MH7A 4GAWA 1GBCA 1CVWH 5A0BA 2XCNA 3P8OA 3TLOA 4GHTA 1QTFA 3H7TA 3OX7U 4GCHG 3R0FA 1BOQA 1O5FH 2LNCA 4OS6A 1FN6A 1KLIH 1MKXH 4DGJA 1BTUA 2FX4A 2OCVB 4XDEA 1C5QA 5B6OA 2V3OH 1GI6A 1HFDA 1C4Y2 4I8JA 1C1WH 3ATLA 5JBTA 1Q2WA 1EQ9A 4NIYA 3LGIA 4NG9H 1W10U 1P10A 2GCTC 3CS0A 1MU6B 1RXPA 5EXMA 2O8WA 1MCVA 1SGDE 1KXEA 1OXGA 1SGRE 3QZRA 2BDCA 4ABIA 1C2IA 2Z9GA 5LPFA 4THNH 1L1GA 1MBMA 3HKJB 3GY8A 4HTCH 4INLA 5BPEA 1IAUA 2Z6BD 2VVVA 2W3KA 3RXLA 1LHDH 1CU1A 3TGKE 4DIIH 2XWAA 2CHAC 4VGCC 1A46H 1UO6A 4B74A 1LPKB 3SV8A 1AIXH 3BIUH 1E35B 3SOSA 4K60A 1BT7A 2PGBB 1LQEA 1C1MA 1XXFA 1MKWH 1XUJA 3F9FA 3UY9A 1GJCB 1WV7H 2VH0A 1TALA 3PO1B 2Y5GA 3RUOA 2PWXA 3AVZA 4WH6A 1UJ1A 2VVCA 1FY8E 1GBIA 5AFZH 4DT7B 3BEFB 2XYAA 1CQQA 4J2YB 1HAYB 3ZZ7A 2ZCKP 3O8RA 2Q6GA 3HKIB 3SHCH 4B2AA 4NA9H 2AMQA 3TITA 4Q7ZA 1DXWA 1QBNA 1G36A 1GBBA 4O3TA 3RM2H 1F5RA 1O5GH 1D6WA 1UK3A 3LGWA 3U1JB 2CV3A 4HGCA 1GI3A 3EDXB 1CHOF 1TOCB 1Y3YA 4D8NA 5F6MA 2FOGA 1CT2E 2VIWA 3MFJA 4FUHA 4Q7XA 2B8OH 1L1NA 1IQMA