1PPEE

The refined 2.0 angstroms x-ray crystal structure of the complex formed between bovine beta-trypsin and cmti-i, a trypsin inhibitor from squash seeds (cucurbita maxima): topological similarity of the squash seed inhibitors with the carboxypeptidase a inhibitor from potatoes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Bos taurus
publication title The refined 2.0 A X-ray crystal structure of the complex formed between bovine beta-trypsin and CMTI-I, a trypsin inhibitor from squash seeds (Cucurbita maxima). Topological similarity of the squash seed inhibitors with the carboxypeptidase A inhibitor from potatoes
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1991-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppeE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppeE02
1O3OA 2ZPQA 2FMJA 2ZTYA 2HNTE 1GJ7B 2F9VA 7LPRA 4ESTE 4KGAA 5T6DA 5H4IB 1NRSH 2PGBB 1LHCH 1QL8A 1HLTH 2WV5A 4R0IA 1O34A 4X6MA 1MTWA 1TABE 3ODFA 1E36B 3EAJA 2ZTZA 3ATWA 2PR3A 1V2VT 2ZHDA 4FUHA 4NA9H 1BUIA 1HJAB 4ABBA 2H9HA 2P93A 3M5OA 2CMYA 2FI5E 3LGIA 1GBMA 3MH7A 2F9NA 5L2YH 1HIAB 4J1YA 5E2PA 2VIPA 2HPQH 1O36A 3SGQE 1BJVA 1UHBB 3PM3A 4I8LA 4GHQA 1SG8B 1AI8H 4K2YA 1PPHE 2BLVA 3RP2A 1D3DB 3T25A 2BQ7B 2A31A 1DM4B 1P2OA 4OS5A 3SU5A 1CGJE 2UWOA 2BDYA 2BD8A 3MNBA 4NZLA 3RMOH 3CENA 5C3NA 1UVSH 1ZSJA 1BT7A 1KXFA 4X8VH 1O3EA 1CHGA 5EW1H 4X1SU 1IQKA 2XC0A 3VB5A 1CSOE 1EPTB 1Y59T 4CRCA 1AU8A 1XKBC 1LMWB 3SW2B 1GMCF 4B2CA 4GCHF 7KMEH 1UK4A 3M37A 2AFQB 4BXWA 1H4WA 1TQ7B 2BVXH 2STBE 1EKBB 1YPEH 3RXHA 4F4OC 1EJMA 1B0FA 3BSQA 3PMHB 1F5RA 1KXCA 1Y5BT 3GYMA 4HI3A 4B74A 1J8AA 1YBWA 2VU8E 1C2EA 4JYUH 5JBAS 1TQ0B 2J38A 2WPLS 1AO5A 3RXRA 1C5LH 2OINA 4AX9H 1GMDF 1TX8A 1SLUB 2WYJA 1MQ6A 1MMJN 3U8OH 1BMMH 4VGCC 3STJA 1UK3A 4FUIA 4UFDH 5EGMA 4IBLH 1C5PA 2B8OH 1EAUA 1OWIA 1DFPA 1GI0A 2AMQA 4K1TA 1KXDA 2ILNA 1SGQE 1E37B 4Q7YA 1HJ8A 2J9NA 4DY7B 1SLXB 2CN0H 1KDQB 5BPEA 2Z9KA 1HV7A 2SGQE 3C1KA 3T62A 3PWCA 1NS3A 4AYVB 1C1SA 3UIRA 2HPPH 1MKWH 1TBZH 4KTSA 4TWYA 3ZZCA 3D49H 3TH4H 2ZKSA 4ZXXH 1O2UA 1P2QA 3BTHE 3S9CA 1VITG 1SGTA 4Y79A 1NRQH 1IOEA 1RRKA 1YCPM 1JXPA 1SGDE 4YESB 2ODYB 3BTFE 3NKKA 3SJ9A 1LHGH 2TRMA 1DY9A 1MKXH 3IG6B 3MU1A 1CU1A 5EQSA 1AMHA 3LGYA 3S7HB 1TNGA 1P02A 1ZSKA 5DP5A 1WV7H 1PFXC 2V0BA 3NWUA 2P94A 1FDPA 2BY5X 1AVXA 1DWDH 2OC8A 4XE4A 2Y82A 3TIUA 4MQAA 2H5CA 3EGKH 2ODQA 5FXLA 5IYTA 1DLEA 1S83A 3SJKA 1C1OA 4DW2U 1HB0B 3UWJH 1BRBE 3RLWH 1GBJA 2PSXA 1YPHC 1P9UA 1F0UA 1W14U 1W2KH 4OGXA 1OS8A 2NU0E 1ESAA 4AFSA 2AEIH 3ZZBA 6CHAC 5DJ7A 3LGVA 4GVUA 1GHXH 1W10U 3SV8A 3E91A 3AAVA 1V2NT 1A4WH 1TNJA 3VXEH 4HFPB 1SQOA 4NSVA 2AGGX 4Y7BA 1N8OB 1O3JA 1TNIA 1J17T 1NY22 4IW4E 4ABHA 2ZU5A 2GZ9A 1NO9H 3RXEA 4BTUB 2Z9GA 1GI6A 1VCQA 4ABFA 1ETRH 3STIA 1RS0A 3VB4A 3DUXH 3M61U 3P8OA 4Q2KA 1FY8E 1UMAH 4HGCA 2BLQA 4AG2A 1Y3UA 3MO3A 2C8WB 5E2OA 3TK5A 4B1TA 4WMDA 4ZKSU 1YGCH 4DG4A 3SV6A 4AYYB 1TRYA 3E90B 4H4FA 3BEIB 3RU4E 2ZC9H 3SNEA 1BTXA 1GCTC 3LDXH 2O8MA 5AHGH 2FOBA 3SI4H 1GGDC 3ZZ6A 1ZRBA 4ISIH 1S0RA 1BBRK 1S82A 4IMQA 3K6ZA 1O3LA 1TGSZ 1MCVA 1QB9A 5IDKA 4YM9A 2ZCKP 2UUJB 1BZXE 1E35B 2ZNKH 3KHVA 4CHAB 5DP7A 3SBKA 4JZ1A 1Z8GA 2JH6D 1HAPH 2PHBA 3LH1A 2B5TB 3M5NA 5F8ZA 1ZZZA 2XWBI 2UUYA 3QK1A 3ZZ5A 4ABGA 4CH8B 1CA0C 3A87A 4AZ2B 1MUEB 2DE8A 1OX1A 2P16A 2FPZA 7GCHF 1C5TA 3PTNA 1YLDA 1K1JA 2WV4A 4MTBA 1AB9C 3OX7U 1O3DA 2BOHB 1GVLA 1C1TA 2GX4A 1VCPA 5EPNA 1ZTJA 1ORFA 1ZRKA 1LVBA 4Q7XA 2VVUA 2BY8X 4YLUA 1QNJA 1OWEA 2FI4E 5PTPA 1LTOA 2I6SA 3T28A 2AMPA 3FZDA 4FUGA 3ZV8A 2BDAA 1RIWC 4JYVH 4IC5A 1K9OE 1GI8B 3HPTB 1FPHH 3PMBB 4WXVA 2YNBA 2Q1JA 4FUJA 3GCTF 4AG1A 2JETB 1LDTT 3SI3H 2DUCA 2GCTC 1JMOH 1C2KA 4B73A 2BXTH 1BTHH 3URDA 1KY9A 4M7GA 5E8EH 2QA9E 2R3UA 4AGJA 3LGWA 1A7SA 2V3HH 2H2ZA 4U30A 1C4V2 3A89A 1BQYA 3E1XB 3B9FH 1MTVA 1V6DA 4ABIA 1TNKA 1AB9B 4OS1A 4X6NA 1C1QA 1B5GH 4A7IB 3QX5H 2ZG0H 4O9VA 3O8RA 1PJPA 3PO1C 2GDDA 3TH3H 3TU7H 1O2GH 2VB0A 3IWMA 3ZYEA 2XWAA 1P11E 2A45B 5E0HA 2ZDAH 1HAHH 4AOQA 2ZHEH 3KF2A 2CV3A 1ANBA 3GCTG 4TPYA 1ZGVA 3BTGE 2WPJS 1TOMH 1ZPBA 3RXBA 1EXFA 3MI4A 5HXFA 4LOYH 3M3TA 1UVUH 3QO6A 2F91A 2EC9H 4Y8YA 1GJ9B 1XXFA 1CO7E 2W7UA 3E0PB 4NA7A 1KDQA 4FVDA 3ZVFA 3T27A 4CBNA 2R0LA 4Y0YE 3EA7A 4WH8A 2FLRH 1YCPK 1WQVH 1HAZB 4RKOB 1EP5A 1YPGH 3S9AA 1S6FA 4X2WA 5DP4A 1VITF 1F0RA 1ZJKA 4ZXYH 1CQQA 3V7TA 1GJ8B 1P3EA 3ZVBA 1ELTA 1VGCC 1IQNA 1SPJA 2BYAX 3A7YA 4D7FA 3RXTA 3RDZA 4AORA 2GT8A 2A7HA 4R8TB 3PROA 4H6SB 4TYDA 2ZCLP 1YKTA 3TVJB 3QTVH 1HAOH 5DO4H 1HUTH 2ALVA 1ZLRA 2R3YA 2RG3A 1JOUB 2GGVB 3UQOA 4AFZA 5CHAC 1WQSA 2WPMS 4GAWA 1J15A 1TIOA 1WU1A 3RC5A 4K1SA 1QB6A 4U32A 2SGDE 2HWLB 3VPKA 1O2PA 1PYTC 1O3PB 1T8LA 2D2DA 3GISB 1XVOA 1VJ9U 5FCRA 1EPTA 2H1UA 4DOQA 1KXAA 1RD3B 2ZFSA 4YLQH 1C1WH 2C93B 1P2NA 1ELEE 3A81A 2FEQH 3A7VA 3SUFA 2Z6BD 1DT2A 1AE8H 3HATH 5T6FA 1TA2A 2PTNA 4YT7H 1P06A 2FOHA 2XC4A 3SNAA 2DE9A 4JZFH 1FV9A 1T4UH 4IGDA 1O2WA 4BAQB 3LJOA 3NPSA 3RC6A 1MTUA 1W11U 2QXGA 3EE0B 4UE7H 2ZFTA 2AS9A 2ZHWH 2CHAC 3QZQA 1O2ZA 5FX6A 5F03A 3KIDU 1FN8A 1P2IA 4BOHA 3SNDA 3ENSB 3RC4A 2XYAA 4DVAU 2NU3E 1KLIH 1GG6C 1G2LA 5A09A 1H9HE 3Q77A 1H9LB 4X6OA 5JDUB 4UD9H 1AE5A 3D23A 3OU0A 3ESTA 1UTJA 4KELA 1O5DH 5L6NH 2IOTA 4DGJA 2HLCA 1BA8B 3T2NA 2FO9A 1AWHB 1C5UA 2ZFPH 1EAXA 3HK6B 1L0ZA 1MZAA 3BG4B 4AB9A 1Z6JH 3A7XA 4K5ZA 5FPSA 4I31A 5HYOA 1VJAU 5J4SA 4FUDA 4J2YB 1GCDA 1AKSA 2FYRA 2VIQA 4BNRA 3MNXA 2VH0A 1O5CB 1W8BH 1HAGE 4DJZB 1DANH 1GBAA 2TGDA 1IQLA 1C1UH 1QBVH 4NZQA 1GJ6A 1ZHPA 1PPCE 1O32A 1BJUA 2OD3B 2AGIX 4A1VA 1GJ5H 1Z8JB 1TX7A 3RXLA 2C8ZB 1ZOMA 1OWDA 1BBRH 2ZFFH 1VCWA 2FOAA 1QURH 1ZHRA 3NK8A 1V2ST 1W0YH 1FLEE 3B23B 5GDSH 2Z7FE 1WTHD 1BITA 1FNIA 1AKSB 1DWEH 4XBDA 3SGAE 1NFYA 2AYWA 3VB3A 2A5KA 2FS9A 1BTZA 2WYGA 5A8ZA 3S0NA 1QQ4A 3RXFA 1ZSLA 2VWLA 5A0BA 1BBRE 3V12A 3UWIA 1Z1JA 2BZ6H 1G9IE 2A5IA 3UUZA 1F5KU 2VJ1A 1QTFA 4OS7A 4LXBH 3FFGA 4SGBE 4U2WA 1HAVA 3SV9A 4WY3A 2V3OH 2BDHA 5LGOA 4BANB 2OLGA 1BMNH 1F0TA 3RXCA 2CGAA 3BTWE 1Y3YA 3RMMH 4CRAA 4K3JA 4O3UA 1GJ4H 2R2WU 2WPHS 2ZQ1A 1ARBA 1YP9A 3TNSA 4NIXA 1UTOA 3RXAA 1EX3A 1UJ1A 1C2HA 4JZEH 4Y6DA 1KXBA 2PKSC 2FOEA 4TY6A 1LKBA 1SHYA 3I29A 3RMNH 1X7AC 2OTVA 1HIAA 1GHBF 3UQVA 4X2XA 1AUTC 1O0DH 5EXLA 1ZPCA 1ELCA 3SV7A 1RGQA 1UTPA 1CT2E 1T8NA 2HNTF 3P17H 1TMUH 1A1RA 2ANYA 2FI3E 5HGGA 1BHXF 2QN5T 1MKWK 1DS2E 2FESH 1P0SH 1TNHA 1G30B 3DA9B 3SU6A 1C2DA 2V6NA 3GICB 3S69A 4UFFH 2BVRH 1DXPA 2D1JA 1TPAE 1HJAC 3SHCH 1UTQA 1GBTA 2B9LA 4CHAC 4B2BA 2JKHA 4I8KA 4JZDH 3SOSA 3CS0A 2FWWA 2OQ5A 3FAOA 3PLPA 3KN2A 2GV6A 1YPHE 1LPZB 1KLJH 3UNRA 1T8OA 2A5AA 3DFJA 4KP0A 1TRNA 5GPIB 1O3NA 1NFXA 4ZMAH 3VB7A 1P09A 1FIWA 2VGCB 1C5QA 5C5OA 3UFAA 1WOFA 3GY7A 2FP7B 1YF4A 4BAMB 4Q7ZA 3OSYA 3L6PA 3BEFB 3H5CB 2PKSB 2D8WA 1QRZA 1QB1A 1TGNA 2J34A 5LPRA 2HOBA 5CE1A 3SZNA 1OYQA 2CJIA 1MD7A 1IQFA 5SGAE 3M3VA 4H6TA 2G51A 4UDWH 3ZZ8A 3U98H 1PQAA 3F9HA 3T29A 1D3QB 1Z1IA 2F83A 1O35A 1SGPE 5AVDA 2Y80A 3LKWA 1O3KA 2FOCA 1G3CA 2BD2A 3RM2H 3KCGH 3RXUA 1O37A 1TPSA 2ZO3H 4CR5A 1TYNA 2YNAA 1W7GH 1Y8TA 4ZUHA 2BX4A 1ANDA 4BAHB 1XXDA 1C1MA 1ZHMA 2SNVA 1K2I1 3E8LA 1L1NA 2EA3A 4XBCA 4FU8A 3LGTA 2ZGHA 2ASUB 3C27B 1L2EA 1GDUA 1OXGA 1SI5H 4X1PU 4A6LA 1O33A 4YOGA 3ZZDA 3A80A 1TBQH 1BMAA 1C5YB 2SNWA 1VR1H 2QF0A 1EATA 2GDEH 1C4Y2 3A7ZA 2G4UA 2O8TA 2VH6A 1KYNA 1Q2WA 2ZCHP 1A0LA 9ESTA 2QGRA 3GCOA 1TALA 3WY8A 3HK3B 4A1XA 1KLTA 2F9PA 4YOIA 1CVWH 1OYTH 5G4BA 1GI1A 3LC3A 1O3CA 5A0AE 1ABJH 1Y3WA 2BDIA 4TPIZ 1O2OA 1O30A 2GMTC 1GHAG 1UO6A 2A2QH 3UNQA 2JETC 4JCNA 1XM1A 1GHAF 1UTNA 1XUJA 5DKMA 4I8HA 3TGJE 1GHYH 1AN1E 1UVOA 4D7GA 2SGAA 2B0FA 5I25A 2ZGBH 2VVVA 4IS5A 1NZQH 1C1RA 1E34B 1P01A 4Y10E 1A0HB 4XBBA 1GGDB 4ZROA 1TGTA 3SU1A 5HMAA 2LNCA 2A4QA 4ZAEA 2NU4E 2ZWLH 1V3XA 1GG6B 3M7TA 2P8OB 1O2RA 1FY4A 2ZGJA 3ATLA 4XSKU 1QFKH 3ZVAA 1MBQA 2FOFA 3PLKA 5FPTA 1F2SE 3RXIA 2A2XH 3NUMA 4E06H 2G00A 5I46H 1AQ7A 3ZZ3A 2F9OA 1C5MD 3SUEA 2ZI2H 4ZHLU 2P3UB 3E0NB 5GWZA 1O3FA 3A8AA 2W3IA 1T32A 2J95A 2Z9JA 4K8BA 1DITH 1Z6EA 4WMEA 3GDSA 3R0FA 4X2YA 1GDQA 1TB6H 1V2MT 4KKDA 1C2LA 1LVOA 1GMDG 2VNTA 4X1NU 2Y6TA 1THPB 5EPYA 1O39A 4ZHMU 3BN9A 3AAUA 1H1BA 5LPEA 2ZU4A 1EAIA 1NFUA 3SNBA 2BVSH 2SGPE 1BRAA 1ELDE 2BY7X 3TK6A 4FUEA 1QA0A 1DUAA 1Q31A 4PROA 2FS8A 2V35A 1Y3VA 1C9TA 1ESBA 1D3TB 1OOKB 4DIIH 3RXDA 1UTKA 4ABEA 1GL0E 1HRTH 1L4ZA 1C9PA 2GKVE 2P8OC 1O38A 2J4IA 3HKIB 3KQCA 4AFUA 1UVTH 1CA8B 2GZ8A 3LPRA 4HZHA 3QGNB 3DFLA 1HBTH 4IN1A 1TLDA 2VWOA 1WCZA 2STAE 5EOKA 2AH4X 4GHTA 4ABAA 3A8DA 1HAYB 1SGYE 2BQ6B 1QHRB 4E7RG 2BDBA 1K1NA 4TWWA 4AGKA 2AERH 1A5GH 3RU4D 3PV4A 2ZP0H 4JYTA 2O8WA 5EG4A 4Q80A 1C5WB 1FAKH 5JBBS 4FXGH 1PQ7A 3PLBA 2BD3A 1TX6A 4ABDA 2F9UA 3BEUA 1O2KA 1INCA 1IHSH 1IQGA 1HAXB 3A82A 1E0FD 1T4VH 1T7CA 2VIDA 3UTUH 1LKAA 1OP8A 3UPEA 2BX3A 3M5LA 3KQDA 1W7XH 2XBWA 2ZPRA 2O8LA 1C2FA 2GD4B 2TGTA 1J16A 3BTME 3F1SB 5HM9A 3O8BA 1EJNA 2XXLA 3JZ1B 3SU2A 3ZZ7A 5K0HA 4H42U 1JWTA 2XTTB 3ZZAA 3M7QA 1DWBH 8LPRA 1D4PB 4K1EA 1A5IA 2QXHA 1OKXA 3GY6A 1LPGB 6LPRA 1LQEA 1QBNA 1EASA 1SGCA 1Z7KA 1P05A 3U8TH 3RUOA 6ESTA 4ISOA 2VWMA 1EB1H 2HNTC 1SLVB 2BDGA 2ZECA 1MAYA 1N6XA 3FANA 3HGPA 2R2MB 1LO6A 1S0QA 2TIOA 3EA8A 3Q3YA 1XUIA 1ESTA 2VIOA 3D62A 4LZ4B 2QXIA 4X0WU 5GXPA 2THFB 2ZU2A 1O5AB 3O8DA 5F8TA 1PPBH 1K22H 1PQ8A 3K2UA 3K65B 1LPKB 3VFEA 1SGEE 1UTLM 2OQUA 3SUDA 1P8VC 1SGFG 1VZQH 5C1YA 3MHWU 3Q00A 2OC0A 1GBFA 1TOCB 4YT6H 3MFJA 4NCYA 2IJOB 5DG6A 5TJXA 1SQTA 1A0JA 1C2JA 1AFQB 1L4DA 1C5OH 1MQ5A 1QJ7B 5EODA 2UWLA 4X2VA 2PKAA 1FONA 4Y76A 4MDSA 4K8YA 5ESBA 1GBKA 1GJBB 1HXFH 4JZIA 4K60A 5JB9S 5F8XA 3SV2H 2QF3A 3PWBA 3SN8A 2ZDVH 1IQEA 1CT4E 3ATIA 4AB8A 1XUFA 1ETSH 5A0CA 2XRCA 4OS2A 3M3SA 1P57B 1XUGA 3HKJB 2P59A 5HM2A 1MD8A 1JRSA 4I33A 2ZDKA 3BTKE 2BMGB 1DVAH 5EW2H 1V2KT 3LIWA 3URCA 2Z3EA 1C1VH 2GP9B 3VGCB 1CBWB 1SL3A 2GZ7A 1FZZA 2F9BH 2JH5D 1GCTB 2AGEX 3A7TA 5C1XA 1CGHA 5C67A 2FIRH 4Z0KA 3HGNA 1ID5H 3MTYA 1Z71A 1K1PA 1JRTA 3EYDA 2FTMA 1QR3E 1PPFE 2PFEA 5EXMA 2ZTXA 4YTAA 1DSUA 1JIMA 1PPGE 2C8YB 2W5EA 2G81E 2H5DA 2PUXB 5C20A 2Y5FA 1ZR0A 1Y3XA 2SFAA 4HTCH 4NIVA 1DDJA 3UR6A 1GVKB 1G3BA 4NFEA 1GPZA 1TWXB 1MAXA 3BTEE 1TONA 5FBEA 1NPMA 7ESTE 5ETXA 1O2TA 1MKXK 1V2PT 1BHXB 2ALPA 1DOJA 5FAHA 1OWJA 1O3IA 3U9AH 1TBRH 3AW1A 4NA8A 4CR9A 1Y5UT 1P3CA 1SGRE 3H7OA 4INHA 3MNCA 4DURA 1WTGH 4E7NA 3MWIU 1BCUH 4VGCB 1A3BH 3SHAH 2BXUH 1AIXH 1ARCA 2GT7A 3A7WA 1P9SA 1WAYB 2W3KA 1J14A 1GBDA 5J4QA 1ZTKA 4B76A 5JYIA 2OC7A 1NRNH 1FI8A 1DLKB 3Q3KA 4AFQA 3MH6A 2VIVA 1MU8B 1CE5A 2ANMH 1DXWA 3E16B 8KME2 1HCGA 3Q3XA 4MNWA 2BLOA 5BRRE 2FZZA 3GY4A 1OPHB 2XCNA 4CH2B 2ZIQH 1FN6A 1SMFE 3RXMA 1SC8U 1BMLA 5GCHF 3QDZB 1K1LA 3ATMA 1SVPA 4Y71A 3RM0H 3P92A 4NWKA 2GMTB 4RSPA 1V2TT 2FX6A 4GPGA 3SU3A 4XFQA 1K1MA 4I7YH 2IPHA 2TPIZ 1QQUA 2A7JA 1NFWA 5K7RA 4FU7A 4GSOA 4NGAH 2BTCE 1SSXA 2EEKA 1C5ZB 4X8SH 2PUQH 3W94A 3RXVA 5C2ZA 3LC5A 2A0QB 1FQ3A 2ODPA 5L30H 1SFQB 2QYIA 2XBVA 1O5EH 1XUHA 5DK1A 1ELVA 1LHDH 1S84A 1DUEA 6CHAB 3FP7E 1AZ8A 3I78A 1QRXA 2WUCA 4QT8C 4D9QA 2YOLA 2BD7A 3M36A 3G01A 4GCHG 6GCHG 3PMJA 1B0EA 2O9QA 7GCHG 3QZRA 1LHEH 1B7XB 1G2MA 3E3TA 4UONA 4DIHH 4I32A 2Q6GA 4Y0ZE 1BTPA 3F6UH 1RTFB 1F0SA 4OS4A 1KIGH 4CRBA 1O3GA 5DP9A 2AMDA 2J2UA 1G37A 5EXNA 1P2MA 4A1TA 1SB1H 1QL9A 1C5RA 2OP9A 1ZYOA 2BD5A 1GI5A 4ZH8A 3QLPH 1GVZA 3F68H 4ZKRU 4A92A 3UNSA 1V2LT 1SFIA 3QUMP 4ISLA 1XUKA 3ITIA 1EP6A 2FTLE 3VGCC 1O5BB 1TA6A 1K1IA 2CHAB 4NIWA 3UREA 2ESTE 4MNYA 5E0GA 1W3CA 3A83A 3SU4A 1YPKH 1AVGH 2BOKA 3KQBA 1E38B 3IITA 1ZMNA 4MNVA 4THNH 3CP7A 1KXEA 1WBGB 3M7UA 2FYQA 1GI9B 2ZHFH 1FIZA 4RKJB 3SO3A 1THSH 4YOJA 2Y5HA 1QCPA 3PTBA 4FU9A 4X1QU 1NRPH 2J94A 4ZHAA 3ZZ9A 2XBXA 5FHTA 3AW0A 2A4RA 1O2MA 4ASHA 1HGTH 2OUAA 3LOXA 1BTUA 3GYLB 3T26A 3N7OA 4OS6A 5LH8A 1GMHF 4I8JA 5DP8A 4D9RA 1EZXC 1G3DA 2ZDMA 4CBOA 1S81A 3P8GA 4O3TA 1GJCB 1EB2A 1GHBG 2PLXA 1GBCA 1EZQA 3GCNA 5GJ4B 1JIRA 2H6MA 1OWKA 1D3PB 2O8UA 2OBOA 4BTTB 4Z6AH 1S85A 4ISNA 1NT1A 3MU8A 1UVPA 5DGJA 2TGAA 1O2VA 1O31A 1PYTD 3T5FH 2BY6X 1QA7A 1DPOA 1TRMA 3P95A 1C5XB 3VEQB 1AUJA 1TNLA 1ZJDA 4X6PA 1OSSA 4JK6A 2ZPSA 4IMZA 3OYPA 1O2LA 4WXIA 2NU2E 1W12U 1P04A 2FOGA 2PGQB 2QAAA 4INKA 3A8BA 1TGBA 1HJ9A 1FMGA 3BG4C 4NFFA 2G52A 5JBCS 1ZTLA 2C90B 4WWYA 1V2OT 2EI7A 3RXQA 2A4GA 1ZMLA 2ZU1A 2FODA 4UEHH 2ZGXH 5L2ZH 3RMLH 1UK2A 1EJAA 1XVMA 3GDUA 3UR9A 1M9UA 3AASA 3TH2H 1G36A 2ZZUH 3TLOA 1WYKA 1PPEE 4CRFA 1O5GH 3KL6A 4OGYA 2BZAA 3TITA 3JZ2B 1TPPA 5DP3A 3F9EA 3LT3A 3Q76A 4MPWA 1O2XA 1A5HA 1C2IA 2H9EH 3BIVH 1O3HA 3ELAH 2I6QA 2VINA 4MVNA 1GBEA 1FY5A 2FXRA 3A85A 2LPRA 5JPMH 1W13U 1W0ZU 2Z9IA 5DPAA 1YPMH 4UFGH 3U69H 3GY5A 2GVFA 3TGIE 1CA0B 3MOCA 2B7DH 1QRWA 1K1OA 1KTSB 3ZVGA 4DT7B 1FPCH 5F6MA 2OXSA 3GY3A 1O2NA 2RCEA 1Z8RA 2FOMB 2G5NA 2Y5GA 1SGNE 1ZPZA 4MPVA 3TGKE 2OBQA 4BXSA 1DWCH 2PV9B 2XW9A 3GDVA 2PSYA 3QWCH 1EZSC 2UWPA 5AFZH 1XMNB 2SGEE 4LK4A 1AD8H 1ANCA 1WUNH 4FUCA 4CRDA 2VGCC 1TMBH 1AWFH 1VGCB 2G5VA 2HGTH 5A8XA 1OP2A 1BDAA 3MMGA 6GCHF 2HRVA 1ELFA 2ZF0H 3TNTA 1V2QT 2QCYA 1LCYA 1P10A 1LHFH 3K6YA 1HFDA 1MTNC 1MCTA 3A84A 2RA0A 1ABIH 2P3FH 1OP0A 1GBLA 2BM2A 1F5LA 3UOUA 3ZV9A 5T6GA 2ANWA 2VWNA 3LU9B 3BG8A 1IAUA 2CXVA 2BY9X 2EI8A 3MO6A 4BTIB 1S5SA 2C3SA 4FUFA 2BQWB 1IQJA 3L3TA 2Z94A 4DCDA 1BTYA 1KTTB 3A88A 1RTKA 2XBYA 4MLFB 3BTTE 1NRRH 4WH6A 3H7TA 3D65E 2VIWA 3MH5A 1O2YA 3SJIA 1GI2A 1EZUC 1YPJH 3M35A 3PB1E 1C2MA 2C8XB 5CHAB 1U6QA 3SQEE 4E05H 3U1JB 3ODDA 1A2CH 1GL1A 4IC6A 5JBTA 2WINI 3FZZA 2Z3DA 2JH0D 1V2RT 2P95A 2Q6FA 5A2MH 3KEEA 2A1DB 2FM2A 4NIYA 1RJXB 1MZDA 1UCYK 1BTWA 2FX4A 3MU0A 3TJVA 1KSNA 3NCLA 1EUFA 1HXEH 2SGFE 1GHWH 2IN2A 2XCFA 2GCTB 2VVCA 3RXGA 1SOTA 2A32A 5AFYH 1SGIB 3P70B 1YCPH 3A86A 1NM6A 1EPTC 4LZ1H 1C5SA 1DY8A 1GJAB 4XDEA 4BAOB 3V3MA 1HNEE 2R9PA 2Y7XA 5CMXH 1DSTA 3P8FA 1ELAA 4A5TS 2AIQA 1GBBA 2ZQ2A 1SR5C 5LPFA 1O2JA 1C5NH 2PWXA 3MU4A 3RXPA 2GCHF 1QJ6B 1YYY1 5FBIA 3V13A 3RXOA 1XX9A 3GCHC 1YLCA 4GUXA 4INLA 9LPRA 1O3MA 3PYHA 5C1UA 3W95A 1RTLA 5FX5A 1C1NA 4NSYA 2K1QA 1AGJA 5JB8S 1TMTH 1G32B 2BB4A 2OCVB 3OTJE 1O2QA 4MPUA 1O2SA 2F3CE 3U1IB 3PMAB 2C4FH 5A8YA 1FY1A 1YPLH 3MO9A 1GI7B 1EOJA 1BOQA 3ZVCA 1P2JA 1NU7B 5FCKA 1QGFA 3F9FA 1LVMA 2KAIA 3M5MA 1QJ1B 1AZZA 2ZDNA 4NWLA 1THRH 1BB0B 1GWAA 3RXJA 2TGPZ 2PW8H 1HAIH 3SU0A 2PTCE 1O2HA 3QTOH 1CHOG 3DD2H 2M5TA 1MTSA 4I8GA 2AIPA 3CS7A 3BV9B 3GCHB 2UUKB 2RDLA 2GTBA 1BRUP 1FAXA 1V2JT 1ZMJA 2ZHQH 1IQMA 1FY3A 1G3EA 3LH3A 3RXSA 4Y8ZA 5ESTE 2BHGA 1C2GA 3GY8A 2HALA 3TJNA 3OY6U 1GI4A 3SORA 2QXJA 2XC5A 1CBWC 1HAVB 1T8MA 2D26C 1AY6H 2Q6DA 4O03A 4CREA 5ABWA 3K9XB 3S7KB 2GV7A 4Y7AA 1MTNB 3SGBE 5EQRA 1J9CH 3R3GB 1O2IA 2Z9LA 1H9IE 1H8IH 1L1JA 2GCHG 1C1PA 1LVYA 1FXYA 1P2KA 3KQEA 1QIXB 1SBWA 4F49A 4B2AA 4KTUA 1GHZA 1ETTH 1L1GA 3FVFB 4X8UH 4WMFA 4ZKNU 2Z3CA 4GLYA 4D8NA 1A3EH 5C5NA 2ULLA 1BIOA 3DT0H 2R0KA 1K21H 1V2UT 3P6ZB 1PPZA 1F7ZA 3LGUA 4CRGA 1TGCA 4B71A 1O3BA 3SJ8A 1TE0A 1MBMA 1N8OC 4ISHH 1NC6A 1O5FH 4B75A 2BLWA 2EI6A 1IQHA 3BIUH 1VITH 1ELBA 2XNIA 3UOPA 2QIQA 4FUBA 5GCHG 2QC2A 3AVZA 3ZYDA 1HPGA 1GBIA 2TBSA 4KTCA 1DX5M 1NU9A 3OY5U 1GMCG 1D6WA 3QN7A 4Y8XA 2WPKS 3KGPA 3FP8E 1LQDB 1GHVH 4U01A 2ZU3A 1C5VA 1UHBA 4FVBA 3U8RH 8ESTE 5T3HA 5EU8A 2ZDLA 3MH4A 1NN6A 1N6YA 3MYWA 3RU4T 2W7SA 1GJDB 3GOVB 1IQIA 1F92A 4BAKB 1C4U2 3L33A 4YO9A 2ZEBA 1FJSA 1OWHA 1RIWB 3BF6H 2A4OA 4RN6A 4WF8A 3VXFH 2G55A 1A46H 3RLYH 1PQ5A 2WPIS 1CGIE 2H9TH 3KNXA 4XOJA 1QY6A 2WUBA 1UCYE 2FDAA 1FUJA 1IHTH 2J92A 3V0XA 2NWNA 4AN7A 1NTPA 2BD4A 3S9BA 1SOZA 1H8DH 2Y7ZA 5GIBA 1YC0A 1AFQC 1XKAC 4ZKOU 1UTMA 1TFXA 3TPIZ 2ZFQH 1ZGIA 1D6RA 1ACBE 4JMYA 3FP6E 2UUFB 5FPYA 5TCCA 2G4TA 3RXKA 2P3TB 1NESE 1DE7H 3A8CA 4O97A 1Y5AT 3DHKH 1YM0A 3MU5A 3EQ0H 2BD9A 3ZVDA 1ANEA 4K69A 1N1LA 3ATKA 3NXPA 4ABJA 3SJOA 3PO1B 3QGJA 2KAIB 3SUGA 2W26A 3P8NA 1RFNA 3TJOA 4D76A 5AF9H 1GI3A 1ELGA 3MNSA 8GCHF 4JK5A 2NU1E 5E0JA 1EQ9A 1HDTH 5TCAA 1P03A 2QY0B 3BTQE 3LONA 3E6PH 2PKAB 1P12E 1BRCE 1K28D 1Z8IB 4WVPE 3I77A 2FLBH 5EQQA 1GMHG 4X1RU 4MPXA 2OC1A 1TPOA 4WJG2 1MU6B 1JBUH 1AFEH 1SQAA 1QBOA 1WSSH 1NROH 4SGAE 1S6HA 1EOLA 1T31A 3TK9A 5B6OA 8GCHG 3F9GA 4MG3A 1QL7A 1UCYH 4TY7A 2ZFRH 4MNXA 1AHTH 4YZUA 3VB6A 1SLWB 2CF9H 2ZGCA 4Y11E 3EA9A 2G8TA 1HYLA 4X8TH 1AVWA 4NG9H 1CT0E 3GY2A 3B8JA 3ZZ4A 1MH0A 3O8CA 5DP6A 2HVXA 1O3AA 2A7CA 3BTDE 1SGFA 1GDNA 3NZIA 3TJUA 4IN2A 3EDXB 1EAWA 2CF8H 2RA3A 3SNCA 3SQHE 1A61H 2Y81A 2BDCA 1SHHB 3UY9A 1GBHA 1CHOF 1V2WT 1D9IA 1TAWA 1DICA 3LJJA 3ZVEA 2QV1A 4UFEH 1Q3XA 2ZA5A 1RXPA 2ANKH
chains in the Genus database with same CATH superfamily
1O3OA 2ZPQA 2FMJA 2ZTYA 2HNTE 1GJ7B 2F9VA 7LPRA 4ESTE 4KGAA 5T6DA 5H4IB 1NRSH 2PGBB 3F2FA 1LHCH 4HG6A 1QL8A 1HLTH 2WV5A 4R0IA 1O34A 4X6MA 1MTWA 1TABE 3ODFA 1E36B 3EAJA 2ZTZA 3ATWA 2PR3A 1V2VT 2ZHDA 4FUHA 4NA9H 1BUIA 1HJAB 4ABBA 1W0JD 2H9HA 2P93A 3M5OA 2CMYA 2FI5E 3LGIA 1GBMA 3MH7A 2F9NA 5L2YH 1HIAB 4J1YA 5E2PA 2VIPA 2HPQH 1O36A 3SGQE 1BJVA 1UHBB 3PM3A 4I8LA 4GHQA 1SG8B 1AI8H 4K2YA 1PPHE 2BLVA 3RP2A 1D3DB 3T25A 5KEDA 2BQ7B 2A31A 1DM4B 1P2OA 4OS5A 3SU5A 1CGJE 2UWOA 2BDYA 2BD8A 3MNBA 4NZLA 3RMOH 3CENA 5C3NA 1UVSH 1ZSJA 1BT7A 4I86A 1KXFA 3PV2A 4X8VH 1O3EA 1CHGA 5EW1H 4X1SU 1IQKA 2XC0A 3VB5A 1CSOE 1EPTB 1Y59T 4CRCA 1AU8A 1XKBC 1LMWB 3SW2B 1GMCF 4B2CA 4GCHF 3OEHD 7KMEH 1UK4A 3M37A 2AFQB 4BXWA 1H4WA 1TQ7B 2BVXH 2STBE 2WPDD 1EKBB 5F53A 1YPEH 3RXHA 4F4OC 1EJMA 1B0FA 3BSQA 3PMHB 1F5RA 1KXCA 1Y5BT 3GYMA 4HI3A 4B74A 1J8AA 1YBWA 1E79D 2VU8E 1C2EA 4JYUH 5JBAS 1TQ0B 2J38A 2WPLS 1AO5A 3RXRA 1C5LH 2OINA 4AX9H 1GMDF 1TX8A 1SLUB 2WYJA 1MQ6A 4P02A 1MMJN 3U8OH 1BMMH 4VGCC 3STJA 1UK3A 4FUIA 4UFDH 5EGMA 4IBLH 1C5PA 2B8OH 1EAUA 1OWIA 1DFPA 1GI0A 2AMQA 4K1TA 1KXDA 2ILNA 2WZQA 1SGQE 1E37B 4Q7YA 1HJ8A 2J9NA 4DY7B 1SLXB 2CN0H 1KDQB 5BPEA 2Z9KA 1HV7A 2SGQE 3C1KA 3T62A 3PWCA 1NS3A 4AYVB 1C1SA 3UIRA 2HPPH 1MKWH 1TBZH 4KTSA 4TWYA 2CK3D 3D49H 3ZZCA 3TH4H 3MQKC 2ZKSA 4ZXXH 1O2UA 1P2QA 3BTHE 3S9CA 1VITG 1SGTA 4Y79A 1NRQH 1IOEA 1RRKA 1YCPM 1JXPA 2J98B 1SGDE 4YESB 2ODYB 3BTFE 3NKKA 1S6LA 3SJ9A 1LHGH 2TRMA 1DY9A 1MKXH 3IG6B 3MU1A 1CU1A 5EQSA 1AMHA 3LGYA 3S7HB 1TNGA 1P02A 1ZSKA 5DP5A 1WV7H 1PFXC 2V0BA 3NWUA 2P94A 1FDPA 2BY5X 1AVXA 1DWDH 2OC8A 4XE4A 2Y82A 3TIUA 4MQAA 2H5CA 3EGKH 2ODQA 5FXLA 5IYTA 1DLEA 1S83A 3SJKA 1C1OA 4DW2U 1HB0B 3UWJH 1BRBE 3RLWH 1GBJA 4F55A 2PSXA 1YPHC 1P9UA 1BMFD 1F0UA 1FX0B 1W14U 1W2KH 4OGXA 1OS8A 2NU0E 1ESAA 4AFSA 2AEIH 3ZZBA 6CHAC 5DJ7A 3LGVA 4GVUA 1GHXH 1W10U 3SV8A 3E91A 3AAVA 1V2NT 1A4WH 1TNJA 3VXEH 4HFPB 1SQOA 4NSVA 2AGGX 4Y7BA 1N8OB 1O3JA 1TNIA 1J17T 1NY22 4IW4E 4ABHA 2ZU5A 2GZ9A 1NO9H 3RXEA 4BTUB 2Z9GA 1GI6A 1VCQA 4ABFA 1ETRH 3STIA 1RS0A 3VB4A 3DUXH 3M61U 3P8OA 4Q2KA 1FY8E 1UMAH 4HGCA 2BLQA 4AG2A 1Y3UA 3MO3A 2C8WB 5E2OA 3TK5A 2PP6A 5CDFE 4B1TA 4WMDA 4ZKSU 1YGCH 4ACBA 4DG4A 2WSSD 3SV6A 4AYYB 1TRYA 3E90B 4H4FA 3BEIB 3RU4E 5B6LA 2ZC9H 3SNEA 1BTXA 1GCTC 3LDXH 2O8MA 5AHGH 3UB0A 2FOBA 3SI4H 1GGDC 3ZZ6A 1ZRBA 4ISIH 1S0RA 1BBRK 1S82A 1H8ED 4IMQA 3K6ZA 1O3LA 1TGSZ 2HVYB 1MCVA 1QB9A 5IDKA 4YM9A 2ZCKP 2UUJB 1BZXE 1E35B 2ZNKH 3KHVA 4CHAB 5DP7A 3SBKA 5HIZA 4JZ1A 1Z8GA 2JH6D 1HAPH 2PHBA 3LH1A 2B5TB 3M5NA 5F8ZA 1ZZZA 2XWBI 2UUYA 3QK1A 3ZZ5A 4ABGA 4CH8B 1CA0C 3A87A 4AZ2B 1MUEB 2DE8A 1OX1A 2P16A 2K0QA 2FPZA 7GCHF 1C5TA 3PTNA 1YLDA 1K1JA 2WV4A 4MTBA 1AB9C 3OX7U 1O3DA 2BOHB 1GVLA 1C1TA 5DSFA 2GX4A 1VCPA 5EPNA 1ZTJA 1ORFA 1ZRKA 1LVBA 4Q7XA 2VVUA 2BY8X 4YLUA 1QNJA 1OWEA 2FI4E 5PTPA 1LTOA 3N7DA 2I6SA 3T28A 2AMPA 3FZDA 4FUGA 3ZV8A 2BDAA 1RIWC 4JYVH 4IC5A 1K9OE 1GI8B 3HPTB 1FPHH 3PMBB 4WXVA 2YNBA 2Q1JA 4FUJA 3GCTF 4AG1A 2JETB 1E1RD 1LDTT 3SI3H 2DUCA 2GCTC 1JMOH 1C2KA 4B73A 2BXTH 1BTHH 3URDA 1KY9A 4M7GA 5E8EH 2QA9E 2R3UA 4AGJA 3LGWA 1A7SA 2V3HH 2H2ZA 4U30A 1C4V2 3A89A 1BQYA 3E1XB 3B9FH 1MTVA 1V6DA 4ABIA 1TNKA 1AB9B 4OS1A 4X6NA 1C1QA 1B5GH 4A7IB 3QX5H 2ZG0H 4O9VA 3O8RA 1PJPA 3PO1C 2GDDA 3TH3H 3TU7H 1O2GH 2VB0A 3IWMA 3ZYEA 2XWAA 1P11E 2A45B 5E0HA 2ZDAH 1HAHH 4AOQA 2ZHEH 3KF2A 2CV3A 1ANBA 3GCTG 4TPYA 1ZGVA 3BTGE 2WPJS 1TOMH 1ZPBA 3RXBA 1EXFA 3MI4A 5HXFA 4LOYH 3M3TA 1UVUH 3QO6A 2F91A 2EC9H 4Y8YA 1GJ9B 1XXFA 1CO7E 2W7UA 3E0PB 4NA7A 1KDQA 4FVDA 3ZVFA 3T27A 4CBNA 2R0LA 4Y0YE 3EA7A 4WH8A 2FLRH 1YCPK 1WQVH 1HAZB 4RKOB 1EP5A 1YPGH 3S9AA 1S6FA 4X2WA 5DP4A 1VITF 5GNDA 1F0RA 1ZJKA 4ZXYH 1CQQA 3V7TA 1GJ8B 1P3EA 3ZVBA 1ELTA 1VGCC 1IQNA 1SPJA 2BYAX 3OE7D 3A7YA 4D7FA 3RXTA 3RDZA 4AORA 2KR7A 2GT8A 2A7HA 4R8TB 3PROA 4H6SB 4TYDA 2ZCLP 1YKTA 3TVJB 3QTVH 1HAOH 5DO4H 1HUTH 2ALVA 1ZLRA 2R3YA 3FOAA 2RG3A 1JOUB 2GGVB 3UQOA 4AFZA 5CHAC 1WQSA 2WPMS 4GAWA 1J15A 1TIOA 1WU1A 3RC5A 4K1SA 1QB6A 4U32A 2SGDE 2HWLB 3VPKA 1O2PA 2KM0A 1PYTC 1O3PB 1T8LA 2D2DA 3GISB 5IK2D 1XVOA 1VJ9U 5FCRA 1EPTA 2H1UA 4DOQA 1KXAA 1RD3B 2ZFSA 4YLQH 1C1WH 2C93B 1P2NA 1ELEE 3A81A 2FEQH 3A7VA 3KQ5A 3SUFA 2Z6BD 1DT2A 1AE8H 3HATH 5T6FA 1TA2A 2PTNA 4YT7H 2KCYA 1P06A 2FOHA 2XC4A 3SNAA 2DE9A 4JZFH 1FV9A 1T4UH 4IGDA 1O2WA 4BAQB 3LJOA 3NPSA 3RC6A 1MTUA 1W11U 2QXGA 3EE0B 4UE7H 2ZFTA 2AS9A 2ZHWH 2CHAC 3QZQA 1O2ZA 3DSGA 5FX6A 5F03A 3KIDU 1FN8A 1P2IA 4BOHA 3SNDA 3ENSB 3RC4A 2XYAA 4DVAU 2NU3E 1KLIH 1GG6C 1G2LA 5A09A 1H9HE 3Q77A 1H9LB 4X6OA 5JDUB 4UD9H 1AE5A 3D23A 3OU0A 3ESTA 1UTJA 4KELA 1O5DH 5L6NH 2IOTA 4DGJA 2HLCA 3VG8A 1BA8B 3T2NA 2FO9A 1AWHB 1C5UA 2ZFPH 1EAXA 3HK6B 2XNDD 1L0ZA 1MZAA 3BG4B 4AB9A 1Z6JH 3A7XA 4K5ZA 2GJGA 5FPSA 4I31A 5HYOA 1VJAU 5J4SA 4FUDA 4J2YB 1GCDA 1AKSA 2FYRA 2VIQA 4BNRA 3MNXA 2VH0A 1O5CB 1W8BH 1HAGE 4TT3D 4DJZB 1DANH 1GBAA 2TGDA 1IQLA 1C1UH 1QBVH 4NZQA 1GJ6A 1ZHPA 3PV5A 1PPCE 1O32A 1BJUA 2OD3B 2AGIX 4A1VA 1GJ5H 1Z8JB 1TX7A 3RXLA 2C8ZB 1ZOMA 1OWDA 1BBRH 2ZFFH 1VCWA 2FOAA 2EQNA 1QURH 1ZHRA 3NK8A 1V2ST 1W0YH 1FLEE 2JJ1D 3B23B 5GDSH 2Z7FE 1WTHD 1BITA 1FNIA 1AKSB 1DWEH 4XBDA 3SGAE 1NFYA 2AYWA 3VB3A 2A5KA 2FS9A 1BTZA 2WYGA 5A8ZA 3S0NA 1QQ4A 3RXFA 1ZSLA 2VWLA 5A0BA 1BBRE 3V12A 3UWIA 1Z1JA 2BZ6H 1G9IE 2A5IA 3UUZA 1F5KU 2VJ1A 1QTFA 4OS7A 2AHME 4LXBH 3FFGA 4SGBE 4U2WA 1HAVA 3SV9A 4WY3A 2V3OH 2BDHA 5LGOA 4BANB 2OLGA 1BMNH 1F0TA 3RXCA 2CGAA 3BTWE 1Y3YA 3RMMH 4CRAA 4K3JA 4O3UA 1GJ4H 2R2WU 2WPHS 2ZQ1A 5C94A 1ARBA 1YP9A 3TNSA 4NIXA 1UTOA 3RXAA 1EX3A 1UJ1A 1C2HA 4JZEH 4Y6DA 1KXBA 2PKSC 2FOEA 4TY6A 1LKBA 1SHYA 3I29A 3RMNH 1X7AC 2OTVA 1HIAA 1GHBF 3UQVA 4X2XA 1AUTC 1O0DH 5EXLA 1ZPCA 1ELCA 3SV7A 1RGQA 1UTPA 1CT2E 1T8NA 2HNTF 3P17H 1TMUH 1A1RA 2ANYA 2FI3E 5HGGA 1BHXF 2QN5T 1MKWK 1DS2E 2FESH 1P0SH 1TNHA 1G30B 3DA9B 3SU6A 1C2DA 2EY4C 2V6NA 3GICB 3S69A 5EJZA 4UFFH 2BVRH 1DXPA 2D1JA 1TPAE 1HJAC 3SHCH 1UTQA 1GBTA 2KCOA 2B9LA 4CHAC 4B2BA 2JKHA 4I8KA 4JZDH 3SOSA 3CS0A 2FWWA 2OQ5A 3FAOA 3PLPA 3KN2A 2GV6A 1YPHE 1LPZB 1KLJH 3UNRA 1T8OA 2A5AA 3DFJA 4KP0A 1TRNA 5GPIB 1O3NA 1NFXA 4ZMAH 3VB7A 1P09A 1FIWA 2VGCB 1C5QA 5C5OA 3UFAA 1WOFA 3GY7A 2FP7B 4FOUC 1YF4A 4BAMB 4Q7ZA 3OSYA 3L6PA 3BEFB 3H5CB 2PKSB 2D8WA 1QRZA 1QB1A 1TGNA 2J34A 5LPRA 2HOBA 5CE1A 3SZNA 1OYQA 2CJIA 1MD7A 1IQFA 5SGAE 3M3VA 4H6TA 2G51A 4UDWH 3ZZ8A 3U98H 1PQAA 3F9HA 3T29A 1D3QB 1Z1IA 2F83A 1O35A 1SGPE 5AVDA 2Y80A 3LKWA 1O3KA 2FOCA 1G3CA 2BD2A 3RM2H 3KCGH 3RXUA 1O37A 1TPSA 2ZO3H 4CR5A 1TYNA 2YNAA 1W7GH 1Y8TA 4ZUHA 2BX4A 1ANDA 4BAHB 1XXDA 1C1MA 1ZHMA 2SNVA 1K2I1 3E8LA 1L1NA 2EA3A 4XBCA 4FU8A 3LGTA 2ZGHA 2ASUB 3C27B 4Z1MD 1L2EA 1GDUA 1OXGA 3OAAD 1SI5H 4X1PU 4A6LA 1O33A 4YOGA 3ZZDA 3A80A 1TBQH 2QF4A 3WWBA 1BMAA 1C5YB 2SNWA 1VR1H 2QF0A 1EATA 2GDEH 1C4Y2 3A7ZA 2G4UA 2O8TA 2VH6A 1KYNA 1Q2WA 2ZCHP 1A0LA 9ESTA 2QGRA 3GCOA 1TALA 3WY8A 3HK3B 4A1XA 1KLTA 2F9PA 4YOIA 1CVWH 1OYTH 5G4BA 1GI1A 3LC3A 1O3CA 5A0AE 1ABJH 1Y3WA 2BDIA 4TPIZ 1O2OA 1O30A 2GMTC 1GHAG 1UO6A 2A2QH 5DN6D 3UNQA 2JETC 4JCNA 1XM1A 1GHAF 1UTNA 1XUJA 5DKMA 4I8HA 3TGJE 1GHYH 1AN1E 1UVOA 4D7GA 2SGAA 2B0FA 5I25A 2ZGBH 2VVVA 4IS5A 1NZQH 1C1RA 1E34B 1P01A 4Y10E 1A0HB 4XBBA 1GGDB 4ZROA 1TGTA 3SU1A 2J5UA 5HMAA 1KMHB 2LNCA 3N99A 2A4QA 4ZAEA 1NBMD 2NU4E 2ZWLH 1V3XA 1GG6B 3M7TA 2P8OB 1O2RA 1FY4A 2ZGJA 3ATLA 4XSKU 1QFKH 3ZVAA 1MBQA 2FOFA 3PLKA 5FPTA 1F2SE 3RXIA 2A2XH 3NUMA 4E06H 2YMSD 2G00A 5I46H 1AQ7A 3ZZ3A 2F9OA 1C5MD 3SUEA 2ZI2H 4ZHLU 2P3UB 3E0NB 5GWZA 1O3FA 3N7EA 3A8AA 2W3IA 1UW7A 1T32A 2J95A 2Z9JA 4K8BA 1DITH 1Z6EA 4WMEA 3GDSA 3R0FA 4X2YA 1GDQA 1TB6H 1V2MT 4KKDA 1C2LA 1LVOA 1GMDG 2VNTA 4X1NU 2Y6TA 1THPB 5EPYA 1O39A 4ZHMU 3BN9A 3AAUA 1H1BA 5LPEA 2ZU4A 1EAIA 1NFUA 3SNBA 2BVSH 2SGPE 1BRAA 1ELDE 2BY7X 3TK6A 4FUEA 2J98A 1QA0A 3SZEA 1DUAA 1Q31A 4PROA 1W0KD 2FS8A 2YMSB 3KYFA 2V35A 1Y3VA 1C9TA 1ESBA 1D3TB 1OOKB 4DIIH 3RXDA 1UTKA 4ASUD 3GS9A 4ABEA 1GL0E 1HRTH 1L4ZA 1C9PA 2GKVE 2P8OC 1O38A 2J4IA 3HKIB 3KQCA 4AFUA 1E1QD 1UVTH 1CA8B 2GZ8A 3LPRA 3FKSD 4HZHA 3QGNB 3DFLA 1HBTH 4IN1A 1TLDA 2VWOA 1WCZA 2STAE 5EOKA 2AH4X 4GHTA 4ABAA 3A8DA 1HAYB 3F3BA 1SGYE 2BQ6B 1QHRB 4E7RG 2BDBA 1K1NA 4TWWA 4AGKA 2AERH 1A5GH 3RU4D 3PV4A 2ZP0H 4JYTA 2O8WA 5EG4A 4Q80A 1C5WB 1FAKH 5JBBS 4FXGH 1PQ7A 3PLBA 2BD3A 1TX6A 4ABDA 2F9UA 3BEUA 1O2KA 1INCA 1IHSH 1IQGA 1HAXB 3A82A 1E0FD 1T4VH 1T7CA 2VIDA 3UTUH 1LKAA 1OP8A 3UPEA 2BX3A 3M5LA 3KQDA 1W7XH 2XBWA 2ZPRA 2O8LA 2RFKC 1C2FA 2GD4B 2TGTA 1J16A 3BTME 3F1SB 5HM9A 3O8BA 1EJNA 2XXLA 3JZ1B 3SU2A 3UAIC 3ZZ7A 2W6ID 5K0HA 4H42U 1JWTA 2XTTB 3ZZAA 3M7QA 1DWBH 1VKYA 8LPRA 1D4PB 4K1EA 1A5IA 2QXHA 1OKXA 3GY6A 1LPGB 6LPRA 1LQEA 1QBNA 1EASA 1SGCA 1Z7KA 1P05A 3U8TH 1WDIA 3RUOA 6ESTA 3DSOA 4ISOA 2VWMA 1EB1H 2HNTC 1SLVB 2BDGA 2ZECA 1MAYA 1N6XA 3FANA 3HGPA 2R2MB 1LO6A 1S0QA 2TIOA 3EA8A 3Q3YA 1XUIA 1ESTA 2VIOA 3D62A 4LZ4B 2QXIA 4X0WU 5GXPA 2THFB 2ZU2A 1O5AB 3O8DA 5F8TA 1PPBH 4OM9A 1K22H 1PQ8A 3K2UA 3K65B 1LPKB 3VFEA 1SGEE 1UTLM 2OQUA 3SUDA 1P8VC 1SGFG 4P00A 1VZQH 5C1YA 3MHWU 3Q00A 2OC0A 3W1EA 1GBFA 1TOCB 4YT6H 3MFJA 4NCYA 2IJOB 5DG6A 5TJXA 1SQTA 1A0JA 2RDEA 1C2JA 1AFQB 1L4DA 1C5OH 1MQ5A 2F43B 1QJ7B 5EODA 2UWLA 4X2VA 2PKAA 1FONA 4Y76A 4MDSA 4K8YA 5ESBA 1GBKA 1GJBB 1HXFH 4JZIA 4K60A 5JB9S 5F8XA 3SV2H 2QF3A 3PWBA 3SN8A 2QE7D 2ZDVH 1IQEA 1CT4E 3ATIA 2LP6A 4AB8A 1XUFA 1ETSH 5A0CA 2XRCA 4OS2A 3M3SA 1P57B 1XUGA 3HKJB 2P59A 5HM2A 1MD8A 1JRSA 4I33A 2ZDKA 3BTKE 2BMGB 1DVAH 5EW2H 1V2KT 3LIWA 3URCA 2Z3EA 1C1VH 2GP9B 3VGCB 1CBWB 1SL3A 3WW7A 2GZ7A 1FZZA 2F9BH 2JH5D 1GCTB 3PRDA 2AGEX 3A7TA 3OTPA 5C1XA 2F4LA 1CGHA 5C67A 2FIRH 4Z0KA 3HGNA 1ID5H 3MTYA 1Z71A 1K1PA 1JRTA 2YMSC 3EYDA 2FTMA 1QR3E 1EFRD 1PPFE 2PFEA 5EXMA 2JIZD 2ZTXA 4YTAA 1DSUA 1JIMA 1PPGE 2C8YB 2W5EA 2G81E 2H5DA 2PUXB 5C20A 2Y5FA 1ZR0A 1Y3XA 2SFAA 4HTCH 4NIVA 1DDJA 3UR6A 1GVKB 1G3BA 4NFEA 1GPZA 1TWXB 1MAXA 3BTEE 1TONA 5FBEA 1NPMA 7ESTE 5ETXA 1O2TA 1MKXK 1V2PT 1BHXB 2ALPA 1DOJA 5FAHA 1OWJA 1O3IA 4FETA 3U9AH 1TBRH 3AW1A 4NA8A 4CR9A 1Y5UT 1P3CA 2V7QD 1SGRE 2V3MA 3H7OA 3MNCA 4INHA 1WTGH 4DURA 4E7NA 3MWIU 1BCUH 4VGCB 1A3BH 3SHAH 2BXUH 1AIXH 1ARCA 2GT7A 3A7WA 1P9SA 1WAYB 2W3KA 1J14A 1GBDA 5J4QA 1ZTKA 4B76A 5JYIA 2OC7A 1NRNH 1FI8A 1DLKB 3Q3KA 4AFQA 1NBME 3MH6A 2VIVA 1MU8B 1CE5A 2ANMH 1DXWA 3E16B 8KME2 1HCGA 3Q3XA 4M9FA 4MNWA 3WWFA 2BLOA 5BRRE 2FZZA 3GY4A 2IPQX 1OPHB 2XCNA 4CH2B 2ZIQH 1FN6A 3DCLA 1SMFE 3RXMA 1SC8U 1BMLA 5GCHF 3QDZB 1K1LA 3ATMA 1SVPA 3EE7A 4Y71A 3RM0H 3P92A 4NWKA 2GMTB 4RSPA 1V2TT 2FX6A 4GPGA 3SU3A 4XFQA 1K1MA 3DSPA 4I7YH 2IPHA 2TPIZ 1QQUA 4TSFD 2A7JA 1NFWA 5K7RA 4FU7A 4GSOA 4NGAH 1K0HA 2BTCE 1SSXA 2EEKA 1C5ZB 4X8SH 2PUQH 3W94A 3KYGA 3RXVA 5C2ZA 3LC5A 4Q63A 2A0QB 1FQ3A 2VBCA 2ODPA 5L30H 1SFQB 2LELA 3SYJA 2QYIA 2XBVA 1O5EH 1XUHA 5DK1A 3H09A 1ELVA 1LHDH 3NRLA 1S84A 1DUEA 6CHAB 3FP7E 1AZ8A 3I78A 1QRXA 2J97A 2WHXA 2WUCA 4QT8C 4D9QA 2YOLA 2BD7A 3M36A 3G01A 4GCHG 6GCHG 3PMJA 1B0EA 2O9QA 7GCHG 3QZRA 1LHEH 1B7XB 1G2MA 3E3TA 4UONA 4DIHH 4I32A 2Q6GA 4Y0ZE 1BTPA 3F6UH 1RTFB 1F0SA 4OS4A 1KIGH 4CRBA 1O3GA 5DP9A 2AMDA 2J2UA 5KECA 1G37A 5EXNA 1P2MA 4A1TA 1SB1H 1QL9A 1C5RA 2OP9A 1ZYOA 2BD5A 1GI5A 4ZH8A 3QLPH 1GVZA 3F68H 4Q4LA 4ZKRU 4A92A 3UNSA 1V2LT 1SFIA 3QUMP 4ISLA 1XUKA 3ITIA 1EP6A 2FTLE 3VGCC 1H8HD 1O5BB 1TA6A 1K1IA 2CHAB 4NIWA 3UREA 2ESTE 4MNYA 5E0GA 1W3CA 3A83A 3SU4A 1YPKH 5C0TA 1AVGH 2BOKA 3KQBA 1E38B 3IITA 1ZMNA 4MNVA 4THNH 3CP7A 1KXEA 1WBGB 3M7UA 2FYQA 1GI9B 2ZHFH 1FIZA 4RKJB 3SO3A 1THSH 4YOJA 2Y5HA 1QCPA 3PTBA 4FU9A 4X1QU 1NRPH 2J94A 4ZHAA 3ZZ9A 2XBXA 5FHTA 3AW0A 2A4RA 1O2MA 4ASHA 1HGTH 2OUAA 3LOXA 1BTUA 3GYLB 3T26A 3N7OA 4OS6A 5LH8A 1GMHF 4I8JA 5DP8A 4D9RA 1EZXC 1G3DA 2ZDMA 4CBOA 1S81A 3P8GA 4O3TA 1GJCB 1EB2A 1GHBG 2PLXA 1GBCA 1EZQA 3GCNA 5GJ4B 1JIRA 2H6MA 1OWKA 1D3PB 2O8UA 2OBOA 4BTTB 4Z6AH 1S85A 4ISNA 1NT1A 3MU8A 4YXWD 2KX4A 1UVPA 5DGJA 2TGAA 1O2VA 1O31A 1PYTD 3T5FH 2BY6X 1QA7A 1DPOA 1TRMA 3ZIAD 3P95A 1C5XB 3OEED 3VEQB 1AUJA 1TNLA 1ZJDA 4X6PA 1OSSA 4JK6A 2ZPSA 4IMZA 3OYPA 1O2LA 3AK5A 4WXIA 2NU2E 1W12U 1P04A 2FOGA 2PGQB 2QAAA 4INKA 3A8BA 1TGBA 1HJ9A 1FMGA 3BG4C 4NFFA 2G52A 5JBCS 5KGOA 1ZTLA 2C90B 2KZ4A 1V2OT 2EI7A 4WWYA 3RXQA 2A4GA 1ZMLA 2ZU1A 4XRNA 2FODA 4UEHH 2ZGXH 5L2ZH 3RMLH 1UK2A 1EJAA 1XVMA 3GDUA 3UR9A 1M9UA 3F2HA 3AASA 3TH2H 1G36A 2ZZUH 3TLOA 1WYKA 1PPEE 4CRFA 1O5GH 3KL6A 4OGYA 2BZAA 3TITA 4RI0A 3JZ2B 1TPPA 5DP3A 2KFWA 3F9EA 3LT3A 3Q76A 4MPWA 1O2XA 1A5HA 1C2IA 2H9EH 3BIVH 1YWUA 1O3HA 3ELAH 2I6QA 2VINA 4MVNA 1GBEA 1FY5A 2FXRA 3A85A 2LPRA 5JPMH 1W13U 1W0ZU 2Z9IA 5DPAA 1YPMH 4UFGH 4RT1A 3U69H 3GY5A 2GVFA 3TGIE 1CA0B 3MOCA 2B7DH 1QRWA 1K1OA 1KTSB 3ZVGA 4DT7B 1FPCH 5F6MA 2OXSA 3GY3A 1O2NA 2RCEA 1Z8RA 2FOMB 3F2GA 2G5NA 2Y5GA 1SGNE 1ZPZA 5HKKD 3F0PA 4MPVA 3TGKE 1COWD 2OBQA 4BXSA 1DWCH 2PV9B 2XW9A 3GDVA 2PSYA 5EIYA 3QWCH 1EZSC 2UWPA 5AFZH 1XMNB 2SGEE 4LK4A 1AD8H 1ANCA 1WUNH 4FUCA 4CRDA 2VGCC 1TMBH 1AWFH 1VGCB 2G5VA 2HGTH 5A8XA 1OP2A 1BDAA 3MMGA 6GCHF 2HRVA 1ELFA 2L74A 2ZF0H 1V2QT 3TNTA 2QCYA 1LCYA 1P10A 1LHFH 3K6YA 1HFDA 1MTNC 1MCTA 3A84A 2RA0A 1ABIH 2P3FH 4ZCNA 1OP0A 1GBLA 2L6OA 2BM2A 1F5LA 3UOUA 3ZV9A 5T6GA 2ANWA 2VWNA 3LU9B 3BG8A 1IAUA 2CXVA 2BY9X 2EI8A 4DT4A 3MO6A 4BTIB 1S5SA 5EJLA 2C3SA 4FUFA 2BQWB 1IQJA 3L3TA 2Z94A 4DCDA 1BTYA 1KTTB 3A88A 1RTKA 2XBYA 4MLFB 3BTTE 1NRRH 4WH6A 3H7TA 3OFND 3D65E 2VIWA 3MH5A 1O2YA 3SJIA 3FN8A 1GI2A 1EZUC 1YPJH 3M35A 3PB1E 1C2MA 2C8XB 5CHAB 1U6QA 3SQEE 4E05H 3U1JB 3ODDA 1A2CH 1GL1A 4IC6A 5JBTA 2WINI 3U28C 3FZZA 2Z3DA 2JH0D 1V2RT 2P95A 2Q6FA 5A2MH 3KEEA 2A1DB 2FM2A 4NIYA 1RJXB 1MZDA 1UCYK 1BTWA 2FX4A 3MU0A 3TJVA 1KSNA 3NCLA 1EUFA 1HXEH 2SGFE 1GHWH 2IN2A 2XCFA 2GCTB 2VVCA 3RXGA 1SOTA 2A32A 5AFYH 1SGIB 3P70B 1YCPH 3A86A 1NM6A 1EPTC 4LZ1H 1C5SA 1DY8A 1GJAB 4XDEA 4BAOB 3V3MA 1HNEE 2R9PA 2Y7XA 5CMXH 1DSTA 3P8FA 1ELAA 4A5TS 2AIQA 1GBBA 2ZQ2A 1SR5C 5LPFA 1O2JA 1C5NH 2PWXA 3MU4A 3RXPA 2GCHF 1QJ6B 1YYY1 5FBIA 5HIYA 3V13A 3RXOA 1XX9A 3GCHC 1YLCA 4GUXA 4INLA 9LPRA 1O3MA 3PYHA 5C1UA 3W95A 1RTLA 5FX5A 1C1NA 4NSYA 2K1QA 1AGJA 5JB8S 1TMTH 1G32B 2BB4A 2OCVB 3OTJE 1O2QA 4MPUA 1O2SA 2F3CE 3U1IB 3PMAB 2C4FH 5A8YA 1FY1A 1YPLH 3MO9A 1YLNA 1GI7B 1EOJA 1BOQA 3ZVCA 1P2JA 5C17A 1NU7B 4ACAA 5FCKA 1QGFA 4B6FA 3F9FA 1LVMA 2KAIA 2XOKD 3M5MA 1QJ1B 1AZZA 2ZDNA 4NWLA 1THRH 1BB0B 1GWAA 2M2AA 3RXJA 2TGPZ 2PW8H 1HAIH 3SU0A 2PTCE 1O2HA 3QTOH 1CHOG 3DD2H 2M5TA 1MTSA 4I8GA 2AIPA 5EJ1A 3CS7A 3BV9B 3GCHB 2UUKB 2RDLA 2GTBA 1BRUP 1FAXA 1V2JT 1ZMJA 2ZHQH 1IQMA 1FY3A 1G3EA 3LH3A 3RXSA 4Y8ZA 5ESTE 2BHGA 1C2GA 3GY8A 4RT0A 2HALA 3TJNA 3OY6U 1GI4A 1WXRA 3SORA 1YY3A 2QXJA 2XC5A 1CBWC 1HAVB 1T8MA 2D26C 1AY6H 2Q6DA 4O03A 4CREA 5ABWA 3K9XB 2IJD1 3S7KB 2GV7A 2KCPA 4Y7AA 1MTNB 3SGBE 5EQRA 1J9CH 3R3GB 1O2IA 2Z9LA 1H9IE 1H8IH 1L1JA 2GCHG 1C1PA 1LVYA 1FXYA 1P2KA 3KQEA 1QIXB 1SBWA 4F49A 4B2AA 4KTUA 1GHZA 1ETTH 1L1GA 3FVFB 4X8UH 4WMFA 4ZKNU 2Z3CA 4GLYA 4D8NA 1A3EH 5C5NA 2ULLA 1BIOA 3DT0H 2R0KA 2JJ2D 1K21H 1V2UT 3P6ZB 2HLDD 1PPZA 1F7ZA 3LGUA 4CRGA 1TGCA 4B71A 1O3BA 3SJ8A 1TE0A 1MBMA 1N8OC 4ISHH 1NC6A 1O5FH 4B75A 2BLWA 2EI6A 5T1VA 1IQHA 3BIUH 1VITH 1ELBA 2XNIA 3UOPA 2QIQA 4FUBA 5GCHG 2QC2A 3AVZA 3ZYDA 1HPGA 1GBIA 2TBSA 4KTCA 1DX5M 1NU9A 3OY5U 1GMCG 1D6WA 3QN7A 4Y8XA 2WPKS 3KGPA 3FP8E 1LQDB 1GHVH 4U01A 4F48B 2ZU3A 1C5VA 1UHBA 3F0OA 4FVBA 3U8RH 8ESTE 5T3HA 5EU8A 2ZDLA 3MH4A 1NN6A 1N6YA 3MYWA 5CHBA 3RU4T 2W7SA 1GJDB 2K8IA 3GOVB 1IQIA 4AC9A 1F92A 4BAKB 1C4U2 3L33A 4YO9A 2ZEBA 1FJSA 1OWHA 1RIWB 3BF6H 2A4OA 4RN6A 4WF8A 3VXFH 2G55A 1A46H 3RLYH 1PQ5A 2WPIS 4XD7D 1CGIE 2H9TH 3KNXA 4XOJA 1QY6A 2WUBA 1UCYE 2FDAA 1FUJA 1IHTH 2J92A 5FL7D 3V0XA 2NWNA 3FO8D 4AN7A 1NTPA 2BD4A 3S9BA 1SOZA 1H8DH 2Y7ZA 5GIBA 1YC0A 1QZ8A 1AFQC 1XKAC 4ZKOU 1UTMA 1TFXA 3TPIZ 2ZFQH 1ZGIA 1D6RA 1ACBE 4JMYA 3FP6E 2UUFB 5FPYA 5TCCA 2G4TA 3RXKA 2P3TB 1NESE 1DE7H 3A8CA 4O97A 1Y5AT 3DHKH 1YM0A 3MU5A 3EQ0H 2BD9A 3ZVDA 1ANEA 4K69A 1N1LA 3ATKA 3NXPA 4ABJA 3SJOA 3PO1B 3QGJA 2KAIB 3SUGA 2W26A 3P8NA 1RFNA 3TJOA 4D76A 5AF9H 1GI3A 2JDID 1ELGA 3MNSA 8GCHF 4JK5A 2NU1E 5E0JA 1EQ9A 1HDTH 5TCAA 1P03A 2QY0B 3BTQE 3LONA 3E6PH 2PKAB 1SQRA 1P12E 1BRCE 1K28D 1Z8IB 4WVPE 3I77A 2FLBH 5EQQA 1GMHG 2W6JD 4X1RU 4MPXA 2OC1A 1TPOA 4WJG2 1MU6B 1JBUH 4B6EA 1AFEH 1SQAA 1QBOA 1WSSH 1NROH 4SGAE 1S6HA 1EOLA 1T31A 3TK9A 5B6OA 8GCHG 1SKYE 3PRBA 3F9GA 4MG3A 1QL7A 1UCYH 4TY7A 2OK5A 2ZFRH 4MNXA 1AHTH 4YZUA 3VB6A 1SLWB 2CF9H 2KCAA 2ZGCA 5C0UA 4Y11E 3EA9A 1OHHD 2G8TA 1HYLA 4X8TH 1AVWA 3CNRA 4NG9H 1CT0E 3GY2A 3B8JA 3ZZ4A 1MH0A 1MABB 3O8CA 5DP6A 2HVXA 1O3AA 2A7CA 3BTDE 1SGFA 1GDNA 3NZIA 3TJUA 4IN2A 3EDXB 1EAWA 2CF8H 2RA3A 3SNCA 3SQHE 1A61H 2Y81A 2BDCA 1SHHB 3UY9A 1GBHA 1CHOF 1V2WT 1D9IA 1TAWA 1DICA 2QF5A 3LJJA 3ZVEA 2QV1A 2WV9A 1Q3XA 4UFEH 2ZA5A 1RXPA 2ANKH
chains in the Genus database with same CATH topology
1O3OA 2ZPQA 2FMJA 2ZTYA 2HNTE 1GJ7B 2F9VA 7LPRA 4ESTE 4KGAA 5T6DA 5H4IB 1NRSH 2PGBB 1LHCH 1QL8A 1HLTH 2WV5A 4R0IA 1O34A 4X6MA 1MTWA 1TABE 3ODFA 1E36B 3EAJA 2ZTZA 3ATWA 2PR3A 1V2VT 2ZHDA 4FUHA 4NA9H 1BUIA 1HJAB 4ABBA 2H9HA 2P93A 3M5OA 2CMYA 2FI5E 3LGIA 1GBMA 3MH7A 2F9NA 5L2YH 1HIAB 4J1YA 5E2PA 2VIPA 2HPQH 1O36A 3SGQE 1BJVA 1UHBB 3PM3A 4I8LA 4GHQA 1SG8B 1AI8H 4K2YA 1PPHE 2BLVA 3RP2A 1D3DB 3T25A 2BQ7B 2A31A 1DM4B 1P2OA 4OS5A 3SU5A 1CGJE 2UWOA 2BDYA 2BD8A 3MNBA 4NZLA 3RMOH 3CENA 5C3NA 1UVSH 1ZSJA 1BT7A 1KXFA 4X8VH 1O3EA 1CHGA 5EW1H 4X1SU 1IQKA 2XC0A 3VB5A 1CSOE 1EPTB 1Y59T 4CRCA 1AU8A 1XKBC 1LMWB 3SW2B 1GMCF 4B2CA 4GCHF 7KMEH 1UK4A 3M37A 2AFQB 4BXWA 1H4WA 1TQ7B 2BVXH 2STBE 1EKBB 1YPEH 3RXHA 4F4OC 1EJMA 1B0FA 3BSQA 3PMHB 1F5RA 1KXCA 1Y5BT 3GYMA 4HI3A 4B74A 1J8AA 1YBWA 2VU8E 1C2EA 4JYUH 5JBAS 1TQ0B 2J38A 2WPLS 1AO5A 3RXRA 1C5LH 2OINA 4AX9H 1GMDF 1TX8A 1SLUB 2WYJA 1MQ6A 1MMJN 3U8OH 1BMMH 4VGCC 3STJA 1UK3A 4FUIA 4UFDH 5EGMA 4IBLH 1C5PA 2B8OH 1EAUA 1OWIA 1DFPA 1GI0A 2AMQA 4K1TA 1KXDA 2ILNA 1SGQE 1E37B 4Q7YA 1HJ8A 2J9NA 4DY7B 1SLXB 2CN0H 1KDQB 5BPEA 2Z9KA 1HV7A 2SGQE 3C1KA 3T62A 3PWCA 1NS3A 4AYVB 1C1SA 3UIRA 2HPPH 1MKWH 1TBZH 4KTSA 4TWYA 3ZZCA 3D49H 3TH4H 2ZKSA 4ZXXH 1O2UA 1P2QA 3BTHE 3S9CA 1VITG 1SGTA 4Y79A 1NRQH 1IOEA 1RRKA 1YCPM 1JXPA 1SGDE 4YESB 2ODYB 3BTFE 3NKKA 3SJ9A 1LHGH 2TRMA 1DY9A 1MKXH 3IG6B 3MU1A 1CU1A 5EQSA 1AMHA 3LGYA 3S7HB 1TNGA 1P02A 1ZSKA 5DP5A 1WV7H 1PFXC 2V0BA 3NWUA 2P94A 1FDPA 2BY5X 1AVXA 1DWDH 2OC8A 4XE4A 2Y82A 3TIUA 4MQAA 2H5CA 3EGKH 2ODQA 5FXLA 5IYTA 1DLEA 1S83A 3SJKA 1C1OA 4DW2U 1HB0B 3UWJH 1BRBE 3RLWH 1GBJA 2PSXA 1YPHC 1P9UA 1F0UA 1W14U 1W2KH 4OGXA 1OS8A 2NU0E 1ESAA 4AFSA 2AEIH 3ZZBA 6CHAC 5DJ7A 3LGVA 4GVUA 1GHXH 1W10U 3SV8A 3E91A 3AAVA 1V2NT 1A4WH 1TNJA 3VXEH 4HFPB 1SQOA 4NSVA 2AGGX 4Y7BA 1N8OB 1O3JA 1TNIA 1J17T 1NY22 4IW4E 4ABHA 2ZU5A 2GZ9A 1NO9H 3RXEA 4BTUB 2Z9GA 1GI6A 1VCQA 4ABFA 1ETRH 3STIA 1RS0A 3VB4A 3DUXH 3M61U 3P8OA 4Q2KA 1FY8E 1UMAH 4HGCA 2BLQA 4AG2A 1Y3UA 3MO3A 2C8WB 5E2OA 3TK5A 4B1TA 4WMDA 4ZKSU 1YGCH 4DG4A 3SV6A 4AYYB 1TRYA 3E90B 4H4FA 3BEIB 3RU4E 2ZC9H 3SNEA 1BTXA 1GCTC 3LDXH 2O8MA 5AHGH 2FOBA 3SI4H 1GGDC 3ZZ6A 1ZRBA 4ISIH 1S0RA 1BBRK 1S82A 4IMQA 3K6ZA 1O3LA 1TGSZ 1MCVA 1QB9A 5IDKA 4YM9A 2ZCKP 2UUJB 1BZXE 1E35B 2ZNKH 3KHVA 4CHAB 5DP7A 3SBKA 4JZ1A 1Z8GA 2JH6D 1HAPH 2PHBA 3LH1A 2B5TB 3M5NA 5F8ZA 1ZZZA 2XWBI 2UUYA 3QK1A 3ZZ5A 4ABGA 4CH8B 1CA0C 3A87A 4AZ2B 1MUEB 2DE8A 1OX1A 2P16A 2FPZA 7GCHF 1C5TA 3PTNA 1YLDA 1K1JA 2WV4A 4MTBA 1AB9C 3OX7U 1O3DA 2BOHB 1GVLA 1C1TA 2GX4A 1VCPA 5EPNA 1ZTJA 1ORFA 1ZRKA 1LVBA 4Q7XA 2VVUA 2BY8X 4YLUA 1QNJA 1OWEA 2FI4E 5PTPA 1LTOA 2I6SA 3T28A 2AMPA 3FZDA 4FUGA 3ZV8A 2BDAA 1RIWC 4JYVH 4IC5A 1K9OE 1GI8B 3HPTB 1FPHH 3PMBB 4WXVA 2YNBA 2Q1JA 4FUJA 3GCTF 4AG1A 2JETB 1LDTT 3SI3H 2DUCA 2GCTC 1JMOH 1C2KA 4B73A 2BXTH 1BTHH 3URDA 1KY9A 4M7GA 5E8EH 2QA9E 2R3UA 4AGJA 3LGWA 1A7SA 2V3HH 2H2ZA 4U30A 1C4V2 3A89A 1BQYA 3E1XB 3B9FH 1MTVA 1V6DA 4ABIA 1TNKA 1AB9B 4OS1A 4X6NA 1C1QA 1B5GH 4A7IB 3QX5H 2ZG0H 4O9VA 3O8RA 1PJPA 3PO1C 2GDDA 3TH3H 3TU7H 1O2GH 2VB0A 3IWMA 3ZYEA 2XWAA 1P11E 2A45B 5E0HA 2ZDAH 1HAHH 4AOQA 2ZHEH 3KF2A 2CV3A 1ANBA 3GCTG 4TPYA 1ZGVA 3BTGE 2WPJS 1TOMH 1ZPBA 3RXBA 1EXFA 3MI4A 5HXFA 4LOYH 3M3TA 1UVUH 3QO6A 2F91A 2EC9H 4Y8YA 1GJ9B 1XXFA 1CO7E 2W7UA 3E0PB 4NA7A 1KDQA 4FVDA 3ZVFA 3T27A 4CBNA 2R0LA 4Y0YE 3EA7A 4WH8A 2FLRH 1YCPK 1WQVH 1HAZB 4RKOB 1EP5A 1YPGH 3S9AA 1S6FA 4X2WA 5DP4A 1VITF 1F0RA 1ZJKA 4ZXYH 1CQQA 3V7TA 1GJ8B 1P3EA 3ZVBA 1ELTA 1VGCC 1IQNA 1SPJA 2BYAX 3A7YA 4D7FA 3RXTA 3RDZA 4AORA 2GT8A 2A7HA 4R8TB 3PROA 4H6SB 4TYDA 2ZCLP 1YKTA 3TVJB 3QTVH 1HAOH 5DO4H 1HUTH 2ALVA 1ZLRA 2R3YA 2RG3A 1JOUB 2GGVB 3UQOA 4AFZA 5CHAC 1WQSA 2WPMS 4GAWA 1J15A 1TIOA 1WU1A 3RC5A 4K1SA 1QB6A 4U32A 2SGDE 2HWLB 3VPKA 1O2PA 1PYTC 1O3PB 1T8LA 2D2DA 3GISB 1XVOA 1VJ9U 5FCRA 1EPTA 2H1UA 4DOQA 1KXAA 1RD3B 2ZFSA 4YLQH 1C1WH 2C93B 1P2NA 1ELEE 3A81A 2FEQH 3A7VA 3SUFA 2Z6BD 1DT2A 1AE8H 3HATH 5T6FA 1TA2A 2PTNA 4YT7H 1P06A 2FOHA 2XC4A 3SNAA 2DE9A 4JZFH 1FV9A 1T4UH 4IGDA 1O2WA 4BAQB 3LJOA 3NPSA 3RC6A 1MTUA 1W11U 2QXGA 3EE0B 4UE7H 2ZFTA 2AS9A 2ZHWH 2CHAC 3QZQA 1O2ZA 5FX6A 5F03A 3KIDU 1FN8A 1P2IA 4BOHA 3SNDA 3ENSB 3RC4A 2XYAA 4DVAU 2NU3E 1KLIH 1GG6C 1G2LA 5A09A 1H9HE 3Q77A 1H9LB 4X6OA 5JDUB 4UD9H 1AE5A 3D23A 3OU0A 3ESTA 1UTJA 4KELA 1O5DH 5L6NH 2IOTA 4DGJA 2HLCA 1BA8B 3T2NA 2FO9A 1AWHB 1C5UA 2ZFPH 1EAXA 3HK6B 1L0ZA 1MZAA 3BG4B 4AB9A 1Z6JH 3A7XA 4K5ZA 5FPSA 4I31A 5HYOA 1VJAU 5J4SA 4FUDA 4J2YB 1GCDA 1AKSA 2FYRA 2VIQA 4BNRA 3MNXA 2VH0A 1O5CB 1W8BH 1HAGE 4DJZB 1DANH 1GBAA 2TGDA 1IQLA 1C1UH 1QBVH 4NZQA 1GJ6A 1ZHPA 1PPCE 1O32A 1BJUA 2OD3B 2AGIX 4A1VA 1GJ5H 1Z8JB 1TX7A 3RXLA 2C8ZB 1ZOMA 1OWDA 1BBRH 2ZFFH 1VCWA 2FOAA 1QURH 1ZHRA 3NK8A 1V2ST 1W0YH 1FLEE 3B23B 5GDSH 2Z7FE 1WTHD 1BITA 1FNIA 1AKSB 1DWEH 4XBDA 3SGAE 1NFYA 2AYWA 3VB3A 2A5KA 2FS9A 1BTZA 2WYGA 5A8ZA 3S0NA 1QQ4A 3RXFA 1ZSLA 2VWLA 5A0BA 1BBRE 3V12A 3UWIA 1Z1JA 2BZ6H 1G9IE 2A5IA 3UUZA 1F5KU 2VJ1A 1QTFA 4OS7A 4LXBH 3FFGA 4SGBE 4U2WA 1HAVA 3SV9A 4WY3A 2V3OH 2BDHA 5LGOA 4BANB 2OLGA 1BMNH 1F0TA 3RXCA 2CGAA 3BTWE 1Y3YA 3RMMH 4CRAA 4K3JA 4O3UA 1GJ4H 2R2WU 2WPHS 2ZQ1A 1ARBA 1YP9A 3TNSA 4NIXA 1UTOA 3RXAA 1EX3A 1UJ1A 1C2HA 4JZEH 4Y6DA 1KXBA 2PKSC 2FOEA 4TY6A 1LKBA 1SHYA 3I29A 3RMNH 1X7AC 2OTVA 1HIAA 1GHBF 3UQVA 4X2XA 1AUTC 1O0DH 5EXLA 1ZPCA 1ELCA 3SV7A 1RGQA 1UTPA 1CT2E 1T8NA 2HNTF 3P17H 1TMUH 1A1RA 2ANYA 2FI3E 5HGGA 1BHXF 2QN5T 1MKWK 1DS2E 2FESH 1P0SH 1TNHA 1G30B 3DA9B 3SU6A 1C2DA 2V6NA 3GICB 3S69A 4UFFH 2BVRH 1DXPA 2D1JA 1TPAE 1HJAC 3SHCH 1UTQA 1GBTA 2B9LA 4CHAC 4B2BA 2JKHA 4I8KA 4JZDH 3SOSA 3CS0A 2FWWA 2OQ5A 3FAOA 3PLPA 3KN2A 2GV6A 1YPHE 1LPZB 1KLJH 3UNRA 1T8OA 2A5AA 3DFJA 4KP0A 1TRNA 5GPIB 1O3NA 1NFXA 4ZMAH 3VB7A 1P09A 1FIWA 2VGCB 1C5QA 5C5OA 3UFAA 1WOFA 3GY7A 2FP7B 1YF4A 4BAMB 4Q7ZA 3OSYA 3L6PA 3BEFB 3H5CB 2PKSB 2D8WA 1QRZA 1QB1A 1TGNA 2J34A 5LPRA 2HOBA 5CE1A 3SZNA 1OYQA 2CJIA 1MD7A 1IQFA 5SGAE 3M3VA 4H6TA 2G51A 4UDWH 3ZZ8A 3U98H 1PQAA 3F9HA 3T29A 1D3QB 1Z1IA 2F83A 1O35A 1SGPE 5AVDA 2Y80A 3LKWA 1O3KA 2FOCA 1G3CA 2BD2A 3RM2H 3KCGH 3RXUA 1O37A 1TPSA 2ZO3H 4CR5A 1TYNA 2YNAA 1W7GH 1Y8TA 4ZUHA 2BX4A 1ANDA 4BAHB 1XXDA 1C1MA 1ZHMA 2SNVA 1K2I1 3E8LA 1L1NA 2EA3A 4XBCA 4FU8A 3LGTA 2ZGHA 2ASUB 3C27B 1L2EA 1GDUA 1OXGA 1SI5H 4X1PU 4A6LA 1O33A 4YOGA 3ZZDA 3A80A 1TBQH 1BMAA 1C5YB 2SNWA 1VR1H 2QF0A 1EATA 2GDEH 1C4Y2 3A7ZA 2G4UA 2O8TA 2VH6A 1KYNA 1Q2WA 2ZCHP 1A0LA 9ESTA 2QGRA 3GCOA 1TALA 3WY8A 3HK3B 4A1XA 1KLTA 2F9PA 4YOIA 1CVWH 1OYTH 5G4BA 1GI1A 3LC3A 1O3CA 5A0AE 1ABJH 1Y3WA 2BDIA 4TPIZ 1O2OA 1O30A 2GMTC 1GHAG 1UO6A 2A2QH 3UNQA 2JETC 4JCNA 1XM1A 1GHAF 1UTNA 1XUJA 5DKMA 4I8HA 3TGJE 1GHYH 1AN1E 1UVOA 4D7GA 2SGAA 2B0FA 5I25A 2ZGBH 2VVVA 4IS5A 1NZQH 1C1RA 1E34B 1P01A 4Y10E 1A0HB 4XBBA 1GGDB 4ZROA 1TGTA 3SU1A 5HMAA 2LNCA 2A4QA 4ZAEA 2NU4E 2ZWLH 1V3XA 1GG6B 3M7TA 2P8OB 1O2RA 1FY4A 2ZGJA 3ATLA 4XSKU 1QFKH 3ZVAA 1MBQA 2FOFA 3PLKA 5FPTA 1F2SE 3RXIA 2A2XH 3NUMA 4E06H 2G00A 5I46H 1AQ7A 3ZZ3A 2F9OA 1C5MD 3SUEA 2ZI2H 4ZHLU 2P3UB 3E0NB 5GWZA 1O3FA 3A8AA 2W3IA 1T32A 2J95A 2Z9JA 4K8BA 1DITH 1Z6EA 4WMEA 3GDSA 3R0FA 4X2YA 1GDQA 1TB6H 1V2MT 4KKDA 1C2LA 1LVOA 1GMDG 2VNTA 4X1NU 2Y6TA 1THPB 5EPYA 1O39A 4ZHMU 3BN9A 3AAUA 1H1BA 5LPEA 2ZU4A 1EAIA 1NFUA 3SNBA 2BVSH 2SGPE 1BRAA 1ELDE 2BY7X 3TK6A 4FUEA 1QA0A 1DUAA 1Q31A 4PROA 2FS8A 2V35A 1Y3VA 1C9TA 1ESBA 1D3TB 1OOKB 4DIIH 3RXDA 1UTKA 4ABEA 1GL0E 1HRTH 1L4ZA 1C9PA 2GKVE 2P8OC 1O38A 2J4IA 3HKIB 3KQCA 4AFUA 1UVTH 1CA8B 2GZ8A 3LPRA 4HZHA 3QGNB 3DFLA 1HBTH 4IN1A 1TLDA 2VWOA 1WCZA 2STAE 5EOKA 2AH4X 4GHTA 4ABAA 3A8DA 1HAYB 1SGYE 2BQ6B 1QHRB 4E7RG 2BDBA 1K1NA 4TWWA 4AGKA 2AERH 1A5GH 3RU4D 3PV4A 2ZP0H 4JYTA 2O8WA 5EG4A 4Q80A 1C5WB 1FAKH 5JBBS 4FXGH 1PQ7A 3PLBA 2BD3A 1TX6A 4ABDA 2F9UA 3BEUA 1O2KA 1INCA 1IHSH 1IQGA 1HAXB 3A82A 1E0FD 1T4VH 1T7CA 2VIDA 3UTUH 1LKAA 1OP8A 3UPEA 2BX3A 3M5LA