1PPEE

The refined 2.0 angstroms x-ray crystal structure of the complex formed between bovine beta-trypsin and cmti-i, a trypsin inhibitor from squash seeds (cucurbita maxima): topological similarity of the squash seed inhibitors with the carboxypeptidase a inhibitor from potatoes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The refined 2.0 A X-ray crystal structure of the complex formed between bovine beta-trypsin and CMTI-I, a trypsin inhibitor from squash seeds (Cucurbita maxima). Topological similarity of the squash seed inhibitors with the carboxypeptidase A inhibitor from potatoes
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1991-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppeE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppeE02
4TY7A 2EI6A 2JH6D 2ZPSA 4B73A 5GPIB 3V7TA 1AVWA 1QBNA 1HDTH 1IQKA 2TGDA 5F8ZA 1LKBA 1OKXA 3Q3XA 3S7KB 4X2VA 4ISIH 2FM2A 4X8TH 1O5GH 2JETB 1ELDE 1MCTA 4NG9H 4K1TA 4ABJA 3GY7A 1QGFA 1GL1A 1DVAH 1FZZA 2AIQA 3OTJE 2W3IA 1O3EA 1AHTH 4XOJA 4JZIA 3K65B 3ZZ3A 3U69H 1EUFA 5GWZA 1BMNH 3TJNA 3F68H 1TPAE 3STIA 2D8WA 1C5OH 1UCYE 1C5RA 4AGKA 2VVUA 1NPMA 3PO1C 1O2IA 1BZXE 4LOYH 4NFFA 1DXWA 2OTVA 4Q7YA 2TGAA 5GIBA 3I29A 4I31A 1O2ZA 1V2RT 1KLIH 3SU1A 2XCFA 1AZ8A 1C1TA 1SGEE 2BVSH 2FO9A 1FY5A 1QJ1B 3ZZBA 1ANEA 1EX3A 1T8LA 3EA9A 2FZZA 5JB9S 4RSPA 2ZGHA 2FX6A 1ZZZA 3UNRA 4K8BA 1SGQE 1J15A 2GCHF 1BOQA 2C8ZB 4MPVA 1TGNA 4CRAA 2Z9IA 1A2CH 1NO9H 4JK5A 1QQUA 2AIPA 2XCNA 3MU4A 1QB9A 2ZGCA 3SU2A 3M3SA 3SU4A 2PKAB 1O2XA 2XBYA 1EZXC 5DO4H 4FUBA 2J2UA 2VIDA 1GJ8B 5G4BA 1O3KA 1TMUH 2J94A 3LGWA 4IGDA 1A4WH 2O8UA 4NZQA 1C1OA 4DVAU 4I33A 2Y5HA 1EAIA 3ATKA 3GDVA 1S84A 3SU0A 3UR6A 3QDZB 5C1YA 1ZSJA 3M3TA 3KCGH 3RXRA 2GZ8A 1NRNH 1L1GA 5I25A 3PYHA 3A8AA 3BV9B 1S83A 1HXFH 2FDAA 1GMCF 5JDUB 1AE8H 4TY6A 2GZ7A 2P16A 3ATMA 1P57B 4X8SH 3OY5U 2WPJS 1K9OE 1BT7A 1W0YH 2BXUH 5HM9A 3ITIA 1GCTC 2ZQ1A 2CXVA 3OY6U 2ZHDA 1UTQA 2LPRA 2ZU3A 3TH4H 1K1MA 7LPRA 4DY7B 2OXSA 4IN2A 5GXPA 4ABDA 1E34B 3PM3A 3EAJA 5DKMA 3ESTA 1TA6A 1YF4A 3ZYDA 1F0UA 4A1XA 1ANDA 1EJAA 3SGQE 4MPWA 2B9LA 2OCVB 2UUJB 2R0KA 1SGFG 1RTFB 5FHTA 2RCEA 1O30A 3UR9A 4NIYA 4FXGH 2AFQB 3M36A 3K9XB 3QX5H 1SQAA 2GX4A 2SNWA 1V2UT 2PGBB 1UTPA 6CHAC 1AI8H 4ISOA 3UNSA 3F9GA 2A5IA 4NSYA 2Y5GA 2HPQH 4AFZA 2QXGA 2BQ7B 2VIWA 4Z6AH 1YC0A 3A8BA 3K6YA 4D9RA 1TGCA 3BTQE 1O3MA 4F49A 1HGTH 2QIQA 1CQQA 2V35A 5CHAC 3MNSA 2LNCA 2GMTC 1ELGA 1GMDG 1GJ7B 3F9EA 2C3SA 1OOKB 4H6SB 2AGEX 3SNCA 1S0RA 1QRXA 2GDDA 2PR3A 5GJ4B 5C20A 2WPKS 1N8OB 1BMLA 1EPTC 1O3IA 4MLFB 2XC4A 3RXGA 4OS6A 1Z8RA 1FDPA 4GCHG 4NWLA 1LCYA 3QZRA 3RXMA 1K1JA 1LO6A 3GCTG 2SGEE 4JYTA 4BTUB 1L2EA 1QB6A 1Z1JA 1X7AC 2ZKSA 2A5AA 1TPOA 3STJA 1TNGA 1RTKA 4OGXA 2SGAA 1AUJA 1QIXB 1JBUH 2R3UA 3TIUA 1BMMH 1O2KA 1XM1A 1N6XA 2GP9B 2W7UA 2FOEA 3KQEA 1J14A 2FLBH 2A31A 3AASA 5K7RA 2ZHEH 1QJ6B 3P8OA 1V2LT 2IN2A 4LZ4B 2AGGX 4THNH 1IQJA 3UQVA 4BXSA 2RDLA 4GAWA 3UFAA 1HAHH 1DWBH 1NM6A 2QGRA 1DPOA 1MAXA 1MD7A 2C4FH 2VH6A 4K8YA 2GTBA 1YGCH 2SGDE 4XSKU 3PMAB 1O5FH 2NU3E 2QC2A 1MTSA 1ZRKA 1YPJH 4CBNA 4Y8XA 3EE0B 1O2NA 4JK6A 5F8XA 3TNSA 3UOPA 1DANH 2P93A 4UFGH 1NROH 1AKSA 3VB4A 3LKWA 1GVKB 5FPYA 1GGDC 2BLWA 3A82A 3FP7E 2C8WB 5JB8S 5C67A 3QO6A 4IBLH 1CU1A 1C1NA 4O03A 4JZDH 2W26A 2NU0E 1GBKA 3DUXH 3F9FA 1VCPA 1TLDA 1K1NA 1BBRK 1C5QA 3RC6A 4X0WU 4B71A 1AQ7A 5FX5A 2FYQA 3EQ0H 2BQ6B 1HAGE 2FS8A 1W12U 3Q00A 1Y8TA 1B0EA 3ODDA 1GI1A 2GT7A 1KXEA 5HMAA 3TLOA 3U8OH 1TNLA 5A0AE 1C5UA 4ZROA 1VCQA 1ZHPA 4R8TB 3Q3KA 4BOHA 1GMDF 3RP2A 2BY9X 3ENSB 2H2ZA 2ZCKP 4ISNA 1GBFA 4O3UA 1WTGH 4BAOB 2RG3A 2XC5A 4CH8B 1KDQA 1QCPA 1GHXH 1L4DA 2Y6TA 2F9OA 3FZZA 8KME2 1C5WB 1AN1E 1DICA 1UVOA 4GCHF 5C5NA 2Q6FA 1O2WA 1HAYB 4ZHAA 4AX9H 2BDIA 1LQDB 2G00A 3VGCC 2FMJA 1C1MA 3GCTF 2ZGXH 4JYVH 2BD5A 2ZZUH 1TGTA 3RM0H 1CE5A 1RS0A 5L2ZH 1O2MA 4YT7H 1D6WA 2Z9LA 4ABFA 4TPYA 2BVXH 1GCTB 2PFEA 1QNJA 2VH0A 2BY5X 1EJMA 3GY5A 4DGJA 6GCHG 1SLXB 2A0QB 5A2MH 4E05H 2OLGA 2WPLS 1TONA 4RKOB 2PKAA 3URCA 4KELA 4GUXA 3LJOA 4B74A 2QF0A 4CH2B 1C1WH 2BD9A 2Y7ZA 3D62A 3PLPA 1W2KH 4YLQH 1P8VC 4MG3A 3ZZAA 1P05A 4JZ1A 4VGCC 2OQUA 1S82A 1UVSH 3RXVA 3T28A 4UD9H 3TVJB 2C90B 1VJAU 1XVOA 3MNXA 2H9EH 3MI4A 1D3PB 1Q2WA 3MH4A 1QURH 1V2MT 1GBDA 3SU6A 4ZXYH 3NXPA 1BRBE 2BD3A 2GD4B 1FJSA 1NS3A 2VVVA 3TJUA 1C5LH 2ZPRA 3SV2H 1ZYOA 1M9UA 3HKIB 5E0HA 4FUDA 3NWUA 1O3OA 4X6PA 1GJAB 3DA9B 5GDSH 5HGGA 1L1NA 2P3TB 1QFKH 3AW0A 1O5CB 5HXFA 2A2QH 4B76A 1FN8A 1LVMA 5FCRA 1EPTB 2ZEBA 4OS1A 3ZZ8A 1HB0B 3KEEA 3A7XA 3E91A 3QLPH 1DM4B 4FVBA 1GBMA 1ABJH 1V2WT 1GJCB 2CV3A 3EA8A 4DIHH 4YM9A 1DOJA 3M35A 3A83A 2WPMS 1P2JA 1YPMH 1GI3A 4MQAA 4TWWA 2ZECA 2G51A 4TPIZ 3B23B 4Y10E 4CRCA 4YESB 1BHXF 1ZGIA 3E8LA 3KIDU 4OGYA 1TNJA 3I77A 2G5VA 1MU8B 1P03A 1UK3A 1K22H 3TGJE 2AYWA 1ZOMA 1PQ7A 4UFDH 5ETXA 1P2OA 3H5CB 2VNTA 3ZVCA 3ZZ9A 3PWCA 1MUEB 2B0FA 3IWMA 3ZZ7A 2OC7A 4MNVA 1PQ8A 4FUCA 1IQMA 4CRGA 2ODPA 5T3HA 2VIVA 3NKKA 4D7GA 1TOCB 1E37B 2B5TB 4ABBA 1ZSLA 1H9IE 5JBAS 3SNEA 1HJAB 1B0FA 2ZDAH 2NU4E 5H4IB 6GCHF 5K0HA 2ZFFH 1BMAA 2ZQ2A 4I8KA 4O3TA 5LPFA 2FXRA 4K69A 3M7TA 3MOCA 5TCCA 1UVPA 1V2KT 1FNIA 1CHOG 4U30A 1ETTH 1GGDB 2H9HA 3HK3B 4X1QU 3NK8A 1OXGA 1YKTA 2BZAA 1ZTLA 1OYQA 4AYYB 4JYUH 1C1RA 1NFXA 1NTPA 5E0GA 4DT7B 1GWAA 2FOBA 4I8JA 3A81A 2I6QA 1O3FA 2QXIA 2XBVA 1UMAH 5DG6A 2BDCA 4F4OC 3MFJA 1BTUA 5EXMA 1VR1H 2GGVB 2ODQA 1AFQC 1DT2A 2ZU1A 4D7FA 2V3OH 1QL9A 5AFZH 1A5HA 1BTHH 1F0TA 1BTZA 2GCTC 1PPHE 2XWAA 3QWCH 2BDBA 2RA3A 1Z1IA 2TGPZ 4PROA 3EDXB 1PPGE 1LHGH 3BF6H 4ZHMU 1W0ZU 1SGFA 1HAIH 1AE5A 8LPRA 1PPZA 3P8FA 1JWTA 3V3MA 4ZUHA 2QXJA 1KTTB 1K21H 5TJXA 1A3BH 3FAOA 3F9HA 2CF9H 1P10A 1LDTT 2R2MB 1LPZB 3EGKH 4AFUA 1FN6A 1FXYA 3SBKA 1MH0A 1D3QB 4AFQA 1G2LA 1WOFA 5LH8A 1KDQB 1G2MA 4WVPE 5AVDA 4FU8A 1J17T 1FMGA 4Z0KA 5ABWA 4WXIA 2PV9B 5E2OA 1WCZA 3RMLH 4ABAA 1F5KU 4AZ2B 1NRQH 1EATA 1NFWA 4UFEH 2F91A 8GCHG 1S0QA 4ZHLU 3ZV8A 1UK4A 3RU4E 1EP5A 2H9TH 2ASUB 1PJPA 2FI5E 3UQOA 1KSNA 2XXLA 2ULLA 5HYOA 1GHYH 1YLDA 2ZTXA 3SUEA 2FOGA 1HAPH 5A0CA 2BTCE 5DP5A 4Y71A 1D9IA 3ZVEA 1DSUA 1S5SA 2ZC9H 4M7GA 5A8XA 1LVYA 2HNTC 2G55A 2HVXA 3A8CA 1SGCA 1BDAA 3ATLA 2D1JA 5T6DA 2FODA 1C5XB 2EI8A 3JZ2B 2PKSB 1SLUB 1LPKB 2OQ5A 1BUIA 5AHGH 4KP0A 3SUGA 1KXBA 2ZG0H 4ZKSU 2P8OB 3SU3A 1SVPA 2GZ9A 5C1UA 3GCHC 3P92A 1GBIA 2BX3A 1EQ9A 2VU8E 2JH5D 4YT6H 1CHOF 1O3HA 1ESTA 2AMDA 3Q77A 2RA0A 4ESTE 1JOUB 1P09A 2ZHQH 1O3DA 1YCPK 4DURA 1RXPA 3F1SB 2PWXA 3SNBA 2BDYA 1HJ9A 3RLWH 1XXFA 4Y6DA 1RIWC 4Y76A 1GHWH 3UNQA 4AG2A 3GICB 1SL3A 3QTOH 4YOJA 3VEQB 3KNXA 1T8OA 1ZHMA 2XBXA 3E6PH 1A0LA 3BSQA 4CBOA 1A0JA 1AVGH 1H9LB 4GHTA 1SMFE 3U1IB 3HGPA 5IDKA 1DY8A 1E36B 1UTMA 5E8EH 2J4IA 1GG6C 1GHAG 2WYJA 3O8RA 3E1XB 4I32A 3RXEA 5EQRA 4IS5A 1QRZA 1O2PA 4XDEA 3L6PA 1V2ST 1FPHH 2R3YA 1LHDH 2K1QA 1VCWA 5FBEA 3MH7A 3LGIA 1T7CA 1TBQH 1ESAA 1SLWB 3R0FA 3H7TA 3T25A 2NWNA 9ESTA 3FP8E 1C5ZB 2FPZA 3L3TA 3VPKA 1AMHA 5EQSA 1PYTC 2A7HA 1L0ZA 4AORA 2FX4A 3SUDA 4I8GA 2ZWLH 3RXAA 3RXTA 2STAE 4AFSA 4E7NA 2HLCA 3AW1A 3UPEA 1V2JT 3UUZA 1MTNB 3A85A 4FU9A 2W3KA 3QUMP 1GBTA 2J95A 1VZQH 1W7GH 4KGAA 1OP8A 1TGBA 1NRPH 4A1VA 5DP7A 1C5MD 2TBSA 2D26C 3SV9A 3B9FH 1P2IA 1KTSB 2ZO3H 3M5OA 3NZIA 1EAXA 1C5YB 1TRMA 3P70B 1D6RA 2ESTE 8GCHF 1EPTA 2STBE 1WQSA 1CBWC 2O8TA 2VWLA 2CGAA 2ZNKH 3QGNB 1LHEH 2G4TA 4A6LA 3QN7A 1O31A 3T2NA 4I7YH 4NFEA 4UE7H 3SV8A 1O3CA 3GCOA 4YOIA 1CT4E 5A09A 3ZZCA 1O2VA 1V6DA 3TGIE 3BTTE 4TYDA 4B1TA 1THRH 4ASHA 2ANWA 1OX1A 1UJ1A 2FLRH 4U2WA 1SGYE 1C5NH 5DP3A 1Z7KA 1VITH 1Y5UT 4ZXXH 2VGCB 3M7UA 3A7ZA 1O34A 1CA8B 2JH0D 3A87A 1BRAA 1O2JA 2QCYA 5PTPA 1V3XA 3P6ZB 1BQYA 1P04A 2QY0B 4NZLA 2TIOA 2GCTB 4R0IA 4YO9A 1GJDB 1G37A 4INLA 2ZP0H 1AUTC 1ELBA 1OWHA 1ARBA 3QGJA 1SHYA 1YCPH 4XE4A 1J9CH 5EOKA 3A80A 3U98H 2DUCA 4U01A 1W7XH 3SI4H 3CS7A 1E0FD 3PMBB 1WUNH 3C27B 4XBBA 3TK5A 4NGAH 1YPHC 4YOGA 2UWOA 4Y0YE 5DPAA 1P12E 1NU7B 1MKWK 1ELVA 1D3TB 4Y79A 3ZVBA 1IHSH 1LHCH 2BYAX 1HV7A 4BAMB 6LPRA 1CGJE 2SGPE 2BD4A 4Y7AA 4SGBE 1EASA 5BPEA 1IQGA 1ZPZA 1FY8E 1GHAF 3G01A 5A8YA 2ZFSA 2V6NA 1FI8A 3T26A 1FAKH 3GY8A 2G52A 1G36A 4ZKNU 2ZGBH 3PO1B 2HRVA 1AB9C 3LGUA 4UEHH 4BTTB 2Q6DA 3DT0H 1C2KA 3SHAH 2OD3B 1GJ6A 2EI7A 2F9PA 3MU8A 3RXCA 3PB1E 3RXLA 2GDEH 4IMZA 1IQFA 1NFUA 1P2QA 2QV1A 1GJ9B 2BDHA 3D65E 1W13U 1C5SA 5E2PA 4OS4A 5C1XA 3BIUH 1H8IH 4UDWH 4NWKA 2QXHA 1GBLA 5F03A 3SZNA 5J4SA 4QT8C 1BIOA 4A1TA 3TH3H 1OSSA 3ODFA 4Y8ZA 1CVWH 2UUFB 3ZZ6A 3GCNA 1AIXH 1Z6EA 1RJXB 3E0NB 2PGQB 4GHQA 2R0LA 1TWXB 2G4UA 2BB4A 5DK1A 3P17H 2BDGA 3GCHB 3RMMH 1GDQA 3RC5A 1F2SE 3RUOA 1QBOA 1F7ZA 1O3BA 3MMGA 4UFFH 1XMNB 1F5LA 1Y3YA 2G5NA 4A5TS 1JMOH 4HTCH 2QA9E 1JXPA 1QA7A 2ZGJA 4D76A 5AF9H 3LT3A 3D23A 3OSYA 4NA7A 3UTUH 1O2OA 2I6SA 5EXLA 5DGJA 1TX6A 1AWFH 1RIWB 4X8UH 1HAXB 1BRCE 3NUMA 4FUHA 2JETC 1ABIH 2EEKA 1EOJA 1CGIE 1C2LA 2VB0A 3T5FH 2G81E 2OC8A 1ID5H 1BBRE 3ATWA 3DFLA 2ZCLP 5DP8A 1GDNA 1G30B 1GG6B 2ILNA 1G9IE 1TMBH 2AGIX 3HKJB 1BTYA 2BY8X 1MZAA 2ZU5A 1LTOA 3V0XA 9LPRA 1ZTJA 2P59A 1GJ4H 4X1PU 1MKWH 3V12A 1ELFA 4X6MA 1OWIA 1DSTA 1S6HA 4CRFA 2ZPQA 4BANB 3SQEE 2IOTA 2PUXB 3TGKE 1XUGA 1SQTA 1YM0A 2BVRH 1SB1H 3LONA 1MD8A 3UREA 1AGJA 1B7XB 1MQ5A 1C2FA 3RDZA 2BD2A 1ETRH 1FONA 1J16A 3M37A 4FUJA 4MVNA 3LC5A 1TX8A 1GI8B 1NT1A 1GPZA 1ZMLA 3SO3A 3MH6A 3RXDA 6CHAB 2ZA5A 3PV4A 4CHAC 4HFPB 1S85A 4UONA 3PMJA 4FU7A 1V2PT 1SG8B 1W3CA 1O2LA 1JIMA 1QB1A 1ZLRA 1O3JA 4GSOA 1IOEA 3A7TA 2OBOA 2ZDNA 4FVDA 1DFPA 2ZF0H 2FIRH 5CHAB 2Y80A 2GMTB 1G3BA 1BBRH 1OPHB 3P95A 3ATIA 1QL8A 2CHAC 1TBZH 1P9SA 1MZDA 2J38A 1SI5H 1GCDA 3VFEA 7ESTE 2VVCA 1LVOA 1O36A 4MNXA 3IG6B 2VWMA 1ELTA 5L6NH 3E16B 2H6MA 2A4OA 2Z9JA 5T6FA 4JCNA 2GV7A 3VB7A 5CE1A 1A5GH 2DE8A 4YTAA 1TPPA 4K2YA 2Q6GA 3MWIU 4Q7XA 1Y5BT 1EZSC 3BG8A 3DFJA 2ZDLA 1ESBA 1GBHA 1P2MA 4DIIH 1A61H 1HXEH 2FOCA 1LKAA 3FP6E 4GLYA 2B7DH 2FOAA 1UK2A 2ZU2A 1RD3B 1Z8JB 1UTKA 4K1SA 3QTVH 2Y82A 1PQ5A 1O2TA 2BHGA 1FY3A 1HLTH 4AB8A 1FY4A 1MKXK 1TRYA 1V2TT 1C1PA 2QF3A 3SHCH 3E90B 4WWYA 2W7SA 2O9QA 3PTBA 1FV9A 1O3NA 2CMYA 2F3CE 3RXFA 1EJNA 3SI3H 5ESBA 1SGTA 1C5VA 1MBQA 1SHHB 1Z8GA 1ZPBA 1C4U2 3BTME 2XWBI 1GHZA 1F92A 5EQQA 2QYIA 3AAUA 3KHVA 2ZDVH 1OP0A 3TITA 1FIZA 2F9NA 2XNIA 4WJG2 5A0BA 3BIVH 5EW1H 2KAIB 1K1OA 1SFQB 4Y11E 4NIXA 1Y3XA 1FLEE 1G32B 1MTVA 3BTKE 1P02A 2TGTA 1Z6JH 2WV4A 3S9BA 2AEIH 1UTLM 1S81A 2ZIQH 4TWYA 3LJJA 4X1SU 1IQNA 1TRNA 1UVTH 3SUFA 1YPLH 1C1SA 3NCLA 1GVLA 4HI3A 3MH5A 3HGNA 1EZQA 1SPJA 1CA0C 1YPEH 3SU5A 2J92A 3SN8A 1HUTH 4Q2KA 1GI5A 3A88A 1DWCH 1IQLA 3TNTA 4CR5A 2PW8H 1O38A 1P06A 1ORFA 1K28D 3RXKA 1G3EA 1TNHA 1HAVA 2P94A 1QQ4A 2XW9A 3BG4C 1WV7H 1UCYK 3M5LA 4D8NA 3TJVA 1S6FA 3LH1A 1N8OC 1GJ5H 3T27A 4WH6A 8ESTE 1E38B 1Y3WA 3MU5A 2ANKH 1HIAA 1W10U 1NN6A 2ZHWH 1DXPA 4B2AA 1HRTH 5EPNA 2XBWA 3PROA 4OS5A 1A3EH 5I46H 5DP4A 1DS2E 3MYWA 1GMCG 3O8BA 2FP7B 4NSVA 1RGQA 4CREA 3KF2A 1JIRA 2OINA 1DX5M 1SOTA 1ZMJA 3ELAH 3SQHE 2P95A 4Y8YA 3SV7A 1GVZA 3LH3A 3VB5A 3CS0A 4INHA 4ZMAH 3RC4A 2PLXA 2FS9A 4IC6A 2VIQA 2BOHB 1C1QA 1SGNE 2EC9H 4MTBA 1XUKA 4CRDA 5J4QA 5DP6A 3VGCB 3PMHB 3ZZDA 3A7WA 3OYPA 2FOMB 7GCHG 4LXBH 2ZTYA 1TQ0B 1DWDH 2BLOA 2QN5T 4X1RU 3RXPA 3TU7H 4CR9A 5C3NA 4O97A 1FY1A 2Z3DA 1FPCH 1DLEA 1EB1H 3ZVFA 1BTPA 2BLQA 1MKXH 2FOHA 1PQAA 1EP6A 3SJ9A 3RXJA 1SGIB 2C93B 1T31A 4JMYA 4WH8A 1KY9A 3VB6A 2F9UA 1O2GH 2PSYA 1SOZA 2JKHA 4NIWA 1N6YA 2HOBA 4MPUA 2V3HH 2XTTB 3V13A 1BA8B 4K1EA 1XKBC 3LC3A 1NZQH 1HJ8A 2TPIZ 1WSSH 1DUAA 2OP9A 3U1JB 2YNAA 3A7VA 1TGSZ 2AMQA 4RKJB 5C5OA 3RMOH 4ABEA 3Q3YA 3CENA 1INCA 1YBWA 2NU1E 3BTHE 4JZFH 3FANA 1O37A 1Q31A 4VGCB 1WAYB 3OU0A 1FIWA 3T29A 4GVUA 1DLKB 2ALPA 1PPCE 1QBVH 3LU9B 3W94A 2A1DB 1V2VT 3SNDA 4CHAB 1ZGVA 3B8JA 3MO9A 4Y7BA 4KTSA 3M61U 4NCYA 1DE7H 1P9UA 3RXSA 2VINA 2CN0H 5EPYA 1H1BA 3TPIZ 4RN6A 5SGAE 3IITA 2G8TA 5E0JA 2BQWB 1KXCA 2HNTE 4BAHB 4AB9A 1Z71A 5FAHA 2CHAB 1UHBB 1AWHB 2O8WA 5ESTE 1NESE 2GKVE 1LHFH 1C1VH 5BRRE 1KXDA 2OC1A 1ZMNA 4ABHA 1H4WA 4CRBA 1ZHRA 3PLBA 1UCYH 3S9AA 1EAUA 1MTWA 4B75A 1CT2E 1XUIA 2ZCHP 2BOKA 3NPSA 4MNYA 4MNWA 4NIVA 1EAWA 3VB3A 1P01A 1XUHA 4BXWA 4MPXA 1DY9A 2ZFRH 4B2BA 1LVBA 5LPRA 2Z6BD 1N1LA 1Y3UA 1UTOA 1V2OT 2PUQH 3VXEH 2P3UB 1DUEA 1K1PA 1BRUP 2B8OH 3RXHA 4X2YA 3SJKA 1W11U 2BX4A 2C8XB 1HCGA 3SORA 1HNEE 1SGPE 1MMJN 2NU2E 2W5EA 2A4RA 1GL0E 3GYMA 1G3DA 1KXFA 4BAKB 1C9TA 4X6OA 1O2RA 1G3CA 3GYLB 2M5TA 2PTCE 2R2WU 1UTJA 4LZ1H 1ZPCA 2HPPH 1TMTH 2BD8A 1GJBB 2HALA 1OP2A 1NRRH 4H4FA 2GT8A 2A5KA 4DCDA 5JBCS 5L30H 1OWEA 3MNBA 7GCHF 2XRCA 4D9QA 1MAYA 2HWLB 2J9NA 1ACBE 4H6TA 2R9PA 2WV5A 1TE0A 1TOMH 4J1YA 4Y0ZE 3HK6B 4WMFA 4JZEH 3ZZ4A 2BZ6H 3H7OA 4I8LA 3TJOA 2ZTZA 1WTHD 1NY22 2V0BA 4O9VA 4NA9H 3ZV9A 1BJVA 1D4PB 2Z3CA 4OS2A 4B2CA 1GHVH 1VJ9U 2ZDMA 1O5DH 1OWJA 3MTYA 1HYLA 4X1NU 4WY3A 3ZVAA 4KKDA 7KMEH 4U32A 4FUGA 3U8TH 1AU8A 1EXFA 1CT0E 4FUFA 4X6NA 3BN9A 3FVFB 4J2YB 2VJ1A 2ZI2H 3I78A 1GBCA 2ALVA 1ZJKA 3SNAA 1TPSA 3RXBA 3Q76A 2FOFA 1BITA 1LQEA 1XX9A 1T4UH 4Q7ZA 3LGVA 3SJOA 1C2EA 1J8AA 4X8VH 1CA0B 1GI9B 1O32A 1RFNA 2BY6X 4K60A 3C1KA 1K2I1 1C2HA 1AFQB 1ANCA 2FI4E 3BG4B 4YLUA 1T32A 2BMGB 1P3CA 1WU1A 2Y81A 3UY9A 1L4ZA 1AZZA 2F9VA 3WY8A 1XXDA 1C5PA 3AVZA 3S7HB 4DJZB 1PPBH 4K3JA 2WPIS 1QJ7B 1ZR0A 4IC5A 2BDAA 5EU8A 1HAVB 3UWJH 1SFIA 3MU0A 1EB2A 1JRSA 5FCKA 1GI7B 1SGDE 1SC8U 2VIPA 1VITG 1F5RA 2HGTH 3EYDA 2F9BH 3M5MA 5EW2H 3RXQA 1BTWA 4YZUA 1TABE 1HIAB 1ELCA 2KAIA 1T4VH 4XFQA 1UO6A 1SSXA 1TALA 4FUIA 3RXOA 4ABIA 5DJ7A 5A8ZA 5FBIA 1GMHG 1NRSH 2ZFQH 1P3EA 2PSXA 1P11E 1AY6H 3A8DA 4K5ZA 1O5AB 1FUJA 1ZRBA 3PLKA 2Y7XA 3E3TA 2Q1JA 1L1JA 2QAAA 1YPHE 3M5NA 4WF8A 1GBEA 1OWKA 2AERH 1MTUA 3L33A 1HAOH 5F8TA 1LPGB 3U8RH 1IAUA 1HJAC 4H42U 2GVFA 5JPMH 1ZJDA 1B5GH 4E06H 1O5BB 2PTNA 4DW2U 1SBWA 1O3PB 3GY2A 4SGAE 1GBJA 2Y5FA 4AYVB 1TYNA 1KIGH 3FFGA 3MO6A 3RXIA 2J34A 2WYGA 1DITH 4AG1A 4GPGA 1UTNA 5GCHG 1ETSH 4ZKRU 1TIOA 5EG4A 1XUJA 4Q80A 3KGPA 1UVUH 2OUAA 3BTEE 5C2ZA 3KN2A 2IJOB 3OX7U 5LPEA 2Z3EA 4BAQB 3PTNA 3SV6A 3GY4A 4HZHA 1QTFA 3LDXH 4WMEA 2Z94A 3GDUA 3ZVGA 1YLCA 1GHBG 4INKA 2O8LA 1YPKH 3LOXA 1TAWA 2A4QA 1O0DH 1TB6H 3TK9A 3W95A 4OS7A 1OWDA 1VGCC 1QHRB 2FTMA 1ARCA 3RU4D 1GI0A 1Y59T 3BEFB 1P2KA 4X2WA 1H8DH 3VXFH 4AOQA 1WQVH 1K1LA 2TRMA 2HNTF 5LGOA 2ZHFH 1BB0B 2EA3A 3GY6A 2GV6A 3KQDA 1WBGB 1THPB 3A89A 3U9AH 1O35A 4AGJA 1O3LA 2BD7A 2AH4X 1C2DA 3RM2H 3RLYH 2A45B 1EZUC 2H1UA 3RXUA 1P2NA 3LPRA 3BTFE 2WUBA 4XBCA 3A86A 3P8GA 3SW2B 1C2IA 1HAZB 3K6ZA 4IW4E 3R3GB 2VIOA 2ODYB 2YNBA 2A7CA 3MU1A 1C1UH 5EXNA 1O5EH 3MHWU 4ISHH 1IQEA 1SGRE 1SQOA 3D49H 5L2YH 3S69A 3ZVDA 1CSOE 1ANBA 1KYNA 2SFAA 1TBRH 2UWPA 1HBTH 1D3DB 3DD2H 2FYRA 1A1RA 1GI4A 1TNIA 1TA2A 1A46H 2A32A 2BY7X 3EA7A 3JZ1B 3A84A 4X2XA 2FTLE 1WYKA 2UUYA 1O3AA 1JRTA 2BM2A 1QA0A 3UOUA 3MO3A 1C4Y2 1O2HA 2ZFPH 1XKAC 1KLTA 3DHKH 3ZZ5A 1EKBB 3GISB 2PHBA 1VITF 3HATH 3BEIB 4ZAEA 5FPTA 3O8CA 2VWOA 5JBTA 1P0SH 3GDSA 1LMWB 3UWIA 3BEUA 4KTCA 1W8BH 5F6MA 1T8NA 4E7RG 1GMHF 3GOVB 1BTXA 1GI2A 2WPHS 1O2YA 3HPTB 3PWBA 3KQCA 4BNRA 1BCUH 4KTUA 2AMPA 1C5TA 1PPEE 3M7QA 1A7SA 2FESH 1UHBA 2THFB 2UWLA 1SLVB 3K2UA 2OBQA 3AAVA 3BTDE 1C2JA 1ELAA 2VWNA 2WINI 1AO5A 2H5CA 5EGMA 1QR3E 2PKSC 2FI3E 1CBWB 4MDSA 1ZSKA 2UUKB 2P8OC 1AFEH 4ISLA 5EODA 5IYTA 3S0NA 1HPGA 1XUFA 3KQBA 1QY6A 2DE9A 2CJIA 4XBDA 5GCHF 2P3FH 1QRWA 1O33A 4WXVA 1CGHA 5FXLA 2SGQE 1YPGH 1O3GA 3MNCA 1KXAA 1IQHA 1V2QT 1Y5AT 3TH2H 3M3VA 1CO7E 1TNKA 2SGFE 1TQ7B 3T62A 1BHXB 1GHBF 1Q3XA 1FAXA 2A4GA 6ESTA 3SGBE 3RMNH 4DG4A 5T6GA 5FX6A 1Z8IB 1YYY1 5JBBS 2ZU4A 1IHTH 2AS9A 1THSH 1MQ6A 1AVXA 1Y3VA 2O8MA 2YOLA 4AN7A 2ANYA 3SOSA 1EOLA 1PYTD 1A0HB 1TX7A 3N7OA 3SGAE 3FZDA 3SJIA 2Z9KA 1OYTH 1MBMA 1T8MA 5JYIA 3RU4T 3P8NA 1NC6A 3S9CA 2XYAA 1IQIA 2IPHA 3O8DA 1NU9A 1DDJA 1H9HE 2ANMH 3BTWE 4FUEA 3KL6A 4ABGA 1CHGA 2A7JA 4ZKOU 3TK6A 3F6UH 3QZQA 2BLVA 2Z9GA 5HM2A 2FWWA 1O2UA 1O39A 5CMXH 1A5IA 3QK1A 3URDA 1C9PA 2GCHG 3LIWA 1GBAA 2Z7FE 1MCVA 1F0RA 1V2NT 1MTNC 2SNVA 1AB9B 2F83A 2XC0A 2H5DA 4HGCA 2ZFTA 1K1IA 2OC0A 1GBBA 5AFYH 4DOQA 1BJUA 1RTLA 1ZTKA 1HFDA 1PFXC 2C8YB 2CF8H 2FEQH 3GY3A 1C4V2 1YCPM 4BTIB 1YP9A 1SR5C 4I8HA 1W14U 1FQ3A 4WMDA 1GI6A 4NA8A 4A92A 1DWEH 1RRKA 1KLJH 4A7IB 2BXTH 2ZDKA 3CP7A 1OS8A 1QL7A 3LGTA 1F0SA 4IN1A 1XVMA 3UIRA 3BTGE 3LGYA 1E35B 1TFXA 3A7YA 5TCAA 2A2XH 1O2SA 5DP9A 3SJ8A 1AKSB 1C2GA 1ELEE 4ZH8A 4LK4A 1NFYA 2VGCC 3E0PB 1GDUA 3ZYEA 5B6OA 5FPSA 2D2DA 1O2QA 1U6QA 1C2MA 1AD8H 1MU6B 2WUCA 1VGCB 4IMQA 1PPFE
chains in the Genus database with same CATH superfamily
4TY7A 2EI6A 2JH6D 2ZPSA 4B73A 5GPIB 3V7TA 1AVWA 1QBNA 1HDTH 1IQKA 2TGDA 5F8ZA 1LKBA 1OKXA 3Q3XA 3S7KB 4X2VA 4ISIH 2FM2A 4X8TH 1O5GH 2JETB 1ELDE 1MCTA 4NG9H 4K1TA 4ABJA 3GY7A 1QGFA 1GL1A 1DVAH 1FZZA 2AIQA 3OTJE 2W3IA 2JJ2D 1O3EA 1AHTH 4XOJA 4JZIA 3K65B 2CK3D 4ASUD 3ZZ3A 3U69H 1EUFA 5GWZA 1BMNH 3TJNA 3F68H 1TPAE 3STIA 2D8WA 1C5OH 1UCYE 1C5RA 4AGKA 2VVUA 1NPMA 3PO1C 1O2IA 1BZXE 4LOYH 4NFFA 1DXWA 2OTVA 4Q7YA 2TGAA 5GIBA 3I29A 4I31A 1O2ZA 1V2RT 1KLIH 3SU1A 2XCFA 1AZ8A 1C1TA 1SGEE 2KX4A 2BVSH 2FO9A 1FY5A 1QJ1B 3ZZBA 1ANEA 1EX3A 1T8LA 3EA9A 2FZZA 5JB9S 4B6EA 4RSPA 2ZGHA 2FX6A 3F2HA 1ZZZA 3UNRA 4K8BA 1SGQE 2IJD1 1J15A 2GCHF 1BOQA 2C8ZB 4MPVA 1TGNA 4CRAA 4XRNA 2Z9IA 1A2CH 1NO9H 4JK5A 1QQUA 2AIPA 2XCNA 3MU4A 1QB9A 2ZGCA 3SU2A 3M3SA 3SU4A 2PKAB 1O2XA 2XBYA 1EZXC 5DO4H 4FUBA 2J2UA 2VIDA 1GJ8B 5G4BA 1O3KA 1TMUH 2J94A 3LGWA 4IGDA 1A4WH 2O8UA 4NZQA 5CDFE 1C1OA 4DVAU 4I33A 1H8ED 2Y5HA 3OEHD 1EAIA 3ATKA 3GDVA 1S84A 3SU0A 3UR6A 3QDZB 5C1YA 1ZSJA 3M3TA 3KCGH 3RXRA 2GZ8A 1NRNH 1L1GA 5I25A 3KYFA 3F2GA 3OFND 3PYHA 3A8AA 3BV9B 1S83A 1HXFH 2FDAA 1GMCF 5JDUB 1AE8H 4TY6A 2GZ7A 2P16A 3ATMA 1P57B 4X8SH 3OY5U 5HKKD 2WPJS 1K9OE 1BT7A 1W0YH 2BXUH 5HM9A 3ITIA 1GCTC 2ZQ1A 2CXVA 3OY6U 2ZHDA 1UTQA 2LPRA 2ZU3A 3TH4H 1K1MA 7LPRA 4DY7B 2OXSA 4IN2A 5GXPA 4ABDA 1E34B 3PM3A 3EAJA 5DKMA 3ESTA 1TA6A 1YF4A 3ZYDA 1F0UA 4A1XA 1ANDA 1EJAA 3SGQE 4MPWA 2B9LA 2OCVB 2UUJB 2R0KA 1SGFG 1RTFB 5FHTA 2RCEA 1O30A 3UR9A 3MQKC 3KQ5A 4NIYA 4FXGH 2AFQB 3M36A 3K9XB 3QX5H 1SQAA 2GX4A 4YXWD 2SNWA 1V2UT 2PGBB 1UTPA 6CHAC 1AI8H 4ISOA 3UNSA 3F9GA 2A5IA 4NSYA 2Y5GA 2HPQH 4AFZA 2QXGA 2BQ7B 2VIWA 4Z6AH 1YC0A 3A8BA 3K6YA 4D9RA 1TGCA 3BTQE 1O3MA 4F49A 1HGTH 2QIQA 1CQQA 2V35A 5CHAC 3MNSA 2GMTC 2LNCA 1ELGA 1GMDG 1GJ7B 3F9EA 2C3SA 1OOKB 2V7QD 4H6SB 2AGEX 3SNCA 1S0RA 1QRXA 2GDDA 2PR3A 5GJ4B 5C20A 2WPKS 1N8OB 1BMLA 1EPTC 1O3IA 4MLFB 2XC4A 5GNDA 3RXGA 4OS6A 1Z8RA 1FDPA 4GCHG 4NWLA 1LCYA 3QZRA 3RXMA 1K1JA 1LO6A 3GCTG 2SGEE 4JYTA 4BTUB 1L2EA 1QB6A 1Z1JA 1X7AC 2ZKSA 2A5AA 1TPOA 3STJA 1TNGA 1RTKA 4OGXA 4ACBA 2SGAA 1AUJA 1QIXB 1JBUH 2R3UA 3TIUA 1BMMH 1O2KA 1XM1A 1N6XA 2GP9B 2W7UA 2FOEA 3KQEA 2KCYA 1J14A 2FLBH 2A31A 3AASA 5K7RA 2ZHEH 1QJ6B 3P8OA 1V2LT 2IN2A 4LZ4B 2AGGX 4THNH 1IQJA 3UQVA 4BXSA 2RDLA 4GAWA 3UFAA 4DT4A 1NBME 1HAHH 1DWBH 1NM6A 2QGRA 1DPOA 1MAXA 1MD7A 2C4FH 2VH6A 4K8YA 2GTBA 1YGCH 2SGDE 4XSKU 3PMAB 1O5FH 2NU3E 2QC2A 1MTSA 1ZRKA 1YPJH 4CBNA 4Y8XA 3EE0B 1O2NA 4JK6A 5F8XA 3TNSA 3UOPA 1DANH 2P93A 4F55A 4UFGH 1NROH 1AKSA 3VB4A 3LKWA 1GVKB 5FPYA 1GGDC 2BLWA 3A82A 3FP7E 2C8WB 5JB8S 5C67A 3QO6A 4IBLH 1CU1A 1C1NA 4O03A 4JZDH 2W26A 2NU0E 1GBKA 3DUXH 3F9FA 1VCPA 1TLDA 1SQRA 1K1NA 1BBRK 1C5QA 3RC6A 4X0WU 4B71A 1AQ7A 5FX5A 2FYQA 3EQ0H 2BQ6B 1HAGE 2FS8A 1W12U 3Q00A 1Y8TA 1B0EA 3ODDA 1GI1A 2GT7A 1KXEA 5HMAA 3TLOA 3U8OH 1TNLA 5F53A 5A0AE 1C5UA 4ZROA 4FOUC 1VCQA 1ZHPA 4R8TB 3Q3KA 2EY4C 1GMDF 3RP2A 4BOHA 2BY9X 3ENSB 2H2ZA 2ZCKP 4ISNA 1GBFA 1YLNA 4O3UA 4P00A 1WTGH 4BAOB 2RG3A 2XC5A 4CH8B 1KDQA 1QCPA 1H8HD 1GHXH 1L4DA 2Y6TA 2F9OA 3FZZA 8KME2 1C5WB 1AN1E 1DICA 1UVOA 4GCHF 5C5NA 2Q6FA 1O2WA 1HAYB 4ZHAA 4AX9H 2BDIA 1LQDB 2G00A 3EE7A 3VGCC 2FMJA 1C1MA 3GCTF 5DN6D 2ZGXH 4JYVH 2BD5A 2ZZUH 1TGTA 3RM0H 1CE5A 1RS0A 5L2ZH 1O2MA 4YT7H 1D6WA 2Z9LA 4ABFA 4TPYA 2BVXH 1GCTB 2PFEA 1QNJA 2VH0A 2BY5X 1EJMA 3GY5A 4DGJA 6GCHG 1SLXB 3N99A 2A0QB 5A2MH 4E05H 2OLGA 4Q4LA 2WPLS 1TONA 4RKOB 2PKAA 3URCA 4KELA 4GUXA 3LJOA 4B74A 2QF0A 4CH2B 1C1WH 2BD9A 2Y7ZA 3D62A 3WWFA 3PLPA 1W2KH 4YLQH 1P8VC 4MG3A 3ZZAA 1P05A 4JZ1A 4VGCC 2OQUA 1S82A 1UVSH 3RXVA 3T28A 4M9FA 4UD9H 3TVJB 2C90B 1VJAU 1XVOA 3MNXA 2H9EH 3MI4A 1D3PB 1Q2WA 3MH4A 1QURH 1V2MT 1GBDA 3SU6A 4ZXYH 3NXPA 3WWBA 1BRBE 2BD3A 1MABB 2GD4B 1FJSA 1NS3A 2VVVA 3TJUA 1C5LH 2ZPRA 3SV2H 1ZYOA 1M9UA 3NRLA 3HKIB 4OM9A 5E0HA 4FUDA 3NWUA 1O3OA 4X6PA 1GJAB 3DA9B 5GDSH 5HGGA 1L1NA 2P3TB 1QFKH 3AW0A 1O5CB 5HXFA 2A2QH 4B76A 1FN8A 1LVMA 5FCRA 1EPTB 2ZEBA 4OS1A 3ZZ8A 1HB0B 3KEEA 3A7XA 3E91A 3QLPH 1DM4B 4FVBA 1GBMA 1ABJH 1V2WT 1GJCB 2CV3A 3EA8A 4DIHH 4YM9A 1DOJA 3M35A 3A83A 2WPMS 1P2JA 1YPMH 1GI3A 3DCLA 4MQAA 4TWWA 2ZECA 2G51A 4TPIZ 3B23B 4Y10E 4CRCA 4YESB 2KCOA 1BHXF 1ZGIA 3E8LA 2YMSB 3KIDU 4OGYA 3ZIAD 1TNJA 3I77A 2G5VA 1MU8B 1P03A 1UK3A 2PP6A 1K22H 3TGJE 2AYWA 1ZOMA 1PQ7A 4UFDH 5ETXA 1P2OA 3H5CB 1COWD 2VNTA 3ZVCA 3ZZ9A 3PWCA 1MUEB 2B0FA 3IWMA 2KFWA 3ZZ7A 2OC7A 4MNVA 1PQ8A 4FUCA 1IQMA 4CRGA 2ODPA 5T3HA 2VIVA 3NKKA 4D7GA 1TOCB 1E37B 2B5TB 4ABBA 1ZSLA 1H9IE 5JBAS 3SNEA 1HJAB 1B0FA 2ZDAH 2NU4E 5H4IB 6GCHF 5K0HA 2ZFFH 1BMAA 2ZQ2A 4I8KA 4O3TA 5LPFA 2FXRA 4K69A 3M7TA 3MOCA 5TCCA 1UVPA 1V2KT 1FNIA 1CHOG 4U30A 1ETTH 1GGDB 2H9HA 3HK3B 4X1QU 3NK8A 1OXGA 1YKTA 2BZAA 1ZTLA 1OYQA 4AYYB 4JYUH 1C1RA 1NFXA 1NTPA 5E0GA 1S6LA 4DT7B 1GWAA 2FOBA 4HG6A 4I8JA 3A81A 2I6QA 2JDID 1O3FA 2QXIA 2XBVA 1UMAH 5DG6A 2BDCA 4F4OC 3MFJA 1BTUA 5EXMA 1VR1H 2GGVB 2ODQA 1AFQC 1DT2A 2ZU1A 4D7FA 5IK2D 2V3OH 1QL9A 5AFZH 1A5HA 1BTHH 1F0TA 1BTZA 2GCTC 1PPHE 2YMSD 2XWAA 2RFKC 3QWCH 2BDBA 2RA3A 1Z1IA 2TGPZ 4PROA 5HIYA 3EDXB 1PPGE 1LHGH 3BF6H 4ZHMU 1W0ZU 1SGFA 1HAIH 1AE5A 8LPRA 1PPZA 3P8FA 1JWTA 3V3MA 4ZUHA 2F43B 2QXJA 2K0QA 1KTTB 1K21H 5TJXA 2L74A 1A3BH 3FAOA 3F9HA 1BMFD 2CF9H 1P10A 1LDTT 2R2MB 1LPZB 3EGKH 4AFUA 1FN6A 1FXYA 3SBKA 2F4LA 1MH0A 1D3QB 4AFQA 1G2LA 1WOFA 5LH8A 1KDQB 1G2MA 4WVPE 5AVDA 4FU8A 1J17T 1FMGA 4Z0KA 5ABWA 1YWUA 4WXIA 2PV9B 5E2OA 1WCZA 2HVYB 3RMLH 4ABAA 1F5KU 2KCAA 2XOKD 2L6OA 4AZ2B 1NRQH 1EATA 1NFWA 4UFEH 2F91A 8GCHG 1S0QA 4ZHLU 3ZV8A 1UK4A 3RU4E 1EP5A 2H9TH 2ASUB 1PJPA 2FI5E 3UQOA 1KSNA 2XXLA 2ULLA 5HYOA 1GHYH 1YLDA 2ZTXA 3SUEA 2FOGA 1HAPH 2LP6A 5A0CA 2BTCE 5DP5A 4Y71A 1D9IA 1E1RD 3ZVEA 1DSUA 1S5SA 2ZC9H 4M7GA 5A8XA 1LVYA 2HNTC 2G55A 2HVXA 3A8CA 1SGCA 1BDAA 3ATLA 2D1JA 5T6DA 2FODA 1C5XB 2EI8A 3JZ2B 2PKSB 1SLUB 1LPKB 2OQ5A 1BUIA 5AHGH 4KP0A 5HIZA 1KXBA 2ZG0H 4ZKSU 3SUGA 2P8OB 3SU3A 1SVPA 2GZ9A 5C1UA 3GCHC 3P92A 1GBIA 2BX3A 1EQ9A 2VU8E 2JH5D 4YT6H 1CHOF 1O3HA 1ESTA 2KZ4A 2AMDA 3Q77A 2RA0A 4ESTE 1JOUB 1P09A 2ZHQH 1O3DA 1YCPK 4DURA 1RXPA 3F1SB 2PWXA 3SNBA 2BDYA 1HJ9A 3RLWH 1XXFA 4Y6DA 1RIWC 4Y76A 1SKYE 1GHWH 4I86A 3UNQA 4AG2A 3GICB 1SL3A 3QTOH 4YOJA 3VEQB 3KNXA 1T8OA 1ZHMA 2XBXA 3E6PH 3FN8A 1A0LA 3BSQA 2QF4A 4CBOA 1A0JA 1AVGH 1H9LB 4GHTA 1SMFE 3U1IB 3HGPA 5IDKA 1DY8A 1E36B 1UTMA 5E8EH 2J4IA 1GG6C 1GHAG 2WYJA 3O8RA 3E1XB 4I32A 3RXEA 3VG8A 2W6JD 5EQRA 4IS5A 1QRZA 1O2PA 4XDEA 3L6PA 1V2ST 1FPHH 2R3YA 3UAIC 1LHDH 2K1QA 1VCWA 4RT1A 5FBEA 3MH7A 3LGIA 1T7CA 1TBQH 1ESAA 1SLWB 3R0FA 3H7TA 3T25A 2NWNA 9ESTA 3FP8E 1C5ZB 2FPZA 3L3TA 3VPKA 1AMHA 5EQSA 1PYTC 2A7HA 5KGOA 1L0ZA 4AORA 2FX4A 3SUDA 4I8GA 2ZWLH 3RXAA 3RXTA 2STAE 4AFSA 4E7NA 2HLCA 4P02A 3AW1A 3UPEA 1V2JT 3UUZA 1MTNB 3A85A 4FU9A 2W3KA 3QUMP 1GBTA 2J95A 1VZQH 1W7GH 4KGAA 1OP8A 1TGBA 1NRPH 4A1VA 5DP7A 1C5MD 2TBSA 2D26C 3SV9A 2XNDD 3B9FH 1P2IA 1KTSB 2ZO3H 3M5OA 3NZIA 1EAXA 1C5YB 5EJZA 1WDIA 5CHBA 1TRMA 3P70B 1D6RA 2ESTE 8GCHF 1EPTA 2STBE 1WQSA 1CBWC 3F0PA 2O8TA 2VWLA 2CGAA 2ZNKH 1KMHB 3QGNB 5EJLA 1LHEH 1E79D 2G4TA 2OK5A 4A6LA 3QN7A 1O31A 3T2NA 4I7YH 4NFEA 3KYGA 4UE7H 3SV8A 1O3CA 3GCOA 3OEED 4YOIA 1CT4E 3F2FA 5A09A 3ZZCA 1O2VA 1V6DA 3TGIE 3BTTE 4TYDA 4B1TA 1THRH 4ASHA 2ANWA 1OX1A 1UJ1A 2FLRH 4U2WA 1SGYE 5T1VA 1C5NH 5DP3A 1Z7KA 1VITH 1Y5UT 4ZXXH 2VGCB 3M7UA 3A7ZA 1O34A 4F48B 1CA8B 2JH0D 3A87A 1BRAA 1O2JA 2QCYA 5PTPA 1V3XA 3P6ZB 1BQYA 1P04A 2QY0B 4NZLA 4TT3D 2TIOA 2GCTB 4R0IA 4YO9A 3DSOA 1GJDB 1G37A 4INLA 2ZP0H 1AUTC 1ELBA 1OWHA 1ARBA 3QGJA 1SHYA 2WHXA 1YCPH 4XE4A 1J9CH 5EOKA 3A80A 3U98H 2DUCA 4U01A 1W7XH 3SI4H 3CS7A 1E0FD 3PMBB 1WUNH 3C27B 4XBBA 3TK5A 4NGAH 1YPHC 4YOGA 2UWOA 4Y0YE 3W1EA 5DPAA 1P12E 1NU7B 1MKWK 1ELVA 1D3TB 4Y79A 3ZVBA 1IHSH 1LHCH 2BYAX 1HV7A 4BAMB 6LPRA 1CGJE 5DSFA 2SGPE 2BD4A 4Y7AA 4SGBE 1EASA 5BPEA 1IQGA 1ZPZA 1FY8E 1GHAF 3G01A 5A8YA 2ZFSA 2V6NA 1FI8A 3T26A 1FAKH 3GY8A 2G52A 1G36A 4ZKNU 2ZGBH 3PO1B 2HRVA 1AB9C 3LGUA 4UEHH 4BTTB 2Q6DA 3DT0H 1C2KA 3SHAH 2OD3B 1GJ6A 2EI7A 2F9PA 3MU8A 3RXCA 3PB1E 3RXLA 2GDEH 4IMZA 1IQFA 1NFUA 1P2QA 2QV1A 1GJ9B 2BDHA 3OTPA 3D65E 1W13U 1C5SA 5E2PA 2J97A 4OS4A 5C1XA 3BIUH 1H8IH 4UDWH 4NWKA 2QXHA 1GBLA 5F03A 3SZNA 5J4SA 4QT8C 1BIOA 4A1TA 3TH3H 1OSSA 3ODFA 4Y8ZA 1CVWH 2UUFB 3PV5A 3ZZ6A 3GCNA 1AIXH 1Z6EA 1RJXB 1EFRD 3E0NB 2PGQB 4GHQA 2R0LA 3F3BA 1TWXB 2G4UA 2BB4A 5DK1A 3P17H 2BDGA 3GCHB 3RMMH 1GDQA 3RC5A 1F2SE 3RUOA 1QBOA 1F7ZA 1O3BA 3MMGA 4UFFH 1XMNB 1F5LA 1Y3YA 2G5NA 4A5TS 1JMOH 4HTCH 2QA9E 1JXPA 1QA7A 2ZGJA 4D76A 5AF9H 3LT3A 3D23A 3OSYA 4NA7A 3UTUH 1O2OA 2I6SA 5EXLA 5DGJA 3AK5A 1TX6A 1AWFH 1RIWB 4X8UH 1HAXB 1BRCE 3NUMA 4FUHA 2JETC 1ABIH 1YY3A 2EEKA 1EOJA 1CGIE 1C2LA 2VB0A 3T5FH 2G81E 2OC8A 1ID5H 1BBRE 3ATWA 3DFLA 2ZCLP 5DP8A 1GDNA 3SZEA 1G30B 1GG6B 2ILNA 1G9IE 1TMBH 2AGIX 3HKJB 1BTYA 2BY8X 1MZAA 2ZU5A 1LTOA 3V0XA 9LPRA 1ZTJA 2P59A 1GJ4H 4X1PU 1MKWH 3V12A 1ELFA 4X6MA 1OWIA 1DSTA 1S6HA 4CRFA 1E1QD 2ZPQA 4BANB 3SQEE 2IOTA 2PUXB 3TGKE 1XUGA 1SQTA 1YM0A 2BVRH 1SB1H 3LONA 1MD8A 3UREA 4FETA 1AGJA 4TSFD 1B7XB 1MQ5A 1C2FA 2J5UA 3RDZA 2BD2A 1ETRH 1FONA 1J16A 3M37A 4FUJA 4MVNA 2VBCA 3LC5A 1TX8A 1GI8B 1NT1A 1GPZA 1ZMLA 3SO3A 3MH6A 3RXDA 6CHAB 2ZA5A 3PV4A 4CHAC 4HFPB 1S85A 4UONA 3PMJA 4FU7A 1V2PT 1SG8B 1W3CA 1O2LA 1JIMA 1QB1A 1ZLRA 1O3JA 4GSOA 1IOEA 3A7TA 2OBOA 2ZDNA 4FVDA 1DFPA 2ZF0H 2FIRH 5CHAB 2Y80A 2GMTB 3H09A 1G3BA 1BBRH 1OPHB 3P95A 3ATIA 1QL8A 2CHAC 1TBZH 1P9SA 1MZDA 2J38A 1SI5H 1GCDA 3VFEA 7ESTE 2VVCA 1LVOA 1O36A 4MNXA 5FL7D 3IG6B 2VWMA 1ELTA 5L6NH 3E16B 2H6MA 2A4OA 2Z9JA 5T6FA 4JCNA 2GV7A 3VB7A 5CE1A 1A5GH 3SYJA 2DE8A 4YTAA 1TPPA 4K2YA 2Q6GA 3MWIU 4Q7XA 1Y5BT 1EZSC 3BG8A 2QE7D 3DFJA 2ZDLA 1ESBA 1GBHA 4RI0A 1P2MA 4DIIH 1A61H 1HXEH 2FOCA 1LKAA 3FP6E 4GLYA 2B7DH 2FOAA 1UK2A 2ZU2A 1RD3B 1Z8JB 1UTKA 4K1SA 3QTVH 2Y82A 1PQ5A 1O2TA 2BHGA 2KR7A 1FY3A 1HLTH 4AB8A 1FY4A 1MKXK 1TRYA 1V2TT 1C1PA 2QF3A 2KM0A 3SHCH 3E90B 4Q63A 4WWYA 2W7SA 2O9QA 3PTBA 1FV9A 1O3NA 2CMYA 2F3CE 3RXFA 1EJNA 3SI3H 5ESBA 1SGTA 1C5VA 1MBQA 1SHHB 1Z8GA 1ZPBA 1C4U2 1W0JD 3BTME 2XWBI 1GHZA 1F92A 5EQQA 2QYIA 3AAUA 3KHVA 2ZDVH 1OP0A 3TITA 1FIZA 2F9NA 2XNIA 3OAAD 4WJG2 5A0BA 3BIVH 5EIYA 5EW1H 2KAIB 1K1OA 1SFQB 4Y11E 1K0HA 4NIXA 1Y3XA 1FLEE 1G32B 1MTVA 3BTKE 1P02A 2TGTA 1Z6JH 2WV4A 3S9BA 2AEIH 1UTLM 1S81A 2ZIQH 4TWYA 3LJJA 4X1SU 1IQNA 1TRNA 1UVTH 3SUFA 1YPLH 1C1SA 3NCLA 1GVLA 4HI3A 3N7DA 3MH5A 3HGNA 1NBMD 1EZQA 1SPJA 1CA0C 1YPEH 3SU5A 2J92A 3SN8A 1HUTH 4Q2KA 1GI5A 3A88A 1DWCH 1IQLA 3TNTA 4CR5A 2PW8H 1O38A 1P06A 1ORFA 1K28D 3RXKA 1G3EA 1TNHA 1HAVA 2P94A 1QQ4A 2XW9A 3BG4C 5C0UA 1WV7H 1UCYK 3M5LA 4D8NA 3TJVA 1S6FA 3LH1A 1N8OC 1GJ5H 3T27A 4WH6A 8ESTE 1E38B 1UW7A 1Y3WA 3MU5A 2ANKH 1HIAA 1W10U 1NN6A 2ZHWH 1DXPA 4B2AA 1HRTH 5EPNA 2XBWA 3PROA 1QZ8A 4OS5A 1A3EH 5I46H 5DP4A 1DS2E 3MYWA 1GMCG 3O8BA 2FP7B 4NSVA 1RGQA 4CREA 3DSGA 3KF2A 1JIRA 2OINA 1DX5M 1SOTA 1ZMJA 3ELAH 3SQHE 2P95A 4Y8YA 3SV7A 1GVZA 3LH3A 3VB5A 3CS0A 4INHA 4ZMAH 3RC4A 2PLXA 2FS9A 4IC6A 2VIQA 2BOHB 1C1QA 1SGNE 2EC9H 4MTBA 1XUKA 4CRDA 5J4QA 5DP6A 3VGCB 3PMHB 3ZZDA 3A7WA 3OYPA 2FOMB 2WV9A 7GCHG 4LXBH 2ZTYA 1TQ0B 1DWDH 2BLOA 2QN5T 4X1RU 3RXPA 3TU7H 5C94A 4CR9A 5C3NA 4O97A 1FY1A 2JJ1D 3WW7A 2Z3DA 1FPCH 1DLEA 1EB1H 3ZVFA 1BTPA 2BLQA 1MKXH 2FOHA 1PQAA 1EP6A 3SJ9A 3RXJA 1SGIB 2C93B 1T31A 4JMYA 4WH8A 1KY9A 3VB6A 2F9UA 1O2GH 2PSYA 1SOZA 2JKHA 4NIWA 1N6YA 2HOBA 4MPUA 2V3HH 2XTTB 3V13A 1BA8B 4K1EA 1XKBC 3LC3A 1NZQH 1HJ8A 2TPIZ 1WSSH 1DUAA 2OP9A 3U1JB 2YNAA 3A7VA 1TGSZ 2AMQA 4RKJB 5C5OA 3RMOH 4ABEA 3Q3YA 3CENA 1INCA 1YBWA 2NU1E 3BTHE 4JZFH 3FANA 1O37A 1Q31A 4VGCB 1WAYB 3OU0A 1FIWA 3T29A 4GVUA 1DLKB 2ALPA 1PPCE 1QBVH 3LU9B 3W94A 2A1DB 1V2VT 3SNDA 2GJGA 1ZGVA 4CHAB 3B8JA 3MO9A 4Y7BA 4KTSA 3M61U 4NCYA 2AHME 1DE7H 1P9UA 4XD7D 2VINA 3RXSA 2CN0H 5EPYA 1H1BA 3TPIZ 2QF5A 4RN6A 5SGAE 3IITA 2EQNA 2G8TA 5E0JA 2BQWB 2W6ID 1KXCA 2HNTE 4BAHB 4AB9A 1Z71A 5FAHA 2CHAB 1UHBB 1AWHB 2O8WA 5ESTE 1NESE 2GKVE 1LHFH 1C1VH 5BRRE 1KXDA 2OC1A 1ZMNA 4ABHA 1H4WA 4CRBA 1ZHRA 3PLBA 1UCYH 3S9AA 1EAUA 1MTWA 4B75A 1CT2E 1XUIA 2ZCHP 2BOKA 3NPSA 4MNYA 4MNWA 4NIVA 1EAWA 3VB3A 1P01A 1XUHA 4BXWA 4MPXA 1DY9A 2ZFRH 4B2BA 1LVBA 5LPRA 2Z6BD 1N1LA 1Y3UA 1UTOA 1V2OT 2PUQH 3VXEH 2P3UB 1DUEA 1K1PA 1BRUP 2B8OH 3RXHA 4X2YA 3SJKA 1W11U 2BX4A 2C8XB 1HCGA 3F0OA 3SORA 1HNEE 1SGPE 1MMJN 2NU2E 4B6FA 2W5EA 2A4RA 1GL0E 3GYMA 1G3DA 1KXFA 2IPQX 4BAKB 1C9TA 4X6OA 1O2RA 1G3CA 3GYLB 2M5TA 2PTCE 2R2WU 1UTJA 4LZ1H 1ZPCA 2HPPH 1TMTH 2BD8A 1GJBB 2HALA 1OP2A 1NRRH 1VKYA 4H4FA 2GT8A 2A5KA 4DCDA 5JBCS 5L30H 1OWEA 3MNBA 7GCHF 2XRCA 4D9QA 5EJ1A 1MAYA 2HWLB 2J9NA 1ACBE 4H6TA 2R9PA 2WV5A 1TE0A 1TOMH 4J1YA 4Y0ZE 3HK6B 4WMFA 4JZEH 3ZZ4A 2BZ6H 3H7OA 4I8LA 3TJOA 2ZTZA 1WTHD 1NY22 2V0BA 4O9VA 4NA9H 3ZV9A 1BJVA 1D4PB 2Z3CA 4OS2A 4B2CA 1GHVH 1VJ9U 2WSSD 2ZDMA 1O5DH 1OWJA 3MTYA 1HYLA 4X1NU 4WY3A 3ZVAA 4KKDA 7KMEH 4U32A 4FUGA 3U8TH 1AU8A 1EXFA 1CT0E 4FUFA 4X6NA 1W0KD 3BN9A 3FVFB 4J2YB 2VJ1A 2ZI2H 3I78A 1GBCA 2ALVA 3N7EA 1ZJKA 5B6LA 3SNAA 1TPSA 3RXBA 3Q76A 2FOFA 1BITA 1LQEA 1XX9A 1T4UH 4Q7ZA 3LGVA 3SJOA 1C2EA 1J8AA 4X8VH 3FKSD 2HLDD 2KCPA 1CA0B 1GI9B 1O32A 1RFNA 2BY6X 4K60A 3C1KA 1K2I1 1C2HA 1AFQB 1ANCA 2FI4E 3BG4B 4YLUA 1T32A 2BMGB 1P3CA 1WU1A 2J98A 2Y81A 3UY9A 1L4ZA 1AZZA 5C0TA 2F9VA 3WY8A 1XXDA 1C5PA 1OHHD 3AVZA 3PV2A 3S7HB 4DJZB 1PPBH 4K3JA 2WPIS 1QJ7B 1ZR0A 4IC5A 2BDAA 5EU8A 1HAVB 3UWJH 1SFIA 3MU0A 1EB2A 1JRSA 4RT0A 5FCKA 1GI7B 1SGDE 1SC8U 2VIPA 1VITG 1F5RA 2HGTH 3EYDA 2F9BH 3M5MA 5EW2H 3RXQA 1BTWA 2YMSC 1TABE 1HIAB 4YZUA 4Z1MD 1ELCA 2KAIA 1T4VH 4XFQA 1UO6A 1SSXA 1TALA 4FUIA 3RXOA 4ABIA 5DJ7A 5A8ZA 5FBIA 1GMHG 1NRSH 2ZFQH 1P3EA 2PSXA 1P11E 1AY6H 3A8DA 4K5ZA 1O5AB 1FUJA 1ZRBA 3PLKA 2Y7XA 3E3TA 2Q1JA 1L1JA 2QAAA 1YPHE 3M5NA 4WF8A 1GBEA 1OWKA 2AERH 1MTUA 3L33A 1HAOH 5F8TA 1LPGB 3U8RH 1IAUA 1HJAC 4H42U 2GVFA 5JPMH 1ZJDA 1B5GH 4E06H 1O5BB 2PTNA 4DW2U 1SBWA 1O3PB 3GY2A 4SGAE 1GBJA 2Y5FA 4AYVB 1TYNA 1KIGH 3FFGA 3MO6A 3RXIA 2J34A 2WYGA 1DITH 4AG1A 4GPGA 1UTNA 5GCHG 1ETSH 4ZKRU 1TIOA 5EG4A 1XUJA 4Q80A 3KGPA 1UVUH 2OUAA 3BTEE 5C2ZA 3KN2A 3FO8D 2IJOB 3OX7U 5LPEA 2Z3EA 4BAQB 3PTNA 2RDEA 3SV6A 3GY4A 4HZHA 1QTFA 3LDXH 4WMEA 2Z94A 3GDUA 3ZVGA 1YLCA 1GHBG 4INKA 2O8LA 1YPKH 3LOXA 1TAWA 2A4QA 1O0DH 1TB6H 3TK9A 3W95A 4OS7A 1OWDA 2V3MA 1VGCC 1QHRB 2FTMA 1ARCA 3RU4D 1GI0A 1Y59T 3BEFB 1P2KA 4X2WA 1H8DH 3VXFH 4AOQA 1WQVH 3U28C 1K1LA 2TRMA 2HNTF 5LGOA 2ZHFH 1BB0B 2EA3A 3GY6A 2GV6A 3KQDA 1WBGB 1THPB 3A89A 3U9AH 1O35A 4AGJA 1O3LA 2BD7A 2AH4X 1C2DA 3RM2H 3RLYH 2A45B 1EZUC 2H1UA 3RXUA 1P2NA 3LPRA 3BTFE 2WUBA 4XBCA 3A86A 3P8GA 3SW2B 1C2IA 1HAZB 3K6ZA 4IW4E 3R3GB 2VIOA 2ODYB 2YNBA 2A7CA 3MU1A 1C1UH 5EXNA 1O5EH 3MHWU 4ISHH 1IQEA 1SGRE 1SQOA 3D49H 5L2YH 1FX0B 3S69A 3ZVDA 1CSOE 1ANBA 1KYNA 2SFAA 1TBRH 2UWPA 1HBTH 1D3DB 3DD2H 2FYRA 1A1RA 1GI4A 1TNIA 1TA2A 1A46H 2A32A 2BY7X 3EA7A 3JZ1B 3A84A 4X2XA 2FTLE 1WYKA 2UUYA 1O3AA 1JRTA 2BM2A 1QA0A 3UOUA 3MO3A 1C4Y2 1O2HA 2ZFPH 1XKAC 1KLTA 3DHKH 3ZZ5A 1EKBB 3GISB 2PHBA 1VITF 3HATH 3BEIB 4ZAEA 5FPTA 3O8CA 2VWOA 5JBTA 1P0SH 3GDSA 1LMWB 3UWIA 3BEUA 4KTCA 1W8BH 5F6MA 1T8NA 4ACAA 4E7RG 1GMHF 3GOVB 1BTXA 1GI2A 2WPHS 1O2YA 3HPTB 3PWBA 3KQCA 4BNRA 1BCUH 4KTUA 2AMPA 1C5TA 1PPEE 3M7QA 1A7SA 2FESH 3CNRA 2K8IA 1UHBA 2THFB 2UWLA 1SLVB 3K2UA 2OBQA 3AAVA 3BTDE 1C2JA 1ELAA 2VWNA 2WINI 1AO5A 2H5CA 5EGMA 1QR3E 4AC9A 2PKSC 2FI3E 1CBWB 4MDSA 1ZSKA 2UUKB 2P8OC 1AFEH 4ISLA 5EODA 5IYTA 3S0NA 1HPGA 1XUFA 3KQBA 1QY6A 2DE9A 2CJIA 4XBDA 5GCHF 2P3FH 1QRWA 1O33A 4WXVA 1CGHA 5FXLA 3GS9A 2SGQE 1YPGH 1O3GA 3MNCA 1KXAA 1IQHA 1V2QT 1Y5AT 3TH2H 3M3VA 1CO7E 1TNKA 2SGFE 1TQ7B 3T62A 1BHXB 1GHBF 1Q3XA 1FAXA 2A4GA 2LELA 6ESTA 3SGBE 3RMNH 4DG4A 5T6GA 5FX6A 1Z8IB 1YYY1 5JBBS 2ZU4A 2M2AA 1IHTH 2AS9A 1THSH 1MQ6A 1AVXA 1Y3VA 3PRDA 2O8MA 2JIZD 3FOAA 2YOLA 4AN7A 2ANYA 3SOSA 1EOLA 1PYTD 1A0HB 1TX7A 3N7OA 3SGAE 2WPDD 3FZDA 3SJIA 2Z9KA 1OYTH 1MBMA 1T8MA 2J98B 5JYIA 3RU4T 3P8NA 1NC6A 3S9CA 2XYAA 1IQIA 2IPHA 3O8DA 1NU9A 1DDJA 1H9HE 2ANMH 3BTWE 4FUEA 3KL6A 4ABGA 3DSPA 1CHGA 2A7JA 4ZKOU 3TK6A 5KEDA 3F6UH 3QZQA 2BLVA 5KECA 2Z9GA 5HM2A 2WZQA 2FWWA 1O2UA 1O39A 5CMXH 1A5IA 3QK1A 3URDA 1C9PA 2GCHG 1WXRA 3LIWA 1GBAA 2Z7FE 1MCVA 1F0RA 1V2NT 1MTNC 2SNVA 1AB9B 2F83A 2XC0A 2H5DA 3PRBA 2ZFTA 4HGCA 3OE7D 1K1IA 2OC0A 3UB0A 1GBBA 5AFYH 4DOQA 1BJUA 1RTLA 1ZTKA 1HFDA 1PFXC 2C8YB 2CF8H 2FEQH 3GY3A 1C4V2 1YCPM 4BTIB 1YP9A 1SR5C 4I8HA 1W14U 1FQ3A 4WMDA 1GI6A 4NA8A 4A92A 1DWEH 1RRKA 1KLJH 4A7IB 2BXTH 2ZDKA 5C17A 3CP7A 1OS8A 1QL7A 3LGTA 4ZCNA 1F0SA 4IN1A 1XVMA 3UIRA 3BTGE 3LGYA 1E35B 1TFXA 3A7YA 5TCAA 2A2XH 1O2SA 5DP9A 3SJ8A 1AKSB 1C2GA 1ELEE 4ZH8A 4LK4A 1NFYA 2VGCC 3E0PB 1GDUA 3ZYEA 5B6OA 5FPSA 2D2DA 1O2QA 1U6QA 1C2MA 1AD8H 1MU6B 2WUCA 1VGCB 4IMQA 1PPFE
chains in the Genus database with same CATH topology
4TY7A 2EI6A 2JH6D 2ZPSA 4B73A 5GPIB 3V7TA 1AVWA 1QBNA 1HDTH 1IQKA 2TGDA 5F8ZA 1LKBA 1OKXA 3Q3XA 3S7KB 4X2VA 4ISIH 2FM2A 4X8TH 1O5GH 2JETB 1ELDE 1MCTA 4NG9H 4K1TA 4ABJA 3GY7A 1QGFA 1GL1A 1DVAH 1FZZA 2AIQA 3OTJE 2W3IA 1O3EA 1AHTH 4XOJA 4JZIA 3K65B 3ZZ3A 3U69H 1EUFA 5GWZA 1BMNH 3TJNA 3F68H 1TPAE 3STIA 2D8WA 1C5OH 1UCYE 1C5RA 4AGKA 2VVUA 1NPMA 3PO1C 1O2IA 1BZXE 4LOYH 4NFFA 1DXWA 2OTVA 4Q7YA 2TGAA 5GIBA 3I29A 4I31A 1O2ZA 1V2RT 1KLIH 3SU1A 2XCFA 1AZ8A 1C1TA 1SGEE 2BVSH 2FO9A 1FY5A 1QJ1B 3ZZBA 1ANEA 1EX3A 1T8LA 3EA9A 2FZZA 5JB9S 4RSPA 2ZGHA 2FX6A 1ZZZA 3UNRA 4K8BA 1SGQE 1J15A 2GCHF 1BOQA 2C8ZB 4MPVA 1TGNA 4CRAA 2Z9IA 1A2CH 1NO9H 4JK5A 1QQUA 2AIPA 2XCNA 3MU4A 1QB9A 2ZGCA 3SU2A 3M3SA 3SU4A 2PKAB 1O2XA 2XBYA 1EZXC 5DO4H 4FUBA 2J2UA 2VIDA 1GJ8B 5G4BA 1O3KA 1TMUH 2J94A 3LGWA 4IGDA 1A4WH 2O8UA 4NZQA 1C1OA 4DVAU 4I33A 2Y5HA 1EAIA 3ATKA 3GDVA 1S84A 3SU0A 3UR6A 3QDZB 5C1YA 1ZSJA 3M3TA 3KCGH 3RXRA 2GZ8A 1NRNH 1L1GA 5I25A 3PYHA 3A8AA 3BV9B 1S83A 1HXFH 2FDAA 1GMCF 5JDUB 1AE8H 4TY6A 2GZ7A 2P16A 3ATMA 1P57B 4X8SH 3OY5U 2WPJS 1K9OE 1BT7A 1W0YH 2BXUH 5HM9A 3ITIA 1GCTC 2ZQ1A 2CXVA 3OY6U 2ZHDA 1UTQA 2LPRA 2ZU3A 3TH4H 1K1MA 7LPRA 4DY7B 2OXSA 4IN2A 5GXPA 4ABDA 1E34B 3PM3A 3EAJA 5DKMA 3ESTA 1TA6A 1YF4A 3ZYDA 1F0UA 4A1XA 1ANDA 1EJAA 3SGQE 4MPWA 2B9LA 2OCVB 2UUJB 2R0KA 1SGFG 1RTFB 5FHTA 2RCEA 1O30A 3UR9A 4NIYA 4FXGH 2AFQB 3M36A 3K9XB 3QX5H 1SQAA 2GX4A 2SNWA 1V2UT 2PGBB 1UTPA 6CHAC 1AI8H 4ISOA 3UNSA 3F9GA 2A5IA 4NSYA 2Y5GA 2HPQH 4AFZA 2QXGA 2BQ7B 2VIWA 4Z6AH 1YC0A 3A8BA 3K6YA 4D9RA 1TGCA 3BTQE 1O3MA 4F49A 1HGTH 2QIQA 1CQQA 2V35A 5CHAC 3MNSA 2LNCA 2GMTC 1ELGA 1GMDG 1GJ7B 3F9EA 2C3SA 1OOKB 4H6SB 2AGEX 3SNCA 1S0RA 1QRXA 2GDDA 2PR3A 5GJ4B 5C20A 2WPKS 1N8OB 1BMLA 1EPTC 1O3IA 4MLFB 2XC4A 3RXGA 4OS6A 1Z8RA 1FDPA 4GCHG 4NWLA 1LCYA 3QZRA 3RXMA 1K1JA 1LO6A 3GCTG 2SGEE 4JYTA 4BTUB 1L2EA 1QB6A 1Z1JA 1X7AC 2ZKSA 2A5AA 1TPOA 3STJA 1TNGA 1RTKA 4OGXA 2SGAA 1AUJA 1QIXB 1JBUH 2R3UA 3TIUA 1BMMH 1O2KA 1XM1A 1N6XA 2GP9B 2W7UA 2FOEA 3KQEA 1J14A 2FLBH 2A31A 3AASA 5K7RA 2ZHEH 1QJ6B 3P8OA 1V2LT 2IN2A 4LZ4B 2AGGX 4THNH 1IQJA 3UQVA 4BXSA 2RDLA 4GAWA 3UFAA 1HAHH 1DWBH 1NM6A 2QGRA 1DPOA 1MAXA 1MD7A 2C4FH 2VH6A 4K8YA 2GTBA 1YGCH 2SGDE 4XSKU 3PMAB 1O5FH 2NU3E 2QC2A 1MTSA 1ZRKA 1YPJH 4CBNA 4Y8XA 3EE0B 1O2NA 4JK6A 5F8XA 3TNSA 3UOPA 1DANH 2P93A 4UFGH 1NROH 1AKSA 3VB4A 3LKWA 1GVKB 5FPYA 1GGDC 2BLWA 3A82A 3FP7E 2C8WB 5JB8S 5C67A 3QO6A 4IBLH 1CU1A 1C1NA 4O03A 4JZDH 2W26A 2NU0E 1GBKA 3DUXH 3F9FA 1VCPA 1TLDA 1K1NA 1BBRK 1C5QA 3RC6A 4X0WU 4B71A 1AQ7A 5FX5A 2FYQA 3EQ0H 2BQ6B 1HAGE 2FS8A 1W12U 3Q00A 1Y8TA 1B0EA 3ODDA 1GI1A 2GT7A 1KXEA 5HMAA 3TLOA 3U8OH 1TNLA 5A0AE 1C5UA 4ZROA 1VCQA 1ZHPA 4R8TB 3Q3KA 4BOHA 1GMDF 3RP2A 2BY9X 3ENSB 2H2ZA 2ZCKP 4ISNA 1GBFA 4O3UA 1WTGH 4BAOB 2RG3A 2XC5A 4CH8B 1KDQA 1QCPA 1GHXH 1L4DA 2Y6TA 2F9OA 3FZZA 8KME2 1C5WB 1AN1E 1DICA 1UVOA 4GCHF 5C5NA 2Q6FA 1O2WA 1HAYB 4ZHAA 4AX9H 2BDIA 1LQDB 2G00A 3VGCC 2FMJA 1C1MA 3GCTF 2ZGXH 4JYVH 2BD5A 2ZZUH 1TGTA 3RM0H 1CE5A 1RS0A 5L2ZH 1O2MA 4YT7H 1D6WA 2Z9LA 4ABFA 4TPYA 2BVXH 1GCTB 2PFEA 1QNJA 2VH0A 2BY5X 1EJMA 3GY5A 4DGJA 6GCHG 1SLXB 2A0QB 5A2MH 4E05H 2OLGA 2WPLS 1TONA 4RKOB 2PKAA 3URCA 4KELA 4GUXA 3LJOA 4B74A 2QF0A 4CH2B 1C1WH 2BD9A 2Y7ZA 3D62A 3PLPA 1W2KH 4YLQH 1P8VC 4MG3A 3ZZAA 1P05A 4JZ1A 4VGCC 2OQUA 1S82A 1UVSH 3RXVA 3T28A 4UD9H 3TVJB 2C90B 1VJAU 1XVOA 3MNXA 2H9EH 3MI4A 1D3PB 1Q2WA 3MH4A 1QURH 1V2MT 1GBDA 3SU6A 4ZXYH 3NXPA 1BRBE 2BD3A 2GD4B 1FJSA 1NS3A 2VVVA 3TJUA 1C5LH 2ZPRA 3SV2H 1ZYOA 1M9UA 3HKIB 5E0HA 4FUDA 3NWUA 1O3OA 4X6PA 1GJAB 3DA9B 5GDSH 5HGGA 1L1NA 2P3TB 1QFKH 3AW0A 1O5CB 5HXFA 2A2QH 4B76A 1FN8A 1LVMA 5FCRA 1EPTB 2ZEBA 4OS1A 3ZZ8A 1HB0B 3KEEA 3A7XA 3E91A 3QLPH 1DM4B 4FVBA 1GBMA 1ABJH 1V2WT 1GJCB 2CV3A 3EA8A 4DIHH 4YM9A 1DOJA 3M35A 3A83A 2WPMS 1P2JA 1YPMH 1GI3A 4MQAA 4TWWA 2ZECA 2G51A 4TPIZ 3B23B 4Y10E 4CRCA 4YESB 1BHXF 1ZGIA 3E8LA 3KIDU 4OGYA 1TNJA 3I77A 2G5VA 1MU8B 1P03A 1UK3A 1K22H 3TGJE 2AYWA 1ZOMA 1PQ7A 4UFDH 5ETXA 1P2OA 3H5CB 2VNTA 3ZVCA 3ZZ9A 3PWCA 1MUEB 2B0FA 3IWMA 3ZZ7A 2OC7A 4MNVA 1PQ8A 4FUCA 1IQMA 4CRGA 2ODPA 5T3HA 2VIVA 3NKKA 4D7GA 1TOCB 1E37B 2B5TB 4ABBA 1ZSLA 1H9IE 5JBAS 3SNEA 1HJAB 1B0FA 2ZDAH 2NU4E 5H4IB 6GCHF 5K0HA 2ZFFH 1BMAA 2ZQ2A 4I8KA 4O3TA 5LPFA 2FXRA 4K69A 3M7TA 3MOCA 5TCCA 1UVPA 1V2KT 1FNIA 1CHOG 4U30A 1ETTH 1GGDB 2H9HA 3HK3B 4X1QU 3NK8A 1OXGA 1YKTA 2BZAA 1ZTLA 1OYQA 4AYYB 4JYUH 1C1RA 1NFXA 1NTPA 5E0GA 4DT7B 1GWAA 2FOBA 4I8JA 3A81A 2I6QA 1O3FA 2QXIA 2XBVA 1UMAH 5DG6A 2BDCA 4F4OC 3MFJA 1BTUA 5EXMA 1VR1H 2GGVB 2ODQA 1AFQC 1DT2A 2ZU1A 4D7FA 2V3OH 1QL9A 5AFZH 1A5HA 1BTHH 1F0TA 1BTZA 2GCTC 1PPHE 2XWAA 3QWCH 2BDBA 2RA3A 1Z1IA 2TGPZ 4PROA 3EDXB 1PPGE 1LHGH 3BF6H 4ZHMU 1W0ZU 1SGFA 1HAIH 1AE5A 8LPRA 1PPZA 3P8FA 1JWTA 3V3MA 4ZUHA 2QXJA 1KTTB 1K21H 5TJXA 1A3BH 3FAOA 3F9HA 2CF9H 1P10A 1LDTT 2R2MB 1LPZB 3EGKH 4AFUA 1FN6A 1FXYA 3SBKA 1MH0A 1D3QB 4AFQA 1G2LA 1WOFA 5LH8A 1KDQB 1G2MA 4WVPE 5AVDA 4FU8A 1J17T 1FMGA 4Z0KA 5ABWA 4WXIA 2PV9B 5E2OA 1WCZA 3RMLH 4ABAA 1F5KU 4AZ2B 1NRQH 1EATA 1NFWA 4UFEH 2F91A 8GCHG 1S0QA 4ZHLU 3ZV8A 1UK4A 3RU4E 1EP5A 2H9TH 2ASUB 1PJPA 2FI5E 3UQOA 1KSNA 2XXLA 2ULLA 5HYOA 1GHYH 1YLDA 2ZTXA 3SUEA 2FOGA 1HAPH 5A0CA 2BTCE 5DP5A 4Y71A 1D9IA 3ZVEA 1DSUA 1S5SA 2ZC9H 4M7GA 5A8XA 1LVYA 2HNTC 2G55A 2HVXA 3A8CA 1SGCA 1BDAA 3ATLA 2D1JA 5T6DA 2FODA 1C5XB 2EI8A 3JZ2B 2PKSB 1SLUB 1LPKB 2OQ5A 1BUIA 5AHGH 4KP0A 3SUGA 1KXBA 2ZG0H 4ZKSU 2P8OB 3SU3A 1SVPA 2GZ9A 5C1UA 3GCHC 3P92A 1GBIA 2BX3A 1EQ9A 2VU8E 2JH5D 4YT6H 1CHOF 1O3HA 1ESTA 2AMDA 3Q77A 2RA0A 4ESTE 1JOUB 1P09A 2ZHQH 1O3DA 1YCPK 4DURA 1RXPA 3F1SB 2PWXA 3SNBA 2BDYA 1HJ9A 3RLWH 1XXFA 4Y6DA 1RIWC 4Y76A 1GHWH 3UNQA 4AG2A 3GICB 1SL3A 3QTOH 4YOJA 3VEQB 3KNXA 1T8OA 1ZHMA 2XBXA 3E6PH 1A0LA 3BSQA 4CBOA 1A0JA 1AVGH 1H9LB 4GHTA 1SMFE 3U1IB 3HGPA 5IDKA 1DY8A 1E36B 1UTMA 5E8EH 2J4IA 1GG6C 1GHAG 2WYJA 3O8RA 3E1XB 4I32A 3RXEA 5EQRA 4IS5A 1QRZA 1O2PA 4XDEA 3L6PA 1V2ST 1FPHH 2R3YA 1LHDH 2K1QA 1VCWA 5FBEA 3MH7A 3LGIA 1T7CA 1TBQH 1ESAA 1SLWB 3R0FA 3H7TA 3T25A 2NWNA 9ESTA 3FP8E 1C5ZB 2FPZA 3L3TA 3VPKA 1AMHA 5EQSA 1PYTC 2A7HA 1L0ZA 4AORA 2FX4A 3SUDA 4I8GA 2ZWLH 3RXAA 3RXTA 2STAE 4AFSA 4E7NA 2HLCA 3AW1A 3UPEA 1V2JT 3UUZA 1MTNB 3A85A 4FU9A 2W3KA 3QUMP 1GBTA 2J95A 1VZQH 1W7GH 4KGAA 1OP8A 1TGBA 1NRPH 4A1VA 5DP7A 1C5MD 2TBSA 2D26C 3SV9A 3B9FH 1P2IA 1KTSB 2ZO3H 3M5OA 3NZIA 1EAXA 1C5YB 1TRMA 3P70B 1D6RA 2ESTE 8GCHF 1EPTA 2STBE 1WQSA 1CBWC 2O8TA 2VWLA 2CGAA 2ZNKH 3QGNB 1LHEH 2G4TA 4A6LA 3QN7A 1O31A 3T2NA 4I7YH 4NFEA 4UE7H 3SV8A 1O3CA 3GCOA 4YOIA 1CT4E 5A09A 3ZZCA 1O2VA 1V6DA 3TGIE 3BTTE 4TYDA 4B1TA 1THRH 4ASHA 2ANWA 1OX1A 1UJ1A 2FLRH 4U2WA 1SGYE 1C5NH 5DP3A 1Z7KA 1VITH 1Y5UT 4ZXXH 2VGCB 3M7UA 3A7ZA 1O34A 1CA8B 2JH0D 3A87A 1BRAA 1O2JA 2QCYA 5PTPA 1V3XA 3P6ZB 1BQYA 1P04A 2QY0B 4NZLA 2TIOA 2GCTB 4R0IA 4YO9A 1GJDB 1G37A 4INLA 2ZP0H 1AUTC 1ELBA 1OWHA 1ARBA 3QGJA 1SHYA 1YCPH 4XE4A 1J9CH 5EOKA 3A80A 3U98H 2DUCA 4U01A 1W7XH 3SI4H 3CS7A 1E0FD 3PMBB 1WUNH 3C27B 4XBBA 3TK5A 4NGAH 1YPHC 4YOGA 2UWOA 4Y0YE 5DPAA 1P12E 1NU7B 1MKWK 1ELVA 1D3TB 4Y79A 3ZVBA 1IHSH 1LHCH 2BYAX 1HV7A 4BAMB 6LPRA 1CGJE 2SGPE 2BD4A 4Y7AA 4SGBE 1EASA 5BPEA 1IQGA 1ZPZA 1FY8E 1GHAF 3G01A 5A8YA 2ZFSA 2V6NA 1FI8A 3T26A 1FAKH 3GY8A 2G52A 1G36A 4ZKNU 2ZGBH 3PO1B 2HRVA 1AB9C 3LGUA 4UEHH 4BTTB 2Q6DA 3DT0H 1C2KA 3SHAH 2OD3B 1GJ6A 2EI7A 2F9PA 3MU8A 3RXCA 3PB1E 3RXLA 2GDEH 4IMZA 1IQFA 1NFUA 1P2QA 2QV1A 1GJ9B 2BDHA 3D65E 1W13U 1C5SA 5E2PA 4OS4A 5C1XA 3BIUH 1H8IH 4UDWH 4NWKA 2QXHA 1GBLA 5F03A 3SZNA 5J4SA 4QT8C 1BIOA 4A1TA 3TH3H 1OSSA 3ODFA 4Y8ZA 1CVWH 2UUFB 3ZZ6A 3GCNA 1AIXH 1Z6EA 1RJXB 3E0NB 2PGQB 4GHQA 2R0LA 1TWXB 2G4UA 2BB4A 5DK1A 3P17H 2BDGA 3GCHB 3RMMH 1GDQA 3RC5A 1F2SE 3RUOA 1QBOA 1F7ZA 1O3BA 3MMGA 4UFFH 1XMNB 1F5LA 1Y3YA 2G5NA 4A5TS 1JMOH 4HTCH 2QA9E 1JXPA 1QA7A 2ZGJA 4D76A 5AF9H 3LT3A 3D23A 3OSYA 4NA7A 3UTUH 1O2OA 2I6SA 5EXLA 5DGJA 1TX6A