1PPHE

Geometry of binding of the nalpha-tosylated piperidides of m-amidino-, p-amidino-and p-guanidino phenylalanine to thrombin and trypsin: x-ray crystal structures of their trypsin complexes and modeling of their thrombin complexes
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Geometry of binding of the N alpha-tosylated piperidides of m-amidino-, p-amidino- and p-guanidino phenylalanine to thrombin and trypsin. X-ray crystal structures of their trypsin complexes and modeling of their thrombin complexes.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1991-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pphE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pphE02
2QF3A 1IQIA 2A0QB 3RM2H 4AG1A 2ZF0H 1FXYA 2VWOA 4A6LA 3E1XB 3SU0A 1WTHD 5E2OA 1ZPCA 4K8YA 4WXIA 1GHAF 4Y0ZE 1CSOE 1T4UH 2BVXH 4A5TS 3V7TA 3T27A 1BOQA 1O2MA 2ZCHP 1TPSA 1CGIE 4FVDA 5F8XA 1HJ9A 4Y71A 4NIYA 1PPBH 1F2SE 5DK1A 2XBVA 1WUNH 1AUTC 1TA2A 3M3SA 2GZ7A 4CRAA 1PQ5A 1ZLRA 3HK3B 5C2ZA 5HXFA 1KDQB 3LOXA 1SBWA 4BTUB 1LHEH 1P03A 1V2UT 3TJNA 3F6UH 1LHCH 1AZ8A 3GY3A 4INKA 1TOCB 3I77A 5A2MH 3DFLA 2BLQA 4O3TA 1J17T 1Y5AT 1NU7B 4YOIA 3FP7E 1PQ8A 2A2QH 1QRZA 3Q3KA 2ZCKP 2UUKB 2XBXA 4R0IA 1ZHRA 2WYJA 2FXRA 1YPMH 2ZU4A 1ELAA 1FQ3A 1HAVA 1L0ZA 5FPYA 1YPGH 2J38A 5DGJA 1E35B 1SR5C 1KLIH 4ISIH 1MAYA 4IS5A 4ZKNU 1FDPA 5BRRE 2BY9X 3S9CA 4FUEA 1TPAE 2FI4E 1WCZA 2GMTB 1ELDE 1ZGVA 4BNRA 4CRGA 3ATKA 1HPGA 1TOMH 1G9IE 2G5VA 1GJCB 1F7ZA 2HVXA 3GDUA 4VGCC 5E0JA 1PPHE 1CE5A 1GGDC 2VJ1A 3ESTA 2ZZUH 1PPEE 2TIOA 4NWLA 4RKJB 1C5TA 3TLOA 1JMOH 1UK2A 1GHYH 4X2XA 1O31A 3MO9A 4ZKRU 1HJAB 3PO1B 3KQEA 5EU8A 1C2DA 3H5CB 2V3OH 1J9CH 2ZDNA 5DKMA 1FJSA 3SV7A 1C2IA 1GBAA 1XUKA 1ETTH 3ZZ6A 1BA8B 1AVWA 4X6NA 1C1TA 1QCPA 2Q1JA 3Q3XA 4ABDA 1CGJE 2AMPA 1LQDB 1O3EA 1OP8A 1TGBA 3M35A 1FUJA 4Q7ZA 1V3XA 2R0LA 1C1RA 3ZZ9A 1SGQE 5AFZH 3RMOH 3OY6U 5DP5A 1P09A 1ZRKA 1MKXK 4I33A 2FOAA 2ZPRA 1TNGA 4F49A 3Q76A 3KCGH 3NZIA 3GCOA 1SB1H 5JBBS 3RXOA 1O0DH 3FFGA 4JZ1A 3TGIE 3A7YA 1EUFA 1IQNA 4JK5A 2PTCE 3PWBA 5ETXA 2IJOB 3OTJE 1ANDA 4ZMAH 2C8XB 1BTZA 1OYQA 1LVYA 2D2DA 3OSYA 4TPYA 2UUJB 2BX4A 1VCQA 3BTGE 4NFFA 1K1OA 1CHOG 2EI8A 3S0NA 2Y5HA 1HAZB 3BTWE 1EATA 4B71A 2KAIA 2VB0A 1NFXA 1KXAA 2HPPH 1CA0B 2Q6FA 4B2CA 1DLEA 1KYNA 1OP2A 1GVKB 5FBEA 1LQEA 2OC7A 3TH4H 1Q2WA 2AH4X 1SOTA 1YCPH 2ODQA 2VIVA 3RC5A 2NU0E 3BTHE 2STAE 2XW9A 1TBZH 1V2LT 1NM6A 3ATWA 3NUMA 3GY2A 1DUAA 3FP6E 2GV6A 4DJZB 4CREA 1LHDH 3PO1C 4OGYA 2ZFQH 1P2IA 1GBHA 1S6HA 1C2EA 1IQEA 1HAHH 1K1IA 3A7VA 5EXNA 8GCHF 3ATMA 4ESTE 5EQSA 1UVPA 2GCTC 1Y5UT 1O2JA 1BQYA 1O3FA 2IOTA 1VJ9U 1ZZZA 5AFYH 5C3NA 2ZGJA 1DPOA 4UONA 4NIVA 1A46H 1WQSA 1GMCF 1UVSH 2R0KA 1MKWK 2GD4B 2RA3A 1AKSB 7KMEH 1P3CA 2VWNA 1C1NA 4IW4E 1NFUA 3BF6H 3EQ0H 1UCYK 1DFPA 3T26A 1OPHB 2WV5A 4IN2A 3TH3H 1EZQA 3VEQB 3VB7A 4NA8A 1SSXA 1L4DA 3M3VA 2F9BH 4GLYA 1GVLA 3TJOA 2BZ6H 4JYTA 4NIWA 2G4TA 1UTJA 4NFEA 1IOEA 5E0GA 3P8FA 4YT6H 2D26C 4Y8ZA 4O3UA 1F0RA 2PUQH 1C5NH 5C20A 3RXQA 1CQQA 1W7XH 2F83A 2H1UA 3VXEH 1KLJH 3EDXB 5JDUB 5EW2H 3FZDA 3O8DA 4ZROA 2LNCA 3A81A 5DP8A 1FONA 1QL9A 1A5IA 1K28D 1TNHA 1CA0C 4IC5A 3T2NA 6GCHF 2TGPZ 2H5CA 3R3GB 5LPRA 2ZHEH 5FBIA 5DP3A 1C5XB 3STIA 1HYLA 3RMLH 4UD9H 3P8OA 1XXDA 2ALVA 2V3HH 1B0FA 2R3UA 2HALA 3BTEE 2BLOA 4OS5A 1O5BB 5LPFA 5E2PA 2B9LA 4FVBA 3C27B 1QIXB 1MKWH 3LPRA 1LPGB 1T8LA 1MAXA 2ODPA 1RGQA 3BTDE 4BAQB 2PKAB 1GJ4H 2FWWA 1TABE 2ZP0H 1AGJA 4LZ1H 2CV3A 1THSH 2W26A 3A8AA 4X1RU 1TMBH 1W14U 2P95A 1V2KT 1MZAA 1Z71A 1O5GH 1FPCH 2GT8A 2OBQA 4X8UH 3BN9A 2ALPA 1MTVA 1ZOMA 3SUFA 2OC0A 1P11E 1ZRBA 2VIQA 5LPEA 1TRYA 5GCHG 1C2GA 1C5WB 1Z8JB 4K1SA 2AGEX 4JCNA 4UFFH 4SGAE 3URCA 3ZZBA 1V6DA 1H9IE 3UUZA 3TPIZ 3VB5A 3S9BA 2DE9A 4WVPE 1NO9H 1P57B 2A2XH 4XFQA 1P0SH 3RUOA 1LKBA 1O3MA 4M7GA 3BTQE 6ESTA 3AVZA 2SNVA 2ZU5A 1JOUB 1GL1A 2K1QA 3TITA 5C1XA 1T32A 1U6QA 1P06A 2H5DA 1MZDA 1T8NA 3IWMA 3MU0A 2ZGXH 4TWYA 1T31A 1AKSA 1O2HA 4ISHH 1LKAA 3Q3YA 1YP9A 3RXBA 1O3HA 1GDUA 1G36A 5GJ4B 2VIPA 4FUJA 4AN7A 3LGTA 1HFDA 2EI6A 3ZVFA 1P02A 3CS7A 4JZEH 2WUBA 1W2KH 3GY7A 1FMGA 1HAPH 1RJXB 2WPKS 1HAXB 3QZQA 1GBJA 3SNAA 1Z1IA 3OX7U 3RXFA 2GKVE 1BZXE 1AFEH 1HIAB 2R3YA 5EXLA 3A86A 4YM9A 1ID5H 4U2WA 2B5TB 1O3JA 1HAGE 2FIRH 2GTBA 3SOSA 1MTUA 1GJ6A 2J4IA 1AB9B 1SGYE 1GI1A 4ABEA 2Z9LA 3F9EA 1PQAA 3FVFB 1GHBG 5JBAS 3F68H 3KGPA 2IN2A 1WSSH 4CH2B 2W3KA 2VVUA 1GCTC 2FLRH 4MPXA 1J8AA 1C2JA 4BXSA 5JBTA 2P3FH 1AD8H 3RLWH 3RXHA 3VB4A 1OOKB 1RTLA 1QBVH 3RXCA 1HBTH 1GHBF 2BLVA 2A4OA 3WY8A 1YKTA 1PYTD 1AI8H 2OD3B 1PPCE 2XWAA 1CT0E 1RFNA 3ATLA 4ABAA 3LC3A 2GX4A 4X1NU 1TRNA 3EYDA 3E0PB 4MLFB 2ZFFH 3U1IB 1OWKA 1DX5M 1XVOA 2NU3E 5EGMA 4D7FA 3UR9A 1Z8RA 3HGNA 3ELAH 5J4SA 2IPHA 1VITG 3SGBE 2LPRA 3SUGA 1DWCH 1GBEA 1TAWA 1PYTC 3UTUH 3SN8A 2P8OB 3KNXA 1VGCC 4OGXA 5IDKA 1PPGE 5IYTA 3QTVH 4YOJA 3RP2A 5C5NA 1S6FA 1NRPH 3AAUA 4GCHG 1CHOF 2BB4A 1TGCA 1ORFA 3ZZAA 5JYIA 1UO6A 3W95A 1WAYB 3SUDA 2AYWA 1F0UA 5EPYA 4AX9H 1N6XA 4K2YA 4DG4A 3S9AA 2F9UA 5GXPA 3PLPA 2EA3A 4Y0YE 1A4WH 3HKJB 2A7HA 2GCTB 1DM4B 1GJ7B 2XC4A 3BTKE 3SU1A 2PGQB 2Y6TA 1AMHA 2ZFTA 1O3OA 4BAHB 2HPQH 1BTXA 3UOUA 4KKDA 1G30B 1J14A 4GHTA 2Z3DA 1C1QA 3N7OA 3S7HB 1Q31A 3SJ9A 1GCDA 2BYAX 2A4GA 1XKBC 1L2EA 1W0ZU 1YLDA 1C2HA 2GCHF 1Z8GA 2ZU2A 1GBKA 2ZKSA 2ZC9H 1UTOA 1UHBB 1P10A 2QC2A 4WMFA 4GHQA 1TNIA 3HGPA 4XSKU 4THNH 2GZ8A 1ZR0A 5EXMA 3T28A 1H4WA 2V6NA 1V2TT 1QB9A 2ZPSA 2C93B 1XKAC 1D3DB 2ZU1A 1E0FD 3M5NA 1DY9A 2BXTH 3UNQA 1UK3A 2ZDKA 1D3QB 3E8LA 9LPRA 4J2YB 3A7ZA 2ILNA 2D1JA 1GJ8B 4AFUA 1A7SA 4AGJA 4MQAA 1AQ7A 1EAIA 2XCNA 1X7AC 3UR6A 3ZVAA 1CU1A 1YYY1 1DT2A 1O2OA 3QLPH 1G32B 4MNXA 1TRMA 1WBGB 4SGBE 4LZ4B 3P92A 3NWUA 1F92A 4AFZA 5I46H 1S82A 3SU2A 3MH4A 5FCRA 3QX5H 1C1VH 1K22H 1O2RA 1C5LH 2FI5E 1MD8A 1SQAA 5L2YH 1HAVB 5CE1A 4GVUA 4K60A 1KXDA 1CGHA 2UWPA 3W94A 1G2LA 4AFQA 1JXPA 1A3BH 1THPB 1IAUA 3EAJA 5A0CA 3F9HA 3GDSA 2JH6D 1ZHMA 4H6SB 2Y7XA 2O9QA 3G01A 3MO6A 1ANBA 5CMXH 3SO3A 3LJOA 3QTOH 3H7TA 1XUGA 1XUIA 2OC1A 3RXJA 2FPZA 3JZ2B 4FUFA 4CHAB 1SMFE 2TGDA 1FNIA 3MNBA 3GDVA 2WPJS 3MNSA 1ABJH 2BDAA 1ELFA 1QL7A 4BANB 3KQCA 1V2PT 3BTFE 1ELBA 1SL3A 2CJIA 1VR1H 3UREA 1O3DA 1P2QA 1FZZA 2ASUB 2ZFPH 1TNLA 4R8TB 8KME2 1GGDB 1TBRH 4CRBA 2QCYA 1BITA 1GI3A 3MOCA 4NA7A 3D62A 5GIBA 1NRRH 3LH1A 1C9PA 1SHYA 2CHAC 1D4PB 1KSNA 4CRCA 2W7SA 2YNAA 2PKSB 1NRSH 1TYNA 1O3NA 3PROA 2ANMH 2P3TB 4GSOA 3RMNH 2GDEH 5JPMH 1G3BA 1SLXB 3FP8E 3SV6A 1A5HA 1LVBA 3SJOA 3LC5A 1GJ5H 1GI6A 5T6DA 3K6YA 4FUDA 2AS9A 2FO9A 2A5AA 5L2ZH 5JB8S 1P2NA 1JBUH 1IQKA 3A84A 1VITF 3KN2A 1E36B 1GI8B 1MD7A 1AUJA 1XVMA 4INHA 2P3UB 1G2MA 3LONA 4BXWA 1O3LA 1Y3VA 1C5UA 1DICA 3QDZB 2O8MA 4D76A 3KQBA 3CP7A 1C5RA 1DOJA 2TGTA 3GY6A 1C5SA 3NPSA 4FU9A 1ESTA 1ZMJA 1WOFA 5FX6A 4ZXYH 3LDXH 2GGVB 1LTOA 3E0NB 3GCTG 4GUXA 5BPEA 2FOFA 4YTAA 5LH8A 3ATIA 2ZQ2A 3D23A 2WPHS 3DHKH 1OSSA 1SGFG 1DWDH 1VCPA 1SGCA 4HI3A 1JRTA 1SGIB 4HGCA 4ABJA 1UMAH 2A4QA 1LCYA 1ANEA 1JWTA 1T8OA 1DWBH 1WV7H 3E16B 3K9XB 4A1VA 3TNSA 2ZA5A 5DP4A 2A4RA 1HJ8A 2M5TA 2J92A 3A7WA 4MNVA 5ESTE 4D9RA 3BEUA 2OCVB 2FS9A 3KQDA 3RXMA 1K2I1 3D49H 4UFGH 4WJG2 4X6MA 2UUYA 1GJAB 5T6FA 1NRQH 1EB1H 2GDDA 3PTBA 1ELTA 3RXSA 1FAKH 6CHAC 5GDSH 1GI5A 1W12U 2ZGCA 1GBLA 1DXPA 2AIQA 2ZGHA 3RXIA 2VWLA 1ELVA 2XNIA 3GY8A 1MH0A 3MH7A 1TGSZ 2HRVA 3RXKA 1CBWC 1V2WT 1BMNH 3GY5A 3GYLB 3V3MA 1QGFA 3KIDU 2SGEE 1SI5H 2GVFA 4TPIZ 2BXUH 4FUGA 4IGDA 2XBYA 1O2YA 2A31A 2YNBA 1AB9C 2AEIH 3A83A 2SGDE 1QQ4A 1KTSB 2QF0A 1QA0A 1VZQH 1S85A 4LXBH 1EOJA 1Z6EA 1QL8A 1Y3YA 1B0EA 1O2ZA 1ZSLA 2ZNKH 4Z0KA 1YPJH 1BIOA 1DUEA 5DO4H 2VWMA 1EP5A 2XTTB 3ZYEA 1BMMH 3SNCA 2GT7A 1QJ6B 1HRTH 1IQHA 1MTNC 2Z94A 1C2FA 2CXVA 1PJPA 3U1JB 5ESBA 1EPTA 2YOLA 4X8VH 3VGCC 1ZMLA 1H9LB 3RXUA 2PHBA 3TIUA 5A8ZA 1C1SA 2G81E 1DSUA 2SGFE 1GHAG 1O2LA 3BIUH 1SPJA 2Z9IA 1HLTH 3SHAH 4RKOB 4UDWH 3ITIA 1RTKA 3L33A 2FYRA 2OLGA 2Y80A 1N1LA 1P12E 5A0BA 1YC0A 2FOCA 2XWBI 1DSTA 1O33A 4HZHA 4B2BA 1XMNB 2Z9KA 1PPFE 1EAXA 2BD3A 2FI3E 2KAIB 1O5EH 1K1JA 1O2IA 5DP9A 3QUMP 1N8OB 1AU8A 1NN6A 3VB3A 4B74A 1C1MA 1GHXH 1SQTA 1V2VT 2PTNA 1ABIH 1P2OA 1CBWB 2BD7A 2SGAA 5EW1H 2P94A 3BG8A 5GWZA 1ZTJA 5FXLA 3UFAA 1TONA 1EPTB 1TMTH 1C4V2 1MQ5A 1O5CB 3L6PA 3NCLA 2ESTE 4IN1A 2SNWA 1O39A 2G55A 3LKWA 2DE8A 3T62A 1ELGA 1ETSH 1SLVB 3P6ZB 1MU8B 1SLUB 3HPTB 1FY3A 1D3TB 2FZZA 1P04A 2QYIA 4U30A 2ODYB 3RC4A 3A88A 3QO6A 3MO3A 1RXPA 1AVGH 3FZZA 1NROH 3FANA 1NZQH 3TU7H 2BDBA 1GI4A 1UJ1A 2BDCA 4JK6A 4H42U 1Z8IB 5FPTA 3UOPA 4ISOA 1H1BA 4X1QU 1H9HE 1FIWA 1GG6C 1C2KA 2J2UA 1VCWA 1ZYOA 2BZAA 1OYTH 4JMYA 1W0YH 4E7NA 1B5GH 1SLWB 3SV2H 4O03A 1K1LA 1GI0A 1MKXH 4A92A 1K21H 4ZHAA 2EEKA 4I8GA 1A2CH 1YBWA 3MU8A 1NU9A 1C4U2 1EXFA 3M5MA 1EPTC 2A7JA 1O5FH 2VVCA 1TB6H 1RS0A 1EASA 1TPOA 2RA0A 1GBTA 2A45B 3MWIU 4HTCH 3UNRA 1Z1JA 3MHWU 1TX7A 1UHBA 2AIPA 3ZYDA 1S84A 1H8DH 1FI8A 1GMCG 3HK6B 3ENSB 2BDIA 4MTBA 5T6GA 1ZPZA 3RXDA 3HATH 1PQ7A 2Z6BD 5A0AE 2ANYA 2R2WU 1UK4A 3PMHB 4MPUA 4KGAA 1DS2E 3ZV9A 1MUEB 2FLBH 3K65B 5EPNA 8GCHG 1EB2A 1TQ0B 1MU6B 4K1EA 5EQRA 1KXFA 3NKKA 1BDAA 4OS7A 3ZV8A 5F8ZA 1P9UA 2O8TA 2OQ5A 3PMBB 5F8TA 4X6OA 3PMAB 4DVAU 2VIDA 1ZJKA 1BRCE 3BEIB 3TVJB 2AFQB 1SVPA 5FHTA 5AF9H 1F5RA 5H4IB 7LPRA 1RTFB 1V2MT 1P8VC 4YO9A 4XBBA 4Y10E 3RXPA 3P70B 2QY0B 4ABBA 1P2KA 1UTMA 3LGUA 2C90B 2NWNA 2Y81A 2H9EH 4CH8B 3ODFA 2FODA 2ZTXA 5DPAA 3GCTF 3FAOA 2FX6A 1UCYH 1O2KA 2TPIZ 2HNTE 5JB9S 3K2UA 1P2JA 2CHAB 4TY7A 3TGJE 4X1PU 1VITH 2Z3EA 2GCHG 1TFXA 1QA7A 2O8LA 2VGCC 1E34B 3EE0B 5A09A 1CT4E 1TIOA 3QGNB 1GCTB 1HV7A 2BD4A 2BD5A 4AGKA 1IQGA 2ZDAH 4ISNA 4KP0A 4YOGA 1TGTA 4H6TA 1J16A 2F91A 2Q6DA 1AFQB 6LPRA 2ZFSA 1ZTLA 3SNDA 2XBWA 4MPWA 4NGAH 2TRMA 1NC6A 3ZZCA 1GHWH 1BT7A 1BTPA 3SORA 3MTYA 1UTKA 5J4QA 2G51A 3B8JA 1AE8H 3F9GA 1QBOA 4CBNA 1BB0B 1MTSA 3EGKH 4RN6A 1C2LA 1TGNA 2GP9B 3LGYA 3BTME 3LT3A 3ZVGA 1EAUA 2FP7B 1MCTA 2J95A 2PW8H 2WPMS 1SQOA 4NSVA 1EP6A 4GAWA 2Z3CA 1C5QA 1XXFA 3MNCA 3E6PH 5GCHF 2ZHWH 3F9FA 3A85A 4I8HA 2AGGX 4WY3A 1NTPA 3TH2H 2P93A 2TBSA 1O3GA 1C1PA 1D6WA 4LOYH 1E38B 1OS8A 3UQVA 1T4VH 1J15A 1O37A 2THFB 3BSQA 2G52A 2XYAA 2HOBA 4JZIA 1KXEA 2G4UA 4KTUA 4OS1A 2B8OH 1GHZA 2OXSA 2B7DH 5C1YA 3I78A 1OWIA 1GBMA 4HFPB 1VGCB 1C5VA 2R9PA 2XRCA 1HB0B 2ZU3A 4OS4A 3D65E 1EJAA 1O2VA 1Z6JH 1LPZB 3M61U 5FPSA 5T3HA 1Z7KA 1TPPA 4B1TA 2I6SA 2C8ZB 3TJVA 2GZ9A 3M37A 3QGJA 2WINI 1AFQC 1P9SA 1GL0E 4I32A 2C4FH 3PV4A 1UTQA 1FAXA 2WV4A 1BMLA 3A87A 4ZXXH 2OUAA 4IMZA 4PROA 2OBOA 1CO7E 1GPZA 4TWWA 1L1GA 3GYMA 3Q77A 2OP9A 1W8BH 5A8YA 4ABIA 4B76A 1TWXB 2ZIQH 5EODA 3JZ1B 3RXTA 1LHFH 4K5ZA 5E8EH 2I6QA 2RG3A 2BD2A 3A8CA 4F4OC 1ZTKA 1AN1E 4BAOB 1C5PA 3QZRA 3TK5A 1A1RA 2C8YB 8ESTE 1D6RA 2BQWB 3AW1A 2FTMA 2C8WB 2B0FA 1BMAA 1O2QA 5E0HA 2SGPE 1ELCA 5C5OA 2Z7FE 1M9UA 1IQFA 1AE5A 3P95A 2PSXA 4DGJA 3U9AH 1FY5A 3AAVA 1LHGH 1A0LA 3M7QA 1W3CA 3RXGA 3GY4A 3T5FH 1W13U 3GISB 1GBBA 1O2PA 4Y76A 2P8OC 3ZVBA 4ZH8A 2FOBA 4XDEA 3VB6A 2JETB 4J1YA 2FDAA 4X2WA 2P16A 2XXLA 4U32A 1IQMA 4FXGH 4TY6A 1O2XA 2NU4E 3ZVEA 4ABFA 2F9NA 2FOMB 3BG4B 1BHXB 5TCCA 2VIOA 1ESBA 3URDA 1NESE 3UY9A 2VNTA 4BTIB 3BV9B 3V0XA 1W10U 2H9HA 4NA9H 4AB9A 2XCFA 1JIMA 1ESAA 1WQVH 3PLBA 1SGNE 1GDQA 2F3CE 3ZZ4A 1ANCA 1FPHH 4I8KA 1W7GH 3ZZDA 3O8BA 3MI4A 1A3EH 2QN5T 4FU7A 3B23B 2AERH 1FLEE 1OXGA 1Q3XA 3MYWA 1HUTH 1S0QA 1ZSKA 3RXVA 1O30A 2EC9H 4AFSA 1TX6A 3B9FH 1FY4A 1DVAH 5I25A 1TQ7B 1YPHE 4DOQA 4RSPA 2Q6GA 2QV1A 1DXWA 3RXAA 1GBDA 4BAMB 2CGAA 3RC6A 1HJAC 5L6NH 1NRNH 3MU1A 4D7GA 5DJ7A 5A8XA 2CF8H 3P8NA 1UTPA 1AVXA 2F9OA 4A7IB 1C5YB 2PFEA 1OKXA 2UWLA 2O8UA 3DUXH 3SZNA 2H6MA 1O2WA 1UVOA 4XBCA 3RM0H 6CHAB 4AORA 2W5EA 3OU0A 4MG3A 3SU4A 1F0TA 3UWIA 2FX4A 1D3PB 3T29A 1CHGA 3I29A 4DURA 1E37B 1KTTB 2O8WA 2NU1E 3BEFB 3R0FA 1GBCA 1BTHH 1P3EA 3LU9B 4GCHF 4CR5A 2JKHA 4I8LA 2QXHA 1SGFA 2WUCA 1NT1A 1BTUA 2F9VA 2HLCA 1O2TA 3PB1E 1IHSH 4DIHH 4NSYA 1A0HB 3UQOA 7GCHF 3DFJA 3RDZA 4Q7XA 4O9VA 2BMGB 2QAAA 4OS2A 3SGQE 4WH8A 1HCGA 3RXEA 3PM3A 5PTPA 5EQQA 4Z6AH 1O2UA 1BRBE 1GI2A 4X8TH 4VGCB 5CHAB 4DW2U 3QK1A 2J94A 1YGCH 4DCDA 1S0RA 1QY6A 4JZDH 1QHRB 2P59A 5FX5A 1SGRE 4O97A 2BDHA 1EJNA 1HXEH 1ZSJA 2V0BA 1KDQA 3UIRA 1O3CA 2TGAA 1XM1A 2CN0H 5HYOA 3SJKA 1OWJA 3UNSA 4FUIA 1GBIA 1YLCA 1LVOA 3SJ8A 2ZGBH 1MBQA 3SV9A 3O8CA 3IITA 3S69A 1XUFA 2JH0D 1TMUH 3ZVDA 4NWKA 1G37A 1AHTH 2WYGA 3C1KA 2PLXA 1O3KA 2STBE 1KLTA 1YF4A 2OINA 2ZG0H 3UPEA 2ZQ1A 3P8GA 2QGRA 3KL6A 3SV8A 4ZKSU 1OX1A 1HAYB 4X8SH 1ZJDA 4H4FA 3RLYH 5SGAE 4K1TA 2F9PA 5LGOA 2BY7X 4BOHA 2ZTYA 1BCUH 1RD3B 2A1DB 4KTSA 3RU4T 5L30H 2VGCB 2BM2A 1GVZA 3K6ZA 1ACBE 7ESTE 3LIWA 1FIZA 2ZFRH 1WYKA 4K69A 4X6PA 3SU6A 1PFXC 1Y8TA 1NS3A 4X1SU 1G3DA 4AG2A 4MNYA 1C5ZB 2PUXB 4JYUH 1FV9A 3LGIA 2BLWA 1Y3WA 5AHGH 5EOKA 5F03A 2QIQA 2BQ6B 1IQLA 3A89A 1HDTH 1AIXH 1QB1A 5F6MA 2ZEBA 1FY1A 1SOZA 1QRXA 1TA6A 3KEEA 2JH5D 5C67A 1RIWC 1G3CA 1BHXF 3ZZ8A 1HIAA 4I31A 1TALA 2PWXA 2W7UA 4CRFA 1MCVA 4DT7B 4X2YA 4MNWA 3A7XA 1DITH 2BTCE 1GI7B 3PMJA 1GG6B 1KIGH 1AWHB 2ZTZA 4XOJA 3E90B 1O5AB 1DY8A 4AB8A 1B7XB 1NPMA 4X2VA 1V2ST 4D9QA 1K1MA 2ZHQH 5ABWA 1YPKH 3MU4A 1PPZA 2PV9B 2ZDLA 2DUCA 4Q7YA 1QURH 3SI4H 2Y5GA 4KTCA 4I8JA 1C2MA 1HNEE 3M7UA 4ZUHA 4WWYA 4MDSA 1F5LA 2BY6X 2H2ZA 1TE0A 2ZHDA 3P17H 2H9TH 1YPHC 2BX3A 3TJUA 1S83A 1KXBA 4E06H 3KF2A 3SW2B 1NFYA 3MH5A 3GICB 1GMDF 5HGGA 4DY7B 1A0JA 4UFDH 4MPVA 1FN6A 1MQ6A 1H8IH 4K8BA 4WMEA 2SGQE 1WTGH 1DANH 1V2RT 1C5OH 1TLDA 4IC6A 1ELEE 1EX3A 3RMMH 2A32A 3U8RH 1BRAA 5DG6A 4B73A 1QB6A 2FYQA 5K0HA 9ESTA 1ARCA 1SG8B 1LVMA 3V13A 1DWEH 3HKIB 4Y79A 3SU5A 1SGTA 3L3TA 2BD9A 4Y8XA 3M36A 5AVDA 3A8BA 4AYYB 5TCAA 1IHTH 5EG4A 2A5IA 3TK6A 2HGTH 7GCHG 2ULLA 4BAKB 3SBKA 2RCEA 2OTVA 3AW0A 1K9OE 1GMDG 2FOHA 1MTNB 4XE4A 2UUFB 1MMJN 2BY5X 5HMAA 1GJDB 1W11U 3DT0H 4ZHLU 3STJA 3SNBA 1O36A 2GMTC 1SGPE 2BOHB 1N6YA 1V2JT 3LJJA 3M5OA 1DLKB 3NXPA 3OY5U 4UFEH 1SGEE 1GMHG 1SHHB 3H7OA 1C4Y2 3GCHC 1UTLM 2PGBB 5C1UA 1O5DH 1O2NA 1QNJA 4K3JA 2VIWA 1QR3E 5GPIB 3RXRA 1D9IA 2FEQH 4B75A 2FS8A 1A5GH 4ZHMU 1C1WH 1HAIH 3PLKA 3AASA 4JYVH 1BBRH 1EQ9A 1XUJA 4Y8YA 4IBLH 2NU2E 1CT2E 2BVRH 3UWJH 2HNTF 2CF9H 5TJXA 4A1TA 2HWLB 1A61H 4AYVB 4Q2KA 2R2MB 1XX9A 4WMDA 1AWFH 3SI3H 4I7YH 1BBRK 3BIVH 4U01A 4NCYA 4GPGA 4UE7H 1O32A 1ZMNA 2Y7ZA 3OYPA 2FESH 3A7TA 2FOEA 3M7TA 2J9NA 4CHAC 2GV7A 2RDLA 2ZI2H 4WH6A 1HAOH 2FM2A 1K1NA 2SFAA 4CRDA 3LGWA 2QXIA 1QJ1B 3EA7A 4YESB 3O8RA 3MU5A 4FUBA 1L4ZA 1S5SA 1SC8U 5CHAC 6GCHG 1L1JA 1K1PA 4NG9H 1CVWH 3V12A 1V2OT 3SUEA 3VFEA 2VU8E 1EOLA 4BTTB 2PKSC 1INCA 3QN7A 4AOQA 3SNEA 2WPLS 4WF8A 2Z9GA 4NIXA 1HXFH 1YCPM 4IMQA 1GBFA 1MBMA 3CENA 3KHVA 1GWAA 2ZO3H 2JETC 2FOGA 1F5KU 4YT7H 4OS6A 1MTWA 1BTWA 1TNKA 1WU1A 3GCNA 3ZZ5A 1CA8B 5K7RA 4Y7AA 3F1SB 4B2AA 3VXFH 2C3SA 3MH6A 4CR9A 2QXJA 2Y5FA 1EJMA 3T25A 1O38A 3SJIA 3U69H 4ABHA 3CS0A 2QA9E 2UWOA 2A7CA 1BTYA 1BBRE 1T7CA 2VINA 4A1XA 3E3TA 5B6OA 1FY8E 1NFWA 2BDGA 5FCKA 1DDJA 2OC8A 1KXCA 3M5LA 2ZDMA 2ZPQA 1BJUA 1G3EA 4FUCA 4Y7BA 1C9TA 4Q80A 3MNXA 1GHVH 1JIRA 1L1NA 2BHGA 2BQ7B 1P2MA 2V35A 8LPRA 1C1OA 1OWDA 2ZCLP 4WXVA 3IG6B 1UVUH 1GDNA 1KY9A 4KELA 4ZKOU 1QQUA 3RXLA 1QBNA 3PWCA 1THRH 1QFKH 2HNTC 3QWCH 1DE7H 4AZ2B 5FAHA 1GJ9B 2ZECA 1IQJA 2J34A 1O2GH 1P01A 2QXGA 3ZZ3A 4QT8C 1O3IA 4ASHA 1Y5BT 2CMYA 2ANKH 1BUIA 1O2SA 2G5NA 1SGDE 1EKBB 1YPLH 2AMQA 1AY6H 1NY22 3M3TA 1O3AA 1S81A 3PYHA 3TNTA 3SU3A 3Q00A 1QRWA 1OWHA 1C1UH 1EZUC 3MFJA 2VVVA 3DA9B 3BG4C 3TK9A 1RRKA 4E7RG 1TBQH 1XUHA 1FN8A 1EZSC 1TX8A 4Y11E 1O34A 3A80A 2ZHFH 1BRUP 1QTFA 4ABGA 2AGIX 3E91A 4X0WU 1Y3XA 2Y82A 2VH6A 3LGVA 2FTLE 3A82A 4INLA 1OWEA 3VGCB 3MMGA 4TYDA 2BD8A 2BOKA 3SHCH 4D8NA 1O3PB 4DIIH 4YZUA 2ANWA 1QJ7B 2PKAA 1ZGIA 3U98H 3ZZ7A 1V2NT 5JBCS 4MVNA 4NZQA 1UTNA 1SFQB 2D8WA 5DP6A 3GCHB 1O3BA 2AMDA 3TGKE 1HGTH 3SGAE 2ZWLH 2A5KA 1ARBA 3PTNA 1TNJA 1N8OC 2XC0A 1EZXC 1YCPK 2VH0A 2G00A 1ZHPA 2XC5A 1OP0A 1C5MD 1UVTH 4JZFH 1BJVA 1SFIA 1F0SA 1LO6A 4YLUA 3U8TH 1GMHF 2BVSH 1ZPBA 2PR3A 1YPEH 5HM9A 4UEHH 4XBDA 5G4BA 3DD2H 2BY8X 2G8TA 2ZDVH 1VJAU 1YM0A 5HM2A 2FMJA 1O35A 3RU4D 2W3IA 3SQEE 2Z9JA 1LDTT 4YLQH 3EA8A 1JRSA 3GOVB 3EA9A 3ZVCA 4NZLA 1T8MA 4FU8A 1P05A 3BTTE 3ODDA 1GJBB 3RU4E 3A8DA 2BDYA 4ZAEA 1Y3UA 2WPIS 2EI7A 1AZZA 1RIWB 1LMWB 3NK8A 1ETRH 4FUHA 3LH3A 3S7KB 1LPKB 4Y6DA 4E05H 1V2QT 4CBOA 4ISLA 1AO5A 3U8OH 3VPKA 1GI9B 2OQUA 1EAWA 3SQHE 1Y59T 5DP7A 4LK4A 1UCYE 2PSYA
chains in the Genus database with same CATH superfamily
2QF3A 1IQIA 2A0QB 3RM2H 4AG1A 2ZF0H 1FXYA 4Z1MD 2VWOA 4A6LA 3E1XB 3WWFA 3SU0A 1WTHD 5E2OA 1ZPCA 4K8YA 4WXIA 1GHAF 4Y0ZE 1CSOE 2JJ1D 1T4UH 2BVXH 4A5TS 3V7TA 1E79D 1BOQA 1W0KD 3T27A 1O2MA 2ZCHP 1TPSA 1CGIE 4FVDA 5F8XA 1HJ9A 4Y71A 4NIYA 1PPBH 1F2SE 5DK1A 2XBVA 1WUNH 1AUTC 1TA2A 3M3SA 2GZ7A 4CRAA 1PQ5A 1NBMD 1ZLRA 2LELA 3HK3B 5C2ZA 5HXFA 1KDQB 3LOXA 1SBWA 2M2AA 4BTUB 1LHEH 1P03A 1V2UT 3TJNA 3F6UH 1LHCH 1AZ8A 4YXWD 3GY3A 4INKA 1TOCB 3I77A 5A2MH 3DFLA 2BLQA 4O3TA 1J17T 1Y5AT 1NU7B 4YOIA 3FP7E 1PQ8A 2A2QH 1QRZA 3Q3KA 5GNDA 2ZCKP 2UUKB 2XBXA 4R0IA 1ZHRA 2WYJA 2FXRA 2LP6A 1YPMH 2ZU4A 1ELAA 1FQ3A 1HAVA 1L0ZA 5FPYA 4Q4LA 1YPGH 2J38A 5DGJA 1E35B 1SR5C 1KLIH 4ISIH 1MAYA 4IS5A 4ZKNU 1FDPA 5BRRE 2BY9X 3S9CA 4FUEA 1TPAE 2FI4E 1WCZA 2GMTB 1ELDE 1ZGVA 2YMSB 4ACBA 4BNRA 4CRGA 3ATKA 1HPGA 1TOMH 1G9IE 3WWBA 2G5VA 5KEDA 1GJCB 1F7ZA 2HVXA 3GDUA 4VGCC 5E0JA 1PPHE 1CE5A 1GGDC 2VJ1A 3ESTA 2ZZUH 1PPEE 2TIOA 4NWLA 4RKJB 2K8IA 1C5TA 3TLOA 1JMOH 1UK2A 1GHYH 4X2XA 1O31A 3MO9A 4ZKRU 1HJAB 3PO1B 3KQEA 5EU8A 1C2DA 3H5CB 2V3OH 1J9CH 2ZDNA 3PRBA 1FJSA 5DKMA 3SV7A 1C2IA 1GBAA 1XUKA 1ETTH 3ZZ6A 1BA8B 1AVWA 4X6NA 1C1TA 1QCPA 2Q1JA 3Q3XA 4ABDA 1CGJE 2AMPA 1LQDB 1O3EA 1OP8A 1TGBA 3M35A 1FUJA 4Q7ZA 1V3XA 2F43B 2R0LA 1C1RA 3ZZ9A 1SGQE 4FETA 2IPQX 3KYGA 5AFZH 3RMOH 3OY6U 2WZQA 1P09A 5DP5A 1ZRKA 1MKXK 4I33A 2FOAA 2ZPRA 1TNGA 4F49A 3Q76A 3KCGH 3NZIA 3GCOA 1SB1H 5JBBS 3RXOA 1O0DH 3FFGA 4JZ1A 3TGIE 3A7YA 1EUFA 1IQNA 4JK5A 4P00A 2PTCE 3PWBA 4OM9A 5ETXA 2IJOB 3OTJE 1ANDA 4ZMAH 2C8XB 1BTZA 1OYQA 1LVYA 2D2DA 2KZ4A 3OSYA 4TPYA 2UUJB 2BX4A 1VCQA 3BTGE 4NFFA 1K1OA 1CHOG 2EI8A 3S0NA 2Y5HA 1HAZB 3BTWE 1EATA 4B71A 2KAIA 2VB0A 1NFXA 1KXAA 2HPPH 1CA0B 2Q6FA 4B2CA 1DLEA 1KYNA 1OP2A 1GVKB 5FBEA 1LQEA 2OC7A 3TH4H 1Q2WA 2AH4X 1SOTA 1YCPH 2ODQA 2VIVA 3RC5A 2NU0E 3BTHE 2STAE 2XW9A 1TBZH 1V2LT 1NM6A 3ATWA 3NUMA 3GY2A 1DUAA 3FP6E 2GV6A 4DJZB 4CREA 1LHDH 3PO1C 4OGYA 2ZFQH 1P2IA 1GBHA 1S6HA 1C2EA 1IQEA 1HAHH 1K1IA 3A7VA 5EXNA 8GCHF 3ATMA 4ESTE 5EQSA 1UVPA 2GCTC 1Y5UT 1O2JA 1BQYA 1O3FA 2IOTA 1VJ9U 1ZZZA 5AFYH 3FOAA 5C3NA 2ZGJA 1DPOA 4UONA 4NIVA 1A46H 1WQSA 1GMCF 1UVSH 2R0KA 1MKWK 2GD4B 2RA3A 1AKSB 7KMEH 1P3CA 2VWNA 1C1NA 4IW4E 1NFUA 3BF6H 3EQ0H 1UCYK 1DFPA 3T26A 1OPHB 2WV5A 4IN2A 3TH3H 1EZQA 3VEQB 3VB7A 4NA8A 1SSXA 1L4DA 3M3VA 2F9BH 4GLYA 3WW7A 1GVLA 3TJOA 2BZ6H 4JYTA 4NIWA 2G4TA 1UTJA 4NFEA 1IOEA 3N7EA 5E0GA 3P8FA 4YT6H 2D26C 4Y8ZA 4O3UA 1F0RA 2PUQH 1C5NH 5C20A 3RXQA 1CQQA 1W7XH 2F83A 2H1UA 2J98A 1KLJH 3EDXB 3VXEH 5JDUB 5EW2H 3FZDA 3O8DA 4ZROA 2LNCA 3U28C 3A81A 5DP8A 1FONA 1QL9A 1A5IA 1K28D 1TNHA 1CA0C 4IC5A 3T2NA 6GCHF 2TGPZ 3OFND 2H5CA 3R3GB 5LPRA 2ZHEH 5FBIA 5DP3A 1C5XB 3STIA 1HYLA 3RMLH 4UD9H 3P8OA 1XXDA 2ALVA 2V3HH 1B0FA 2R3UA 2HALA 3BTEE 2BLOA 4OS5A 1O5BB 3OAAD 5LPFA 5E2PA 2B9LA 3EE7A 4FVBA 3ZIAD 3C27B 1QIXB 1MKWH 3LPRA 1LPGB 1T8LA 1MAXA 2ODPA 3F0PA 4F55A 1RGQA 3BTDE 4BAQB 2PKAB 1GJ4H 2FWWA 1TABE 2ZP0H 1AGJA 4LZ1H 2CV3A 1THSH 2W26A 3A8AA 4X1RU 1TMBH 1W14U 2P95A 1V2KT 1MZAA 1Z71A 1O5GH 1FPCH 2GT8A 2OBQA 4X8UH 3BN9A 2ALPA 1MTVA 1ZOMA 3SUFA 2OC0A 1P11E 1ZRBA 2VIQA 2WHXA 5LPEA 1TRYA 5GCHG 1C2GA 1C5WB 1Z8JB 4K1SA 2AGEX 4JCNA 4UFFH 4SGAE 3URCA 3ZZBA 1V6DA 1H9IE 3UUZA 3TPIZ 3VB5A 3S9BA 2DE9A 4WVPE 1NO9H 1P57B 2A2XH 4XFQA 1P0SH 3RUOA 1LKBA 1O3MA 1WXRA 4M7GA 3BTQE 6ESTA 3AVZA 2SNVA 3F2GA 2ZU5A 1JOUB 1GL1A 2K1QA 3TITA 5C1XA 1T32A 1U6QA 1P06A 2H5DA 1MZDA 1T8NA 3IWMA 3MU0A 2ZGXH 4TWYA 1T31A 1AKSA 1O2HA 4ISHH 1LKAA 3Q3YA 1YP9A 3RXBA 1O3HA 1GDUA 1G36A 5GJ4B 2VIPA 4FUJA 4AN7A 3LGTA 1HFDA 3UB0A 2EI6A 3ZVFA 1P02A 3CS7A 4JZEH 2WUBA 1W2KH 3GY7A 1FMGA 1HAPH 5B6LA 1RJXB 2WPKS 1HAXB 3QZQA 1GBJA 3SNAA 1Z1IA 3OX7U 3RXFA 2GKVE 1BZXE 1AFEH 1HIAB 2R3YA 5EXLA 3A86A 4YM9A 1ID5H 4U2WA 2B5TB 1O3JA 1HAGE 2FIRH 2GTBA 3SOSA 1MTUA 1GJ6A 2J4IA 1AB9B 1SGYE 1GI1A 4ABEA 2Z9LA 3F9EA 5HKKD 1PQAA 3FVFB 1GHBG 5JBAS 3F68H 3KGPA 2IN2A 1WSSH 4CH2B 2W3KA 4XRNA 2VVUA 1GCTC 2FLRH 4MPXA 1S6LA 1J8AA 1C2JA 4BXSA 3DSPA 2P3FH 1AD8H 3RLWH 3RXHA 3VB4A 1OOKB 1RTLA 5JBTA 1QBVH 3RXCA 1HBTH 1GHBF 2BLVA 2A4OA 3WY8A 1YKTA 1PYTD 2KCYA 1AI8H 2OD3B 1PPCE 2XWAA 1CT0E 1RFNA 3ATLA 4ABAA 3LC3A 2GX4A 4X1NU 1W0JD 1TRNA 3EYDA 3E0PB 2KCPA 4MLFB 2ZFFH 3U1IB 5CDFE 1K0HA 1OWKA 1DX5M 1XVOA 2NU3E 5EGMA 4D7FA 3UR9A 1Z8RA 3H09A 3HGNA 3ELAH 5J4SA 2IPHA 1VITG 3SGBE 2LPRA 5DSFA 3SUGA 1DWCH 1GBEA 1TAWA 1PYTC 3UTUH 3SN8A 2P8OB 3KNXA 1VGCC 4OGXA 5IDKA 1PPGE 5IYTA 3QTVH 4YOJA 3RP2A 5C5NA 1S6FA 1NRPH 3AAUA 4GCHG 1CHOF 2BB4A 1TGCA 1ORFA 3ZZAA 5JYIA 1UO6A 3W95A 1WAYB 3SUDA 1WDIA 2AYWA 1F0UA 5EPYA 4AX9H 1N6XA 4K2YA 4DG4A 3S9AA 2F9UA 5GXPA 3PLPA 2EA3A 4Y0YE 1A4WH 3HKJB 2A7HA 2GCTB 1DM4B 1GJ7B 2XC4A 3BTKE 3SU1A 2PGQB 2Y6TA 1AMHA 2ZFTA 1O3OA 4BAHB 2HPQH 1BTXA 3UOUA 4KKDA 1G30B 1J14A 4GHTA 2Z3DA 1C1QA 3N7OA 3S7HB 1Q31A 3SJ9A 1GCDA 4RI0A 2BYAX 2A4GA 1XKBC 1L2EA 1W0ZU 1YLDA 1C2HA 2GCHF 1Z8GA 2ZU2A 1GBKA 2ZKSA 2ZC9H 1UTOA 1UHBB 1P10A 2QC2A 4WMFA 2YMSC 4GHQA 1TNIA 3HGPA 4XSKU 4THNH 2GZ8A 1ZR0A 5EXMA 3T28A 1H4WA 2V6NA 1V2TT 1QB9A 2ZPSA 2C93B 1XKAC 1D3DB 2ZU1A 1E0FD 5EJZA 3M5NA 1DY9A 4TSFD 2BXTH 3UNQA 1OHHD 1UK3A 2ZDKA 4ZCNA 1D3QB 3E8LA 9LPRA 4J2YB 3A7ZA 2ILNA 2D1JA 1GJ8B 4AFUA 1A7SA 4AGJA 4MQAA 1AQ7A 1EAIA 2XCNA 1X7AC 3UR6A 3ZVAA 1CU1A 1YYY1 1DT2A 1O2OA 3QLPH 1G32B 4MNXA 1TRMA 1WBGB 4SGBE 4LZ4B 3P92A 3NWUA 1F92A 4AFZA 5I46H 1S82A 3SU2A 3MH4A 5FCRA 3QX5H 1C1VH 1K22H 1O2RA 1C5LH 2FI5E 1MD8A 1SQAA 5L2YH 1HAVB 5CE1A 4GVUA 4K60A 1KXDA 1CGHA 2UWPA 3W94A 1G2LA 4AFQA 1JXPA 1A3BH 1THPB 1IAUA 3EAJA 5A0CA 3F9HA 3GDSA 2JH6D 1ZHMA 4H6SB 2Y7XA 2O9QA 3G01A 3MO6A 1ANBA 5CMXH 3SO3A 3LJOA 3QTOH 2CK3D 3H7TA 1XUGA 5EJ1A 1XUIA 2OC1A 3RXJA 2FPZA 3JZ2B 4FUFA 3OEED 1SMFE 2TGDA 1FNIA 4CHAB 3MNBA 3GDVA 2WPJS 3MNSA 1ABJH 2BDAA 1ELFA 1QL7A 4BANB 3KQCA 1V2PT 3BTFE 1ELBA 1SL3A 2CJIA 1VR1H 3UREA 1O3DA 1P2QA 1FZZA 2ASUB 3MQKC 2ZFPH 1TNLA 4R8TB 8KME2 1GGDB 1TBRH 1UW7A 4AC9A 4CRBA 2QCYA 1BITA 1GI3A 3MOCA 4NA7A 3D62A 5GIBA 1NRRH 3LH1A 1C9PA 1SHYA 2CHAC 1D4PB 1KSNA 4CRCA 2W7SA 2YNAA 2PKSB 2WV9A 1NRSH 1TYNA 1O3NA 3PROA 2ANMH 1E1QD 2P3TB 4GSOA 3RMNH 2GDEH 5JPMH 1G3BA 1SLXB 3FP8E 3SV6A 1A5HA 1LVBA 3SJOA 3LC5A 1GJ5H 1GI6A 5T6DA 3K6YA 4FUDA 2AS9A 2FO9A 2A5AA 2KFWA 4B6FA 3FO8D 5L2ZH 5JB8S 1P2NA 1JBUH 1IQKA 3A84A 1VITF 3KN2A 1E36B 1GI8B 1MD7A 1AUJA 1XVMA 4INHA 2P3UB 1G2MA 3LONA 4BXWA 1O3LA 1Y3VA 1C5UA 1YLNA 1DICA 3QDZB 2O8MA 4D76A 3KQBA 3CP7A 1C5RA 1DOJA 2TGTA 3GY6A 1C5SA 3NPSA 4FU9A 1ESTA 1ZMJA 1WOFA 5FX6A 4ZXYH 3LDXH 3PV2A 2GGVB 1LTOA 3E0NB 3GCTG 4GUXA 5BPEA 2FOFA 4YTAA 5LH8A 3ATIA 2ZQ2A 3D23A 2WPHS 3DHKH 1OSSA 1SGFG 1DWDH 1VCPA 1SGCA 4HI3A 1JRTA 1SGIB 4HGCA 4ABJA 1UMAH 2A4QA 1LCYA 1ANEA 1JWTA 1T8OA 1DWBH 1WV7H 3E16B 3K9XB 4A1VA 3TNSA 2ZA5A 5DP4A 2A4RA 1HJ8A 2M5TA 2J92A 3A7WA 2EY4C 4MNVA 5ESTE 4D9RA 3BEUA 2OCVB 2FS9A 3KQDA 3RXMA 1K2I1 3D49H 4UFGH 4WJG2 4X6MA 2UUYA 1GJAB 5T6FA 1NRQH 1EB1H 2GDDA 3PTBA 1ELTA 3RXSA 1FAKH 6CHAC 5GDSH 1GI5A 1W12U 2ZGCA 1GBLA 1DXPA 2AIQA 2IJD1 2ZGHA 3RXIA 2VWLA 1ELVA 2XNIA 3GY8A 1MH0A 3MH7A 3PRDA 1TGSZ 2HRVA 3RXKA 1CBWC 1V2WT 1BMNH 2KX4A 3GY5A 3GYLB 3V3MA 1QGFA 3KIDU 2SGEE 1SI5H 2GVFA 4TPIZ 2BXUH 4FUGA 4IGDA 2XBYA 1O2YA 4P02A 2A31A 2YNBA 1AB9C 2AEIH 3A83A 2SGDE 1QQ4A 1KTSB 2QF0A 1QA0A 1VZQH 1S85A 4LXBH 1EOJA 1Z6EA 1QL8A 1Y3YA 1B0EA 1O2ZA 1ZSLA 2ZNKH 4Z0KA 1YPJH 1BIOA 1DUEA 5DO4H 2VWMA 1EP5A 2XTTB 3ZYEA 1BMMH 3SNCA 2GT7A 1QJ6B 1HRTH 1IQHA 1MTNC 2Z94A 1C2FA 2CXVA 1PJPA 3U1JB 5ESBA 1EPTA 2YOLA 4X8VH 3VGCC 1ZMLA 1H9LB 3RXUA 2PHBA 3TIUA 5A8ZA 1C1SA 2G81E 1DSUA 2SGFE 1GHAG 1O2LA 3BIUH 1SPJA 2Z9IA 1HLTH 3SHAH 4RKOB 4UDWH 3ITIA 1RTKA 3L33A 2FYRA 2OLGA 2Y80A 1N1LA 3OEHD 1P12E 5A0BA 1YC0A 2FOCA 2XWBI 1DSTA 1H8HD 1O33A 4HZHA 4B2BA 1XMNB 2Z9KA 1PPFE 1EAXA 2BD3A 2FI3E 2KAIB 1O5EH 1K1JA 1O2IA 5HIZA 5DP9A 3QUMP 1N8OB 1AU8A 1NN6A 3VB3A 3F0OA 4B74A 1C1MA 1GHXH 1SQTA 1V2VT 2PTNA 1ABIH 1P2OA 1CBWB 2BD7A 2SGAA 5EW1H 2P94A 3BG8A 5GWZA 1ZTJA 5FXLA 3UFAA 1TONA 1EPTB 1TMTH 1C4V2 1MQ5A 1QZ8A 1O5CB 3L6PA 1SQRA 3NCLA 2ESTE 4IN1A 2SNWA 1O39A 2G55A 2XOKD 3LKWA 2DE8A 3T62A 1ELGA 1ETSH 1SLVB 2JDID 3P6ZB 1MU8B 1SLUB 3HPTB 3FKSD 1FY3A 1SKYE 1D3TB 2FZZA 5KGOA 1P04A 2QYIA 4U30A 2ODYB 3RC4A 3A88A 3QO6A 3MO3A 1RXPA 1AVGH 3FZZA 1NROH 3FANA 1NZQH 3TU7H 2BDBA 1GI4A 1UJ1A 2BDCA 4JK6A 3W1EA 4H42U 5KECA 1Z8IB 5FPTA 4RT1A 3UOPA 4ISOA 1H1BA 4X1QU 1H9HE 1FIWA 1GG6C 1C2KA 2J2UA 3CNRA 1VCWA 1ZYOA 2BZAA 1OYTH 4JMYA 1W0YH 4E7NA 1B5GH 1SLWB 3SV2H 4O03A 1K1LA 1GI0A 1MKXH 4A92A 1K21H 4ZHAA 2EEKA 4I8GA 1COWD 1A2CH 1YBWA 3MU8A 1NU9A 1C4U2 1EXFA 3M5MA 1EPTC 2A7JA 1O5FH 1TB6H 2VVCA 4ASUD 1RS0A 1EASA 1TPOA 2RA0A 1GBTA 2A45B 3MWIU 4HTCH 3UNRA 1Z1JA 3MHWU 1TX7A 1UHBA 2AIPA 3ZYDA 1S84A 1H8DH 1FI8A 1GMCG 3HK6B 3ENSB 2BDIA 4MTBA 5T6GA 1ZPZA 3RXDA 3HATH 1PQ7A 2Z6BD 5A0AE 2ANYA 2R2WU 1UK4A 3PMHB 4MPUA 4KGAA 1DS2E 3ZV9A 1MUEB 2FLBH 3K65B 5EPNA 8GCHG 1EB2A 1TQ0B 1MU6B 4K1EA 5EQRA 1KXFA 3NKKA 1BDAA 4OS7A 3ZV8A 5F8ZA 1P9UA 2O8TA 2OQ5A 3PMBB 5F8TA 4X6OA 3PMAB 4DVAU 2VIDA 1ZJKA 1BRCE 3BEIB 3TVJB 3VG8A 2AFQB 1SVPA 5FHTA 5AF9H 1F5RA 1NBME 5H4IB 7LPRA 1RTFB 1V2MT 1P8VC 4YO9A 4XBBA 4Y10E 3RXPA 3P70B 2QY0B 4ABBA 1P2KA 1UTMA 3LGUA 2C90B 2NWNA 2Y81A 2H9EH 2RDEA 4CH8B 3ODFA 2FODA 2ZTXA 5DPAA 3GCTF 3FAOA 2FX6A 5C17A 1UCYH 1O2KA 2TPIZ 2HNTE 5JB9S 3K2UA 1P2JA 2CHAB 4TY7A 3TGJE 4X1PU 1VITH 2Z3EA 2GCHG 1TFXA 1QA7A 2O8LA 2VGCC 1E34B 3EE0B 5A09A 1CT4E 1TIOA 3QGNB 1GCTB 1HV7A 2BD4A 2BD5A 4AGKA 1IQGA 2ZDAH 4ISNA 3DSGA 4KP0A 4YOGA 1TGTA 4H6TA 1J16A 2F91A 2Q6DA 1AFQB 6LPRA 2ZFSA 1ZTLA 3SNDA 2XBWA 4MPWA 4NGAH 2TRMA 1NC6A 3ZZCA 1GHWH 1BT7A 1BTPA 3SORA 3MTYA 1UTKA 5J4QA 2G51A 3B8JA 1AE8H 3F9GA 1QBOA 4CBNA 1BB0B 1MTSA 2WPDD 3EGKH 4RN6A 1C2LA 1TGNA 2GP9B 3LGYA 3BTME 3LT3A 3ZVGA 1EAUA 2FP7B 1MCTA 2J95A 2PW8H 2WPMS 3F3BA 1SQOA 4NSVA 1EP6A 4GAWA 2Z3CA 1C5QA 1XXFA 3MNCA 3E6PH 5GCHF 2ZHWH 3F9FA 3A85A 4I8HA 2AGGX 4WY3A 1NTPA 3TH2H 2P93A 2TBSA 1O3GA 1C1PA 1D6WA 4LOYH 1E38B 1OS8A 3UQVA 1T4VH 1J15A 1O37A 2THFB 3BSQA 2G52A 2XYAA 2HOBA 4JZIA 1KXEA 2G4UA 4KTUA 4OS1A 2B8OH 1GHZA 2OXSA 2B7DH 5C1YA 2OK5A 3I78A 1OWIA 1GBMA 4HFPB 2QF4A 1VGCB 1C5VA 2R9PA 2XRCA 1HB0B 2ZU3A 4OS4A 3D65E 1EJAA 1O2VA 1Z6JH 1LPZB 3M61U 5FPSA 5T3HA 1Z7KA 1TPPA 4B1TA 2I6SA 2C8ZB 5DN6D 3TJVA 2GZ9A 3M37A 3QGJA 2WINI 2HVYB 1AFQC 1P9SA 3FN8A 1GL0E 4I32A 2C4FH 3GS9A 3PV4A 1UTQA 1FAXA 2WV4A 1BMLA 3A87A 4ZXXH 2OUAA 3N99A 2J97A 4IMZA 2OBOA 1CO7E 4PROA 1GPZA 5EIYA 4TWWA 1L1GA 3GYMA 3Q77A 2OP9A 1W8BH 5A8YA 4ABIA 4B76A 1TWXB 2ZIQH 5EODA 3JZ1B 3RXTA 1LHFH 4K5ZA 5E8EH 2I6QA 2RG3A 2BD2A 3A8CA 4F4OC 1ZTKA 1AN1E 4BAOB 1C5PA 3QZRA 3TK5A 1A1RA 2C8YB 8ESTE 1D6RA 2BQWB 3AW1A 2FTMA 2C8WB 4ACAA 2B0FA 1BMAA 1EFRD 1O2QA 5E0HA 3SYJA 2SGPE 1ELCA 5C5OA 2Z7FE 1M9UA 1IQFA 1AE5A 3P95A 2PSXA 2HLDD 4DGJA 3U9AH 1VKYA 1FY5A 3AAVA 1LHGH 1A0LA 3M7QA 1W3CA 3RXGA 3GY4A 3T5FH 1W13U 3GISB 1GBBA 1O2PA 4Y76A 5FL7D 2P8OC 3ZVBA 4ZH8A 2FOBA 4XDEA 3VB6A 4XD7D 2JETB 4J1YA 2FDAA 4X2WA 2P16A 2XXLA 4U32A 1IQMA 4FXGH 4TY6A 1O2XA 2NU4E 3ZVEA 4ABFA 2F9NA 2FOMB 3BG4B 1BHXB 5TCCA 2VIOA 5C0TA 1ESBA 3URDA 1NESE 3UY9A 2VNTA 4BTIB 3BV9B 3V0XA 1W10U 2H9HA 4NA9H 4AB9A 2XCFA 1JIMA 1ESAA 1WQVH 3PLBA 1SGNE 1GDQA 2F3CE 3ZZ4A 1ANCA 1FPHH 4I8KA 2VBCA 4Q63A 1W7GH 3ZZDA 3O8BA 3MI4A 1A3EH 2QN5T 4FU7A 3B23B 2AERH 1FLEE 1OXGA 1Q3XA 3MYWA 1HUTH 1S0QA 1ZSKA 3RXVA 1O30A 2EC9H 4AFSA 1TX6A 4M9FA 3B9FH 1FY4A 1DVAH 5I25A 1TQ7B 1YPHE 4DOQA 4RSPA 2Q6GA 2QV1A 1DXWA 3RXAA 1GBDA 4BAMB 2CGAA 3RC6A 1HJAC 5L6NH 1NRNH 3MU1A 4D7GA 2KCAA 5DJ7A 5A8XA 2CF8H 3P8NA 1UTPA 1AVXA 3OE7D 2F9OA 4A7IB 1C5YB 2PFEA 1OKXA 2UWLA 2O8UA 3DUXH 3SZNA 2H6MA 1O2WA 1UVOA 4XBCA 4FOUC 3RM0H 6CHAB 4AORA 2W5EA 3F2HA 3OU0A 4MG3A 3SU4A 1F0TA 3UWIA 2FX4A 1D3PB 3T29A 1CHGA 3I29A 4DURA 1E37B 1KTTB 2O8WA 2NU1E 3BEFB 1BMFD 3R0FA 1GBCA 1BTHH 1P3EA 3LU9B 4GCHF 4CR5A 2JKHA 4I8LA 2QXHA 1SGFA 2WUCA 1NT1A 1BTUA 2F9VA 2HLCA 1O2TA 3PB1E 3KYFA 1IHSH 4DIHH 4NSYA 1A0HB 3UQOA 7GCHF 3DFJA 3RDZA 5C0UA 4Q7XA 4O9VA 2L6OA 2BMGB 2QAAA 4OS2A 3SGQE 4WH8A 1HCGA 3RXEA 3PM3A 5PTPA 5EQQA 4Z6AH 1O2UA 1BRBE 1GI2A 5HIYA 4X8TH 4VGCB 5CHAB 1FX0B 4DW2U 3QK1A 2J94A 1YGCH 4DCDA 1S0RA 1QY6A 4JZDH 1QHRB 2P59A 5FX5A 1SGRE 4O97A 2BDHA 1EJNA 1HXEH 1ZSJA 2V0BA 1KDQA 3UIRA 1O3CA 2TGAA 1XM1A 2CN0H 5HYOA 3SJKA 1OWJA 3UNSA 4FUIA 1GBIA 1YLCA 1LVOA 3SJ8A 5EJLA 2ZGBH 1MBQA 3SV9A 3O8CA 3IITA 3S69A 1XUFA 2JH0D 1TMUH 3ZVDA 4NWKA 1G37A 1AHTH 2WYGA 3C1KA 2PLXA 1O3KA 2STBE 1KLTA 1YF4A 2OINA 2ZG0H 3UPEA 2ZQ1A 3P8GA 2QGRA 3KL6A 3SV8A 4ZKSU 1OX1A 1HAYB 4X8SH 1ZJDA 4H4FA 5F53A 3RLYH 4K1TA 5SGAE 1YWUA 2F9PA 5LGOA 2BY7X 4BOHA 2JIZD 2ZTYA 1BCUH 1RD3B 2A1DB 4KTSA 3RU4T 5L30H 2VGCB 2BM2A 1GVZA 3K6ZA 1ACBE 7ESTE 3LIWA 1FIZA 2ZFRH 1WYKA 4K69A 4X6PA 3SU6A 1PFXC 1Y8TA 2J98B 1NS3A 4X1SU 1G3DA 4AG2A 4MNYA 1C5ZB 2PUXB 4JYUH 1FV9A 3LGIA 2BLWA 1Y3WA 5AHGH 5EOKA 5F03A 2QIQA 2WSSD 2BQ6B 1IQLA 3A89A 1HDTH 1AIXH 1QB1A 5F6MA 2ZEBA 1FY1A 1SOZA 1QRXA 1TA6A 3KEEA 2JH5D 5C67A 1RIWC 1G3CA 1BHXF 3ZZ8A 1HIAA 4I31A 2EQNA 1TALA 2PWXA 2W7UA 4CRFA 1MCVA 4DT7B 4X2YA 4MNWA 3A7XA 1DITH 2BTCE 1GI7B 3PMJA 1GG6B 1KIGH 1AWHB 2ZTZA 4I86A 4XOJA 3E90B 4RT0A 1O5AB 1DY8A 4AB8A 1B7XB 1NPMA 4X2VA 1V2ST 4D9QA 1K1MA 2ZHQH 5ABWA 1YPKH 3MU4A 3OTPA 3PV5A 3AK5A 1PPZA 2PV9B 2ZDLA 2DUCA 4Q7YA 1QURH 3SI4H 2Y5GA 4KTCA 4I8JA 1C2MA 1HNEE 3M7UA 4ZUHA 4WWYA 4MDSA 1F5LA 2BY6X 2H2ZA 1TE0A 2ZHDA 3P17H 2H9TH 1YPHC 2BX3A 3TJUA 1S83A 1KXBA 4E06H 3KF2A 3SW2B 1NFYA 3MH5A 2V3MA 5C94A 3GICB 1GMDF 5HGGA 4DY7B 1A0JA 4UFDH 4MPVA 1FN6A 1MQ6A 1H8IH 4K8BA 4WMEA 2SGQE 1WTGH 1DANH 1V2RT 1C5OH 1TLDA 4IC6A 1ELEE 1EX3A 3RMMH 2A32A 3U8RH 1BRAA 5DG6A 4B73A 1QB6A 3N7DA 2FYQA 5K0HA 9ESTA 1ARCA 1SG8B 1LVMA 3V13A 1DWEH 3HKIB 4Y79A 3SU5A 1SGTA 3L3TA 2BD9A 4Y8XA 3M36A 5AVDA 2QE7D 3A8BA 4AYYB 5TCAA 1IHTH 5EG4A 2A5IA 3TK6A 2PP6A 2HGTH 7GCHG 2ULLA 4BAKB 2AHME 3SBKA 2RCEA 2OTVA 3AW0A 1K9OE 1GMDG 2FOHA 1MTNB 4XE4A 2UUFB 1MMJN 2BY5X 5HMAA 1GJDB 1W11U 3DT0H 4ZHLU 3STJA 3SNBA 1O36A 2GMTC 1SGPE 2BOHB 1N6YA 1V2JT 3LJJA 3M5OA 1DLKB 3NXPA 3OY5U 4B6EA 4UFEH 1SGEE 1GMHG 1SHHB 3H7OA 1C4Y2 3GCHC 1UTLM 2PGBB 5C1UA 1O5DH 1O2NA 2JJ2D 1QNJA 4K3JA 2VIWA 1QR3E 5GPIB 3RXRA 1D9IA 2FEQH 4B75A 2FS8A 1A5GH 4ZHMU 1C1WH 1HAIH 3PLKA 2L74A 3AASA 4JYVH 1BBRH 1EQ9A 1XUJA 4Y8YA 4IBLH 2NU2E 1CT2E 2BVRH 3UWJH 2HNTF 2CF9H 5TJXA 4A1TA 2GJGA 2HWLB 1A61H 4AYVB 4Q2KA 2R2MB 1XX9A 4WMDA 1AWFH 3SI3H 4I7YH 1BBRK 3BIVH 4U01A 2V7QD 4NCYA 4GPGA 4UE7H 1O32A 1ZMNA 2Y7ZA 3OYPA 2FESH 3A7TA 2FOEA 3M7TA 2J9NA 4CHAC 2GV7A 2RDLA 2ZI2H 4WH6A 1HAOH 2FM2A 1K1NA 1MABB 2SFAA 3LGWA 4CRDA 2QXIA 1QJ1B 3EA7A 5CHBA 4YESB 3O8RA 3MU5A 4FUBA 1L4ZA 1S5SA 3DCLA 3UAIC 1SC8U 5CHAC 6GCHG 1L1JA 1K1PA 4DT4A 4NG9H 1CVWH 3V12A 1V2OT 3SUEA 3VFEA 2VU8E 1EOLA 4BTTB 2PKSC 1INCA 3QN7A 4AOQA 3SNEA 2WPLS 4WF8A 2Z9GA 4NIXA 1HXFH 1YCPM 4IMQA 1GBFA 2XNDD 1MBMA 2K0QA 2F4LA 3NRLA 3CENA 3KHVA 1GWAA 2ZO3H 2JETC 5IK2D 2FOGA 1F5KU 4YT7H 4OS6A 1MTWA 1BTWA 1TNKA 1WU1A 3GCNA 3ZZ5A 1CA8B 5K7RA 2W6ID 4Y7AA 3SZEA 3F1SB 4B2AA 3VXFH 2C3SA 3MH6A 4CR9A 2QXJA 2Y5FA 1EJMA 3T25A 1O38A 3SJIA 3U69H 4ABHA 3CS0A 2QA9E 2UWOA 2A7CA 1BTYA 1BBRE 1T7CA 2VINA 4A1XA 3E3TA 5B6OA 1H8ED 1FY8E 1NFWA 2YMSD 2RFKC 2BDGA 5FCKA 1DDJA 2OC8A 1KXCA 3M5LA 2ZDMA 2ZPQA 1BJUA 1G3EA 4FUCA 4Y7BA 1C9TA 4Q80A 3MNXA 1GHVH 1JIRA 1L1NA 2BHGA 2BQ7B 1P2MA 2V35A 8LPRA 4F48B 1C1OA 1OWDA 2ZCLP 4WXVA 3IG6B 1UVUH 1GDNA 1KY9A 4KELA 4ZKOU 1QQUA 3RXLA 1QBNA 3PWCA 1THRH 1QFKH 2HNTC 3QWCH 1DE7H 4AZ2B 5FAHA 1GJ9B 2ZECA 1IQJA 2J34A 1O2GH 1P01A 1YY3A 4HG6A 2QXGA 3ZZ3A 4QT8C 1O3IA 4ASHA 1Y5BT 2CMYA 2ANKH 1BUIA 1O2SA 2KR7A 2G5NA 1SGDE 1EKBB 1YPLH 2AMQA 1AY6H 1NY22 3M3TA 1O3AA 1S81A 3PYHA 3TNTA 3SU3A 3Q00A 1QRWA 1OWHA 1C1UH 1EZUC 3MFJA 2VVVA 3DA9B 3BG4C 3TK9A 1RRKA 4E7RG 1TBQH 1XUHA 1FN8A 1EZSC 1TX8A 4Y11E 1O34A 3A80A 2ZHFH 1BRUP 1QTFA 4ABGA 2AGIX 3E91A 4X0WU 1Y3XA 2Y82A 2VH6A 3LGVA 2FTLE 3A82A 4INLA 1OWEA 3VGCB 3MMGA 4TYDA 2BD8A 2BOKA 3SHCH 4D8NA 1O3PB 4DIIH 3DSOA 4YZUA 5T1VA 2ANWA 1QJ7B 2KCOA 2PKAA 1ZGIA 3U98H 3ZZ7A 1V2NT 5JBCS 4MVNA 4TT3D 4NZQA 1UTNA 1SFQB 2D8WA 5DP6A 1KMHB 3GCHB 1O3BA 2AMDA 3TGKE 1HGTH 3SGAE 2ZWLH 2A5KA 1ARBA 3PTNA 1TNJA 1N8OC 2XC0A 1E1RD 1EZXC 1YCPK 2VH0A 2KM0A 2G00A 1ZHPA 2XC5A 1OP0A 1C5MD 1UVTH 4JZFH 1BJVA 1SFIA 1F0SA 1LO6A 4YLUA 3U8TH 1GMHF 2BVSH 1ZPBA 2PR3A 1YPEH 5HM9A 4UEHH 4XBDA 5G4BA 3DD2H 2BY8X 2G8TA 2ZDVH 1VJAU 1YM0A 5HM2A 2FMJA 1O35A 3RU4D 2W3IA 3KQ5A 3SQEE 2Z9JA 1LDTT 2W6JD 4YLQH 3EA8A 1JRSA 3GOVB 3EA9A 3ZVCA 4NZLA 3F2FA 1T8MA 4FU8A 1P05A 3BTTE 3ODDA 1GJBB 3RU4E 3A8DA 2BDYA 4ZAEA 1Y3UA 2WPIS 2EI7A 1AZZA 1RIWB 1LMWB 3NK8A 1ETRH 4FUHA 2QF5A 2J5UA 3LH3A 3S7KB 1LPKB 4Y6DA 4E05H 1V2QT 4CBOA 4ISLA 1AO5A 3U8OH 3VPKA 1GI9B 2OQUA 1EAWA 3SQHE 1Y59T 5DP7A 4LK4A 1UCYE 2PSYA
chains in the Genus database with same CATH topology
2QF3A 1IQIA 2A0QB 3RM2H 4AG1A 2ZF0H 1FXYA 2VWOA 4A6LA 3E1XB 3SU0A 1WTHD 5E2OA 1ZPCA 4K8YA 4WXIA 1GHAF 4Y0ZE 1CSOE 1T4UH 2BVXH 4A5TS 3V7TA 3T27A 1BOQA 1O2MA 2ZCHP 1TPSA 1CGIE 4FVDA 5F8XA 1HJ9A 4Y71A 4NIYA 1PPBH 1F2SE 5DK1A 2XBVA 1WUNH 1AUTC 1TA2A 3M3SA 2GZ7A 4CRAA 1PQ5A 1ZLRA 3HK3B 5C2ZA 5HXFA 1KDQB 3LOXA 1SBWA 4BTUB 1LHEH 1P03A 1V2UT 3TJNA 3F6UH 1LHCH 1AZ8A 3GY3A 4INKA 1TOCB 3I77A 5A2MH 3DFLA 2BLQA 4O3TA 1J17T 1Y5AT 1NU7B 4YOIA 3FP7E 1PQ8A 2A2QH 1QRZA 3Q3KA 2ZCKP 2UUKB 2XBXA 4R0IA 1ZHRA 2WYJA 2FXRA 1YPMH 2ZU4A 1ELAA 1FQ3A 1HAVA 1L0ZA 5FPYA 1YPGH 2J38A 5DGJA 1E35B 1SR5C 1KLIH 4ISIH 1MAYA 4IS5A 4ZKNU 1FDPA 5BRRE 2BY9X 3S9CA 4FUEA 1TPAE 2FI4E 1WCZA 2GMTB 1ELDE 1ZGVA 4BNRA 4CRGA 3ATKA 1HPGA 1TOMH 1G9IE 2G5VA 1GJCB 1F7ZA 2HVXA 3GDUA 4VGCC 5E0JA 1PPHE 1CE5A 1GGDC 2VJ1A 3ESTA 2ZZUH 1PPEE 2TIOA 4NWLA 4RKJB 1C5TA 3TLOA 1JMOH 1UK2A 1GHYH 4X2XA 1O31A 3MO9A 4ZKRU 1HJAB 3PO1B 3KQEA 5EU8A 1C2DA 3H5CB 2V3OH 1J9CH 2ZDNA 5DKMA 1FJSA 3SV7A 1C2IA 1GBAA 1XUKA 1ETTH 3ZZ6A 1BA8B 1AVWA 4X6NA 1C1TA 1QCPA 2Q1JA 3Q3XA 4ABDA 1CGJE 2AMPA 1LQDB 1O3EA 1OP8A 1TGBA 3M35A 1FUJA 4Q7ZA 1V3XA 2R0LA 1C1RA 3ZZ9A 1SGQE 5AFZH 3RMOH 3OY6U 5DP5A 1P09A 1ZRKA 1MKXK 4I33A 2FOAA 2ZPRA 1TNGA 4F49A 3Q76A 3KCGH 3NZIA 3GCOA 1SB1H 5JBBS 3RXOA 1O0DH 3FFGA 4JZ1A 3TGIE 3A7YA 1EUFA 1IQNA 4JK5A 2PTCE 3PWBA 5ETXA 2IJOB 3OTJE 1ANDA 4ZMAH 2C8XB 1BTZA 1OYQA 1LVYA 2D2DA 3OSYA 4TPYA 2UUJB 2BX4A 1VCQA 3BTGE 4NFFA 1K1OA 1CHOG 2EI8A 3S0NA 2Y5HA 1HAZB 3BTWE 1EATA 4B71A 2KAIA 2VB0A 1NFXA 1KXAA 2HPPH 1CA0B 2Q6FA 4B2CA 1DLEA 1KYNA 1OP2A 1GVKB 5FBEA 1LQEA 2OC7A 3TH4H 1Q2WA 2AH4X 1SOTA 1YCPH 2ODQA 2VIVA 3RC5A 2NU0E 3BTHE 2STAE 2XW9A 1TBZH 1V2LT 1NM6A 3ATWA 3NUMA 3GY2A 1DUAA 3FP6E 2GV6A 4DJZB 4CREA 1LHDH 3PO1C 4OGYA 2ZFQH 1P2IA 1GBHA 1S6HA 1C2EA 1IQEA 1HAHH 1K1IA 3A7VA 5EXNA 8GCHF 3ATMA 4ESTE 5EQSA 1UVPA 2GCTC 1Y5UT 1O2JA 1BQYA 1O3FA 2IOTA 1VJ9U 1ZZZA 5AFYH 5C3NA 2ZGJA 1DPOA 4UONA 4NIVA 1A46H 1WQSA 1GMCF 1UVSH 2R0KA 1MKWK 2GD4B 2RA3A 1AKSB 7KMEH 1P3CA 2VWNA 1C1NA 4IW4E 1NFUA 3BF6H 3EQ0H 1UCYK 1DFPA 3T26A 1OPHB 2WV5A 4IN2A 3TH3H 1EZQA 3VEQB 3VB7A 4NA8A 1SSXA 1L4DA 3M3VA 2F9BH 4GLYA 1GVLA 3TJOA 2BZ6H 4JYTA 4NIWA 2G4TA 1UTJA 4NFEA 1IOEA 5E0GA 3P8FA 4YT6H 2D26C 4Y8ZA 4O3UA 1F0RA 2PUQH 1C5NH 5C20A 3RXQA 1CQQA 1W7XH 2F83A 2H1UA 3VXEH 1KLJH 3EDXB 5JDUB 5EW2H 3FZDA 3O8DA 4ZROA 2LNCA 3A81A 5DP8A 1FONA 1QL9A 1A5IA 1K28D 1TNHA 1CA0C 4IC5A 3T2NA 6GCHF 2TGPZ 2H5CA 3R3GB 5LPRA 2ZHEH 5FBIA 5DP3A 1C5XB 3STIA 1HYLA 3RMLH 4UD9H 3P8OA 1XXDA 2ALVA 2V3HH 1B0FA 2R3UA 2HALA 3BTEE 2BLOA 4OS5A 1O5BB 5LPFA 5E2PA 2B9LA 4FVBA 3C27B 1QIXB 1MKWH 3LPRA 1LPGB 1T8LA 1MAXA 2ODPA 1RGQA 3BTDE 4BAQB 2PKAB 1GJ4H 2FWWA 1TABE 2ZP0H 1AGJA 4LZ1H 2CV3A 1THSH 2W26A 3A8AA 4X1RU 1TMBH 1W14U 2P95A 1V2KT 1MZAA 1Z71A 1O5GH 1FPCH 2GT8A 2OBQA 4X8UH 3BN9A 2ALPA 1MTVA 1ZOMA 3SUFA 2OC0A 1P11E 1ZRBA 2VIQA 5LPEA 1TRYA 5GCHG 1C2GA 1C5WB 1Z8JB 4K1SA 2AGEX 4JCNA 4UFFH 4SGAE 3URCA 3ZZBA 1V6DA 1H9IE 3UUZA 3TPIZ 3VB5A 3S9BA 2DE9A 4WVPE 1NO9H 1P57B 2A2XH 4XFQA 1P0SH 3RUOA 1LKBA 1O3MA 4M7GA 3BTQE 6ESTA 3AVZA 2SNVA 2ZU5A 1JOUB 1GL1A 2K1QA 3TITA 5C1XA 1T32A 1U6QA 1P06A 2H5DA 1MZDA 1T8NA 3IWMA 3MU0A 2ZGXH 4TWYA 1T31A 1AKSA 1O2HA 4ISHH 1LKAA 3Q3YA 1YP9A 3RXBA 1O3HA 1GDUA 1G36A 5GJ4B 2VIPA 4FUJA 4AN7A 3LGTA 1HFDA 2EI6A 3ZVFA 1P02A 3CS7A 4JZEH 2WUBA 1W2KH 3GY7A 1FMGA 1HAPH 1RJXB 2WPKS 1HAXB 3QZQA 1GBJA 3SNAA 1Z1IA 3OX7U 3RXFA 2GKVE 1BZXE 1AFEH 1HIAB 2R3YA 5EXLA 3A86A 4YM9A 1ID5H 4U2WA 2B5TB 1O3JA 1HAGE 2FIRH 2GTBA 3SOSA 1MTUA 1GJ6A 2J4IA 1AB9B 1SGYE 1GI1A 4ABEA 2Z9LA 3F9EA 1PQAA 3FVFB 1GHBG 5JBAS 3F68H 3KGPA 2IN2A 1WSSH 4CH2B 2W3KA 2VVUA 1GCTC 2FLRH 4MPXA 1J8AA 1C2JA 4BXSA 5JBTA 2P3FH 1AD8H 3RLWH 3RXHA 3VB4A 1OOKB 1RTLA 1QBVH 3RXCA 1HBTH 1GHBF 2BLVA 2A4OA 3WY8A 1YKTA 1PYTD 1AI8H 2OD3B 1PPCE 2XWAA 1CT0E 1RFNA 3ATLA 4ABAA 3LC3A 2GX4A 4X1NU 1TRNA 3EYDA 3E0PB 4MLFB 2ZFFH 3U1IB 1OWKA 1DX5M 1XVOA 2NU3E 5EGMA 4D7FA 3UR9A 1Z8RA 3HGNA 3ELAH 5J4SA 2IPHA 1VITG 3SGBE 2LPRA 3SUGA 1DWCH 1GBEA 1TAWA 1PYTC 3UTUH 3SN8A 2P8OB 3KNXA 1VGCC 4OGXA 5IDKA 1PPGE 5IYTA 3QTVH 4YOJA 3RP2A 5C5NA 1S6FA 1NRPH 3AAUA 4GCHG 1CHOF 2BB4A 1TGCA 1ORFA 3ZZAA 5JYIA 1UO6A 3W95A 1WAYB 3SUDA 2AYWA 1F0UA 5EPYA 4AX9H 1N6XA 4K2YA 4DG4A 3S9AA 2F9UA 5GXPA 3PLPA 2EA3A 4Y0YE 1A4WH 3HKJB 2A7HA 2GCTB 1DM4B 1GJ7B 2XC4A 3BTKE 3SU1A 2PGQB 2Y6TA 1AMHA 2ZFTA 1O3OA 4BAHB 2HPQH 1BTXA 3UOUA 4KKDA 1G30B 1J14A 4GHTA 2Z3DA 1C1QA 3N7OA 3S7HB 1Q31A 3SJ9A 1GCDA 2BYAX 2A4GA 1XKBC 1L2EA 1W0ZU 1YLDA 1C2HA 2GCHF 1Z8GA 2ZU2A 1GBKA 2ZKSA 2ZC9H 1UTOA 1UHBB 1P10A 2QC2A 4WMFA 4GHQA 1TNIA 3HGPA 4XSKU 4THNH 2GZ8A 1ZR0A 5EXMA 3T28A 1H4WA 2V6NA 1V2TT 1QB9A 2ZPSA 2C93B 1XKAC 1D3DB 2ZU1A 1E0FD 3M5NA 1DY9A 2BXTH 3UNQA 1UK3A 2ZDKA 1D3QB 3E8LA 9LPRA 4J2YB 3A7ZA 2ILNA 2D1JA 1GJ8B 4AFUA 1A7SA 4AGJA 4MQAA 1AQ7A 1EAIA 2XCNA 1X7AC 3UR6A 3ZVAA 1CU1A 1YYY1 1DT2A 1O2OA 3QLPH 1G32B 4MNXA 1TRMA 1WBGB 4SGBE 4LZ4B 3P92A 3NWUA 1F92A 4AFZA 5I46H 1S82A 3SU2A 3MH4A 5FCRA 3QX5H 1C1VH 1K22H 1O2RA 1C5LH 2FI5E 1MD8A 1SQAA 5L2YH 1HAVB 5CE1A 4GVUA 4K60A 1KXDA 1CGHA 2UWPA 3W94A 1G2LA 4AFQA 1JXPA 1A3BH 1THPB 1IAUA 3EAJA 5A0CA 3F9HA 3GDSA 2JH6D 1ZHMA 4H6SB 2Y7XA 2O9QA 3G01A 3MO6A 1ANBA 5CMXH 3SO3A 3LJOA 3QTOH 3H7TA 1XUGA 1XUIA 2OC1A 3RXJA 2FPZA 3JZ2B 4FUFA 4CHAB 1SMFE 2TGDA 1FNIA 3MNBA 3GDVA 2WPJS 3MNSA 1ABJH 2BDAA 1ELFA 1QL7A 4BANB 3KQCA 1V2PT 3BTFE 1ELBA 1SL3A 2CJIA 1VR1H 3UREA 1O3DA 1P2QA 1FZZA 2ASUB 2ZFPH 1TNLA 4R8TB 8KME2 1GGDB 1TBRH 4CRBA 2QCYA 1BITA 1GI3A 3MOCA 4NA7A 3D62A 5GIBA 1NRRH 3LH1A 1C9PA 1SHYA 2CHAC 1D4PB 1KSNA 4CRCA 2W7SA 2YNAA 2PKSB 1NRSH 1TYNA 1O3NA 3PROA 2ANMH 2P3TB 4GSOA 3RMNH 2GDEH 5JPMH 1G3BA 1SLXB 3FP8E 3SV6A 1A5HA 1LVBA 3SJOA 3LC5A 1GJ5H 1GI6A 5T6DA 3K6YA 4FUDA 2AS9A 2FO9A 2A5AA 5L2ZH 5JB8S 1P2NA 1JBUH 1IQKA 3A84A 1VITF 3KN2A 1E36B 1GI8B 1MD7A 1AUJA 1XVMA 4INHA 2P3UB 1G2MA 3LONA 4BXWA 1O3LA 1Y3VA 1C5UA 1DICA 3QDZB 2O8MA 4D76A 3KQBA 3CP7A 1C5RA 1DOJA 2TGTA 3GY6A 1C5SA 3NPSA 4FU9A 1ESTA 1ZMJA 1WOFA 5FX6A 4ZXYH 3LDXH 2GGVB 1LTOA 3E0NB 3GCTG 4GUXA 5BPEA 2FOFA 4YTAA 5LH8A 3ATIA 2ZQ2A 3D23A 2WPHS 3DHKH 1OSSA 1SGFG 1DWDH 1VCPA 1SGCA 4HI3A 1JRTA 1SGIB 4HGCA 4ABJA 1UMAH 2A4QA 1LCYA 1ANEA 1JWTA 1T8OA 1DWBH 1WV7H 3E16B 3K9XB 4A1VA 3TNSA 2ZA5A 5DP4A 2A4RA 1HJ8A 2M5TA 2J92A 3A7WA 4MNVA 5ESTE 4D9RA 3BEUA 2OCVB 2FS9A 3KQDA 3RXMA 1K2I1 3D49H 4UFGH 4WJG2 4X6MA 2UUYA 1GJAB 5T6FA 1NRQH 1EB1H 2GDDA 3PTBA 1ELTA 3RXSA 1FAKH 6CHAC 5GDSH 1GI5A 1W12U 2ZGCA 1GBLA 1DXPA 2AIQA 2ZGHA 3RXIA 2VWLA 1ELVA 2XNIA 3GY8A 1MH0A 3MH7A 1TGSZ 2HRVA 3RXKA 1CBWC 1V2WT 1BMNH 3GY5A 3GYLB 3V3MA 1QGFA 3KIDU 2SGEE 1SI5H 2GVFA 4TPIZ 2BXUH 4FUGA 4IGDA 2XBYA 1O2YA 2A31A 2YNBA 1AB9C 2AEIH 3A83A 2SGDE 1QQ4A 1KTSB 2QF0A 1QA0A 1VZQH 1S85A 4LXBH 1EOJA 1Z6EA 1QL8A 1Y3YA 1B0EA 1O2ZA 1ZSLA 2ZNKH 4Z0KA 1YPJH 1BIOA 1DUEA 5DO4H 2VWMA 1EP5A 2XTTB 3ZYEA 1BMMH 3SNCA 2GT7A 1QJ6B 1HRTH 1IQHA 1MTNC 2Z94A 1C2FA 2CXVA 1PJPA 3U1JB 5ESBA 1EPTA 2YOLA 4X8VH 3VGCC 1ZMLA 1H9LB 3RXUA 2PHBA 3TIUA 5A8ZA 1C1SA 2G81E 1DSUA 2SGFE 1GHAG 1O2LA 3BIUH 1SPJA 2Z9IA 1HLTH 3SHAH 4RKOB 4UDWH 3ITIA 1RTKA 3L33A 2FYRA 2OLGA 2Y80A 1N1LA 1P12E 5A0BA 1YC0A 2FOCA 2XWBI 1DSTA 1O33A 4HZHA 4B2BA 1XMNB 2Z9KA 1PPFE 1EAXA 2BD3A 2FI3E 2KAIB 1O5EH 1K1JA 1O2IA 5DP9A 3QUMP 1N8OB 1AU8A 1NN6A 3VB3A 4B74A 1C1MA 1GHXH 1SQTA 1V2VT 2PTNA 1ABIH 1P2OA 1CBWB 2BD7A 2SGAA 5EW1H 2P94A 3BG8A 5GWZA 1ZTJA 5FXLA 3UFAA 1TONA 1EPTB 1TMTH 1C4V2 1MQ5A 1O5CB 3L6PA 3NCLA 2ESTE 4IN1A 2SNWA 1O39A 2G55A 3LKWA 2DE8A 3T62A 1ELGA 1ETSH 1SLVB 3P6ZB 1MU8B 1SLUB 3HPTB 1FY3A 1D3TB 2FZZA 1P04A 2QYIA 4U30A 2ODYB 3RC4A 3A88A 3QO6A 3MO3A 1RXPA 1AVGH 3FZZA 1NROH 3FANA 1NZQH 3TU7H 2BDBA 1GI4A 1UJ1A 2BDCA 4JK6A 4H42U 1Z8IB 5FPTA 3UOPA 4ISOA 1H1BA 4X1QU 1H9HE 1FIWA 1GG6C 1C2KA 2J2UA 1VCWA 1ZYOA 2BZAA 1OYTH 4JMYA 1W0YH 4E7NA 1B5GH 1SLWB 3SV2H 4O03A 1K1LA 1GI0A 1MKXH 4A92A 1K21H 4ZHAA 2EEKA 4I8GA 1A2CH 1YBWA